4FXPA

Crystal structure of adenosine 5'-phosphosulfate kinase from arabidopsis thaliana in complex with sulfate and aps
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
192
structure length
192
Chain Sequence
ECSVEKVDRQRLLDQKGCVIWVTGLSGSGKSTLACALNQMLYQKGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLLPEGDFVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide binding site communication in Arabidopsis thaliana adenosine 5'-phosphosulfate kinase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Adenylyl-sulfate kinase 1, chloroplastic
total genus 77
structure length 192
sequence length 192
chains with identical sequence B, C
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fxpA00
3TAUA 2ERXA 4TWZA 4B32A 3KQNA 5JI2E 1R0WA 5G41A 4NHOA 1BYUA 2QAGA 2VP4A 4HLQB 1D9XA 1ZINA 4TT3D 5FR1A 1E0KA 2FPKA 3L0PA 4MKGA 3SJZA 1E0AA 1XU4A 5TY0A 2KBEA 4H1VA 3ZS8A 4AKIA 2ODWA 4OHYA 4LJAA 5FI0B 2JLYA 4Q4JA 1T8UA 5HZKA 3IBYA 3PQCA 4FINA 1U8AA 5JSZB 1KI4A 2WSSA 2RH5A 2EU8A 1JB1A 4GMXA 4B33A 4X8OA 1KK0A 1UKYA 4QRHA 2OV2A 3AB3A 4JVLA 3QQ5A 4DJTA 1PUJA 4LV5B 4KV9A 4HLCA 3X1XA 4FN5A 3FHTA 3TSOA 3IKJA 4BLRA 1N6HA 1ETUA 3W3AA 5C2JB 3L2OB 2WKPA 2ZU6A 5FR2A 2QI9C 4HUQA 3X1ZA 2IS2A 3W3ZB 4URZR 1OB5A 1EX7A 1XMSA 1IN8A 1KI7A 3SYLA 4A9AA 5FTJA 4HAXA 3QBVA 5E7JA 4AG5A 1HT1E 4F4CA 2GXSA 1XD8A 1KI2A 1GAJA 4HB2A 2UKDA 2ZR7A 4TSFA 2LWIA 4RFSA 3UPUA 4Q48A 1OFHA 4URVR 2GAOA 3GJ8A 4CT4B 4HDQB 1O87A 3SYKA 1G3IA 4KSBA 1QHHB 3B8HA 5IT5A 4I1SA 4EQ6A 4HAYA 3F8TA 1GFIA 1H8EA 4JVMA 4XWKA 3B13B 3ND9A 3FHCB 2PJRA 2RGEA 3KKMA 3JVVA 4TYYA 2VA8A 1OT3A 1OPXA 1COWA 3U60B 1KY2A 4GI7A 4CEJA 4TMZA 2AKYA 1F48A 3K9NA 4AK9A 1WQ1R 3RRNA 1UM8A 4Y0AA 2GJSA 3KB2A 4BZQA 5BN4A 3KXKA 1XZQA 2ZI9A 1NNEA 2GVDC 1CR0A 2IXEA 5IHPA 1GOTA 3PFIA 4PQRA 4QJ5A 1W5SA 1UBEA 2CXXA 3ADCA 5DN6D 4F38A 2CEAA 1JI0A 1XD2B 3ADBA 2FH5B 2KSQA 5AUNB 3DHWC 1E2FA 4GOJA 4PO1A 4XWAA 4RCZA 4R98A 2Q9CA 1IY2A 1O3YA 5K8UA 1N5IA 2YWGA 3FE2A 3L8YA 1JEDA 4PC3A 3KDSE 2O8BA 1FNMA 4DSOA 2ZSFA 4OJKA 5HTKA 2GK6A 4KSCA 1CJUC 4ITRC 3RHFA 4MGKR 1E2MA 2ZRGA 4NYIR 2O8CA 5DLQC 4AG6A 1JJ7A 1R5NA 5DNYB 1FNNA 5DSZA 1P7CA 1OFUX 2WWFA 4V0ME 1Z0JA 4JSTA 1W7AA 1FTNA 2QT0A 2AHOA 2P65A 3ZVNA 3NBFA 1E1QA 4A2QA 2ZUCA 5E95A 4B34A 3NDPA 4FCTA 1RJ9B 3TSWA 3TW8B 1DE0A 3GLGA 4G5OA 4B44A 3PVSA 1MR3F 5TV2A 4PSKA 4WXPA 5B30A 2FV8A 3AF1A 5LDDC 4RZ3A 3Q5DA 4QHSA 2GXUA 1N25A 1R8QA 3FFBA 4OQMA 1KI6B 3GJ6A 1CXZA 1HUQA 2QROA 4DCVA 2CNWA 2WAXA 4QJ3A 5K8IA 4F91B 3U3JA 1JJVA 3KKNA 721PA 2WOJA 3UG6A 1CEEA 4CEJB 2ZJ2A 1S2MA 2PH1A 3BC1A 1G17A 1G8FA 1JQLB 1A4RA 1QHHA 3QY0A 4KO8A 4RZXA 4URXR 1KO8A 3B6EA 1JR3E 4CIDA 3BH7A 4DDVA 3AGQA 4Q1AA 1KMHA 3QEJA 5E3HA 1UKVY 2IWHA 5CJPA 2YWHA 3W34A 5FPKA 1XTJA 3HU2A 5KDLA 2WJYA 4DDUA 3BFVA 3U5ZB 3LBIA 3DVLA 2YWEA 5D3MB 1P4SA 1MO4A 3U3KA 1CTQA 3MD0A 4HZUB 2R8RA 2FDCA 2XNDD 4BPBA 3QF7A 3RNLA 4B6FA 3X1WA 4O2RA 2Z6VA 3RS2A 3CIOA 1Q12A 4NH0A 3RABA 3EZ6A 1N6RA 1J8MF 3A1TA 3EZ2A 2CK3A 2ZRDA 1NKTA 2DFTA 1YHNA 2WZQA 4GZLA 1SKYE 3T1VA 1X8JA 2A78A 2QPAA 3Q8XB 2FGJA 2HCBA 4ARZB 4GOXA 1HE8B 1FZQA 2G83A 1S9HA 3CPJB 1II8A 4DLVA 3N2EA 1A2KC 4OHXA 2IHBA 2QSYA 4HLUA 3U7GA 1VIYA 3RWOA 3EZ7A 1HT2E 2Q3HA 1M74A 2J9RA 3QG5A 4MKFA 2IXFA 4BRWA 2RHMA 1F60A 4EIWA 5JS8A 5CIQA 1HY3A 4KCGA 4BFSA 5JSZA 4LCBA 3LY5A 5LBIA 4DBLC 3RAPR 4JL8A 3BB1A 1YZNA 2H17A 1OSNA 4K8OA 4XSGA 5JRZA 2FSHA 2VP0A 4HZUA 1KDTA 2D06A 3V4FA 2ZRHA 2REOA 4PC7A 5DI9A 2CVFA 5BXQC 4M1OA 4US1R 2FPLA 3EWSA 1C9KA 2A5GA 1VG8A 4B2IA 3RS0A 1Y63A 3VR4A 4Q9LA 1MO6A 4PAQA 4XVQA 3S1AA 3L0SA 4PPGA 4P4UA 2P6UA 3MWLA 3GLIB 1TL7C 3NEYA 1QVAA 2P3SA 1Z3IX 4XOIA 4UQOA 1AA9A 3R9XA 2ATXA 4EFMA 4WVFA 1IJEA 4Q47A 4BLQA 2GXAA 4PHGA 1B0UA 4PR0A 4Q19A 1ESMA 3UMRA 4D4KA 2RGNA 4QBHA 3W6OA 1M7HA 3W90A 3IDQA 3NBYC 1XCPA 3BGWA 1G16A 1RZ3A 3FB4A 4AURA 3ADKA 3WMGA 1SXJC 2Y8EA 5KSZA 4XSHA 2ASEA 1Z0IA 3MCAA 2BMFA 3CF0A 2PX0A 3H0KA 3NC1C 3KQLA 3VQTA 5AJVB 2PX3A 4CYMA 3FMIA 2WWHA 3B1VA 1TUEA 1G3MA 3NVAA 4PPFA 3W6PA 3ONWA 4ZIRB 2O8CB 4BUJA 1ZYUA 4L15A 2IL1A 3T5DA 4DHEA 4JJZA 4QKQA 1K8RA 1U0HC 1KNQA 1X8KA 2QMOA 3MAAC 2LKDA 2VEDA 4LHYA 1JALA 2NZ8A 1DAEA 2WPDA 2X8AA 1G4AE 1ANKA 1Q1QA 1W0JD 2GK7A 3FTQA 4LJ6A 4PO8A 3X1YA 3D31A 3AF2A 4OL0A 2O8BB 1E98A 2AWOA 4C7OB 4W7SA 1TNDA 4QXAA 3MFYA 2RGBA 4FWTA 3U2QA 3U3OA 5L8VA 4ZDWA 4D26A 1TX4B 1HYQA 1NVVR 1VCIA 3K53A 1N0VC 2PMKA 4NTZA 5GJVC 3WP1B 3VKGA 3A36A 1TQDA 4NP6A 3CR7A 4YXWD 4DIEA 1VG1A 3LW7A 3ZVLA 4MRRA 4BFXA 3ND8A 3B9QA 2J1LA 1CRPA 1X1SA 2ZRKA 2VL7A 121PA 5FI1B 2QL6A 4QNMA 2WHXA 2VYFA 3D3QA 2WWYA 2MMGA 2Q3FA 3OF5A 5D3QA 1N2CE 3W8NA 3BFKA 4N0EA 2GESA 4B3GA 5AUOB 5CB8A 2IYQA 1UBGA 2VSFA 4G5QA 1RPZA 3TE6A 3PUZA 1OIVA 1TF2A 1EX6A 1MOZA 1TADA 2CK3D 1AZTA 1XMJA 4MUBA 4DRZA 2BJVA 4GDFA 3VR5A 3BWDD 2JJ2A 1JNYA 2ZE7A 4L9WA 3DMNA 1R4AA 3GJ4A 1Z2AA 4EQ6B 4RFSB 3TIFA 1SVLA 3X1DA 3Q9LA 1UPTA 3O8BA 1XTSA 2W2TA 3KL4A 4NU0A 4KAXA 3F3YA 2ZJYA 4CZ2A 1QBKC 5C4GB 4BZXA 2DYKA 2F9MA 2V6IA 1SKYB 2C96A 2W2VA 4MGZR 2IYXA 3B1WA 4PC1A 4LYFA 5IF9A 1OH5A 3PJRA 4BE7B 2NO9A 1EXMA 3QNUA 4C2TA 3WP0A 1S9DA 2IUUA 1JAIA 3BERA 5DYGA 1S1CA 3B60A 1KSHA 4P31A 4B43A 2OUKA 3U44B 3DPUA 5EP1A 1E4VA 3WRYC 4EPRA 5LB4A 2N1BA 3CH4B 2AWNA 1P2TA 1QDEA 4G5SA 4LSGA 2XAUA 3DMDA 4OHZA 3WMFA 3ADDA 2O0KA 1XBTA 3B82A 4XD7D 2BVNA 1A82A 1BH2A 1KYIA 1Z83A 1NN1A 1Q22A 1UFQA 4JLVA 2O8FB 2X1VA 1ZNYA 5EJEA 4V02A 2AK3A 1GNPA 3RRMA 4ESHA 4LHXA 5IK2D 3QF4B 4X8HA 1SVKA 1C4OA 5BWMA 2D74A 2GCOA 4LPKA 1KSGA 2W6JD 2IEYA 4HB3A 1Z2CA 4KFTA 2ZRIA 3QXJA 5DH9A 4W5HA 1ZIOA 3K0FA 3P4YA 4AD8A 1KZGB 1S96A 1U0LA 4CGZA 4BLTA 1G7RA 1KDOA 2ZEJA 1AS3A 4JIMA 3IEUA 3CRMA 2A5YB 3KUCA 4TLEA 2QPTA 2XEXA 3FVQA 3VR2A 4M4SA 4C9BA 4IVPA 4V0KA 3T12A 1NVXQ 1L2TA 1PUIA 5CLLA 5EE5B 2GA8A 2HF8A 3LWNA 1HEIA 2ZRAA 1PJRA 3K09A 3A6PC 2ZRLA 3VR6A 2ORVA 1UKZA 4E03A 1R8SA 3IGFA 2E9SA 5JECA 2WWWA 3QI2A 1Z47A 4WBSA 3B1ZA 3I32A 5AJZA 2R65A 1XNJA 2EFDB 4PPNA 1EFRD 4W5JA 4EUNA 2JLSA 4I1VA 3TQCA 4WIAA 1UAAA 3EXAA 4PANA 3I5YA 1U81A 2ZRBA 3DKPA 4D81A 1Z08A 2RHDA 3N2IA 1ZU4A 5BW8A 1KSJA 5H1YA 2ZRMA 3VU9A 4H9GA 2ECKA 3ETLA 2QQ0A 2QTFA 1U8ZA 1N5KA 1XEXB 2ZROA 2DB3A 2YOGA 1HQCA 3Q7QA 1NLYA 3EIQA 2FPMA 2WMOB 3PUVA 4GT1A 4TTRA 4PZYA 5J40A 3FDIA 4ACBA 1FUUA 1N6LA 2P6RA 5DGXA 2H1LA 2G9NA 1KO5A 1N6PA 2AR7A 3ZIAD 2PZEA 4Q66C 3TJZA 1ZM3A 4FMDB 5JZVA 5H68A 4JKIA 2Q6TA 3CF2A 2ODBA 1DAMA 4KYUA 4B74A 3ECCA 1SXJD 1L8QA 1NJGA 5C18A 2GJ9A 4IW3B 4M9ZA 1Z0KA 4CRWB 4O0MA 4MYCA 3WMEA 1Z6XA 4ZKEA 3FHOA 3RRYA 2GCPA 1P6XA 5P21A 1AKYA 2V4ZA 4M8NE 4DB2A 5B64A 5EUQB 4KVAA 1WCV1 1RYHA 4MRSA 1OHHA 1XPOA 3SS8A 2NQ2C 4EAQA 4US2R 1NSTA 1GKUB 3QKRA 4AYWA 1FTSA 1EG7A 3B7GA 4R2HA 3KFVA 2VSOA 1D8TA 1SHZA 1Z8FA 4JMPA 4OI1A 4C0AC 2JJ1A 3N70A 2W0SA 3FYHA 3VFDA 4V03A 1KI9A 5J4HA 3I73A 1N0UA 3PV0A 1E2KA 1G19A 1OKKD 2YHSA 5HCNA 3VNUA 4C7OA 3EW9A 4QG7A 1F2UB 1P3JA 2CE7A 3DO6A 1GKIA 3CKLA 3GLGE 1QHXA 4DIDA 2QP9X 1X6VA 4NYJQ 1U9IC 5EE0A 1PV4A 2CHGA 1ESNA 4P4SB 3QKTA 4QM6A 4M0LA 4BFUA 3KJEA 2FZLA 1GRNA 4G5RA 4V0MA 1CIPA 3AVUA 3I61A 4JT4A 1OB2A 5BYJA 2JLXA 1W4CA 1FMLA 2E87A 3D8BA 5FPTA 4YXWA 1UBFA 4DEXA 4YQFA 3CZQA 4KXFB 4NYMR 5LD2B 3HPQA 5TDHA 2W6IA 2FNAA 2PBRA 1IONA 4C0KA 1KI8A 2I1QA 5B57C 3ZZ0A 3Q7PA 1XZPA 2IS6A 3NWJA 2V3CC 2ZJBA 1SXJB 3CX8A 4V0NA 3UANA 2NO1A 2CCJA 2IYSA 2X77A 5DHFA 5FBRB 1N5JA 4Q1EA 1V5WA 2EW1A 4D2IA 2ZR0A 5KNDA 1U90A 3SDZA 4EFNA 3WNBA 1ZCBA 4NCJA 1OE0A 5JI3E 2GF9A 1NMYA 1T4GA 4BEBA 3ZD7A 2RB4A 3KX2A 2GVZC 3U6KA 1P9NA 2P6NA 2ZS8A 3GCGA 3MMPA 4GP7A 2IS1A 2EFCB 2DFKB 2DWOA 3WBKA 5EXSA 1Q21A 2OLJA 3ZH9B 4BASA 1NI3A 4G1UC 1GL7A 5FTLA 1E2QA 4C0SA 5CYPA 1P61B 2DFLA 4Q4LA 5L3SA 2V9PA 4R7ZA 2A7QA 3SJCA 1KK1A 2C9OA 4CW7A 1DAHA 2OBLA 2IW3A 2QN6A 2QAJA 4TTPA 3QPVA 3PXGA 1Z28A 2BIFA 1E4YA 1LY1A 2VRWA 1W1WA 4JSYA 1P60A 2YZ2A 1NY5A 4IHQA 2F55A 2V55B 3WXMA 1DG3A 4E5UA 4Q18A 2V7QA 1NG1A 2VF8A 3BFXA 3KXIA 3AF0A 5DHAA 4Z54A 1G21E 2JATA 2GCOB 3HR7A 3R20A 4PSVA 3U7HB 1T0JB 2J0UA 2NIPA 3EA5A 5L3SB 2KE5A 5GVSA 1JR3D 1YR6A 3K0CA 3ZQJA 2FG5A 5CYOA 4DLRA 1P9WA 3W8RA 3ZS9A 3GLFB 4XH9B 4L8GA 4DSTA 1OXTA 2VO1A 1MRSA 1ZM7A 2OCBA 2BC9A 1RRCA 3HYTA 1XEFA 3FMFA 4PC6A 1N6IA 3UXMA 4DCUA 4IVRA 4AC9A 3SQXA 4EJSB 2B6HA 1E2JA 4A82A 5L3QA 1FP6A 1WF3A 2I1VB 3ASYA 4TLBA 3VHXA 1E0JA 3BBPA 3DKVA 1SULA 2OO7A 3CF6R 3PEWA 1T5LA 2OBNA 2AX4A 3BORA 2XX3A 2ZRJA 4NYJR 1OFTA 2PT5A 2ZSEA 2PEZA 4B71A 4B47A 2KBFA 5FOWA 1YZTA 1KDRA 1PLLA 4MITA 4DB4A 3OE7D 3B1YA 5D3MA 1AGPA 3GQBA 1K5GA 2IYYA 4EPVA 1A2BA 4QFMA 3LXRA 5JJKA 2CL7X 4HAWA 1XPRA 2QRNA 3RC3A 3WYFA 4OI4A 4MQBA 1AN0A 2OEPA 4IDNA 2ZVPX 4H1UA 1SVWA 4HUTA 4FMCF 4C0QC 3QKSA 2IUSA 4BFYA 4KFUA 2XZLA 3U7FB 3G5UA 3AM1A 4A92A 1T6NA 1KI6A 4JKYA 5KSOA 3Q72A 3EC1A 1NMXA 4JLDA 2QGZA 2K5UA 4PTLA 3C16C 4LJ7A 4TMVA 2KWIA 4TSFD 2VHTA 5EZ5A 3RSOA 2HYDA 3IHLA 1MT0A 3SBEA 4IOKA 3GLGB 4TL7A 2OCYC 4OQFA 1G5RA 2ZU0C 5AJXA 4YMVA 2CE2X 4N1AA 1RFLA 4HEJA 3IEVA 4TYWA 2FWRA 1XJCA 4RZ2A 5FBLB 1VCOA 1J99A 1P75A 1Z07A 3BH6A 1A1VA 2AKAB 1KY3A 4LBVA 4G5GA 2WMNB 1GTVA 3KKOA 1CJVC 1XB2A 1ZM4A 3P1JA 5F3WB 1IXZA 3A4MA 4DLZA 2J0QA 2A30A 1VCMA 2R9VA 2ZREA 2YC2C 2B21A 4HI0E 5L3RA 1XXHB 4EPTA 3HDTA 5KUTA 2AL7A 4I1UA 1E2HA 5DN6A 1VCNA 2W2XA 3W5JA 1FX0B 2OG2A 3WHKA 2ZRNA 1VMAA 3GFTA 2RAPA 3TBKA 4TMXA 1XF9A 3M1IA 3SJBA 3TQFA 5JWOA 3T5GA 1IM2A 1R6BX 3LW8A 5HZHA 3ZD6A 2BM1A 4DZZA 1E9EA 1UADA 2CDNA 3LBHA 4DCSA 2QQEA 4Q4AA 2WTUA 3QJYA 1YR7A 5FBVB 1QHYA 2IUTA 3SQWA 2ZANA 1YZLA 2UVQA 5IRCD 3SJAA 2D3WA 4UXIA 2X19A 2HCJB 4NCKA 5SZHB 3ZVMA 1U98A 4US0R 2KI5A 1OIWA 1ZRHA 4FMCB 1KK2A 1L7VC 1NN5A 1TEXA 5KO2A 2ZS9A 3SOPA 1GIAA 1TMKA 1AK2A 2Q0HA 4NCNA 421PA 2YJTD 5JEDA 2OFOA 2VP9A 2WSSD 2V6JA 3MWKA 1WDTA 1FOEB 4LK2A 2VP2A 4Z1MD 1E9SA 5JMTA 2AD1A 2HXYA 4TL6A 4URWR 3GLIA 2ZYWX 3BB4A 4X8MA 3AVTA 1G6OA 4URYR 3RSLA 1H8HA 1G8YA 4QGFA 2HT6A 4HLUC 3VKHA 5UKDA 5J4KA 4C30A 2J87A 4UNPA 1W2HA 2FFBA 2ZIAA 4P32A 3SZRA 5DIFA 3OIVA 2VQSA 1OH8A 2OESA 2ZAOA 5FOVA 4M53A 3RRZA 2GTPA 2QZ4A 4EFLA 3C41J 2JLUA 1CF4A 2J7PA 2GDJA 3H84A 2IK8A 1GITA 3ZJYA 3AVXA 4QM7A 4BLOA 4FI3C 2JJ2D 1KI1A 3TUZC 4LGMA 3Q3JB 1G3RA 2FSGA 5JWHA 2WJIA 4MKIA 3BJIC 4B3DA 2F3RA 3SEAA 1RE0A 2RKOA 2W58A 2IF0A 4EPYA 2G88A 1WRBA 2JDID 2ZPTX 3QENA 1IN6A 2WIAA 3DM9B 5EP4A 1OLOA 2ZVQX 4L16A 4ESVA 4PFSA 2WOOA 2VLIA 4RSGA 3LDAA 1Z0DA 3U44A 3NH6A 4AKEA 3K70B 2P0EA 1G8GA 1SXJA 4QHTA 3SE0A 1NF3A 3U6BA 1U99A 1GZSA 2IWRA 3LA6A 3GEEA 1S1MA 5HCIA 4BZPA 5HR5A 1W0KA 2JLWA 4JBWA 4I1OA 2QAGB 2VBCA 2C78A 1FUKA 3PUWA 4EPXA 4C0JA 4LJ8A 4ZI3A 2OCAA 2ZRPA 2QE7A 1AS2A 2PCJA 2ZJOA 4JT2A 1UBCA 3I62A 1YRBA 1DAFA 2HJVA 1R10A 1W47A 4TMWA 4M1MA 1VYTA 4C4PA 2Z5FA 3ZDQA 3O8RA 2Q9BA 4OHWA 2NMVA 1CS4C 1GVNB 1FQKA 2YINC 4Q4HB 1G291 1OHHD 2BM0A 4I99A 3R9WA 2QM8A 3JVUA 2F3TA 3T06B 3CWQA 2WJVA 1KKMA 1CJTC 1GL9B 1G8HA 2WV9A 3GEIA 4FCWA 1Z29A 3IQXA 3DOEA 1GNQA 4RD2A 3SBDA 3AF4A 2ZE5A 3CO5A 4FMDF 4NYMQ 2DWQA 1ZNWA 4S2EA 1K5DA 4AIIA 2BHRA 1Q1ZA 5GJWC 4BLSA 3LV8A 3QXCA 1AQUA 1AZSC 3NIBA 3EARA 5JJLA 2SHKA 4EPWA 4HB4A 5FH9A 4MUAA 2V8OA 4MYUA 2ZSAA 4Q1CA 5C1BA 1QHSA 1VTKA 1S8FA 4IDHA 2BDTA 4ASUA 1Z6YA 2JDIA 1II0A 2R62A 2XITA 4JL5A 2IYTA 1QG4A 1LTQA 2J5XA 1ZD1A 2ZI3A 3IBGA 4MKHA 4NL4H 2C95A 2Q21A 2I3BA 3VNVA 1F3OA 3AF3A 1ZUHA 1E1RA 2AXNA 1XXHE 1IOZA 2W6ID 3LRPA 1DTSA 5JEEA 2ZRFA 3QPUA 3FKQA 1MH1A 5FBQB 1NBMA 3A58B 1NY6A 3I4LA 2GETA 2V1UA 2B8WA 2H7VA 2JJ8A 3MRSA 2YKGA 3NHBA 2F1IA 2NO7A 4ZIRA 2O8EB 4QJ4A 4DC9A 1S4QA 2F1RA 1R2QA 2JA1A 3K9GA 4L4UA 4TLCA 2D4HA 2H18A 3GLHA 5JHGB 3CH5A 2JCSA 3MGCA 3AKYA 1AM4D 2FZ4A 2XZOA 2R44A 5G53C 3VU9B 3QVVA 3A1VA 3QBTA 1RRFA 4PZZA 2EVWX 3EZFA 3GFOA 2ZI7A 1I4TD 2JJ1D 4Q9KA 3PG5A 3T1OA 3VR3A 1OFIA 1YR9A 4LJ4A 1WE2A 1DEKA 1DELA 2R6FA 4L9SA 4JJKA 2GHIA 4RVCA 1P9RA 5BYKA 3BIFA 2EFEB 621PA 4HDOB 2C04A 4B73A 2AFHE 3TK1A 2G1KA 5CJ2A 1HTWA 1KKLA 3UWOA 3U3RA 1F2TB 4TYQA 2V7QD 2QMUA 4UNQA 5FTMA 2PLRA 2QE7D 2OAP1 4LBWA 3ZVRA 5JRJA 1Z6TA 4MA4A 2DFNA 3BE4A 3GPLA 1M34E 2EFHB 1YQTA 4Q00A 2CHQA 1QRAA 3BS4A 4Q4HA 1EFUA 1RRGA 3M4YA 5FUWA 1XFAA 2DPXA 3MJHA 4AYTA 3KFXA 5DISB 4HYYA 4KBFA 4YDHB 4OQXA 1NRJB 1ZIPA 4XVRA 1KSFX 2GEVA 3A8TA 3AUYA 4Z8YA 3EPLA 1US8B 3S1AB 2NOAA 2LCFA 3MSXA 3GLFE 1OXVA 4O25A 5F2EA 1GDDA 1NLZA 4TN1A 1VKJA 3UMFA 3QXHA 1Z0FA 3DOFA 4IXMA 4M21A 2BBTA 3KJHA 2V54A 4GOKA 1E9CA 2B7BA 2AK2A 4FCVA 3AKEA 3W5IA 5DO9A 3ZLJA 2JLQA 2X2FA 1ZD9A 3QF4A 4K81B 1E3MA 2GBLA 3IHWA 5JCPA 2HV8A 5DI3A 1IXSB 1F6BA 3GEHA 2YC4C 1OYWA 2XZPA 5DE3A 4JL6A 3RDPA 4BECA 2ODNA 1J2JA 3A1SA 2PEYA 3EASA 4JLNA 4B3CA 5KNCA 1G7CA 2RGDA 4F92B 2GILA 1XEWX 2ORWA 1WB9A 1Q20A 2TMKA 4ZCIA 2RGCA 4Q7LA 1KJZA 2ZI5A 1EFRA 5EE9A 4CT5A 2A5FA 2WICA 3SN6A 5GADl 3THXA 3AVPA 1T0HB 2EYQA 2ZJ5A 3EWAA 5JBQA 3CW2A 3GFPA 4IRUB 821PA 4YMTA 1JAHA 3B9PA 3QOFA 3KKPA 1FMJA 3EPHA 1IN4A 4POAA 1CR1A 2N42A 1S3SA 4DUGD 3GP8A 4KFSA 2BMDA 1IBRA 1R5BA 1VIAA 1W49A 4YONB 4OI0A 2Z43A 1NBME 5LD2C 1XDBA 5G3YA 3BRWD 2PZGA 5AJWA 3U4QB 4LOAA 1E99A 2ODEA 3B5JA 4PAMA 2IYVA 3G0HA 2C2HA 3OZXA 3THYB 1W36B 3THWA 4QNRA 2ORIA 4LPSA 4PHFA 3AVQA 4A2PA 4HLDA 1GWNA 2PT7A 3SHWA 2QG6A 2CL0X 5EE3A 2R6GA 1ZAKA 1AKEA 3L43A 5CDFE 1EK0A 3W9YA 4QGAA 1FP7A 3BXZA 4MYTA 4P0TA 1IY1A 1TF5A 3C5HA 1L4UA 1G41A 1OH6A 5GVRA 2OXRA 1AGRA 1T3SA 3WYAA 1Z6GA 5ELXA 1G5TA 3B78A 3REGA 4TLDA 5B2ZA 2H5EA 4Z51A 2HYIC 1BOFA 4X8LA 2F7SA 2OFWA 4D80A 3CNOA 3OIUA 4UXJA 5CM8B 1N5LA 4A6PA 3PEYA 3M0EA 1T3HA 3K09C 4LJ5A 4BFWA 1ELOA 2CCGA 1VG9B 2DBYA 2FEOA 2WM9B 5FUVA 1XMVA 2FFHA 1VECA 2DCUA 3F0TA 1KOFA 4RKEA 4KBGA 3LLMA 1VYVA 2ZYTX 4TQUS 1FQJA 1R0XA 2R6CA 2XNDA 4A8JC 1XCGB 2HEIA 5H70A 3KJGA 3K70D 2OT3B 2J46A 4JZKA 3AUXA 4TZ0A 3A4NA 4DVGA 5CLQA 3DL0A 3K9LA 4LHWA 1V43A 4CEHA 1SKQA 3FKSA 4JLOA 1SVOA 4M22A 4DT1A 2BKUA 2O52A 1CJMA 1N6OA 1GP2A 1XD2A 1NMZA 4WXRA 3AKCA 4FIDA 1E2GA 3DZ8A 3QSYA 2ZR9A 2NO6A 4B2LA 2ZSBA 4UKDA 5L3VA 3PUXA 1G9XA 3K9HA 2VIIA 3E5HA 5JJIA 2Z4SA 3JZAA 3MJRA 3U7EB 3EAQA 4AI6A 2HXSA 3GJ0A 1E1RD 1GRRA 5EXPA 1P5ZB 2XJ9A 2NO0A 4U00A 2Z83A 2EYUA 3BB3A 2F43A 1JPNA 4GFDA 4IEIA 2N46A 2ZTSA 1JBKA 3IIJA 2D2FA 4KYIB 5SZKB 4ABYA 4E22A 1TU3A 2QA5A 1RW4A 2I4IA 1J90A 5C46F 1KAGA 3QE0A 5EP3A 1NVWQ 3QG1A 3TKLA 4LZZA 4G0NA 2J0UB 4DLSA 1AQYA 3MWJA 5AWFC 5HKKA 3I8XA 2OLKA 2A9KA 1P2SA 4LWZA 4JLKA 5A4JA 4ZO4A 4IXNA 2BKEA 3ZQ6A 2CJWA 4IDPA 1YR8A 4WZAE 4RFVA 3O8DA 2WSMA 3EIHA 3RS5A 2CVHA 4TYNA 2IEZA 1OYYA 4MYHA 3CUEF 4KU4A 3TUIC 8OHMA 1EFTA 1E32A 2VP6A 1TAGA 3IQWA 3SFVA 1XTKA 3AGPA 4LC1A 3WNCA 4IOJA 5FL3A 1DAGA 3A4LA 4OK3A 2A2ZA 4LYJA 5F9HA 2WWIA 2OAQ1 4AWXA 1SVIA 2QU8A 1E1QD 2REXB 4OI2A 2F1JA 3T1TA 4KI0A 5JCZA 3L0OA 1GNRA 1KJYA 1G3UA 3AV0B 4OBEA 1XTIA 1XX6A 1E9BA 4KJZA 1OV4A 2QEQA 3EA0A 4OYHA 4NKRA 4Q4JB 5E4FA 1I4LD 1XD9A 1YU9A 5K8LA 2Z0MA 4YMWA 1GG2A 1D9ZA 5C4MA 1H65A 1B23P 4Z8XA 4UNNA 1MV5A 4A36A 4BFVA 4Q21A 1SGWA 4O2LA 3TRFA 5KOYA 1GUAA 3TR5A 1D5CA 3WY9A 1W4AA 2FA9A 2OM2A 2G0TA 4HATA 4ZDIA 2CBZA 3EZ9A 2XJ4A 2CJWB 4LDJA 4OQLA 3CNNA 2B7CA 3V9PA 3J81k 3OEHD 2XSZA 1M7BA 1EWRA 1Q44A 4DEYA 3I3SR 1Q57A 1KNXA 2JASA 4TL9A 2BOVA 3CRW1 3A1UA 3THOA 3AEZA 1NKSA 1BYIA 2QUZA 1MRNA 1QHIA 3N5CA 1IAQA 1IHUA 4II7A 4FXPA 3IPXA 1TPZA 5FFMA 5HE8A 3O8CA 3QPWA 4IEEA 1WBDA 4ON9A 1QVRA 1G6HA 3KQHA 2JIZD 4QGGA 4URUR 2ERYA 3NEJA 3UATA 1WMSA 2O0HA 5FOXA 5G40A 4B3FX 4JLAA 1XTRA 1W2GA 5AUPB 1E2PA 1WXQA 3K0AB 4LC0A 4B75A 2QBYB 4OQNA 2GZDA 1Y3AA 2QTHA 3GLHB 3L8ZA 1YJ5A 3KZ1E 4OK6A 3WYGA 1RJ9A 3CBQA 4ZDKA 4DT1B 4XTCS 1KO7A 1BIFA 4F93B 2BBWA 4DSNA 2XTNA 2OFXA 4QGHA 5SZJA 3KQUA 4NCHA 3C4JA 1Q3TA 1X1RA 4PHTA 2QT1A 3VR1A 3LQRA 1Z22A 4QC2A 4Y0VA 1ZMXA 5AR1A 1KMQA 1F2UA 3P4XA 1P73A 2ZYVX 3HJNA 1KJWA 2H8KA 2WJHA 2XSZD 4Q1FA 4RZUA 3ZZUA 4CDGA 1TEVA 1CULC 3LXXA 1LB1B 2PMDA 1ZNXA 4LHZA 1E2DA 2E1RA 4RD0A 4F4IA 1FPMA 3C8UA 4LJ9A 2GCNA 2QY9A 2PJZA 1XEXA 2JAQA 4V0OA 3OIWA 5HKKD 3VX3A 1IQPA 3B85A 3K0SA 4RCYA 1AJEA 2GZHA 4QHYA 4XVUA 2P5SA 1GKYA 1HA3A 1ZC4A 4ZCLA 3OAAA 3G82C 2GXQA 3QKSB 3EPJA 2IC5A 1KHTA 4CVNA 4GPTA 2WJJA 1JR6A 5E7IA 2C8VA 4RD3A 2AXPA 4Q1BA 1R7RA 4M1KA 4B35A 2QMHA 3REFA 1GRQA 4JYBA 1QZXA 4HAZA 2IYZA 1XRJA 2WWXA 3H1TA 4LV6A 4UJ3A 2WKQA 5SZIA 1E0SA 3SYNA 5EP2A 4A15A 1XPUA 4A0HA 1IN5A 5JWRA 1E2LA 2MMCA 1L4YA 1N0WA 4LUCA 5J47A 2JLRA 4U02A 3K0FB 4M9XA 3PEVA 4Q1DA 3SU8A 1KGDA 4PPQA 2ZI6A 1TQ2A 2ATVA 3OFNA 3THXB 4B76A 3SNHA 1S3GA 1YZGA 5BN3A 2RGXA 4DUGA 2J7PD 4MRNA 4A4DA 4MH0R 4HUQB 1N6NA 4TQ9A 5KSYA 1QF9A 4R9UC 2ZSDA 3PITA 5GJBA 5FPHA 3OEHA 1UKEA 1LFDB 4ZPXA 1W4RA 3LH5A 1VPLA 2GEUA 1Q1EA 1W46A 2BMEA 4KVGA 4E09A 1IXRC 4GL2A 1II8B 1W4BA 4LI0A 1E79A 3WNDA 1KO4A 4V0LA 4OHVA 2ZE8A 1ZM9A 3QIAA 2BEKA 2BCGY 2QAGC 4MDEA 1MKYA 4IFEA 1YZQA 4KLNA 2KJQA 5A0FA 1JECA 1KTVA 2PLFA 1US8A 2QM7A 2IA5A 2XTMA 4GBMA 4KITB 1T9HA 5F9FA 4HZIA 2GJKA 3GJ3A 2FF7A 4M9QA 1II9A 2IBMA 1MABB 2CLCX 4D0LB 2C9YA 4B6EA 2PL3A 2J0VA 1ZJ6A 1U8YA 4B2PA 4E07A 2XXAA 2YV5A 2L0XA 2IYUA 3QXXA 2OILA 3CPHA 2MSCB 3KJIA 2FSIA 4RY2A 1AS0A 1W36D 1FFHA 1KMHB 2H57A 1QHGA 2OE2A 4AY2A 1F2TA 3AP1A 2B92A 3PIRA 1E2IA 4IFBA 4S35A 4C0LA 4DDWA 2O8FA 2QENA 1T8TA 1UDWA 2BWJA 2WJGA 3UKDA 4C0BA 2MSDB 4JLJA 4ERNA 1R0ZA 2VHCA 2ANBA 4A8JB 2FX3A 3OFND 1E9RA 1ODFA 5FOSA 4OK5A 2IS4A 2YOFA 1KAOA 1NBMD 1N6KA 3CRVA 2IF2A 2ZJAA 1MO5A 4NMMA 4UNSA 4XIGS 4PQFA 1FW6A 2ZYUX 3FMOB 1WP9A 2WWGA 2QTVB 4A0FA 1JXOA 4M1SA 1NVUQ 3FKSD 4D4LA 3LNCA 4NDZA 5EZ6B 3SI7A 1BMFA 3SC3A 3IILA 3T61A 4JBXA 4MDFA 3AVWA 1I4DD 2EWWA 4MGIR 4ZDJA 2J0SA 1U2RA 4NZYA 4U7DA 1ZBDA 1ZU5A 2IXGA 2Q3MA 3E1SA 3HR8A 2ZUBA 1G7TA 2C9CA 3KTAA 1WA5A 1Z5ZA 4P4SA 4CEHB 5CM9C 1NSFA 3I8SA 5M04A 4HSEA 4DLWA 2ONKA 3IO5A 4PHHA 5B58C 1KI3A 1QHNA 3LX8A 4D0GA 2HLDA 1T91A 4RJLA 5AJYA 4Q02A 3MUFA 3EIEA 3BD9A 1W0KD 2RGGA 4PSAA 3LAWA 1JQJC 2J7KA 2V1XA 1LV7A 2BJWA 4NYIQ 1JR3A 1G64A 5EXXA 2GJ8A 1TU4A 4FW9A 5FUXA 2QBYA 1R5OA 1G8PA 3GJ5A 2HT1A 1G20E 2RMKA 2X2EA 3IUYA 5FUYA 1NN0A 1K6MA 2J3EA 3KXLA 4A0GA 4D82A 3C15C 4IDOA 4XTRA 4DLXA 4JLPA 1G1MA 5JFGA 4PC2A 3NDBB 1CKEA 1M6NA 1TQ4A 3LVRE 1SQ5A 2D2EA 2IT1A 1H8ED 2JLZA 2W6JA 2IHYA 4IKEA 4PO9A 2CLSA 4RD6A 3MLEA 5FTNA 2P67A 2ZITA 5F98A 2ZUDA 4WW0A 1OF1A 3H86A 3C7KA 3NH9A 5KDDA 2WAYA 2O0JA 5HPYB 3C14C 3AVOA 5JLJA 5K8TA 1Q1BA 3GJ7A 2O8DA 3TMKA 4TLAA 4A1FA 1W36C 2GEDA 4XJXA 1NIPA 5E7MA 2ZXUA 4ASUD 4D6PA 4GSYA 3R8CA 4M9SA 2BBSA 2FOLA 1DAKA 4TMTA 4QL3A 2FSFA 3VX4A 1DPFA 3OE7A 3NTUA 2W0MA 2XOKA 1H8HD 4TQAA 1Z6AA 1ZP6A 2HDNB 4Q7JB 3U3MA 1P72A 5IK2A 2G0NA 4IDQA 4A2WA 2OCPA 4NBSA 3FOZA 1G18A 4LHVA 3B1XA 3NBXX 5KSPA 1ZUNB 1CRQA 3HU3A 1LW7A 3OAAD 3SHFA 1T3LA 2ZE6A 1Z06A 3AP3A 3L82B 2F6RA 4EJSC 4TT3A 1EGAA 1TUIA 4MRVA 3KB1A 1CU1A 1M8PA 4BGDA 2OXCA 1YZKA 4TZ6A 2OSBA 3IIMA 4DDTA 2QP4A 4BRUA 1XTQA 3Q5EA 3GLFA 3WHLA 5TVKA 2YOHA 5KHOC 1G7SA 1YRAA 1NIJA 4RD4A 2ZJZA 4AYXA 3AH8A 5BQ5A 4JLMA 4LV8B 5LPNA 3ZIAA 1E96A 1IN7A 1F5NA 5J4LA 4C3ZA 4OKSA 1WBBA 3TVTA 2PCLA 1LF5A 4KFRA 2A5JA 2CNWD 2WVJA 3LQQA 1HURA 3K0EA 2XTZA 2CLDX 1CR2A 3NBZC 4B48A 2KB0A 1ZC3A 4CEIA 1BKDR 1ZD8A 3EC2A 1VDZA 1NN3A 2F9LA 2NTYC 2GKSA 3HP1A 4F7WA 3A37A 3ZZTA 2FFQA 1J7KA 2HJGA 3CONA 1HQYE 3QUSA 1UDXA 1D2MA 3OESA 2FFAA 2NG1A 1GM5A 5AK0A 1RKBA 3JZMA 3RS3A 3FFAA 3LX5A 1LVGA 3NXSA 1E9DA 4G01B 3BAFA 1P2UA 2PZFA 5JS7A 4PZLA 1NG9A 4YMSA 1HV8A 2ZJ8A 1IJFA 4R2IA 2NPFA 1W44A 5J5CA 1DS6A 4HAUA 3GLHE 1W0JA 2ZM5A 3AKDA 1FL9A 2OBMA 4ARZA 1LS1A 1TQ6A 4JYCA 4UJ5A 2YYZA 3RANA 5TARA 5BN5A 4TL8A 3R7WA 1P2VA 2C03A 4XWOA 4BQSA 5LB2A 2QP3A 3SFZA 3OIYA 3HWSA 1CR4A 3DZDA 2JEOA 1Q3HA 4P4TA 1OW3B 2FU5C 1YZUA 4RKFA 4DWJA 3C5CA 4Q4AB 1XCMA 1FX0A 1XXHA 3P27A 4BWYA 4UNRA 1A7JA 3OEED 3BOSA 4LYAA 4JVSB 2WKRA 2GBLC 5CK4A 1XWIA 1E9FA 1HH4A 3KKQA 4JS0A 2RGNC 1LF0A 3NHAA 3VMFA 2O8EA 4YMUA 2GF0A 1YKSA 3TSZA 2OZEA 3TH5A 4LYHA 4ILEA 4LJYA 3TGPA 2R2AA 2R6AA 1E6CA 3EG5A 2XB4A 1UEIA 2ZAMA 2A5DA 2MSEB 1RVDA 5KTYA 1Z0AA 2O8DB 2JLVA 1S0UA 2F43B 4WAUA 5KYKA 5TB5A 5GJCA 5CB6A 2GAAA 1OJLA 3CR8A 1SVSA 4M1YA 3UMSA 2EQBA 1R0YA 4TTQA 2J59A 5J4VA 1VG0B 3A1WA 4Q7MB 4RD1A 5FOUA 4DCTA 4WA7A 1BS1A 4N0DA 1UEJA 2P5TB 4YC7A 3FPAA 4I81A 4P3YA 1ONBA 5IDVA 3WRXC 2CL6X 2QRZA 2ANCA 5HE9A 2A3RA 4WOPA 4M2LA 2BV3A 2G77B 4N3NA 2GZAA 2Z4RA 4OJQA 1PLKA 5JHHB 4L5BA 4GRAA 2EWVA 3TUJC 2D62A 2F1HA 4Q9IA 2NZJA 5J4YA 3AVYA 3HPRA 5H8WA 1VHLA 1EWQA 4KODA 3BH0A 4GZMA 2VHJA 4BFTA 1GILA 5FPSA 3RLFA 3WBJA 3GJXC 4QBIA 3ASZA 2DR3A 1DO0A 1NVVQ 4F4JA 3HYRA 3KTAB 4A6XA 2IX3A 2BEJA 1SVMA 1DADA 4C2UA 1BO6A 4U5XA 1I2MA 3QKUA 2ZS7A 1E69A 2AD5A 3ZYCA 5EUMA 3OEEA 4HDCA 4BFZA 4MRPA 1DVRA 1E9AA 4Q01A 1KIMA 3U4QA 3BK7A 4KLZA 3TVDA 3K8YA 1PLJA 2BBOA 1RC8A 5FTKA 1RIFA 3H2YA 5FBWB 3FMPB 1SHKA 2BMJA 2VTKA 4JVNA 1ZNZA 3K0AA 3DM5A 4TMKA 4YDSA 1W5TA 4A0RA 3VHLB 1XMIA 3LO5A 4GP6A 1G4UR 4D4JA 4EJSA 1JPJA 3CNLA 2VP5A 3UK6A 3PCRB 1XJ0A 4A8JA 1X86B 1CP2A 1M1YE 3I92A 3K70C 3VKWA 1UJ2A 4ZCMA 5L3QB 5FPYA 3AQ4A 2CCKA 2HF9A 2FN4A 3CZPA 2QPOA 1G3QA 4MGYR 3L0IB 3LLUA 5FL7A 4W9MC 1PVOA 2GRJA 4DLUA 1NP6A 4FMBB 3LBNA 2C98A 2J41A 2QNRA 2RCNA 4NPHA 4CEIB 4FWIB 4D4MA 1NL3A 1D6JA 2J45A 5DYIA 1D2NA 1KDPA 2C77A 5KPDA 2IYRA 2WBLC 3RC8A 3VAAA 4B3XA 2G1JA 4CF7A 2H92A 4QBFA 5G3ZA 1G5PA 2QORA 1P62B 1Q0UA 4DCNA 1X3SA 3RWMB 1J70A 2G6BA 4LBZA 2CHVA 4LY6A 1QG2A 2RGAA 4W5WA 1XJQA 3QVUA 1ZUIA 3T15A 2H16A 4Q9HA 4DXAA 1TTTA 3GMTA 3PR1A 1ZM2A 3W6NA 3RS4A 1EFHA 1M7GA 3QXSA 5ANRB 521PA 3QEOA 4XD7A 3IO3A 1DBSA 2B8TA 3AVVA 1X8LA 2VHQA 1DG1G 1Z63A 2R6DA 2AN9A 1E2EA 2C5LA 1UF9A 1JXMA 3D7MA 5EQTA 2XNSA 1W48A 2YVUA 4IJMA 4M1TA 1I2DA 3DDCA 1NLFA 2O5VA 3F5FA 1KO1A 5DI3B 5EE1A 2FE4A 4M1WA 1SXJE 2WIBA 2NGRA 3VTKA 2DWPA 2ZQ5A 2XB2A 1COWD 1DAIA 2FGKA 1GL6A 4DSUA 1EESA 4Q7KA 4TYPA 3E70C 1OIXA 3TR0A 3ZGXA 2DHRA 3CX7A 4DKXA 4Q03A 4IOMA 3X2SA 3UWKA 1AIPA 4EKDA 3TW4A 1VHTA 4Z1MA 1OH7A 4LBYA 3CB4A 2CMKA 1XP8A 3V00A 2QSZA 4J0QA 3AP2A 3TLXA 3PUYA 3HU1A 5KU1A 3GD7A 1D2EA 1TF7A 1M2OB 3DEFA 4QBGB 4B3BA 2ONJA 1N3BA 2QGNA 4ZI2A 1KZ7B 3CRQA 1LS6A 2LKCA 4FD2A 2VF7A 1C1YA 2FEMA 5TMPA 3LD9A 2WPDD 3E2IA 6Q21A 3LFUA 3CLVA 3P26A 4LX0A 1OKKA 5TXGA 2G3YA 4P33A 3GLIE 2VH5R 1RYFA 4IVQA 4AKHA 5CIWA 3SR0A 3OHMA 1OXUA 2OHFA 3FGNA 2REBA 4PQYA 1KK3A 4DLYA 4WZ6A 4K46A 4Q5IA 1BMFD 4JLBA 3LVQE 2VSXA 3T35A 3QKRB 1OXSC 5FL7D 2YWFA 3Q85A 1T5IA 2HUPA 3IIKA 5KDOA 3CPEA 3ICEA 1VYUA 1JEEA 2DY1A 3CWZA 3T1QA 4BLPA 2GNOA 1DARA 1A5TA 2XOKD 1ZVQA 3D6TB 3CM0A 1XEWY 4QOSA 4YLGA 3UIEA 2GWHA 3T34A 2ZETA 5KPJA 5CK5A 2Q9AA 3EPKA 4LRWA 4D25A 3O47A 4EDHA 1ZW6A 2HLDD 3NG1A 3NC0C 4AKGA 2C99A 2W00A 1PZNA 4C0HA 2D7DA 1DO2A 3P20A 4G3XA 4I4LA 4R71A 2JIZA 2VPPA 3I1FA 2IYLD 4ZV4A 5A5GA 2VHUA 2IYWA 4JBYA 4NE2A 3R8FA 3U61B 1CLUA 1HE1C 3RVBA 4ZKDA 3UG7A 3TNFA 5EXTA 3PEUA 3R9IA 2YNMA 3TAHA 1DOAA 3M6AA 2BCJQ 1J8YF 1E79D 1LNZA 3CX6A 4DLTA 1E2NA 5CITA 2FMXA 3FWYA 3I5XA 2JGNA 2NPIA 4HB0A 4D0NA 3H4MA 3R7WB 2P2LA 1MO3A 4ACAA 1IY0A 3PENA 4BEJA 3K1JA 4PAOA 2FJUA 2UZIR 3EX7C 3MWYW 3RS7A 1U94A 3K0CC 4PXAA 3IPYA 2EFGA 4HAVA 1CJKC 1CBUA 3KQKA 1SZPA 3V4RA 3KUDA 2GJAA 4NONA 4GMDA 1YVDA 2W83A 3ICQB 2XGJA 2ZRCA 5FOTA 4O3MA 1NJFA 3MG9A 3THWB 1U9IA 1U0JA 2ZI4A 221PA 4WZBE 5KNBA 1RRPA 3CRRA 3NKVA 3THYA 3RYTC 1ZCAA 4IOLA 1MABA 1OXXK 3B2EA 4NCIA 5AUQA 4KHZA 1YE8A 2UZ3A 3I72A 1GSIA 4Q9JA 2XXAB 3P32A 1E94E 2AFIE 4GNKA 2QMEA 5CDFA 4UXHA 4PX9A 2D7CA 1EFCA
chains in the Genus database with same CATH superfamily
1V5GA 5AI6A 2ACEA 2FW7A 4TSKA 3TAUA 3KQNA 4A0SA 4XZ3A 1LPPA 1Z5UA 3H04A 4HLQB 3VJRA 5IYZA 5FR1A 1EFAA 2ODAA 4GYJA 2QTTA 4MKGA 4CNBA 4G8JA 3TZEA 2KBEA 4H1VA 5CX4A 1YKFA 4OHYA 5ALYA 1U3GA 1QH8A 4YCAA 3V1NA 4B1FA 4BYMA 2WJ6A 1AB5A 3DE5X 4FINA 4N7JA 1U7TA 1KI4A 2RH5A 2EU8A 5A9RA 1BRTA 1CZOA 2I78A 4MCHA 3FDJA 4OGGA 1KK0A 4HDMB 1M67A 5G1PA 1AUXA 4B40A 3WIDA 4HLCA 2D0DA 1RXIA 3KAJA 4FN5A 1CEQA 3STYA 3VNSA 1FFBA 3IKJA 1ND5A 4YRFA 1TYCA 5C2JB 2V6FA 3UXYA 1SC4A 2WKPA 4RK5A 1YDEA 1H1DA 5L7YA 2Y1KA 2QI9C 4BMDA 3QVJA 2JEYA 1MFPA 2HUNA 4K9OA 5NULA 1IN8A 1BE8A 1DTWA 3MCVA 5KNDD 4A9AA 3BWEA 1C8VB 3MS4A 1XIVA 3QBVA 4HL6A 1HT1E 4JR0A 5GQSA 4S1TA 3V8NA 1QLWA 4AG5A 1WR8A 2HR1A 1RJDA 1QPBA 1XD8A 1KI2A 3V7NA 4HB2A 3T3NA 4N0PA 2LV8A 4M89A 1GU1A 1HR0B 4ZQGA 2N3ZA 5EGSA 4BAUA 2E4AA 1CVRA 3S28A 3BRSA 3GJ8A 4R1SA 4RDXA 1XZLA 3ZDAA 3SYKA 1H22A 5K3FB 1SN7A 3UUGA 2V58A 1L5QA 1QHHB 2FPWA 1TAHA 4FYHA 5IT5A 3KZKA 4DJ5X 2ZB4A 1EFDN 2O1SA 3HNOA 2Q4BA 4NBWA 1K06A 4M83A 1IUKA 3FHCB 4JNCA 4BVAA 2GD0A 8MHTA 1JXAA 4E15A 2AFIA 2GTHA 1K86A 2QTZA 3QM1A 2AN4A 1QAMA 3VSBA 1J9ZA 1OT3A 1D1TA 4DR7B 1RAHA 1COWA 2I3DA 3IH5A 5ALSA 3KTFA 3BDAA 5JYBA 5G4LA 1KETA 2C9BA 3AHDA 4B3JA 2I1LA 5LZ2A 1XZEA 2GVDC 4MI1A 2YJ4A 3RC7A 3ASVA 1GOTA 4HQFA 1WB5A 2G4LA 3PFIA 4IIYA 2XYHA 1W5SA 2BSAA 3KAPA 1UBEA 4L9AA 5AMXA 1AB6A 3U17A 3ADCA 2HK9A 5CIYA 3WLPA 5I47A 3RIYA 4RVUA 2P11A 2M6KA 2CEAA 3OQJA 3ADBA 3L04A 2JF0A 5BSUA 4MDHA 1HPLA 2C5FA 2QGFA 5ERGB 3C6ZA 3KTOA 3G68A 1LRJA 1F0PA 1U1IA 2GBPA 3LXMA 4GOJA 4XWAA 4E1VA 2H4JA 5HMLA 1N5IA 3L8YA 1JWBB 4LQLA 4LDRA 3WWPA 1FNMA 3ZJ5A 1UIMA 2IHUA 1VSTA 4IM7A 3ZBUA 4G0OA 4OGLA 4QXOA 4HEA1 1IK6A 1CJUC 3RHFA 4MGKR 1E2MA 2O8CA 1U2EA 4HWOA 3A6HA 3UF0A 3DB2A 4R2WA 2PGNA 5DLQC 3SQNA 4AG6A 4F5DA 2GSDA 5DSZA 5KOHB 1EB9A 2ZYDA 4XB1A 2RBEA 4Y3UA 1WVMA 1R4MB 1TIBA 1A8IA 2IX9A 4FYWA 1YQWA 2H4XA 1W7AA 4D5EA 4R0VA 1UODA 1Z37A 3NBFA 1O9BA 2ZUCA 4P7KA 5E95A 4B34A 3EQ8A 1BH6A 3TSWA 5ECDA 3UKJA 5DCLA 4GR9A 3VZDA 3NAQA 1SUWA 1E5LA 2CB0A 1BXZA 4KL8S 3SVTA 4WXPA 5B30A 5FD8A 4Q6BA 3AF1A 4AY6A 4RZ3A 3OT4A 3HHEA 2IHNA 1E2UA 4R8VA 2GXUA 1WHSA 4E4YA 1USUA 4N7BA 4WDQA 4M1EA 2E1PA 1CXZA 3VYRB 5IBCA 2CNWA 4QJ3A 3Q7IA 1JJVA 3KKNA 2XNCA 3UG6A 3U5TA 4WK6A 4MQFA 3U3DA 4C7KA 1G17A 2VHEA 1Z0ZA 3OFSA 3ZWAA 1CDOA 3MA0A 4XGRA 4RZXA 4Z0TA 1U3TA 3DXFA 4DYVA 5IDWA 1E1NA 2HIGA 2K2QB 4CMIA 2N47A 3E5RA 2O5CA 3AGQA 3TLMA 4F3RA 3QEJA 5BV2P 3TZBA 1C0KA 1KZYC 1UKVY 5SYAA 5FPKA 3BRQA 3BPSA 4DDUA 1CY6A 3U5ZB 2N1MA 3Q2IA 5K01A 2QYOA 3MF4A 5D3MB 4XRGA 1NP7A 4I6EA 4IHJB 2R8RA 2W8BA 2EBUA 1KP2A 4H31A 2QRMA 4I5DA 4BO1A 4EW1A 4JXZA 1YBHA 3FIJA 4YCSA 4DG5A 4Q05A 4B6RA 2B2NA 1MX1A 1HI9A 4KE8A 3CIOA 4ENUA 5FQNA 5DEIA 3IKLA 1HDZA 1MGPA 3CGGA 3TZKA 3N1UA 4ZGWA 4NEHB 4YCLA 1SKYE 1ZIDA 4PN3A 4KXNA 2NTVA 5DX0A 3Q8XB 1T8WA 2FGJA 3LOPA 5DM1A 4YYEA 5KWEA 1HE8B 3FLBA 2G83A 1OYVA 2BYTA 5JADA 1FDUA 3OU6A 1YRLA 3VSEA 3K8ZA 3U7GA 2QSYA 3S5UA 3EZ7A 1Q7BA 4W6ZA 1H85A 1EQAA 1HOXA 1OFUA 2J9RA 3A4IA 2UUAB 1PKEA 4DPLA 1JYEA 3I37X 1F60A 1D8AA 1GPUA 2PG3A 2WD7B 3PICA 4HDMA 4MW6A 3O75A 5FWAA 4EIWA 3EQZA 1IEQA 2I7XA 3HJHA 4BC1A 1QFXA 3BMNB 5HBGA 4LCBA 3JR7A 3GAFA 4Y7CA 4EY8A 2BY4A 4RIHA 1O6FA 4BQEA 1YZNA 4AJPA 1OSNA 1E6EA 2PAFA 2IOFK 4XSGA 2VYVD 1DHTA 3RVKA 1XA0A 4AN1A 2OO5A 2VP0A 3DW3X 1C0EA 4IHJA 2D06A 1A9PA 1MAAA 2DSTA 2I71A 4WOCA 2REOA 1L7BA 2J30A 3FPGA 4PC7A 4KQXA 2Q1WA 5LIRA 3H1BA 2O2IA 4US1R 2FR1A 1IQUA 1B3BA 3F96A 2WVHA 4MAMA 5EEHA 4J75A 3O91A 1F4VA 3B36A 3RS0A 1Y63A 3TVYA 1SUFA 3L8HA 2PRSA 4R8MA 1XI2A 3S1AA 2Q41A 5DLEA 2JJYA 4YXFA 3W5CA 1TO6A 3MFQA 1QVAA 2PVSA 1Q77A 3OUUA 1P7WA 2P3SA 1Z75A 4HQOA 1VPVA 1K4KA 2W90A 1AA9A 2ATXA 1PFVA 4BNUA 1HE3A 2FSVC 2HLPA 4MEBA 1PR1A 3U13A 4Q47A 3WGYA 3EZYA 1N3IA 2BI4A 4KXQA 4UEQA 2YZKA 2P1RA 5LKAA 2O3SA 1K8XB 2ECQA 3A6FA 5F9MA 4BNXA 2PL9A 2PV7A 1WTCA 3BSSA 4BL5A 3UB3A 3W6OA 5C5CA 4LTNA 4IDGA 3W90A 4NULA 4QJBA 3NBYC 4KGDA 1XZKA 5TQVA 4C5CA 1Z12A 1F0KA 4DJFC 2XD9A 3LLCA 4OHFA 4BPRA 1WULS 3ILHA 1P1RA 3IBTA 1IDOA 1Z0IA 1X9IA 3MCAA 5EA2A 5ERXA 3CF0A 2HDWA 4BLUA 4E70A 4HNQA 4MP8A 2DLNA 5AOVA 3WL6A 4CYMA 2W2MA 2QW1A 1X1EA 2QX8A 5F4BA 2OXFA 3D8HA 4D9KA 3BHNA 4PPFA 1H2EA 1Q6ZA 3TM5A 3W6PA 2X5XA 3ONWA 2WTXA 3C7DB 3ZUGA 3COVA 1VL0A 4L15A 5LYYA 2FW1A 1L5VA 2Y27A 1DKQA 4X6LA 1K8RA 1WMFA 5JMOA 2RGRA 2VKQA 3AFOA 1P44A 1TJ4A 3C4QA 3LNTA 5I48A 3QLUA 2RJ3A 3BE5A 1MA0A 1HKUA 1Q1QA 3E5MA 3R44A 1JIKA 1M6YA 4RTSA 3LF2A 2NXWA 4R2MA 3SKXA 1JFFA 4QNNA 1QORA 4E08A 3AF2A 3SLKA 3WP1B 5JNLA 3E27A 1GQYA 5JCJA 1TNDA 4QXAA 3MFYA 1Z5GA 1ZRMA 4FWTA 3U2QA 5L8VA 4X1IA 1NVVR 2P9YA 1HT0A 4HMQA 1DV2A 1JJAA 2AZMA 5FX2A 2WAOA 1GARA 1L1FA 3WR5A 3L8DA 2BCEA 4DSAA 3E82A 2H1WA 5T7BA 3QV2A 4DIEA 5JY1A 2XE6A 5B37A 3ZVLA 5EZYB 2P8SA 4HT3B 2G76A 4Q3NA 1B0AA 3B9QA 1KEWA 1TTQB 4GICA 1X1SA 3JZIA 3Q8MA 1CRPA 4RSRA 1X19A 3OQIA 3KSAC 5JTUA 2MMGA 5EHIA 2WWYA 2Q3FA 3USES 4OM7A 4WL0A 1N2CE 3IUEA 3WLAA 4DDMA 1O77A 4CUJA 3BL5A 4JELA 1YR3A 3WNZA 5AUOB 3C6XA 5CB8A 2VSFA 2HBRA 1QK5A 4G5QA 1CUDA 1PJ4A 3TS1A 2PYZA 3JATB 5DCWA 1XZBA 4KQCA 1EX6A 3RJ9A 1IWOA 4IZHA 3LCRA 1XMJA 2XMQA 4UHEA 2YJZA 5K0ZA 3DZIA 4M88A 1SK9A 2XHZA 4UTOA 5INTA 5ILOA 1DEXA 3BWDD 4J3JA 1JNYA 5JALA 3DMNA 4NFYA 4LOJA 1UPCA 1Z2AA 4JI1B 1WXGA 1SVLA 3DZJA 5GONA 4LXHA 1C1XA 2X23A 4IKPA 1UK7A 4MCAA 4R69A 3LMKA 3F3YA 2OGWA 1V4NA 4H0NA 5CAEB 1QBKC 2XMSA 4CZ2A 3CMMA 3EULA 4L4RA 5C4GB 5LFAA 4IGKA 2F9MA 1QDLB 4RL4A 1Z6ZA 3KT6A 2C96A 2W2VA 3AEKB 4MGZR 1USIA 1M1UA 3B1WA 1T1IA 3H9JA 4WBSA 5FADA 5C53B 3AKZA 1B8VA 1EXMA 2Y05A 3FLEA 4MIKA 4HMOA 4RK4A 4ESEA 2IUUA 1UPAA 3LPCA 2RH9B 4HHEA 4KWEA 1JAIA 1U63A 3HXOA 2VJAA 2HSWA 2WE8A 1S1CA 3PXDA 4MRMA 4H18A 2OUKA 4O08A 5IF9A 5EUBA 2GS9A 3DPUA 2GDZA 2J6CA 3EIFA 4Y6RA 3RU3A 4RXTA 4LYEA 3GP5A 5LB4A 3WRYC 4QU5A 3O84A 4TWBA 3E03A 3O1JC 2YN4A 4CQMB 2AWNA 2DWCA 1QDEA 1WCWA 2Q4RA 4NENB 1KU6A 2D59A 3C6BA 3AI2A 5JD5A 1QRRA 3ADDA 2MIIA 1A82A 2JFHA 3NJ8A 4Y9UA 3ABIA 3QK7A 4UBKA 1Q22A 1F0YA 4C6HA 5IJAA 2QT9A 5KYWB 2QTNA 2WT4A 3RBZA 2EFYA 1PW7A 4BRSA 1HZJA 1CUYA 5EJEA 4KRFA 2JZOA 3VC2A 1Y4ZA 3HJTA 4IUDS 4CMAA 1CS0A 5IDXA 3WK9A 5B7PA 1JIIA 2RH4A 3BHIA 5BWMA 5M3BA 4DR2B 2W6JD 1BHSA 3QXJA 5DH9A 4W5HA 4PSDA 1ECFA 2I6QA 4UM7A 5AVZA 2V7BA 1N4DA 2D2XA 1TZ2A 3H42B 4BEVA 1V2HE 1K3TA 1ZD5A 1HYBA 1UKBA 1U8FO 2IZOA 5JS2A 1E64A 5JFOA 1AS3A 2H1RA 4JIMA 4J16C 3IEUA 1M3SA 2QUIA 1HLPA 4FOPA 4TLEA 4C9BA 4E46A 2YASA 4M4SA 4RH3A 3ENZA 1NXQA 3HBMA 1NVXQ 1IJKA 1L2TA 1PUIA 2PPLA 2GA8A 3DO8A 5EE5B 3WO0A 2ZRAA 3K09A 3KQQA 1LBSA 1B43A 2CFRA 1U2PA 1RJEA 2HWXA 2NO4A 3ANNA 5EIFA 4BLWA 4ZALA 3OT5A 1NBAA 5JECA 4I7EA 4AF7A 3QTTA 1JKJB 3LUCA 3WYEA 2ET6A 4UUNA 1RTKA 3EQ6A 5AJZA 2X7XA 2J3QA 1XNJA 2EFDB 2HXGA 4PPNA 1FTGA 1FX1A 2G40A 2V5AA 2JLSA 5HW0A 4I1VA 4DJEC 1DIGA 1NSYA 4MQFB 1V1MA 4UATA 1SC6A 2AMJA 2HQSA 3DKPA 4YCMA 2RHDA 2QZZA 3N0VA 1ZU4A 4LDPA 4QYTA 2JNWA 4DAOA 1U2GC 2BKVA 2X2PA 3IEPA 2UYHA 1OT5A 2J85A 3PPWA 2NSLA 4B80A 2JCXA 4I2VA 1PEKE 1QGUB 2QR3A 5ALWA 3S81A 5DHTA 2ECKA 2XD4A 1LLCA 1N5KA 1QCCA 2HLNA 3X2EA 2ESRA 3ROZA 1Y34E 2YOGA 1HQCA 3WL8A 3W9SA 5AW1A 3V4ZA 3W1EA 3PUVA 1JG6A 3ID6C 4HF7A 4PZYA 3B51X 1WQ3A 5J40A 4WNAA 5HS4A 3FDIA 4R1MA 1W1IA 1Y48E 4L57A 2G0AA 5DNCA 2PAAA 1N6LA 4JN6B 1O4VA 3D2BA 3TG8A 2H1LA 1S2IA 4JMLA 4NHEA 3H1FA 3QYFA 4WXEA 4CKEB 1W4LA 2AR7A 3F9RA 4RABA 1E3JA 3ZDXB 3ZIAD 1OA1A 2AG0A 4LVCA 2HSEA 1ISHA 2IU6A 2AE2A 5IM4A 4TMYA 2B4YA 2PX8A 2ODBA 4Q16A 1X15A 2YW2A 4GF5A 2CLHB 1Q6YA 4B74A 1I1NA 2AVDA 5IUNC 4NV3A 2OWEA 4HLNA 1J6UA 4FS8A 2I0FA 5CFRA 3IDAA 5E3IA 3HJCA 4IW3B 4M9ZA 4YRIA 1Z0KA 3FH0A 4CRWB 3CVWA 1XR3A 2YQ4A 1ISMA 1M2VA 4DNOA 2YNMC 2O3UA 1CUSA 5HS6A 4IMJB 2A88A 1HL7A 2UAGA 3NUZA 1SZDA 1ILWA 2ISCA 4O2AF 3ZNPA 2A4KA 2CNKA 3OTGA 5EUQB 4YH1A 1QS0A 4LA4A 4JBGA 5I9SA 2PZLA 5TS3A 4UHFA 1OHHA 1B3RA 1JA1A 5HF5A 3C85A 1OFGA 2NQ2C 2DT5A 5HUHA 1NSTA 1GKUB 3QKRA 5EZYA 3ZWPA 4AYWA 1EG7A 3QE3A 4FNAA 3OKPA 5B3KA 2XCTB 1SHZA 1H9AA 4OLJA 1U0OC 3N70A 1WPQA 1GSHA 2W0SA 3FYHA 3UMCA 1QOZA 3VFDA 5CG1A 4W1SA 2VRCD 1V4BA 1KI9A 3GLSA 2GM5A 4KTTE 4TWJA 4UZFA 4WUTA 5J4HA 3K71B 3U0VA 1N0UA 1V3UA 4W5TA 1E2KA 5SV2A 1PJZA 2YHSA 3EXG1 5HCUA 2CFIA 5EYPA 1F2UB 2Q5HA 1X3LA 3DO6A 3QNMA 3NFYA 1KFCB 2HA6A 1PV4A 1DXOA 1OTXA 2AG5A 1JJIA 2IPNA 1YRWA 2JIDA 1UM9B 3A4VA 3OM1A 4YROA 1C9DB 4BFUA 4EO4A 3C6MA 4KP7A 3DEZA 1T9KA 2QJWA 2O3QA 2ZYGA 4LXQA 3I61A 3DQQA 1EH5A 4C4XA 1IHOA 3L6OO 4MW7A 5BYJA 3B2QA 3NALA 4BMZA 4F9EA 1UWCA 4OX9B 1KC1A 4XM1A 2WQ6A 3D8BA 3GVPA 3CZQA 1ZGBA 2FFJA 2WF9A 3PNPA 5TDHA 3AJEA 3BIOA 5JVDB 4AP9A 2CXPA 3G0BA 1ZS9A 2IYOA 4OJNA 1KI8A 2JG3A 5B57C 3LSYA 3ZZ0A 4CM7A 1EP3B 1XZPA 2IS6A 3F2VA 4D41A 3CX8A 1SXJB 1DJMA 3T7AA 1I33A 4EB6B 1BC5A 2AMLA 2NO1A 2CCJA 1IBKB 4U3JB 2CWWA 1HDEA 5FBRB 4Q1EA 3VAZA 1V5WA 2HIHA 2R8XA 4GR4A 4NF2A 2JFGA 1TM4E 1RYDA 2YXEA 2VDVE 3GDWA 2PUWA 4PPYA 2WKWA 1NMYA 1T4GA 2WG1A 2YJ3A 3KX2A 4ZT2A 4BEBA 2GVZC 5I7FA 3ZD7A 2P6NA 1MVLA 3IP9A 1D2RA 3MMPA 2B4TO 1QIDA 4URHA 3WLOA 1ORWA 1IY9A 4GSKA 4Y2JA 4D4GA 2ERCA 2H1SA 2B0CA 3G88A 4J1TC 2I34A 4NZZA 4CMKA 4UBMA 5ALRA 5FTLA 4LDAA 1P61B 4R1PA 5FHRA 5LZ5A 1A7UA 1PHRA 3FMGA 2OZPA 4BJ3A 3OPXA 5AKJA 5AW8A 1VGQA 5HIJA 5IUKC 2XXBA 2QVGA 4WZBA 3UMBA 2J48A 2A7QA 3WV4A 5K8JB 1KK1A 1PNTA 1UKAA 2BM9A 2FJPA 3AIMA 3I9OA 2OBLA 3UUEA 3PR2B 4WRRA 3GT3A 4JGBA 3QLTA 4OY3A 3PXGA 3V3TA 4BGUA 4EVQA 5I5EA 1E4YA 1WXIA 2XNKA 1W1WA 2VDNB 3VPCA 2YZ2A 1NY5A 3DEYX 4QO7A 5FV4A 3HBFA 4FJ2A 1ZLYA 2VF8A 3KXIA 2IXDA 2ECFA 3AF0A 3TD9A 3F9CA 1N2OA 3AL3A 3S7TA 4CF6A 4PSVA 4MLZA 3LCUA 3N3BC 5L3SB 4JX9A 1QYDA 1U0BB 3ZQJA 4DLRA 2YJGA 1P9WA 3WGJA 3EGDA 4L02A 3KJQA 4ZMSA 1WX1A 1OZAA 1QCYA 3KV3O 1KH2A 1OXTA 1WNTA 3GT4A 1JXQA 1PVDA 1MRSA 1Y8CA 3FAKA 4JLSA 1ZM7A 1BQ3A 2PIDA 4IGIA 2H85A 4WCFB 3ZV7A 3CSDA 2YKGA 2XMGA 9ABPA 3FMFA 5CR9A 2C2ZA 5DRTA 4DCUA 1UOPA 2RI1A 4AC9A 4EOGA 3K9FC 1PT5A 1FP6A 1WF3A 1TZKA 2I1VB 4Y6OA 3VHXA 1AUPA 2IITA 5I9BA 5ECWA 4C5AA 4XAQA 4C01A 3CF6R 3AM5A 2EZ9A 1JEYA 2IY9A 4MRAA 5IXJA 2P9BA 3ZR4B 1W6UA 1DKUA 3FA2A 3SICE 4ZXFA 1QWSA 1J42A 2RDMA 2XX3A 3CSSA 2ZRJA 5COQA 3R75A 4NYJR 3L0BA 3TLJA 5HP4A 4Y2VA 1X38A 4DN6A 3L02A 1QFSA 3QYAA 2VT7A 4MITA 3M5WA 4DB4A 2FPUA 2KLBA 2NU7A 1AKQA 1VP9A 3O38A 4JOQA 5AKLA 3L6UA 2Q29A 3JVDA 1T5OA 4J0FA 3A6EA 2IYYA 1UJ5A 2IEIA 5JJKA 3FOAA 4MI3A 2Y9MB 4JHLA 2CL7X 4E2YA 1Y3IA 1VLVA 3GNSA 3I58A 3H83A 3CTPA 4ITUA 2EBHX 4XEUA 4HAWA 3ZDEA 2XNJA 3ZWVA 5BVHB 2RE8A 1X7WB 2CJXA 4RM2A 3LIIA 4OHUA 5F1YA 3LZ6A 1HTTA 1AN0A 4IDNA 4Y2SA 2V6MA 3OJEA 1K3UB 2DM6A 5KBYA 1U7HA 2FMTA 4IIGA 2IUSA 3M4ZA 3BMQA 4KFUA 3G5UA 1KI6A 3Q3EA 4YAEA 1JG3A 1WHSB 3FSGD 2HA4A 2QLMA 2ZIGA 1QYXA 3AEUB 1QH1A 3QMWA 1NMXA 3LDUA 3HSSA 4QU9A 3L79A 3DMFA 2VF4X 1JQEA 2A1UA 4MVJG 3C16C 4PTLA 5E6RB 1Z17A 2VHTA 5ILGA 1JZTA 4F3NA 3C4VA 4HWSA 1XRRA 3SBEA 3GLGB 3OM8A 4FE7A 4TL7A 2ICAA 5IBQA 1O7JA 1V3QE 4OQFA 4CV2A 3DEJA 4CDNA 5AJXA 5DM60 4DV2B 3GARA 3GLKA 4EJ0A 4N1AA 1RFLA 3MJCA 1N1MA 4HEJA 4KE7A 4EHHA 4TYWA 2FWRA 2GCEA 4I8DA 4RZ2A 1VCOA 1J99A 4BDTA 3IMEA 4OHKA 4KWHA 4X41A 4Y2UA 4MV1A 5EG5A 3WA7A 1XDWA 4LBVA 1EJ6A 1J00A 2WMNB 4KQWA 1L5HA 4G1CA 1ZM4A 2PDAA 3DB1A 4B8ZA 3VPAA 1NDUA 1OTYA 5TQ0A 2V59A 2XQIA 3IV6A 5JZBA 2Y2UA 4G4JA 2SECE 3RUHA 5LL6P 1EEXB 2B21A 3EG9B 2JFBA 2W98A 1RBYA 2NVBA 3DLIA 4HI0E 4EPTA 2AL7A 1ZH8A 5BW6B 5KUTA 2D2VA 2NXEA 1FX0B 4BB6A 3QMVA 1XLUA 1K7CA 1JSZA 4TMXA 4WKCA 4YUAA 1XF9A 1N1GA 3SJBA 1IWBB 1VLZA 1GPYA 3TQFA 1SUEA 1IFXA 3L3BA 3VZBA 1QO0A 3EWIA 1I0ZA 1LWNA 3OJ0A 3Q8KA 3G6KA 2ALJA 4DZZA 3LBHA 1XMQB 2V7TA 4JUBA 1XROA 3FYUC 5FKJA 3AYZB 1P45A 1K8QA 1QHYA 2IUTA 1WCIA 3SQWA 1TRHA 2SCUB 5DASA 2ZANA 1N4AA 2QRHA 4MYSA 1QOPB 2BUCA 3SJAA 2R7KA 2X19A 1I4WA 2HCJB 2PPVA 3RTEA 5IRCD 3HCBA 2QX9A 3OCJA 4HS4A 3K16A 4G0XA 1TKBA 2HA7A 5BN5B 2YCBA 1V8FA 3O2SB 1UBJS 1JG7A 2UZ0A 3M33A 4ZVUA 2P9QA 1AZLA 1TMKA 4NCNA 1I6LA 3VMMA 3ZCVA 2VP9A 4M9RA 4BJHB 1WDTA 1FOEB 1XC7A 5D2CA 4LK2A 2VP2A 5EPOA 3I42A 3S2EA 2ECOA 1I10A 1P31A 2F4NA 3LL7A 4S1VA 4XWTA 3WB1A 4URWR 2JIQA 4TL6A 4TXMA 1JG2A 2ZYWX 2PRIA 3ETCA 1VHQA 5B53A 4D8TA 4O4LB 5LQDA 3ER9A 2FW9A 3I01A 5CVUA 4HNGA 2QXUA 3HEAA 1H8HA 3RSLA 1DUSA 2R7MA 5EKUA 3C0KA 4MJLA 4QGFA 5CVDA 3K9CA 4ZTBA 3B38A 1JTVA 3UW3A 2XA9A 3RG2A 4Z4HA 1F12A 2F90A 1KYXA 2X3FA 3NAMA 4Q24A 3OIVA 2DTEA 2VQSA 2GTIA 1BXRB 2E0IA 2JGFA 4IMIB 1R8YA 4JUCA 2QZ4A 4M53A 2OD7A 2RHJA 5MGBA 2PMFA 4TYMA 2JLUA 3QWIA 3H84A 4YMHA 3RK1A 5KTMA 2ONCA 3O1IC 4BLOA 1V96A 4RHCA 5K8VA 3PGA1 3UB2A 4AZSA 2M9MA 3AUJB 3ZE7A 1KI1A 2QYTA 4LGMA 1NVFA 8LDHA 3TUZC 3R3UA 3NT5A 3Q41A 1GTMA 1SXHA 1K7FB 4U2CA 3BGOS 4KKVA 1RE0A 4CTJA 1E3QA 4EPYA 3B1JA 3H4TA 2QXTA 2ZPTX 3LBAA 1CJCA 3PHLA 3DM9B 4RANA 1CT9A 1VKRA 3OURA 4CL3A 2ZVQX 4L16A 4DA0A 1KRWA 5KCZA 4PFSA 2VLIA 5ICMA 1ENZA 1ZOIA 1M75A 2WTNA 4DYHA 2GPWA 1I9GA 1T15A 2BGMA 3P2OA 3W5AA 5T4EA 1ML4A 1V48A 4UQPA 1G8GA 2JHFA 4Q7EA 3AFMA 3D6VA 4MVWA 3NC4A 2PFSA 1TC1A 1U99A 2C0PA 4CR8A 2Q6LA 3GEEA 4PYNA 1QG6A 3GO4A 5HCIA 3WJ1A 2JLWA 4FFPA 2J8ZA 5JXGA 1QH9A 1Y5NA 4R8RA 1QAOA 3SAJA 4LJ8A 4W99A 2I65A 1NDHA 4N01A 3FOEC 3DTVA 4WBXC 5BQXA 2ZRPA 3MYRA 2QE7A 2W8BB 3UH0A 4ZQCB 1GNTA 1FFGA 4MV3A 5GZ1A 4JT2A 3RU7A 3U7QB 3LT2A 5IVKA 1OX5A 3WDSA 3FM9A 4M1MA 3EZXA 1VYTA 1CF2O 2Z5FA 3AETA 4R05A 2J0EA 4LG1A 3C43A 3H2HA 1CS4C 1A3CA 1FQKA 3W7BA 3L7IA 2IBSA 4I99A 1XKQA 1RPNA 4ZCPA 3A1DA 1KKMA 4XW2A 2O50A 4P7BA 1GL9B 3ZV4A 2P2GA 2WV9A 3CVJA 4FCWA 2C2KA 3DOEA 4G41A 4KVZA 4HEA6 3AF4A 2A86A 1ZNWA 3QFHA 1AKWA 2JL1A 2BHRA 1Q1ZA 4PZCA 1T36A 5GJWC 4BLSA 2PZJA 3CKYA 3HQ4O 4KMSA 3NHMA 4BV9A 4LFAB 3DUFB 5IVHA 3VV2A 1L5LA 2P9FA 2GO1A 2Z1MA 3P0HA 5EIEA 1ZJWA 5JJLA 2BFCB 3W4KA 2A14A 2SHKA 1KS2A 1MN6A 1IUPA 1J2UA 2ZSAA 4Q1CA 3ICPA 4P58A 4IV0A 3RSFA 4QPPA 1ZW1A 4O6VA 1S8FA 5JQWA 1X1DA 4ASUA 5ALVA 5IJWA 5F5NA 1K5HA 2B1RA 1QG4A 2G04A 2RK6A 2ZI3A 1EI9A 3IBGA 3PP8A 2XODA 4GOMD 4MKHA 4ATNA 1NAHA 3Q7SA 5AKEA 4C7MA 4EF4A 1JJFA 1DBPA 3LQ2A 5I7RA 1P3DA 4L5IA 1C80A 1RQLA 4EYQA 4CR7A 3LT5A 1H2RS 4UU1A 3ZW7A 1BRMA 1IOZA 3G8CA 2W6ID 3P9PA 2ARKA 3ESAA 4PYMA 4E5VA 4GPBA 4G1BA 5AM3A 1QCZA 1GG5A 1TZJA 4M6WB 4ZEVA 3QPUA 5HSGA 1C14A 3SDSA 4BWGA 2JC3A 3A58B 3R23A 4GI2A 4KOEC 4ENTA 1YNSA 2XWSA 1G98A 3VR0A 3T1YB 4HQKA 4MS4B 1IZ0A 2GN0A 2HJHA 1QO9A 3R5KA 2HHJA 1D4AA 3IR5A 5AW0A 2JJ8A 3VVBA 5SICE 2SBTA 2F1IA 2MT9A 4GSLA 3V6LA 1DI0A 1RD4A 3LI2A 4QRIA 5JQGA 1S4QA 2F1RA 2K6GA 2OOSA 2QHXA 2XQGA 5GZ3A 1Y8RA 2D4HA 3GLHA 4M38A 1HTBA 2PFGA 1Y9ZA 1U11A 1YZ3A 2YWDA 1EM6A 2W4QA 3P9ZA 2XUKA 3PR3A 5E7QA 4C2BA 4UTRA 1B8PA 2DU8A 2I54A 2DH5A 2CHUA 3P9SA 2D54A 3PQ3A 1CSEE 3VU9B 1PEDA 3CVYA 4PZZA 2D1QA 3EZFA 4X66B 2OV4A 4GDMA 1CUBA 1MPTA 3C6KA 5DTRA 4N7MA 1RT9A 3T1OA 1NM5C 4RCVA 3TCNA 3GRPA 2BONA 3M6IA 4DQDA 5EUCA 3DHEA 1PDWA 4RVCA 5DWDA 3ROGA 5K3OA 2AJ8A 2YHAA 4EUFA 1OI2A 1P18A 1SBIA 2RIRA 3HHPA 3KZOA 4YGYA 1C3LA 5JCJD 3V42A 1MNQA 3PFWO 2P2DA 4RGBA 3UWOA 3UHOA 1F2TB 3CT4A 2V7QD 2QMUA 4UNQA 5FTMA 2PLRA 4D9FA 3OKAA 1SUDA 5JRJA 5T4FA 4BFCA 2ZATA 4LY9A 2DFNA 3CLRD 4MA4A 2VCYA 1XJ5A 3CEAA 4U5QA 4NPAA 5ALEA 3GRUA 1EFUA 3OUTA 4AYTA 4FKBA 3F8SA 2QIPA 5A71A 5IASA 1AKVA 2V5UA 4MWEA 5DISB 1L4HA 2PFKA 4HYYA 2O3RA 1L8LA 4KBFA 5AHRA 5DKFA 3RFVA 4F1KA 5B3LA 1XA3A 4OQXA 3KU4A 4GRDA 1SD2A 5E4YA 3HXMA 2I2CA 2O57A 2WF5A 4DAEA 1J8VA 3FRIA 3AB7A 2LCFA 2VDPB 3LPMA 3QU5A 4YJ2F 1GPDG 4O25A 4ZZ1A 4X71A 2DKNA 3QFCA 1GDDA 3ED1A 2DX7A 3LGXA 1QLHA 1VKJA 5FLYA 5CNIA 3TD6A 3OE4A 3A1EA 2BBTA 2C4NA 4M21A 4U6NA 1D0IA 1J0DA 1A7AA 3VTZA 3ZWNA 1FS5A 1TB4A 1XHFA 4GOKA 4AFNA 1FLDA 2PJDA 3QA3E 5ENDA 3W04A 3GLIB 2XWQA 5A4DA 3ZLJA 2ZWMA 1RC0A 3OHPA 5K51A 1N8KA 2X2FA 3CH6A 3T3MB 1E3MA 3JZFA 5DI3A 5BRNA 3NHUA 4TS9A 5JCPA 5JRDS 3GEHA 5MN6A 1D2AA 2XZPA 2CBXA 5DE3A 3GUYA 4JL6A 1GY8A 2CSUA 2Y76A 2ODNA 5AK3A 3RDPA 1J2JA 1DIBA 2PEYA 3A1SA 3LIPA 1N8NA 5DW3A 1G7CA 4ZT7A 4F92B 5JAIA 2MYNA 3CN9A 3AY0A 2R7AA 2TMKA 4IIUA 1TIPA 2G25A 1KJZA 2RGCA 4QREA 4R1UA 2WK1A 2A5FA 2WICA 5L7WA 4NFSA 5CMLA 2EYQA 2PUHA 3GMSA 1VE3A 4FFRA 4IRXA 4S0ZA 4QOGA 3UK2A 2X2OA 5BUQA 5JBQA 3CE9A 4XUDA 3HFJA 1EWVA 1YB5A 3B9PA 4L8WB 1FMJA 3I12A 1P9OA 3RVOA 2BR4A 3C3MA 3FPFA 4TUYB 5ALHA 1CR1A 4UEKA 4X3PA 2HSJA 4G0MA 3T52A 4OHBA 5JSQA 4LF7B 2QN2A 4DUGD 2ZRQA 2PXCA 2WIFA 4G56A 1N34B 3GI1A 5ENVA 1IBRA 1VIAA 2RGUA 2AH5A 4JCOA 5JSFA 3O90A 2H7YA 1SC9A 1RHMA 2PZGA 3D5EA 1QC5A 1LQUA 5FWXA 1M0SA 3RTCA 3B5JA 3GX1A 3G0HA 5GINE 3OZXA 3OO1A 1FTWA 1B41A 1LLFA 2C5HA 3D5TA 1C1XB 4BNHA 4JLWA 4CGYA 3RBXA 1EFKA 2FWAA 4A2PA 2AVNA 2FRDA 3DTTA 4P5PA 3QLEA 4Y1GA 1I01A 3KEOA 1BS9A 1DKLA 1EVKA 2CL0X 2QG6A 4GX5A 5CT4A 5EE3A 2QUJA 3ET4A 4QQNA 1QPZA 1AKEA 2J3MA 1JW9B 2ZXFA 3KLNA 3W9YA 1DQYA 4BS9A 4DR6B 5AO9A 3ZX5A 2GPYA 4MYTA 3V8PA 1TF5A 3W78A 2XGGA 1KQFA 5GVRA 2OZLB 1RWKA 1FXWF 5KWJA 2O1EA 3BHJA 3Q3GE 4AL4A 2C1EA 2WY2D 2B3TA 1QYIA 2PKQO 3B78A 2DECA 1LC3A 1NOKA 4D4HA 1Q14A 2E6UX 4DMUB 4Z51A 1M34A 3CZ4A 3Q87B 4XLTA 3RF7A 1BOFA 1GLGA 1QAQA 1V7PC 4OH7A 3USCS 2OFWA 1U4SA 1ZGJA 3CNOA 1EDDA 1EVZA 1DC3A 3GJYA 1N5LA 3FTNA 4UXJA 4A6PA 1T3HA 1Z2OX 3TQRA 2K4MA 4UEWA 1Q2UA 1VG9B 2DBYA 2WM9B 4CKYA 1AOXA 5K03A 1KOFA 2IOHA 4KFCA 2QQ5A 4KBGA 2JHGA 4QYMA 2XKJE 1VYVA 3HB7A 1R0XA 3UAGA 3PA6A 3ZWYA 4A8JC 5CUQA 1LLDA 3ZGYA 1Z7BA 1U0NA 3EC7A 1SCDA 3OMWA 1UL1X 4OHOA 1MX9A 1OR8A 3K3PA 4AVYA 1EM8A 2JZNA 3ER8A 5CLQA 3PC7A 4DT1A 1UP6A 1DFHA 3WGMA 2BKUA 2JAOA 4P98A 4UW9A 3QYPA 1AQ6A 1MBZA 2JH3A 3PFGA 3HV2A 2JCVA 1A1SA 2QW0X 4EZIA 2BEWB 2QZJA 3CS3A 4GLOA 2N0SA 4RF3A 4UOZA 4D3ZA 3QSYA 3ZNNA 5CVVA 1N0IA 1TD1A 1DXHA 2ZSBA 3HCRA 4OQYA 3TDKA 3ZTYA 4BJ6A 1T9GS 4OSPA 5L3VA 1ZH6A 2AFHB 2WLSA 3ENWA 2EJTA 2H2WA 2H5JA 4LY3A 1FRFS 5LQSA 1LXCA 4CMBA 5JJIA 2HWWA 5BN4B 4ND8A 3U7EB 3E48A 1IWPB 3RT1A 5AD1A 1LLQA 2QLBA 4AI6A 3IQEA 4G07A 4PONA 3KE8A 1AHPA 1E1RD 2IE8A 5H3LA 3A9RA 4WY8A 1P5ZB 1VJTA 5EKSA 2XJ9A 1OGYA 4XQ0A 2ENUA 2DP4E 2F1OA 3PL5A 4U00A 4DA7A 1DAOA 4DM7A 5JDCA 1CY4A 3ZE9A 2XT0A 3ACDA