4FXSA

Inosine 5'-monophosphate dehydrogenase from vibrio cholerae complexed with imp and mycophenolic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
484
structure length
467
Chain Sequence
MLRIAKEALTFDDVLLVPAHSTVLPNTADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKIFEAVTHPVTVRPEQTIADVMELTHYHGFAGFPVVTENNELVGIITGRDVRFVTDLTKSVAAVMTPKERLATVKEGEVQEKMHVEKILVVNDEFQLKGMITAKESKPNACKDEQGRLRVGAAVGAAPGNEERVKALVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAMSKGSSDRYFQTADKLVPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKESHVHDVQITKEAPNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inosine 5'-monophosphate dehydrogenase from Vibrio cholerae complexed with IMP and mycophenolic acid.
rcsb
molecule keywords Inosine-5'-monophosphate dehydrogenase
molecule tags Oxidoreductase
source organism Vibrio cholerae o1 biovar el tor
total genus 114
structure length 467
sequence length 484
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4fxsA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fxsA01
3A9IA 3FS2A 3K6EA 5FESA 2E5BA 1DBTA 1GTHA 3SSJA 3LM7A 2ISWA 3GK0A 3SY5A 3WK1A 2J9XA 4COOA 2PCQA 4KKXA 1W56A 2ZA1A 1KFLA 1DKWA 2TYSA 4HNTA 3C0JA 2DU2A 1F2JA 4LRTA 1SO5A 4JGDA 4MFDA 4UUUA 1JULA 1EWEA 5EL1A 1WBJA 3W1QA 1PBJA 5KZDA 1OF8A 4IY3A 3QJAA 2V81A 1A5AA 3QZEA 4FNUA 4UUIA 1LRTA 3T40A 4GUFA 5K23C 2EPHA 4O12A 1THFD 5D05A 3CWOX 2NUYA 3NA8A 1I2QA 1GTEA 3UPWA 1TTPA 2A1YA 2CU0A 1U5JA 2W79A 3IIXA 3LRLA 2BX7A 2I14A 2OT1A 3QF0A 1VGAA 4QQ3A 2CWNA 3DKJA 2YFNA 1K8XA 3N19B 3LXBA 2FQIA 2Y7FA 2EKCA 3FNAA 2J9YA 2JKPA 4TO8A 4K36A 4DF1A 4Z1CA 5D2WA 5C6MA 4WXYA 1VCFA 3GDTA 2FIQA 1OFQA 2LLEA 1TPEA 3M5YA 3WJXA 1FWTA 3S5NA 1GVOA 2HS8A 3P67A 4U28A 5E1QA 4NXSA 1OHLA 1LOQA 2DZUA 3TE9A 3W73A 1FUYA 2C14A 3LFZA 4GQYA 1V7YA 1TTJA 1W8SA 2GQ9A 2DZTA 4JTEA 3A21A 3TR2A 4C1KA 1GZGA 2QCFA 2B0MA 3BGGA 1AL7A 2QR6A 1XUUA 3LHHA 4E2BA 3RK8A 4ICNA 3ANYA 1O95A 5D2YA 3KVKA 3NQ6A 3NZ1A 5EMUA 2RIHA 2VFIA 1AMKA 4H6KA 3EX3A 4XTIA 2PC4A 4JTIA 2OT0A 5LGXA 4OU1A 5D2XA 3MUXA 3O15A 1KTNA 3I8NA 1XKYA 2QEZA 2QUVA 4ZL1A 3L67A 3W23A 2NLIA 4Z1AA 4TX9A 3ABRA 3ZWSA 3PM6A 3W86A 1YDVA 1P0KA 4OV4A 4WY0F 1NVMA 5BRBA 3QC3A 4B5NA 4FX7A 3PB2A 1RQEA 2CLEA 1L6WA 1TTIA 3EX2A 4NZJA 1ZAHA 4UNLA 5IM51 3OBKA 4MFEA 1R30A 4IXHA 2TSYA 3LI1A 3DFSA 5EPDA 1EWDA 3KPBA 4AF0A 3BV4A 4C1LA 1FCBA 5CKSA 1PS9A 3I7SA 4O11A 4AHPA 3NOEA 4FB7A 1VLIA 4MZYA 3HF3A 1WDWA 1KW1A 4LRSA 1B9BA 4RJEA 1C8VA 3W2KA 2J27A 1XKFA 1T8XA 3OVRA 3DENA 1I2OA 5F4WA 4PL1A 4BR1A 3PB0A 4DF2A 1LROA 5DBUA 4OV9A 3LBCA 4K8EA 2ZZ3A 4AEOA 1TTQA 4H3DA 4GQWA 4UXDA 3W2LA 5I3IA 5HR7A 2TRSA 4O9KA 2QDGA 4QISA 4NJJA 5G2HA 2VKZG 3SGZA 1SW7A 3G0XA 4ZQNA 4XQ6A 3MW7A 2XN1A 5AHIA 4TR9A 3HGSA 4GUJA 2E5CA 3NQEA 5HINA 1U83A 5LZLA 4HG0A 3WJYA 4JX5A 2I9EA 3STFA 5DLCA 3W7DA 1K8YA 3FV6A 2BZNA 1HG3A 2ISSA 2Z6IA 4NZFA 5K4ZA 2DZVA 2GJNA 4BWLC 1FCQA 3S1XA 1W5NA 1OFDA 3F4NA 1F74A 3S42A 3W76A 3G1VA 3M5ZA 3N73A 4PFMA 4O52A 1OF6A 1DORA 4IWWA 4GJ1A 1OFBA 5AC8A 3GXPA 5LNVA 2QLVC 4OT7A 3U8GA 3WFAA 3ZFHA 1P1XA 3GXTA 3G22A 3QSTA 3QW3A 4G1KA 5K4XA 4QM1A 3R5EA 5LKYA 4O14A 5AYYA 5U7SA 3GDRA 3PUOA 2C18A 2GQAA 3QH2A 1XBXA 3Q37A 3P62A 5LNUA 5HULA 2X1TA 3NQCA 1DHPA 4UTKA 4O13A 4HT3A 2NV1A 5LXQA 2PRHA 3TXVA 1O50A 2ZDRA 3G3DA 3KXQA 2XN2A 1AW1A 1EIXA 4UTJA 4LOCA 3LB0A 2FLIA 5TQLA 2ZA3A 8TIMA 1H7XA 4HHPA 3KFTA 2I1OA 5K24C 1I45A 1IGSA 2ABAA 2O16A 3W1RA 2WQPA 1LRQA 2QCEA 2Y88A 2FDSA 1BWLA 4S2BA 3RMJA 1Z42A 4JN6A 4PH6A 1KA9F 1TO3A 1VHNA 1TYGA 1K7XA 2CZFA 3UYCA 3OVPA 3NL2A 2RC3A 1DQWA 1TQXA 4JX6A 2OUXA 3T4CA 4FNSA 2J9ZA 1SW0A 2QKFA 3HBLA 4BF9A 3MHUA 3P61A 3LTSA 1W3NA 1XBYA 4R53A 2NXIA 2WPBA 2YXGA 1LYXA 3GYEA 2Z0IA 4LUIA 4TMCA 1KM4A 2V2DA 1I2NA 5ABTA 2E5DA 3D0CA 3PSVA 5TBOA 1X6UA 4PEKA 4LV9A 2VXNA 1OK4A 2VEPA 1QOQA 5EA9A 3CWNA 3DZ1A 1ICPA 5D37A 1KFKA 3TJXA 6TIMA 4EF8A 4UFMA 3G0UA 1DQXA 4RZ5A 4Y9AA 3C4UA 4LTSA 3LV6A 5CZSA 4ORIA 2JKAA 4IPJA 1QMLA 3N9SA 3ZS4A 4O53A 4NJIA 5DN1A 4DQWA 3KRZA 3TIMA 4LW7A 5J5DA 4O1AA 3B0VC 4UR8A 2YVYA 2VFFA 1TQJA 4MYAA 4UTTA 2OJPA 2YDAA 5F2MA 4M5PA 3SW6A 3VI2A 4LUJA 4MLJA 5H2ZA 5A5WA 3LHUA 3EXRA 4RCXA 3TFXA 3H55A 3S5OA 1D9EA 1TPH1 4IMDA 2Q8ZA 4NX0A 4O50A 1L6SA 4FX6M 2QCDA 4Z1BA 1WX0A 3CIXA 1EUNA 2C15A 5D02A 1UBSA 3ZWTA 1W5PA 4LS0A 5FF3A 4ZZ9A 1Q6QA 3A24A 4GRSA 2V2HA 3OEXA 3L0KA 1TRIA 1F73A 1K8ZA 4JTUA 3FYOA 2QUUA 4K38A 3W70A 1A5SA 1GVSA 3HJZA 4IJBA 3IVSA 3B0PA 1X8FA 1D3HA 3KXRA 3B04A 1UB3A 3W22A 2CLHA 1FX6A 1C29A 3BK0A 4IYSA 4AMAA 1ZALA 3TROA 3T7VA 3CT7A 1CW2A 4Y96A 2JKEA 3E02A 3NL5A 3VFLA 3HMJG 4CQ9A 2ZQ0A 3I7QA 1JVNA 2QH1A 3EWBX 4JXCA 1GYNA 1LTDA 3M16A 3W7HA 3NPXA 3NQ7A 3O1NA 4O4VA 4GUIA 1MZHA 2HSAA 3OG3A 1HFBA 1Q6LA 3M7WA 3STEA 2QCLA 3NGJA 3C8FA 5BW6A 4N4PA 4BI6A 1OABA 4RKAA 3EB2A 5D2VA 3QRHA 3HB9A 1CX9A 2J24A 3W84A 1NSJA 1PCKA 2ZZ1A 3PWAA 4A22A 2YR1A 3T44A 2NXHA 1A5BA 5K22B 1PL9A 1QR7A 5KZEA 1G4SA 2CLOA 4UFHA 5CSSA 4AB4A 4MJZA 3WK3A 5I3JA 1GG0A 3G1AA 4DELA 4O10A 5DELA 3M5VA 1M5WA 4FO4A 2G5WA 1ME7A 4GQVA 1FBAA 1GQNA 1XXXA 4E2DA 3BG5A 4JICA 3MP5A 4LC8A 4UMAA 5KITA 3V75A 3GB6A 2G97A 2V9DA 4W9TA 5AHMA 1R47A 3NG3A 4UTHA 3C2OA 4IX2A 1Q45A 7TIMA 2QAPA 1WV2A 1YXCA 5D38A 1NF7A 5FEZA 4O16A 4O1DA 1Q3NA 5G2WA 2GVGA 3MWAA 2Q8LA 1Y5HA 3PC2A 3UWZA 1XL9A 4LU0A 2NXGA 2WSQA 5C5YA 2H6RA 5CSRA 4M19A 1XI3A 3MP3A 3L9CA 2BTMA 3QM3A 4Z0SA 3LHWA 5FI8A 1IIHA 3LHVA 2V5BA 1LOLA 3DH7A 3S6DA 1H50A 3K30A 4E0CA 3SECA 3MP4A 3WJSA 1FWNA 3F4WA 4JYEA 1DJQA 4Q32A 4LC6A 2GVJA 1XC4A 3W87A 1JCXA 2FPYA 1YPIA 5IBXC 4PA8A 3L65A 1KBJA 1N7KA 3MI3A 1VHCA 5DY2A 4FXSA 4CNNA 1EP3A 5E93A 1W3IA 3SL7A 2JBMA 5A8GA 4O4WA 1N8FA 2H8XA 5SWUA 2WJZA 5C2XA 3L5MA 2Y7EA 3G1XA 3IGSA 3LLFA 5FF4A 5G2IA 3TW6A 1SZEA 3LCIA 4FEZA 4ESYA 1PE1A 4RZ6A 1G4PA 1VR6A 5CZ0A 3QPZA 4WQ6A 3QYQA 2B7QA 4FIRA 3CC1A 1GVRA 3BG3A 4IUOA 4A2SA 2E1DA 5J5RA 3TSBA 1VPXA 4FNPA 2EGZA 4RLIA 3BVJA 3W72A 3TUUA 1B57A 1J2WA 3LGEA 3HF7A 2V2CA 1S5VA 2X16A 1JCNA 2R91A 1VC4A 3NDOA 1KLZA 3HQ1A 3LHYA 3ORGA 3LCWA 4CCEA 1JQXA 4LVFA 1FDYA 3M9YA 2ABBA 1Q6OA 1HUVA 3ATYA 3PBYA 4OWGA 5DCBA 3V1PA 2E6DA 5F4XA 2JGYA 1YXDA 1RPXA 2V8ZA 3GBYA 3A5VA 1H7OA 4O54A 1K03A 3LCLA 4NNBA 4WX2A 4LNYA 5DXXA 2VC6A 2YCEA 1Z41A 2ZYFA 4PC8A 4KFPA 3W7JA 3PBWA 4HNVA 5AYXA 3LERA 1W37A 3THQA 2RDWA 2W0UA 3QQ0A 2VOMA 1I2PA 4FNTA 2P1FA 4YWIA 4QNEA 4UTTC 4CNOA 3ABOA 3R2GA 1JUKA 3TSMA 3IIVA 1ML1A 1TPWA 1KFCA 3ELFA 2OOYE 1SZGA 4O17A 1TPUA 4WOZA 2ZFAA 4EF9A 1B3OA 2TPSA 4YXGA 1NF0A 4A21A 2YGYA 2ZRYA 4AWTA 1SZFA 1MO0A 4GC4A 5KMYA 3TMLA 1W31A 2ZZ2A 3I6RA 4MIMA 5I3GA 2D4ZA 1KFEA 2BLEA 3E49A 4OHQA 3VE9A 1OX4A 1UJPA 5G1TA 5HNRA 1M6JA 3EX4A 2P0OA 1QNVA 3ZR4A 3ABQA 1VLWA 3EWYA 1H1ZA 4IY2A 4IX0A 1UCWA 3USBA 3GNNA 2CZEA 4JY8A 1EB3A 2B7OA 2X1UA 4QIUA 1EX5A 3LV5A 1L9WA 4K6AA 1JCMP 1N55A 3KAOA 4UNKA 2NX3A 5U4NA 2O7QA 3IV3A 5GVJA 1OFRA 2QCGA 1YLVA 1DL3A 1ZAJA 3DBPA 4A2RA 1TMHA 2PURA 4Q4KA 2HTMA 3GNDA 5G5IA 3UY8A 2ZZ6A 3EXTA 3PY2A 4IY0A 4HPXA 1TREA 3IGXA 1YTKA 3PUDA 2QUTA 2V0TA 2UV7A 3QQ1A 1EA0A 1H7NA 1S3HA 2F7FA 3UPBA 3LRKA 1L6YA 3TC6A 3P82A 1QPNA 2YYUA 3W7IA 2C6QA 2YFOA 1JUBA 1LBLA 4BFAA 1H5YA 2EAWA 1FWWA 4UTLA 2FPTA 2Y85A 3LQNA 3QMSA 3IRDA 3JRKA 4AF0B 1XBVA 3FJ6A 4LV4A 4PCUA 1P5BA 2ZTJA 4AH7A 3M41A 4L4LA 3NNTA 1MEIA 4WD0A 4WUIA 3W71A 3CU2A 2FB2A 3O6YX 2CW6A 2QCNA 4H4IA 1OFAA 5D09A 5I3FA 1AK5A 4OQVA 5FEWA 2NWSA 1OK6A 1JJKA 1SO6A 2NWRA 3TA6A 1VYRA 4R34A 1WAUA 1TSIA 3TXZA 3O05A 4UFJA 4NNAA 1GOXA 3W7PA 1ZFJA 3LXAA 4JIPA 1OYAA 3DFTA 2NYCA 5CZJA 4ML9A 1WOBA 1OX6A 4FF7A 5HR6A 3G8EA 3PR2A 3HIJA 4NUWA 3HPZA 4QSHA 5MHBA 1KTBA 4NXKA 2P10A 3L66A 1W1ZA 1Y0EA 4LVBA 2QCMA 3TQ0A 4DO4A 4UR7A 3WJWA 3OCMA 1NAL1 2R14A 2A7NA 4XKYA 3NQ8A 2WV8A 1EP1A 6ALDA 3M47A 1FDJA 3NQAA 1WA3A 2YZRA 5AOUA 4Y90A 1YPFA 4PCFA 5EY5A 3W75A 3QW4B 4FX8A 2X2GA 5G4WA 2Z2UA 2GJLA 4UMBA 4XWUA 1NFBA 1XDLA 5D30A 5AC7A 3Q58A 3HG2A 1ZENA 1TB3A 2GPTA 3SFKA 3TH6A 4OBTA 4HNUA 1JR1A 1FWSA 2VEMA 1F05A 3AJXA 2EMQA 1SO4A 2DZSA 4CQ8A 2H3DA 1F7BA 1H7RA 4L0DA 5AYZA 3MBDA 3O6DA 1H63A 4IMEA 2WSRA 2YX0A 3MYOA 3UD6A 3CEUA 3L0GA 4MY9A 2QJHA 4GXMA 4IMCA 3R12A 4WZHA 3MYPA 1OYBA 3GZ3A 1MEWA 1JRCA 3G1DA 4N02A 3W7GA 3NQFA 4E38A 3ABSA 1T96A 2Z6JA 1RVGA 3HGOA 3EX1A 2A21A 2JK2A 5F4SA 2NUXA 1QWGA 1RV8A 3OI8A 1JCYA 3NAVA 5IBXA 4AWSA 3KRUA 3S9YA 3TCEA 3CIWA 2R94A 2VFGA 1RR2A 4HSNA 4O15A 2TMDA 3HOJA 2B7PA 1R2TA 2E6AA 3N2XA 5FF0A 1VCGA 3FWSA 3Q94A 2XFWA 2AAMA 3MJYA 1PVMA 5CPNA 1GJPA 1O60A 3P74A 3BLIA 2OMAA 3NPUA 4JTLA 3H53A 1QFEA 4QITA 3EWWA 2CLKA 3MI6A 1KM1A 2PFIA 4S1FA 4M6QA 3LX9A 5CZTA 3W1PA 4CQAA 2HMCA 3W7LA 5K3VA 4Q33A 1GT8A 2DJLA 2Y62A 3VCRA 1IF2A 1KFBA 3IVUA 5DBTA 4D2JA 3QPYA 4JDYA 3RU6A 2QRDE 3OCOA 4X2RA 3TDFA 1LLWA 1Q6RA 1S5TA 1GG1A 4LT9A 5LNSA 3U2OA 2PRLA 3CTLA 1FXQA 5CGQA 3PS7A 3DFNA 5L6UA 2QR1E 2NYEA 3O07A 2E77A 4MUZA 3FJLA 5E0KA 2V5LA 3C61A 5F1UA 4RV8A 3DKLA 2ZTKA 3QFEA 1OVDA 3B03A 4O0ZA 1S5WA 4NT0A 4XUGA 3SR7A 3I65A 2BWGA 4R33A 3BARA 4JTGA 4JS3A 4JTHA 3IVTA 3TQKA 1LRNA 1SSDA 3SI9A 1TJRA 3IIZA 5F2LA 2XN0A 2CZ5A 4Z0JA 3DHFA 3YPIA 4WY0A 3T55A 4I7WA 4NVTA 4UFLA 4HN4A 1NEYA 1UASA 2DP3A 4LVDA 5TIMA 2YPIA 4JR5A 1H60A 3C2RA 4DEFA 5LSMA 1IXQA 1M7PA 2E6YA 3W9ZA 5BNKA 5LNRA 3A22A 5K25C 3LBMA 4ADSA 3KVMA 3L2BA 1TPVA 1PV8A 3S5YA 1GYLA 3GVGA 1LLZA 5I3HA 2X1SA 3UXDA 4TIMA 1R2SA 3RFAA 4JTJA 1H1YA 3LDVA 3PSWA 2GOUA 4XBKA 4M7TA 4ORMA 1VJIA 4K8HA 4N6EA 1YDNA 3PG8A 1K3UA 4RX0A 2YZQA 1ONRA 2RHGA 5H91A 2QCDB 3QEZA 1L2UA 4KFNA 4YLWA 1JCJA 3UY7A 1KV5A 2WNNA 3NZRA 4L28A 3S5ZA 3P81A 4CLMA 1ZJIA 3CHVA 2YW3A 3L31A 4NX5A 4FHAA 3OHIA 2UV5A 3G1YA 1K7FA 3IEBA 1XUZA 2RFGA 4LVAA 3O06A 1LDCA 3W85A 4GFSA 3M0ZA 2OOXE 2WSYA 3IIPA 1W5QA 3C2FA 4BK9A 1O4UA 4I9AA 5HUPA 1DJNA 3CQ0A 3NEVA 4ADUA 1QDSA 3DGRA 5D2TA 4POCA 1WXJA 1LBFA 3GDMA 4FRYA 4JYFA 1GVFA 4X22A 4J9JA 4DPQA 1AW5A 3LHZA 3W2NA 2J6XA 4IOTA 4BI5A 3ATZA 2ZCGA 4P61A 4P2VA 3W1AA 4S2CA 3FFSA 5D33A 2Z1BA 2YW4A 1M7OA 3NM1A 1TPB1 1K02A 1BTMA 4JX4A 4ZQPA 5BMWA 2G95A 3NQGA 3L5LA 4MZ1A 3W74A 3LCGA 2D73A 5BMXA 4LS2A 1KV8A 1H62A 2ATSA 1IXNA 3BG9A 2VFHA 2FFCA 2R8WA 1X1OA 1FY6A 2QJIA 5CG7A 3SGUA 4O0KA 3GIYA 4I7VA 1JCLA 3PC3A 4NQ1A 2Y70A 1XFBA 2Y89A 4R7JA 4O19A 1B4EA 2EF7A 4JTTA 4GNJA 3N9RA 2ZRVA 1VZWA 4X3ZA 5F1VA 1MSSA 3OA3A 2YZIA 2KZHA 3DFPA 1YTDA 4Y8FA 4RK8A 1Z44A 4TU1A 1JQVA 2J88A 2NV2A 1GEQA 2NX1A 3GDKA 5BOOA 2ZBTA 1DOSA 3I68A 1BEUA 3JS3A 4CCDA 4O28A 2RH9A 2H90A 1ZHAA 3HG4A 4NOCA 5IIPA 1QCWA 4IMGA 3SIZA 2GUUA 3I7RA 3R89A 3NL3A 1G6CA 4MY8A 5D04C 3EKLA 3NQMA 2BSLA 3GX9A 4MOZA 3P5ZA 4WJEA 2FPVA 1IIGA 3FLUA 4ZMGA 4UIOA 5T26A 3CLMA 1XM3A 3L21A 2QF7A 3UNDA 2A6LA 4I7UA 3P80A 1RQHA 1GVQA 1IXPA 3PC4A 5DY3A 3RNDA 4MPQA 2DZXA 4IPIA 4NNCA 4MLRA 4YCPA 3DDJA 3JR2A 4U4MA 3W7RA 3NO5A 4HKPA 2C16A 2H8ZA 3O6CA 4CNPA 4WOQA 4LWWA 4XTDA 3GKFA 3BLFA 4N4QA 2RIFA 4ESYB 3WK0A 3W2JA 1VCVA 3RF9A 3QMRA 2QJGA 5HUOA 3UWYA 2GQ8A 2A4AA 3FHMA 1SO3A 2ZA2A 4N9CA 1YXYA 4P1OA 4PL2A 4NJKA 3W3OA 3E0IA 2X30A 3TC7A 3L68A 4YMZA 5LGZA 3W1NA 2VEKA 4YCOA 1AG1O 1RZMA 3F1QA 4NJGA 3M44A 4QJ1A 1SZNA 1YTEA 4M7SA 3PBUA 5FF7A 1FCUA 1F76A 1VQTA 2FJKA 3OVQA 1O5XA 2AGKA 5D32A 3SJ3A 5G1YA 3OIXA 3L0NA 3LLDA 3DAQA 1ME8A 5K9XA 2O7SA 3KPCA 3C6CA 4PTNA 3GLCA 4JTKA 2RKXA 4EOUA 3EWZA 4RXGA 3MHFA 3TK7A 5LHEA 4EWND 4IY4A 5CPLA 5CPOA 3P8IA 3TDHC 3G1HA 1BWKA 1YAVA 3W7CA 1UUOA 3M5XA 4ZQMA 1OG0A 5K2ZA 3DU0A 1LOSA 4GUGA 3PF3A 3U6WA 3K2VA 1G67A 1ZY9A 2E68A 5HWNA 1W54A 3E96A 3NQDA 2W6RA 2WKJA 1WOAA 1VYPX 1ZAIA 4OE7A 3C56A 4MY1A 4DO6A 1FQ0A 2UV8G 1O5KA 5D03A 4GWEA 4N6FA 2ZY9A 4O1CA 4OGZA 1TRDA 3H54A 1OFOA 3P60A 3BLEA 1X7FA 4UTWA 1AW2A 3MHGA 1OX4B 4LVGA 3G1FA 1WYIA 4DBDA 3PBVA 4AHQA 4IMFA 1G4EA 3TX9A 1TPC1 2NX9A 4UMCA 3VKJA 4UC5A 1A50A 3NR0A 3LCHA 5C55A 2C3ZA 3N3MA 3F03K 3BO9A 2QCHA 1Z48A 1BKSA 4HSOA 2A0NA 3W1XA 3STGA 3FWRA 3DFQA 1RD5A 4IGHA 1C9DA 3HO8A 1PHWA 5K7JA 1XCFA 3TW7A 4JYDA 2VENA 2E09A 3FKRA 3G0SA 3G1SA 1H61A 1D3GA 2A5HA 3MO7A 3NQVA 1LCOA 4JEQA 3W07A 1SSGA 5AHFA 2VELA 1KM0A 3PC0A 3PAJA 1YDOA 2QREE 3DFOA 3BGJA 4PODA 3G24A 4KFOA 1JRBA 4ONVA 2A7PA 4A3UA 4GE8A 2P9MA 3FOKA 1FXPA 2HS6A 3VNDA 3TJLA 4YL2A 2WOQA 1DV7A 2UV4A 3G18A 1PCWA 1H51A 3HG3A 1SR9A 1XBZA 2AQWA 1G7VA 1QO5A 3UZ5A 1TV8A 2ISVA 3P7YA 1F5ZA 2YVZA 3B06A 1QAPA 1ZNNA 3P8JA 1LBMA 2CFFA 3CEPA 4GBUA 2A2IA 4N2YA 1KFJA 1ZCOA 5AC6A 4AHOA 3IGUA 3TKFA 3FEMA 1WBHA 1B4KA 2DJXA 3W1TA 4K37A 4Y6GA 1F6PA 4UTUA 3E12A 3LRMA 2F84A 2C13A 3B4UA 1ICQA 1H7WA 3LI0A 1KM5A 3B0UX 2ZRZA 1ADOA 3NL6A 1TCDA 2ATMA 3UWUA 2BXVA 3TE5C 4UCGA 5HMSA 2UV6A 1CI1A 2WNQA 3FYPA 2ZRWA 1AL8A 3KOFA 2ZZ7A 3W7MA 1YYAA 1QO2A 2C19A 2NZLA 3EXSA 4ALDA 1X1ZA 4ZQRA 4FNQA 3A5FA 4AWUA 4O1BA 2G96A 4GUHA 5F2IA 2QRCE 4XKYB 1GPWA 1LORA 4JDBA 3P5YA 2Y6ZA 5CPMA 3KRSA 1J4EA 2VEIA 3HGRA 5AHNA 4KWVA 4P1GA 3CPRA 4QNWA 4RXFA 3DHDA 3HG5A 1R46A 5FEXA 2CLIA 3G8RA 3PG9A 3B05A 4DXVA 4UTMA 4N9EA 3PULA 2JGQA 3TAKA 1G4TA 1TPDA 1KBIA 2QDHA 1G69A 1QOPA 3W6YA 3M1ZA 3PVFA 4UFIA 5AHLA 1TIMA 3C52A 5G4EA 3TSDA 2Q3OA 1TJPA 1JUEA 3DI0A 4JY9A 3L5AA 2ZRUA 3LOTA 1K7EA 4HPJA 3S1VA 1VYSX 4HIBA 1OYCA 4FNRA 4RZ4A 1A5CA 3W88A 1PHQA 2VFDA 4UFKA 3IIOA 3LXCA 3NXFA 1FCVA 2YSWA 3W2MA 2CLMA 5FEPA 3EKZA 5K9DA 3LCXA 3INPA 3LCFA 1PIIA 1EP2A 3BW3A 3NPWA 5HWJA 3VE7A 3UXAA 3NYZA 5EBUA 5KZMA 2PE4A 5DXYA 2Y63A 3EWXA 4N9BA 3NQ2A 3UQNA 4NU7A 5KSWA 5KTLA 3QMTA 4K7YA 4FIQA 4JIQA 1EPXA 1J5TA 1LZOA 2Y7DA 3TAOA 2NUWA 1OFPA 3LTYA 4M6VA 5LNWA 1I2RA 5C54A 2CZDA 3W1MA 2PRMA 3UWWA 4WXZA 4JTFA 4AVFA 3G3MA 1OJXA 2FTPA 3KX6A 3EEGA 2YYTA 3O63A 3W7KA 5LHFA 4MVAA 5I3KA 4L27A 3KH5A 2OX1A 3R8RA 1LM1A 2Y61A 2ALDA 1QPRA 2FB3A 4ZQOA 4X9SA 3C3NA 1KM2A 3MI2A 4A29A 1HTIA 3KVJA 3N2MA 3W2UA 2OCZA 4MJMA 3E9AA 2CLLA 3PUEA 3FIGA 4L4MA 2EHHA 3FKKA 2GVLA 3NVTA 5K9CA 1OFEA 2QCCA 1KM6A 5DCEA 5DCDA 3GXNA 1SUXA 2DORA 1KLYA 3HGJA 4O18A 4XZ9A 3W7EA 2ZZ5A 2ZRXA 3M43A 4UTWC 1HL2A 1HO4A 4K7VA 3N34A 5AN7A 1RQBA 3GR8A 4N9DA 5KINA 4RR4A 3TU9A 1W5OA 4DF0A 3W7QA 1HO1A 2V30A 3C2EA 1SPQA 3S1WA 2X1RA 4XBSA 4ZQCA 1QPOA 2QAFA 4MZ8A 5FF2A 5KS7A 5EKYA 5AFDA 4CCCA 4LS1A 3BW4A 4ZVJA 2WO5A 1TV5A 1VS1A 3GR7A 4DBEA 5AHEA 3B8DA 3MMTA 2V82A 3QSRA 3W83A 2A7RA 3R13A 3CB8A 3TNOA 3SZ8A 4WY0B 3GAKA 3FA5A 4JD4A 3W7NA 1SFJA 1T0OA 1MEHA 4NJHA 4K39A 1P0NA 3UWQA 1I8JA 1VH7A 4UTIA 4AAJA 4L3VA 3GDLA 3BPWA 5EYWA 4Z1DA 3O8AA 3TFCA 4IXXA 3S8HA 1I4NA 3RLVA 4DPPA 1V5XA 1MXSA 2Y7GA 2B4GA 3EWUA 1F6KA 4DO5A 1H7PA 3T78A 4MKNA 1A53A 2C0AA 2Q3RA 1ICSA 4AXKA 3NM3A 1YADA 3DI1A 3T4NC 4MYXA 3EX6A 2A85A 3CM4A 1EUAA 3KVLA 3STCA 1FDZA 3Q2DA 4O8RA 4Z08A 3WK2A 2DZPA 3AO0A 4QAIA 4HNNA 4IQLA 2WNZA 1W0MA 2IQTA 1OX5A 1XDMA 2RDTA 3A23A 1G7UA 3LHTA 4JTSA 4KWWA 3UWVA 3NPVA 1P4CA 3GKAA 1VRDA 2YVXA 5F2GA 3LTPA 1FWRA 2VFEA 5HWMA 1R2RA 2CLFA 4JNMA 3S0CA 1W5MA 3TQVA 3KPDA 1KTCA 1PVNA 1GWJA 2B7NA 3KHJA 3TMQA 3HPSA 4BI7A 1QPQA 2DZWA 3LV9A 2ZZ4A 3O16A 1WQ5A 4EVZA 1T99A 1IXOA 1LP6A 1W3TA 4FXRA 1TV7A 3W1LA 4EIVA 1TPFA 3L2IA 3M6YA 4LY8A 3W1UA 5AB3A 1ALDA 3W7OA 1ME9A 5HJLA 3P84A 5MMZA 1E51A 1DVJA 3S1UA 1O94A 4BWLA 2E6FA 2EF9A 4ADTA 2C1HA 2OZ0A 3HPXA 4M6PA 1UUMA 3C2VA 3MBFA 5HQEA 1SU5A 4TMBA 4O57A 3WJZA 3DXIA 1EEPA 3UZJA 1SFLA 2H3BA 3BW2A 1SQ7A 1SW3A 3RLUA 3GAYA 3TV8A 1KM3A 2A6NA 3N14A 5L9FA 2RDUA 3THAA
chains in the Genus database with same CATH superfamily
3A9IA 5FESA 1IYXA 1VIZA 4IM4A 3ARZA 3SY5A 3WK1A 3HMCA 1EFZA 2J9XA 2PGWA 1TJ1A 4KKXA 3FJNA 4QRNA 5LIWX 1W56A 2ANUA 2ZA1A 4HNTA 3ZT6A 3SCRA 1F2JA 4JGDA 4EPBC 4MFDA 1TR9A 1JULA 1WBJA 3BAWA 2YJQA 4HGXA 3AIQA 3WELA 2XSBA 4UUIA 1W1TA 5AVHA 3T40A 4GUFA 1V02A 3UGVA 3DC0A 3NA8A 4IL0A 2Q8XA 3H4WA 3S2NA 3SB0A 1JDEA 1BYCA 1F4AA 1MFUA 4TXEA 4AWEA 2UY4A 1J10A 2ZXAA 2WSPA 2I14A 2PDQA 2CWNA 1TVPA 3DKJA 2ZDSA 5I02A 5GNXA 3GNOA 3LXBA 4KIRA 3GU9A 4ZO6A 2EKCA 3H23A 2WHJA 1CIUA 3GZAA 1XLAA 2XTKA 4D1IA 5D2WA 5C6MA 2J78A 1SMAA 3GDTA 1O12A 3P67A 1OHLA 4K3ZA 1LOQA 3LFZA 2IPWA 2GVEA 5E6YA 3S2JA 2QCFA 1AL7A 1D2KA 1XUUA 1GVIA 2WHMA 4X60A 1O95A 3UJSA 1FWGC 3NQ6A 5EMUA 4AYSA 2DZAA 1AMKA 1SJAA 3EX3A 4XTIA 2PC4A 2IPGA 2OT0A 5D2XA 3BLLA 3MUXA 3O15A 1KTNA 3WNLA 1BXCA 4ZL1A 3S83A 3WLSA 2L5HA 3VIHA 3W86A 1YDVA 4WY0F 1FWAC 5BRBA 2FKPA 4LH8A 3MUY1 3QC3A 2KX9A 2GDVA 2V63A 1TTIA 1BG9A 2CITA 4S3GA 2FGBA 3VCNA 4XX6A 5EMJA 4N7QA 2GLKA 4XK2A 2DSUA 3DFSA 5EPDA 1EWDA 3BV4A 4C1LA 3H26A 5CKSA 1PS9A 3I7SA 3AIWA 1VLIA 3EMQA 4ZO7A 4MZYA 4IL2A 4RJEA 1IWAA 1XKFA 3OVRA 1BVWA 5F4WA 1HJXA 1LROA 5DBUA 2WWDA 3LN3A 4K8EA 1VEPA 3NO3A 3AYVA 2HBVA 5I3IA 3LPFA 2TRSA 4O9KA 2WBGA 1CWYA 5G2HA 1CGTA 1ISYA 2VKZG 3MANA 4ZQNA 4NZ3A 4BJHA 2XN1A 1UYQA 1RK6A 1P7TA 2GSEA 3NQEA 5LZLA 4WKAA 2Z7GA 3KBNA 2DIKA 1K8YA 3FV6A 3FNDA 1OADA 2Z6IA 5M17A 2DZVA 2RJHA 4ZB2A 2HRWA 1W5NA 1OFDA 2GGHA 4KF1A 4X63A 1B54A 2ZUWA 1V6XA 4IWWA 4GYKA 5DMNA 3SSZA 3TEVA 3BL3A 3KWXA 4HPHA 2QLVC 1XYAA 3AXIA 3U8GA 2XH7A 1AVAA 1QNPA 2QUMA 3ZSSA 5A69A 3GDBA 1V3IA 3QSTA 3QW3A 5LKYA 4KCUA 4RL3A 5U7SA 3AMKA 1EGVA 1XBXA 2DY3A 3AZSA 2HXTA 4PUMA 1D3CA 4LF2A 4QAWA 1EOKA 4W8AA 4UTKA 2XGZA 1Q66A 2PRHA 1O50A 4GVIA 3AHYA 3KRBA 4V27A 4AG0A 3CZKA 4C6JA 3ES7A 2FLIA 1EZWA 3TN5A 3WLOA 3KFTA 1W9XA 5K24C 4FMVA 2GWNA 1IGSA 1J2BA 4AEEA 4JNZA 5AKQA 2DFAA 1PKLA 4R9OA 4S2BA 3RMJA 1Z42A 1XIFA 4PH6A 1KA9F 2ISFA 4AD3A 1K7XA 3UYCA 4KGLA 4E4PA 1SW0A 3AFBA 3HBLA 4BF9A 3D47A 3R58A 3GC5A 1XLFA 3P61A 1PB0A 1QATA 3HU7A 1LQ2A 2OWCA 4ZA0A 2YXGA 3AIEA 3GH7A 2V2DA 1I2NA 1OEPA 2YA2A 1TWSA 4RDWA 3PSVA 1MDLA 4Q7BA 3TW9A 1NOWA 1C90A 1X6UA 4PEKA 2HE8A 3L2LA 2VEPA 1QOQA 5EA9A 2PI6A 5D9PA 3RX2A 4W4QA 4M3PA 1DQXA 4RZ5A 4D71A 4Z2HA 1TMQA 3OGRA 4B4HA 3SQLA 4E5TA 5DN1A 4NJIA 1QU4A 3B0VC 1WP6A 3Q45A 1GOOA 3CJPA 3GO2A 4MYAA 4UTTA 2OJPA 4U5IA 3DN5A 1AQFA 3SW6A 5H2ZA 1J01A 3V7PA 3LHUA 1VP5A 1MXDA 1E1CB 3MUIA 2NQHA 3S5OA 1B3YA 3K4AA 3ITVA 4NX0A 2PLJA 5C7VA 5T9BG 1L6SA 4FX6M 3WDHA 1EUNA 3MPGA 3ZWTA 3AISA 3DYPA 1Q6QA 1XHGA 3F7JA 1VPQA 2C1GA 2OELA 3P14A 1TRIA 1F73A 2BVWA 3FYOA 3H2NA 3HJZA 3IVSA 1CLKA 2NSOA 2CLHA 4NAEB 1TX0A 4ACZB 4D1JA 1C29A 3GFXA 3VMNA 3OLGA 2VI0A 3TROA 1C3FA 4GI9A 1CW2A 4KEZA 2JKEA 1ZBVA 2WMFA 1XQKA 1XYZA 3E02A 3NL5A 4PZVA 4CQ9A 3HMJG 4CVWA 3PZVA 3WFLA 2PDFA 2Y8UA 1GYNA 1DXFA 2PLMA 3NPXA 3VOGA 1Q6LA 5HNNA 3M7WA 3STEA 4FZIA 1H1NA 4N4PA 1HP5A 4RKAA 3W38A 3HB9A 2XVNA 1CX9A 4OUIA 1NSJA 4A22A 2YR1A 3T44A 2GJXA 1A5BA 3N4FA 4BZYA 1WKFA 2NVAA 3RR1A 5CSSA 2XH4A 1GG0A 5BXSA 1EJSC 1J18A 4JFUA 3A64A 1B9ZA 4H00A 1ME7A 1GQNA 4HCDA 1XXXA 1KKOA 3MMDA 1ZS2A 3C0SA 4JICA 3H2AA 3V75A 4GKTA 3CZLA 2G97A 4W9TA 4ZTXA 3C2OA 1ZBWA 3RPMA 1V79A 4RNHA 3ZO9A 3WQWA 3P6LA 5D38A 4E8DA 1RY0A 1Q3NA 2GVGA 3MWAA 1Y5HA 3WEZA 1FKXA 4GX9A 1JF6A 2GFTA 3VNKA 1QNQA 3C0LA 2DIJA 4LUSA 4Z0SA 1IIHA 2V5BA 3BMWA 3S6DA 4E0CA 1OCBA 1VBHA 3DYOA 1EEXA 1W2PA 1HJQA 3MUAA 4FLOA 2QV4A 3PN8A 1UD6A 2R6OA 3JVAA 4UQBA 5A2CA 3SL7A 1F3WA 3UJFA 4KRUA 1DWHM 5SWUA 4ZGYA 3L5MA 4JTQA 3K2GA 3TW6A 3RJXA 2INFA 4YTSA 1KRCC 3E2VA 4UTFA 1DIKA 4Y9NA 5B7ZA 3CC1A 1GVRA 4IUOA 4A2SA 1W1IE 3AWOA 4DAFA 4M0XA 1KXQA 3MMWA 3EPNA 3HTWA 1NDVA 2V2CA 4ZBCA 4C7GA 3HQ1A 1US2A 3LCWA 4CCEA 2C7FA 1F8MA 4ZE5A 4MPKA 1JPKA 1Q6OA 3ATYA 3PBYA 4WR3A 5F4XA 1ECQA 1XINA 3N4EA 1E5NA 4L64A 4AZ5A 1RPXA 2V8ZA 5DRIA 3ARUA 1Q7QA 1MW1A 4WX2A 2VC6A 1OWQA 1OSEA 2ZYFA 4JFTA 4PTDA 3VDHA 3VIGA 3EMZA 2CNCA 2ADAA 2D2OA 1W37A 2RDWA 2ZADA 3FHQA 1L8PA 2F61A 4CNOA 1JZ8A 3TSMA 5FSEC 2YKKA 1TPWA 1XKJA 1KFCA 2FZ9A 2GJPA 2XIQA 2FZNA 2G50A 1CNVA 4HD5A 1C91A 4C6LA 4EF9A 4AWTA 1WNOA 4G5DA 1MO0A 3WUGA 2GDQA 5AYIA 1XC6A 3PP7A 2ZZ2A 2DQWA 3FX4A 4MIMA 3VM7A 3T2QA 1KGUA 2VRJA 4YTTA 4MHBA 3WNPA 3U2CA 2P0OA 3V35A 1VLWA 2CZVA 1H1ZA 1UZ1A 4GCXA 4WGHA 3PJXA 4L1XA 4G2DA 1QWKA 5A94A 5EBAA 3S9ZA 3A9BA 5ABFB 3LV5A 3ARQA 1N55A 3KAOA 2OB3A 4NASA 1ZAJA 4A2RA 4B91A 1GQKA 4NZ5A 3EXTA 4IY0A 3T42A 4ILSA 3N9KA 1GPFA 3L4YA 1H7NA 4HB7A 1LWJA 3TC6A 3RG6A 1T5AA 2YYUA 3W7IA 4V28A 3RLHA 4FLRA 3KL5A 3LQNA 3CIVA 2VEFA 2ONEA 1TWDA 4AF0B 4DNHA 2XG9A 5DEZA 4PCUA 1Y8BA 1YKWA 4TX6A 3CU2A 2FB2A 1UW9A 2OLHA 4H4IA 5I3FA 2DT0A 4XVDA 4OQVA 1PTAA 5FEWA 1LF1A 4DI8A 2QDDA 3K13A 3TA6A 3K1GA 1CTNA 3MV01 1BVZA 3ZVHB 1WAUA 2PD9A 1UWIA 3O05A 1GHRA 1ZFJA 3BAKA 3ZR5A 2CIPA 4H9VA 2NQZA 4M1BA 3HIJA 1HZYA 3MWCA 4JQ2A 4LALA 4L56A 1KTBA 5DMLA 1F4HA 2P10A 4XBJA 1W1ZA 4D9PA 2YIHA 3PWGA 1F3EA 2EBNA 3OCMA 2R14A 3WJWA 2A7NA 2WV8A 4GA8A 5CC3A 1JXJA 1FDJA 5EMLA 1FRBA 2YZRA 4PCFA 3WF3A 5EY5A 2X2GA 2Z28A 4XZMX 2Z2UA 2FJUB 1JYXA 2GSJA 1XDLA 1RHCA 1UA7A 3BOFA 3QV6A 3UZWA 4PCSA 1LL6A 3H2OA 4HYRA 3SFKA 2BP1A 4HNUA 4PFHA 1FWSA 3LK6A 2EPMX 1Y5VA 3E0FA 2DZSA 4CQ8A 3DEQA 2YL9A 5M1TA 1U30A 3PFMA 3O6DA 2PLKA 4IMEA 1UPMB 4UQAA 3CEUA 3L0GA 4GXMA 1OYBA 1YQ2A 2OODA 1JRCA 4E38A 3E2QA 3ABSA 3C5QA 3HGOA 1TWWA 2A21A 1D7FA 8CGTA 2UY2A 4CNUA 3SN1A 3REQB 4AWSA 3KRUA 4C6PA 2R94A 4OJYA 4HSNA 2E6AA 3CMFA 4OFCA 3N2XA 1XRVA 1VCGA 3FWSA 2PTWA 3Q94A 3VIMA 5IXEA 3MJYA 5E09A 1GJPA 3P74A 3BLIA 1WKEA 4JIIX 4QITA 1OC6A 4AQLA 3NZQA 1CCWB 2V3DA 4J28A 1O1ZA 5LA2A 1KM1A 2QJJA 5EMMA 3UFYA 1K6WA 3GC4A 2DDXA 5HQMA 4Q33A 3BC9A 3FA4A 3PJTA 1TZ7A 4AIOA 1KFBA 1QJWA 3IVUA 5DBTA 3R0UA 2Y8KA 2QRDE 2XIIA 3IJ8A 3T0DA 4D6CA 3VFCA 3ARVA 3CXOA 1GOWA 1M65A 2NLYA 1S5TA 4XZWA 1X7IA 1IEXA 4J35A 2J66A 4J7RA 3ZIZA 2HPIA 5CGQA 3MZNA 4TV5A 1F9CA 2WK2A 2E77A 3C61A 5C70A 5XIAA 2BXZA 2DSZA 2PUZA 4H6RA 1OVDA 1Q6FA 4XUGA 5KETA 3I65A 4B15A 3RPTA 4A8LA 4R33A 4JTGA 5E9AA 1IWBA 2VNCA 1V51A 3B3DA 1ELSA 4IFOA 3IIZA 2CZ5A 2WZMA 3DHFA 3EKGA 3BLDA 3YPIA 2IKJA 4NVTA 4A8NA 3W37A 1NEYA 3H70A 1GUVA 1EC7A 2Z00A 2OX4A 4LVDA 2IMRA 4IQEA 3TTQA 1H60A 1FWDC 1M7PA 2ZXDA 1LL4A 3PPHA 3A22A 4GQ0A 3T09A 3LBMA 5HNTA 1H49A 1JFHA 3LNMA 3RIKA 4IIBA 1GONA 1V6UA 4A35A 3GVGA 2VURA 3SCSA 3QY8A 5I3HA 3CZ8A 3FK4A 4I9MA 1E15A 1J8VA 4KT2A 3LEPA 3LDVA 2GOUA 2XFRA 3PPCA 3LY0A 3AUOA 2XVLA 3AHTA 3KOZA 3VIIA 4K8HA 3WYZA 1HF6A 3PG8A 1K3UA 4A3YA 2YZQA 1ONRA 1Q6EA 1UD4A 4KFNA 4PR4A 1JCJA 1KV5A 4DYJA 3P81A 1FWJC 1IV8A 3CHVA 4JKKA 4DO7A 2YW3A 4FHAA 7ODCA 1K7FA 1XUZA 3IEBA 4JCLA 1KCZA 4NI3A 1TCMA 5DFAA 3W85A 2AKMA 4RE0A 5CAHA 4MKVA 3AIVA 5D8WA 4G8TA 2X8RA 4MWAA 2ZUTA 4F0LA 1DJNA 3CQ0A 6REQA 1WUFA 2QVHA 4JPGA 2RDXA 2ZXBA 3DGRA 5D2TA 4GX8A 2D23A 3VGEA 3GDMA 4PGLA 4FRYA 3L4UA 4J9JA 1F3TA 2HISA 4ECLA 4BI5A 2ZCGA 3SUTA 1RH9A 4S2CA 1V3JA 2YCLB 1EJTC 3A3HA 4JX4A 2YB1A 4DI9A 3A6OA 1NFGA 1H62A 2FFCA 3FSTA 2R8WA 4EWJA 2ZC8A 2QJIA 3HA1A 4EAYA 3SGUA 4O0KA 3PPFA 2Y70A 4QS6A 4R7JA 3COTA 3TN4A 1XRFA 2BNJA 4JTTA 4GNJA 2YXXA 4W93A 2ZRVA 4X3ZA 2OVLA 2PDKA 1MSSA 1MFVA 5F1VA 1U1HA 2PTDA 1YTDA 4Y8FA 4RK8A 4RZBA 4CD7A 4R9XA 3D3AA 1GJUA 4B90A 4CUCA 3BH4A 3I68A 1MQPA 4CCDA 4O28A 2PU0A 2H90A 5HMDA 1X6NA 5FJOA 3SIZA 1E6QM 1M01A 2CBIA 3POCA 1U22A 3ES8A 1XLKA 5D04C 4WEVX 2WLZA 2ZVIA 4J5NA 2FPVA 1U1JA 4UIOA 5EU9A 4P7QA 3L21A 2FDMA 5IHSA 2ZC1A 2QF7A 3WBXA 4GVFA 2PDIA 3P80A 1BTCA 1RQHA 7TAAA 3PZMA 1GHSA 3CGTA 4IPIA 1G01A 1XGEA 1DWFM 3NO5A 1W1YA 4HKPA 4CNPA 2D24A 3OBEA 4XTDA 2QIIA 4N4QA 4IFRA 4QJ3B 1UKOA 4YNGA 3RF9A 5HUOA 6A3HA 5C71A 2A4AA 3FHMA 1ZGDA 2ZA2A 4N9CA 4NJKA 3GU1A 3L68A 4YMZA 5LGZA 5C9RA 4BS0A 5KEZA 2VEKA 3TA9A 1RZMA 4H41A 3F1QA 3ARXA 3M44A 1E4IA 3SM0A 1YTEA 4PUNA 2CWXA 4Q4QA 1X97A 3RRAA 2HK1A 3BJFA 3SJ3A 3WDRA 3OVGA 4X61A 4MB4A 1UP0A 2D0FA 1TZ9A 4FK9A 4B5WA 1XLJA 4PUUA 3KP1A 3CAVA 4LAKA 4RXGA 3TK7A 2IQDA 5LHEA 3S6OA 4ZXOA 3DESA 3G1HA 1YAVA 2XVPA 5K2ZA 3EDJA 3DU0A 2PWFA 1OT2A 4XIAA 2VDGA 3NQDA 2W92A 4XZHA 3AALA 4MY1A 1B1YA 1L6GA 4DWSD 3LSBA 4S23A 2BS9A 3VK5A 4O1CA 3H54A 1G94A 4KCWA 1UWUA 3K1DA 3MHGA 1OX4B 1JFXA 3WQ8A 4DJFA 4NILA 1K6AA 4DBDA 1UZHA 4JNYA 3PBVA 3NCOA 2FMNA 3A12A 4YIWA 1TPC1 3V16A 4UC5A 1A50A 5EFFA 1MDRA 4AW7A 4TOQA 3LCHA 4HZ6A 1POKA 2C3ZA 3N3MA 3F03K 4DBWA 5TF0A 1M9HA 5GNYA 3DFQA 1E6PA 1RD5A 3D3FA 4IGHA 4J4KA 1PHWA 1G9HA 5DANA 1A5OC 4Q8NA 2E09A 3G0SA 3G1SA 3KOYA 3EA2A 3NQVA 1LCOA 4JEQA 3W07A 1KM0A 2VWTA 2JF6A 5CBJA 4JZ5A 3LLXA 3GVWA 1XRSA 4U10A 2Y5EA 1XLCA 1WO2A 4P8XA 4GE8A 4RPQA 1KCLA 2HJPA 2HS6A 3TJLA 5E0FA 1BSLA 5BWFA 1VFTA 1SR9A 2W3ZA 4IP5A 1AQ0A 3UZ5A 4U33A 1V02E 1X8CA 1R3SA 3GFZA 1QAPA 1ZNNA 3WLLA 4Q8UA 1LBMA 2V3GA 2YOCA 4AHOA 2ALRA 4QEHA 4L6OA 1H4PA 3W1TA 1F6PA 4UTUA 4UOJA 3E12A 1BSIA 2G41A 2Q01A 2B81A 4B9ZA 1H7WA 3TLQA 5AC4A 5J04A 1ADOA 1TCDA 2QT3A 3TE5C 3APGA 1UJQA 4KETA 4UCGA 3FYPA 2ZRWA 4NIRA 3C3UA 3M0XA 5HXMA 1UH4A 3GNPA 2ZZ7A 2D20A 4PE8A 1IWPA 4ALDA 1X1ZA 1V6YA 4FNQA 5F2IA 2QRCE 3VIOA 1LORA 4OBRA 1TV4A 2YCJA 3P5YA 4B5SA 5HDRA 4GY0A 1LUCB 2VEIA 3HGRA 3UERA 4P1GA 3VVGA 1R46A 5FJPA 3OGVA 4DXVA 2FVLA 3SCVA 1TKKA 3VDGA 2WZEA 2GWGA 2WZIA 1YBQB 1XIMA 1TPDA 3GH4A 2QDHA 5EMYA 4UFIA 1TIMA 4HU3A 2X05A 5BROA 1JUEA 3DI0A 1DWGM 4REQB 1VYSX 4UBPC 4RZ4A 4EKJA 1BQCA 4UFKA 5BOEA 3H22A 3IIOA 3LXCA 3NXFA 4DYKA 5XINA 3IUIA 2Y0FA 3PK7A 3LGGA 1PIIA 3BW3A 3DOPA 5HWJA 3H7RA 1WDSA 1S2AA 3GG7A 4NYUA 5JUVA 2V69A 3ARTA 3VIFA 2Y63A 2XH2A 1O5RA 5EB8A 4NU7A 5KSWA 3VILA 5KTLA 1M3UA 4IIDA 2Y5JA 3LTYA 3RCMA 1JD7A 2YDSA 5GNZA 4JTFA 4AVFA 3G3MA 1OJXA 1BG4A 3FXGA 4GJJA 1QI2A 4MVAA 4L27A 2AKZA 3KH5A 4R3UA 3TC3A 3DC8A 1QNSA 1A4LA 2FB3A 4ZQOA 3C3NA 4OOUA 3KVJA 3KDNA 1YNYA 1OINA 2OCZA 3ECQA 3I3BA 4H9XA 2NQ9A 4V1YA 3EOUA 2VZOA 3GG8A 4F2TA 3NVTA 5K9CA 5DCDA 1SUXA 3AHZA 2OFJA 1UQZA 1CBGA 4UTWC 1HL2A 3BGAA 5A8MA 3O2LA 3VINA 2E9LA 4RR4A 1E3ZA 3W7QA 4DF0A 2X09A 2V30A 1SPQA 3DGBA 2X1RA 4XBSA 1QPOA 1J96A 1S2VA 2QAFA 5FF2A 5KS7A 1H0IA 2ZVRA 5DT5A 4CCCA 3BSHA 4HBKA 2PWUA 2XSAA 3BQ5A 1HW6A 3GR7A 3B8DA 3MMTA 2V82A 1V0LA 3W83A 2A7RA 3R13A 3EA1A 1B5TA 4WY0B 1FHDA 3QZ6A 4JD4A 3T1GA 1T0OA 4J27A 4GH1A 3UWQA 1CGXA 3TTYA 4LYQA 4L3VA 3APYA 3GDLA 2G4JA 3KWSA 3O8AA 5ECVA 3TFCA 4IXXA 3S8HA 3BTNA 4MNMA 2B4GA 3EWUA 1H7PA 4MKNA 4DWSA 2D22A 2Q3RA 3VIPA 3CQIA 1WE5A 1MWOA 5C9XA 2WMGA 4ERAA 5CJ5A 3SY1A 4YYFA 1EUAA 3STCA 3Q2DA 4HP5A 3GHUA 4DUOA 1W1VA 4GO8A 3OLEA 1R3YA 5LXXA 4NRRA 1XIHA 2WNZA 2IQTA 3A23A 1XDMA 4JTSA 3W82A 5HBFA 3LHTA 1ZLPA 5FAJA 2YVXA 5F2GA 4FOJA 4ZODA 4AZCB 1V77A 2VFEA 3WNKA 4JNMA 4F9DA 3KOXA 1PVNA 4IMAA 1EH9A 4J3VA 3HPSA 3SGGA 4I6KA 5BYWA 4BI7A 5CQ1A 1RBAA 1Q8JA 4PMOA 3JZEA 3O16A 5CXPA 2E28A 3R7MA 3RLGA 3RN6A 1HJUA 1NU5A 3CT2A 1W3TA 4GKLA 3KS5A 4YWSA 4FXRA 4Q4SA 1TV7A 3W1LA 4G6CA 1JDAA 1XIEA 6CGTA 3L2IA 5CLTA 4LY8A 3W1UA 2DSWA 1Z6KA 3QKZA 4M6UA 3P84A 5MMZA 2VRQA 3SEPA 1UD5A 4KCVA 2JQXA 1O94A 3P0WA 4LUTA 3V0UA 4BWLA 4FPSA 2CXEA 2EF9A 3KZPA 3KBVA 2HV5A 1RP9A 3JW7A 1GJWA 3HPXA 1IGWA 1H09A 2C71A 1SU5A 3DXIA 1JF5A 1B90A 4CVUA 1VFFA 3O0FA 2PDCA 4F0SA 1HKKA 4IJCA 4UOZA 2RDUA 3SUVA 1PSCA 3THAA 3DG6A 5FL1A 2YB4A 3MDWA 4GISA 2E5BA 1M03A 2DIEA 3TYDA 1ZTVA 2PDHA 2ISWA 2XM2A 3NZPA 2E67A 7ENLA 1KGXA 4C60A 3GIPA 3OO2A 3WG6A 3TJIA 1DKWA 3APTA 3BAYA 4LRTA 1EWEA 2OR2A 1PBJA 3H2MA 1DE6A 4M1RA 3QJAA 2V81A 2BHYA 1HP4A 2ZUNA 3H2EA 5HAOA 1F07A 3CK5A 2EPHA 4O12A 1E6ZA 2NUYA 4BCEA 1GTEA 3UPWA 1J5SA 2X41A 1TTPA 3GRIA 4XUYA 3XIMA 1C93A 2D0GA 1XW8A 2IUZA 2EPOA 3LRLA 1E6XM 2G3JA 1LT7A 4QFUA 2X1IA 1VGAA 4KRZA 1OD8A 2FHCA 4MNJA 4RW5A 4B5UA 2FQIA 3FNAA 2J9YA 4HZ8A 2PDNA 4QJ4B 5LIXX 3WMBA 2F6UA 3UR8A 2FIQA 4D6JA 2HVOA 3M5YA 4U28A 2PF8A 4WDWA 1E0WA 1SR0A 1HNYA 1I0DA 1T8QA 3TE9A 1FUYA 2OXNA 3GS6A 1BLIA 1MYRA 4GQYA 1W8SA 1PKNA 5CGTA 2XSXA 1VBJA 4JTEA 1ISVA 1GZGA 3UCDA 3LHHA 1VJSA 4HQVA 3KM8A 3RK8A 1ONEA 4ICNA 4C65A 4AZBA 3KVKA 1RBOB 3NZ1A 2R82A 3ARSA 2VFIA 1XJBA 3WF1A 2QVNA 5LGXA 3W01A 1UR0A 4GG9A 1EO5A 4NAFA 3W23A 4Z2JA 2ZWYA 3ABRA 1Q6GA 2ACRA 4FI4A 1EIBA 1P0KA 4OV4A 2J7EA 4B5NA 3EX2A 4NZJA 4UNLA 1R30A 2UY3A 4LPCA 1MNZA 4WRHA 1OM0A 4JAWA 3MSYA 3KPBA 3UG3A 4O11A 3NOEA 3HF3A 1WDWA 4LRSA 4DM1A 3UVIA 5M2FX 5I5RA 2WVSA 1R9XA 1T8XA 2EXOA 1I2OA 3EGJA 4BR1A 5DX7A 4DF2A 5C8BB 2W63A 2OLSA 1OBAA 4AEOA 5A6BD 3K8MA 1KRMA 4GQWA 3SCUA 1EDQA 3W2LA 3STPA 3ME3A 1AJZA 3G0XA 4OKDA 1VENA 4XQ6A 3MW7A 3IJDA 4OVXA 5AHIA 1JNEA 1U83A 4O0QA 1MW2A 5I7GA 1DJYA 1JI2A 4CD4A 2ISSA 5T8GA 1PIGA 1QI0A 2FZMA 1FCQA 2XZ9A 1DIDA 1GK8A 1WDQA 2VVSA 3CAKA 5CJNA 1F74A 1KR0A 3U0HA 1RCXB 1DORA 3S5SA 4CN4A 3M0JA 5AC8A 1R86A 3DECA 2UBPC 3AZTA 4PCPA 3M07A 3GBDA 2MNRA 3ZFHA 4ZB5A 1QTWA 3GXTA 4INFA 4CD8A 5K4XA 4QM1A 3B0YA 4O14A 5AYYA 3ONCA 1CGVA 3PUOA 1W1A1 2GQAA 3E2SA 3QH2A 1J11A 3AWNA 3WDQA 5CJMA 4H83A 3Q37A 5LNUA 2D1ZA 3EYPA 4LB3A 1R38A 3U4FA 1KBKA 3NQCA 4O13A 3W26A 4DJEC 5CCZA 2X42A 2VOTA 2INEA 1UOZA 3A4WA 2WHLA 1DJHA 2QF8A 1AJ2A 2ZDRA 2QLYA 1CENA 1A3HA 3V0TA 4LOCA 2FZBA 5H6HA 3VNIA 2PGRA 3TNBA 4HHPA 4LEFA 1UIOA 1J0JA 4XV0A 1I45A 2PP1A 1NP2A 3B0XA 4QXIA 2WQPA 1LRQA 1BWLA 2VEGA 4JN6A 4GACA 2WYSA 4H6QA 1VFMA 1TO3A 1TYGA 1B3WA 3FGCA 2D3LA 3KHDA 3GTIA 4QLKA 3NL2A 2RC3A 1DQWA 1TQXA 3LPOA 4FNSA 2HEJA 2J9ZA 3VD4A 3H8AA 4HCLA 1I6NA 3PJUA 4R85A 2YA0A 3LTSA 1CGUA 2VC5A 4R53A 3CHCA 3EOLA 1LYXA 3GYEA 3UBPC 2Z0IA 2Z1SA 3BOXA 5G4HC 3WF0A 2E5DA 3E6EA 3D0CA 1GNXA 3SBFA 3R94A 3D46A 5TBOA 1PX3A 5BXTA 1QUMA 1OCQA 4KCTA 1QRQA 3CWNA 1KFKA 3B40A 3LENA 4EPDC 1GZ1A 4FOUA 4LTSA 3LV6A 4ORIA 1QMLA 3N9SA 3OQ8A 3ZS4A 4O53A 4DQWA 3VKAA 4LW7A 5J5DA 1YPXA 4KPLA 2YVYA 3MZ2A 4DB7A 1ISXA 4LYKA 4ROPA 1Z8AA 3RYSA 3KBJA 4LUJA 1UWTA 4FS9A 2F2KA 3EXRA 4RCXA 3TFXA 3H55A 4RNIA 2PDYA 2OSXA 2Z2BA 2NQJA 2QCDA 3VC5A 1WX0A 3F4DA 5TD4A 5D02A 5FF3A 3S2LA 4RE2A 1OCNA 3VIKA 1H11A 3OEXA 3L0KA 4HHMA 4JTUA 2QNEA 4K38A 2WZTA 2V5CA 4IJBA 3B04A 4GNKB 3W22A 3ICJA 3CV2A 4PMQA 3RM9A 3HV9A 4DZAA 1ZALA 3DG7A 4LAMA 4Y96A 1HJVA 4Y2WA 2ZQ0A 3WH5A 2DVTA 1UZDA 2I9UA 1AQHA 1VKFA 3W7HA 3M0KA 1D8WA 3M16A 1REQA 4O4VA 3B9EA 1S5MA 2PTYA 5DF0A 3NGJA 2BVYA 4QP0A 3RM4A 3EB2A 3QRHA 4QGCA 1R87A 1PCKA 2WC7A 1KO0A 3QXBA 2J79A 2NXHA 5K22B 5KZEA 3MVTA 1PZ3A 4UFHA 3WK3A 5JIWA 4EAMA 5I3JA 5A8PA 4YVPA 3USZA 2WVVB 3M5VA 4GQVA 4E2DA 3BG5A 2VZUA 4RW3A 1GQJA 3MP5A 1UR9A 1TIWA 5M3WA 3TYUA 1IT0A 2V9DA 1IZJA 5AHMA 1R47A 3NG3A 4IX2A 4I5UA 2HDJA 5BXPA 5FEZA 3B8IA 4O1DA 1I60A 3N17A 4WJXA 4YN5A 1HT6A 1NY1A 1XL9A 3MDUA 2J8FA 2WJEA 2QYGA 1XI3A 5FIPA 4IG2B 3GG1A 1NDWA 1V4YA 3LUTA 1CXEA 3B8VA 1TE6A 4OTKA 1Z32X 3LHVA 4QDPA 3WUFA 2PBGA 3ZJ6A 1FWNA 4JYEA 3ZVIA 2OOFA 4MJ2A 2GOKA 1JCXA 4PSRA 5BU6A 2WM1A 1E0UA 4BQ5A 4V1XA 1WPCA 1DWJM 1XD0A 1VHCA 1RJPA 4FXSA 4CNNA 5GJPA 3AU6A 1EP3A 1PBGA 1OC7A 4MAZA 2JIWA 2WJZA 5C2XA 1TV2A 2Y7EA 5FF4A 1L2QA 2EPNA 4ZB0A 1PE1A 3DX5A 1VR6A 4WQ6A 3T9PA 4US6A 2QW5A 1ADSA 1AZ1A 2E1DA 4FNPA 3V5FA 1Y65A 3IRSA 4CN6A 4BA0A 2P88A 3WD3A 3TUUA 3LGEA 3HF7A 2X16A 3T8LA 3LHYA 3ORGA 1AH4A 3EWCA 3FXYA 1FDYA 3ITTA 1QW7A 4TX8A 4WDTA 3V1PA 2OYMA 1XLLA 2JGYA 1YXDA 3VAVA 4Z42C 4O54A 1YE6A 1K03A 1EDTA 3BLOA 5DXXA 1Z41A 4WGXA 4HNCA 2EKGA 3W7JA 3R79A 4HNVA 5AYXA 2HK0A 3THQA 1QI5A 1UWAA 3QQ0A 3UXIA 1BFNA 2P1FA 1DQUA 3SRDA 1DP0A 1W3LA 4UTTC 4P5UA 1PYMA 4XD6A 3IIVA 1ML1A 3OW1A 2OOYE 4FOKA 1TPUA 4WOZA 5LA0A 1QHPA 3HPFA 2X40A 1M7JA 4YXGA 2AL2A 1NF0A 4QBXA 1VF8A 2YGYA 2ZRYA 1RXOB 1SZFA 3U48A 2EG8A 4MWAE 5KMYA 4MDPA 4RDYA 2VR2A 4J40A 2ZUSA 2GGGA 2BLEA 3E49A 3QV7A 3EX4A 3IJ9A 2VL4A 2VGFA 1UC5A 4LYRA 3TN6A 5DMMA 3EWYA 4ZEPA 2FVMA 4IX0A 3AMLA 5FJIA 4JY8A 2EEXA 2B7OA 4QIUA 1EX5A 3RGTA 1JPIA 1L9WA 1JCMP 4BHYA 2NX3A 4Q6XA 4CQCA 1DL3A 2CHNA 3DBPA 3EMCA 1S2WA 1TMHA 2PURA 4Q4KA 4TQTA 5G5IA 3UY8A 1B30A 2EO7A 2C8NA 3IGXA 4H1ZA 3PUDA 3LQLA 2QUTA 2V0TA 4F40A 1DJXA 1GOQA 1S3HA 4FLSA 4W8BA 5CC6A 2YXOA 5A6SA 2C6QA 2YFOA 1LBLA 4BFAA 2FGLA 1JZ3A 2EAWA 1JIBA 3UETA 3IRDA 3VUPA 1KXTA 1JD9A 5DMYA 5JBEA 2DUZA 3FJ6A 3QR1A 4B3KA 1XRTA 4LV4A 5JXQA 5H1WA 3M41A 1NWUA 4WUIA 3VNMA 4S3DA 4AD5A 4ENLA 4ZOEA 3O6YX 4GZJA 1XQLA 2P5NA 3PZ9A 3S3GA 3WLKX 1OFAA 3ZJ7A 5KZ6A 2BG5A 3V3WA 1SO6A 2NWRA 1HKIA 1CXIA 3GUGA 3TXZA 3VTRA 1JI1A 1GOXA 3TR9A 3W7PA 4L9XA 4FF5A 3DFTA 2NYCA 5CZJA 3S4TA 4ML9A 1WOBA 1OX6A 4FF7A 5HR6A 2QZRA 4GCAA 2E40A 2F9RA 1JG9A 3AXXA 4NXKA 1P7TB 4WIWA 2OSYA 1NAL1 1EP1A 1WA3A 1TJ2A 5EMKA 4L9YA 1DIEA 1O6IA 4C6DA 3W75A 2VC9A 3BSGA 1NFBA 4AEFA 1YW1A 5A6KA 3DYMA 1EF2A 3Q58A 3IK4A 3I6EA 3MJMA 1IT8A 1TB3A 2GPTA 2G3MA 3TH6A 4YVXA 4OBTA 3EDKA 1JR1A 3GTFA 3AJXA 5FCZA 1SO4A 4JHMA 1UQYA 2Y8VA 1H7RA 4Y9MA 1LLOA 2VDHA 4L0DA 1EJUC 3FV9A 1JGIA 2YX0A 3MYOA 3FEQA 3UD6A 4MY9A 3B9DA 3IUDA 4H8HA 4WZHA 2ASHA 3R25A 4QQUA 4S3EA 3PAOA 3VGFA 2Z24A 1MEWA 2ISDA 3LPGA 5C2GA 3G1DA 1IZCA 2Z1VA 3NQFA 4R5EA 1T96A 3EX1A 5F4SA 4QHRA 2J25A 2G37A 3ERPA 4J3TA 1ADDA 3TCEA 2VFGA 3KLKA 2WHKA 3HOJA 5FJTA 2HBXA 2AAMA 2J9LA 3GXMA 5CPNA 2AAAA 3NPUA 2PFIA 4S1FA 3WQEA 3LX9A 5CZTA 2PPGA 4CQAA 5K3VA 2OPJA 2DJLA 3VCRA 3ZJ8A 4J3XA 1UWRA 4D2JA 4JDYA 1KWGA 2CC0A 2R1PA 3OZPA 2XGBA 3PZIA 1Q6RA 5BOFA 5LNSA 3CTLA 1FXQA 4D6DA 3DFNA 4GZEA 3PBGA 2NYEA 1V93A 3ARRA 3TCSA 2V5LA 5F1UA 1FH7A 3DFYA 3R4IA 3DKLA 1F61A 3B03A 2OEKA 2IQ0A 3RDKA 3LQGA 3EBVA 3BARA 4JTHA 2Z2AA 1LRNA 4DLMA 1IEQA 3MKCA 1QNRA 3SI9A 1E55A 1IQ8A 3BICA 3VA8A 1EJ7L 3T55A 4UFLA 2DP3A 3H24A 4H19A 5D9OA 5TIMA 3ITCA 2Z26A 3CH9A 3C2RA 3GVVA 4QCFA 2E6YA 3GU2A 3L2MA 5BNKA 4DIAA 5K25C 3VXGA 4ADSA 5LIUX 3KVMA 3GC2A 3L2BA 1ZCCA 2IKIA 4MG4A 2D69A 4HPGA 1PUDA 4XB3A 1W6TA 1HQTA 3WDIA 4TIMA 3LBOA 3AYSA 3G2GA 3PSWA 1BPLB 1AA1B 6XIAA 4XBKA 2WJFA 3ITXA 2PU1A 3ONBA 3A4JA 4ORMA 3KTSA 3VKDA 4D8LA 1VJIA 2FZ8A 4N6EA 4AZ6A 4I5XA 4RX0A 3SURA 1L2UA 4YLWA 4WDUA 1ZJIA 4US5A 2OEJA 3PFRA 1HN1A 2WCSA 2AQOA 3OHIA 3GTNA 2DV0A 2Z25A 3LGDA 3EWDA 3M0ZA 4I3GA 2WSYA 2ZUMA 4M29A 2WC4A 4FALA 3C2FA 3ZLHA 1NWTA 1O4UA 2UWFA 2REQA 3OODA 3CBWA 4ADUA 2OU4A 1JZ5A 1ITCA 4DUVA 4POCA 5C0QA 1GVFA 4AZ7A 5HJYA 3LHZA 3B4YA 2J6XA 3VOJA 4P2VA 3W1AA 1E9YB 2O9RA 3LA4A 1M7OA 1TPB1 1K02A 2DPEA 2G95A 2AL1A 3H2CA 3W74A 4LBUA 5BRQA 3LCGA 2GJXB 4LS2A 1BXBA 4RPPA 2ATSA 3VO0A 4PB5A 1WCGA 3WQOA 3WLRA 2Y89A 2EF7A 4LAOA 4GY1A 4L5ZA 2YZIA 1E6RA 3ITYA 3L4ZA 1UD8A 4TU1A 1JQVA 5HPOA 3MMUA 1SFSA 3GDKA 4Z2KA 4JTDA 4RDVA 3W28A 3JS3A 3QOMA 2RH9A 2FZDA 3HG4A 4NRSA 4GIEA 3I7RA 3R89A 1WUEA 2NVDA 3F2CA 2J8GA 4R27A 1P43A 4LUSB 3EKLA 3NQMA 1TR1A 2BSLA 5JH1A 4MOZA 4JTCA 2WZHA 3SN0A 1UHVA 4DRSA 3CLMA 5IDIA 1QXLA 1ZL1A 3IWPA 4QEEA 2CEQA 1YMYA 1IXPA 3PC4A 1A80A 3AI0A 4MPQA 4C6BA 4EE9A 3BZJA 4GXWA 3DDJA 4M51A 3WL1A 3CO4A 1E0TA 5GJMA 4AD1A 2C16A 5A8OA 2H8ZA 3O6CA 3AUJA 4PMDA 4LWWA 1P0BA 3QOKA 5EGRA 1UWSA 1KD0A 3QMRA 2QJGA 5AZ1A 1YE4A 1XH0A 4P1OA 4AVOA 2X30A 2BFGA 4WSJA 2GK1A 4AY1A 4YCOA 3UW6A 2TODA 4QJ1A 1AUSL 3UA4A 2PDLA 3L4TA 2NV9A 3TTSA 5FF7A 1XGDA 1FHLA 1F76A 1VQTA 3AS0A 5C9WA 3FHAA 2JIEA 1XSJA 4E4FA 3TYEA 2AMGA 2WMJA 1BYAA 5G1YA 1VBRA 4IPPA 3DAQA 4ROQA 2VD8A 4EOUA 3R43A 4EWND 2ZUUA 2VCCA 4PMRA 1UUOA 4ZQMA 4QJ5B 4Q3MA 1LOSA 3U6WA 2W6RA 1WOAA 1VYPX 3VKKA 1UC4A 3MCMA 3GTHA 3II1A 3KCOA 4H9YA 3IJIA 4AUBA 2UV8G 4UQDA 3T0AA 1O5KA 5ENLA 3BLKA 4N6FA 1G1YA 3RX3A 4EXAA 3BLEA 4EANA 1X7FA 1AW2A 4LVGA 4JEJA 1K4GA 3VNLA 4B5TA 4ML4A 1WZLA 4ZENA 4C6NA 4IMFA 1G4EA 4UMCA 1XYCA 3JU2A 4BF7A 5HATA 4ZOAA 3NR0A 4NKCA 5C55A 3ARYA 1OGBA 3FJ4A 1XG3A 3WH9A 1F3XA 3UR5A 1Q2RA 2A0NA 3QHNA 3FWRA 3D5HA 2CBUA 4JYDA 5CH9A 3FKRA 4V2XA 4M80A 1OCJA 1PXGA 5JMUA 4ASTA 3WD4A 3PAJA 1WXYA 2QREE 1ZQ5A 1W91A 4KFOA 1JRBA 5E9XA 3NEHA 2A7PA 5I2UA 2P9MA 3FOKA 1FXPA 1RBLA 4YL2A 1KKRA 2JEPA 3LZ5A 2WOQA 2UV4A 3G18A 1WKDA 1H51A 1BHGA 1P6WA 1JAKA 1KCKA 3N2BA 2AQWA 1QO5A 4DN1A 1F5ZA 2BOFX 1QK0A 2CFFA 4N2YA 2A2IA 1KFJA 4F0KA 1ZCOA 5AC6A 3IGUA 3TKFA 2OZTA 2I17A 3UT0A 3O7UA 4XO6A 1O68A 4JIRA 2C13A 4PB4A 2YCIX 1W1PA 3SFWA 1ZPTA 4HK5A 2VQUA 3UWUA 2JFEX 4JHZA 1YBQA 1IZKA 2WNQA 3N04A 4CGTA 3A47A 3I4KA 1AL8A 1YYAA 2NZLA 3AAMA 3A5FA 4AWUA 4GUHA 3EEZA 1EQCA 3BCDA 1CB7B 4J2MA 1DXIA 4JDBA 2IKGA 2DSVA 1CB2A 3GE7A 4GQGA 1H2JA 4J2PA 3CPRA 1DTNA 4QNWA 1U33A 1PX4A 3DHDA 4L7ZA 4GY7A 5FEXA 3G8RA 2V6AA 1O5QA 3B05A 4PMNA 2J8TA 2JGQA 4NL1A 1UOKA 1QOPA 3W6YA 3M1ZA 3PVFA 2PTZA 1TJPA 3GVRA 4JY9A 3L5AA 1RJQA 4E2VA 1DWAM 3S1VA 3PNZA 3FDKA 1A5CA 3ABXA 4PYSA 4LF1A 3T2OA 2YSWA 2OKOA 5D9MA 5K9DA 1XS2A 5FOOA 3NPWA 4LAUA 3VE7A 3UXAA 3BAXA 5G1MA 3LSCA 3W6LA 2PB1A 4D8AA 2J7HA 1Q6CA 2DQXA 2IKHA 4NZ4A 3CUXA 2FMOA 4QTGA 1I2RA 2PRMA 1ZJAA 3V0SA 4IF2A 3EEGA 3O63A 1GEHA 5IHRA 3GM8A 4MB1A 3R8RA 2J7BA 1LM1A 2ALDA 2ZKMX 1E0VA 4X9SA 4A29A 3MI2A 4C6MA 1K77A 2TAAA 2CESA 2CLLA 3FKKA 3IARA 3KW3A 3LG3A 4ZTYA 2RAGA 3AIUA 1OFEA 2IXUA 2J7CA 3QKEA 1SZRA 1KM6A 4JL2A 3GXNA 1NIUA 3NDZA 1W3KA 4I9TA 4XZ9A 2OTDA 4HN8A 1GOMA 2IS7A 2UZ9A 3N34A 3QC0A 5AN7A 3CASA 4ES4A 1PO9A 1GORA 3TU9A 3C86A 1HO1A 4UQCA 1X38A 5DRCA 3QY6A 1GW9A 4PMUA 4GD0A 4LS1A 4ZVJA 1VS1A 3AXMA 2R1LA 3WUEA 2QPXA 3QSRA 1XSIA 2PDXA 3CB8A 3TNOA 5AVNA 3CV6A 3FA5A 4KH2A 2G3FA 3W7NA 1MEHA 1J93A 4NJHA 4MF4A 1VH7A 5FACA 4UTIA 1PAMA 2XFYA 3KP0A 3UCCA 4Z1DA 4B4FA 4CQBA 1I4NA 3RLVA 4A4AA 4JHOA 3HFTA 1F6KA 7PTDA 2H9AA 1XLEA 4AXKA 2R9RA 1RPKA 3QHMA 4CD5A 5I03A 4HZ7A 3QLLA 3CM4A 3KVLA 3GHTA 1UUQA 2OWWA 4Q8WA 3WH6A 3LZ3A 3WK2A 4QAIA 3AO0A 2P76A 1A3XA 4Q8VA 4YTRA 4XG1A 4IQLA 4WJ8A 2WMHA 1XISA 3NPVA 2DSKA 3NZGA 3PZNA 1VRDA 1UKSA 5JU6A 4DX3A 4PCTA 1RVKA 1R2RA 4H04A 4PTMA 4C91A 3OU8A 3S0CA 3TQVA 4LB4A 3KPDA 4A05A 2Z1WA 2ESCA 3KHJA 3PZGA 1QPQA 1I75A 2ZZ4A 3WEOA 5HK4A 1E4LA 4MWAB 3P2VA 4CU8A 6REQB 4EIVA 1ZUAX 2GGJA 2A3LA 3M6YA 5AB3A 2QIWA 2J7FA 1ALDA 1V6VA 3QTGA 3HN3A 3RXZA 2PGFA 1DVJA 3WKZA 1Y7VA 3EDDA 4QS5A 4HA3A 2E6FA 1UP2A 4NZCA 2OZ0A 3RILA 2IW0A 5I09A 1EEPA 1SQ7A 4RUBA 3GAYA 1QNOA 3MUCA 2A6NA 5AECA 3N14A 3N15A 1PTDA 4B2DD 3NSNA 2BVDA 3FS2A 1AZ2A 4QDWA 1GTHA 3SADA 4C1NA 5CLWA 3BCJA 3OYZA 3GK0A 2CHRA 2Q6ZA 4COOA 1E1FA 3B97A 3FCPA 1KFLA 4PTWA 3B9NA 2TYSA 3SCNA 4PUEA 4C90A 2OGJA 4L9ZA 3OJGA 4H6EA 4UUUA 3BQ6A 3W1QA 1ECEA 5KZDA 4IY3A 3SQMA 2E25A 3B8TA 2FGZA 1LRTA 1THFD 5D05A 4CN1A 3CWOX 4K1GA 4BQ3A 5T91A 1I2QA 2QS8A 1CXHA 2CU0A 1U5JA 1ZSXA 3KL3A 5HJXA 2PZ0A 2BX7A 3CAQA 3TVAA 1K8XA 3N19B 5BCAA 1XPYA 2Y7FA 3RUBL 5HQLA 1P0EA 4TO8A 4G1NA 2CBVA 5A1AA 1IR1A 3CPGA 3QY7A 4K36A 3TTEA 5IFPA 4Z1CA 1UKQA 1FWFC 2VP8A 4PBGA 2LLEA 3WJXA 3W4RA 1V08A 1FWTA 4L65A 1GVOA 2HS8A 3FW6A 4NXSA 4C6CA 2DZUA 2Z1KA 3WCZA 1FWCC 2VRKA 3W73A 3HJEA 1U1UA 1V7YA 1TTJA 2O9PA 3GUWA 4C1KA 4HMCA 2B0MA 2QR6A 2NVCA 3KBWA 3ENLA 4DHGA 4E2BA 3MSGA 4IGSA 4GGHA 4AVNA 4HCHA 3U7BA 2E0PA 4EPKA 4JTIA 3CPUA 1E4MM 4GZ7A 3VD5A 3I8NA 2QUVA 3L67A 2X0SA 1EGZA 3WNMA 3E0WA 3NGFA 1LWIA 3UEQA 4FX7A 1RQEA 1L6WA 4EXQA 4DWSC 4MFEA 3BMVA 2EJAA 1EA9C 4IXHA 4XKMA 3FVMA 3LI1A 2R1MA 1QI3A 2PDJA 1YEYA 4K8GA 2QGYA 4D6IA 4J3UA 1GKRA 4FB7A 1C8XA 3KBSA 3DENA 3ZYZA 3PB0A 4MWAD 2XWEA 3RR4A 1RLDA 4IPLA 3VYLA 4IISA 2QDGA 4Q7IA 4QISA 4NJJA 5M03A 1FWHC 3NFUA 1E3XA 3SGZA 1B3ZA 4HTBA 4R7WA 2PMQA 1Q85A 4TR9A 4GUJA 4F9JA 2E5CA 5HINA 3WBAA 4HG0A 4QE1A 1OY0A 2I9EA 4P7OA 4URIA 3CL8A 1KNWA 5AZ0A 3WQPA 2PBOA 4Q8QA 3VPLA 2BZNA 1HG3A 4W5UA 2QV5A 4NZFA 4F2BA 1AFSA 5H8PA 2GJNA 5JBDA 3M0YA 5JBFA 4BWLC 1ITQA 3P3BA 5DO8A 1KQZA 3M46A 4Q7NA 2XJ7A 3UGRA 3F4NA 3S42A 5TAOA 4AFYA 1S3TC 3W76A 3G1VA 3M5ZA 4O52A 4WVXA 2NT0A 1OFBA 5JH2A 1PX8A 1ITUA 3BSMA 3W81A 4TVUA 5M5DA 1EYWA 4G56A 3N13A 3I6TA 1ISWA 5I3DA 4OT7A 4U31A 4R7OA 4P8UA 1GYMA 4G1KA 4RE4A 4HNOA 1K9EA 3GW0A 3M7SA 5CC7A 2DT1A 4BEUA 3TQPA 3NIYA 2P8CA 4H9TA 3UR2A 5A6TC 2E8YA 2PAJA 3P62A 5CSUA 5HULA 2OO6A 4PMVA 2X1TA 2P8BA 4GYPC 3VDAA 3T0TA 2Y2WA 5LXQA 3GY1A 3TXVA 3C0QA 3GWQA 3G3DA 3KXQA 2XN2A 3UESA 3UPMA 3B9OA 3A4AA 4Q4OA 1EIXA 1B0IA 1BYDA 3IJQA 3SUSA 1Q13A 3LB0A 5TQLA 2ZA3A 1H7XA 1K70A 3BXWA 1AD1A 1S38A 5IOBA 4HTYA 4IH3A 4AZGA 2ABAA 2O16A 2R24A 3EOEA 2FHBA 2FDSA 4B2DA 2VO5A 3U4AA 3CYVA 2HPMA 1K1DA 1NH6A 1VHNA 2CZFA 1EC8A 3OVPA 4D6GA 4L4PA 3MCNA 5FL0A 3E2RA 3VX0A 3QTPA 2YLAA 4MDOA 2NXIA 2WPBA 4AX7A 3QR3A 4LUIA 4TMCA 3I3EA 5ABTA 1L8NA 3R8HA 1FP8A 4MGGA 4EX4A 1PJ9A 4HMEA 4LV9A 1OK4A 3DZ1A 1ICPA 3AXKA 5D37A 3TJXA 4CKQA 3IGHX 4UFMA 3G0UA 2IXVA 4WHBA 1Q63A 2DH2A 4Y9AA 3R1ZA 3C4UA 2WC3A 5CZSA 3BLPX 2JKAA 3VGDA 4JCMA 4MNKA 3KRZA 1N8IA 4MB5A 4UR8A 4H9ZA 3MA8A 1TQJA 3WLNA 3RO6A 4M56A 4L6DA 1G5AA 2YDAA 1MI3A 4DNMA 1GGOA 4IFKA 3VNYA 3VI2A 4MLJA 4DJFD 3B8SA 2A3CA 1JYVA 1D9EA 1H41A 1TPH1 2Q8ZA 1C8QA 1S2UA 3ISIX 3UWEA 1W9DM 3CIXA 1UBSA 3LS9A 5BXRA 3A24A 3NTYA 2AMXA 2V2HA 4GOAA 1K8ZA 3MT1A 1UR8A 2QUUA 5A8QA 3AS2A 2XIOA 1D3HA 3KXRA 3OZMA 2J74A 1BAGA 1FX6A 2G8ZA 3BK0A 4IYSA 4AMAA 4ZCWA 1JDFA 2WPGA 4AZHA 1XR2A 3RCNA 3QZAA 2WVVA 4QE4A 2XYLA 4HHHA 2CBJA 4JXCA 4MM1A 3UXKA 1LG1A 1MZHA 2HSAA 1PYFA 3VNJA 2HVNA 3F4CA 1WB0A 1HFBA 3BAJA 3WENA 3C8FA 5BW6A 2PDGA 1OABA 4ZSTA 1E4NA 1UMYA 2J24A 3W84A 1UR4A 1EL3A 2ZZ1A 3PWAA 1PKMA 3VIJA 1P48A 4C5YA 4A8RA 1JDDA 1QR7A 3IAQA 1G4SA 4DWSB 1RAKA 3CHEA 2V5KA 4NYYA 4W7VA 3U7VA 2G5WA 4IUGA 2W61A 4C5ZA 2C91A 3KCLA 1XLMA 3GD6A 4UMAA 5KITA 1A49A 3GB6A 2FH8A 2XWDA 4UTHA 1Q45A 3GR4A 2ZICA 1BGAA 3F5KA 1SJCA 1WV2A 1YXCA 1OZQA 4HJFA 4AYGA 3AZRA 2BHZA 1CZ1A 3PC2A 3UWZA 4C7FA 2J7GA 1E1EA 1XIIA 2X0YA 4LU0A 1J6OA 2WSQA 1EBGA 2H6RA 5CSRA 4M19A 1QASA 2VUNA 2QPUA 4GO9A 3MVIA 3L9CA 1I9CB 3QM3A 4JKMA 4X0VA 4PUKA 4H9MA 1Q8AA 3LMYA 7XIMA 3SECA 3F4WA 4Q32A 1DJQA 2EPLX 3PJWA 1V7AA 3ANUA 3W87A 2XHYA 5IBXC 1YPIA 4PA8A 1KBJA 3MI3A 4QLJA 1SVDA 2PCEA 4LUTB 3IPWA 5E93A 1SGJA 3SCPA 1ZP3A 1N8FA 4QLLA 4W7WA 4D6HA 2INZA 3NYDA 1MUWA 2VGGA 1SZEA 2GUBA 4FEZA 3VGBA 2JALA 4ESYA 2VX7A 4RZ6A 5CZ0A 1TA3A 2PF0A 3CQKA 5FJUA 3EB3A 4DJEA 4FIRA 2OGYA 4GQQA 3BG3A 5J5RA 2D2JA 1EC9A 3TSBA 5MKGA 3HFYA 3BVJA 3TOPA 1IT7A 1OIFA 2W27A 1B57A 1J2WA 5HNUA 4H7ZA 1S5VA 1JCNA 2R91A 1KLZA 3VOCA 1CLXA 1JQXA 3WQDA 4LVFA 2YL5A 3QBUA 3N2OA 3M9YA 4Z17A 5D8ZA 4AMCA 4V33A 4I9JA 1NARA 3GBYA 1EHAA 4UCFA 1H7OA 4ZSUA 3LCLA 4NNBA 4LNYA 4ZXLA 2YCEA 5D9NA 3TWAA 3LERA 2VMFA 1E40A 1XGZA 2XIMA 3PZUA 2EG7A 3O6AA 2VOMA 1I2PA 4FNTA 3PBMA 5HMFA 3ABOA 3R2GA 4HU4A 3RX4A 3T4WA 1TWZA 4NHVA 4DWDA 3ELFA 3G5EA 4I5RA 4O17A 3ZT7A 2A3BA 1DJGA 1NWRA 1JGMA 2CKSA 1S2TA 1B3OA 1X1NA 4A21A 1KBLA 1Z89A 4H2CA 2BVTA 4DUWA 4IZGA