4FYUA

Crystal structure of thioredoxin from wuchereria bancrofti at 2.0 angstrom
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
ADLLANIDLKKADGTVKKGSDALANKKVVALYFSAHWCPPCRQFTPILKEFYEEVDDDQFEIVFVSLDHSEEDLNNYVKESHGDWYHVPFGSSEIEKLKNKYEVAGIPMLIVIKSDGNVITKNGRADVSGKAPPQTLSSWLAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal structure of Thioredoxin from Wuchereria bancrofti at 2.0 Angstrom
rcsb
source organism Wuchereria bancrofti
molecule tags Oxidoreductase
total genus 48
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4fyuA00
2IMDA 3EWLA 2JACA 4NHWA 2KP2A 1ON4A 2LNSA 1TKDB 3P7XA 1SKRB 3ISOA 1V58A 2JL4A 2LS5A 3J7Yk 2IFQA 3G7YA 5AISA 1T4ZA 2H1GA 3IPZA 4MABA 1GTAA 3HCZA 4L5OA 4ACSA 3KD0A 2MMOA 3EE2A 3L4NA 3MDKA 1SK2A 2A2SA 3C7MA 2K8SA 19GSA 1EOGA 3DD3A 4MA9A 4IS0A 4EUYA 2H72A 1W4VA 3D22A 2V41A 1VF1A 2MMAA 3BBYA 2PPTA 18GSA 4PX1A 1XWAA 2NTOA 1HNBA 4TR1A 4JEDA 4K1FA 4LL1B 2DJ1A 2HLSA 4X1UA 2F3MA 1K0CA 1EOHA 2P0GA 3UOMA 3VI7A 5JCGA 4JRRA 4KCAA 2V6KA 3P2AA 2CAIA 4G9HA 1YKAA 2DSAA 2DJJA 4MCUA 2HFDA 4RI6A 4CHSA 3F63A 2I4AA 1PKWA 6GSTA 4QQ7A 2N5AA 2LNTA 1K0AA 4NV5A 3GL5A 4XS4A 1ERVA 2RM5A 3FHKA 2CT6A 4RUVA 2JZRA 5DDLA 3KCMA 4NXIA 3UAPA 1SKWB 1T4YA 2C0GA 4BWSA 3EMXA 3BCIA 4P3YB 3VK9A 11GSA 3OR5A 2X8HA 3LYKA 3IBHA 2JU5A 1O8XA 4Q5FA 2PVQA 1OKTA 2GZPA 2H6ZA 3IK7A 1SD8A 2LQQA 1LU4A 3M1GA 4KA0A 4IHUA 2JZSA 2X8CA 5DAKB 5D9VA 2HNLA 5ECQB 1GTUA 3TKPA 2VD0A 1JZDA 1Q98A 2H19A 4V1Ap 4KE3A 5H5RA 1EP8A 1QUWA 5ECLB 1VF4A 1GSYA 4WBJA 3GNJA 2LUSA 1PD21 2EIOA 5CRGA 1TXXA 3K8NA 2KUCA 4FYCA 4O5RA 2N5FA 1T8EB 4MZWA 2KOKA 2HE3A 3VWVA 5H5QA 1O7UA 1A2LA 1XXUA 4IP1A 4MK3A 1GSSA 5CRDA 4NV2A 1FOVA 2YZUA 2LV3A 4O32A 2IMIA 3ME7A 4XRDA 3H1NA 1XPVA 4AJ6A 2C0DA 2YJ7A 4KDXA 1B4PA 1YEXA 2DMLA 2E2MA 5B8BA 1WMJA 4HI7A 4L5LA 5DJLA 4JE1A 1EV4A 2GSQA 3CXGA 1THXA 4YQVA 3JCML 2H1BA 6GSXA 1RW1A 3V1WA 3UVHA 3ZYWA 3TOUA 1BEDA 5GSSA 2FA4A 4KB3A 1TK8B 2I9HA 1PA3A 2AYTA 1YF1A 2DJKA 3E3EA 3RBTA 1IYHA 1J9BA 2WGRA 4ZL8A 5HR2A 4EDZA 3W6GA 5ELGA 2WZ9A 2PUKC 3QMXA 4RI7A 1QQ2A 2XPDA 5COHA 1EZKA 2V6OA 2EIQA 1YY7A 1M2DA 4F82A 3ED3A 5AN1A 4ISDA 3HZ4A 2C0FA 2YWOA 3FRCA 3U6VA 5ELAA 1GUKA 4MF7A 4E8HA 1E6BA 4MJAA 4PUAA 3QFBC 3RHBA 3GKXA 4DSQA 2VIMA 2K6VA 5ECPB 3RAZA 2OACA 2M46A 3HVSA 3N5OA 2KHPA 4L0WA 6GSVA 2B7KA 2AB6A 2GSTA 6GSYA 3L78A 4XS1A 3QDNA 1M99A 1XWBA 1BG5A 5AGYA 3F3QA 1AW9A 2ON5A 3CMIA 2H71A 2FA8A 4ZB9A 3KP9A 1DUGA 4ML6A 5G5EA 1S3DA 1AIUA 4MMMA 4TR1B 5ECSA 5DBQA 3PR8A 1MD3A 2HI7A 2NVLA 5D8IA 1G7EA 3S9FA 2ON7A 1B8XA 2DLXA 3ZIJA 3EU3A 1VGLA 2AAWA 4ECJA 1UN2A 2F8AA 3UJ1A 5ENUA 4F2IA 1XW6A 1TRUA 5ABRA 4JR6A 3CSHA 1OC8A 3UBKA 1GULA 2R6KA 2YCDA 4GSSA 1M2AA 5HR3A 1OKDA 1FG4A 3TKSE 2DJ2A 1YKCA 3IHQA 2FGXA 1KBNA 1TRVA 3HYPA 3IK9A 1AQXA 3FK8A 4WETA 4ZBAA 3HD5A 3DRNA 5KN0A 2PERA 3C71A 1OE8A 2GTUA 5LNKe 4IELA 3KGKA 4K7IA 4TR0A 4TR3A 1DE1A 2GLRA 2ALBA 2MBTA 1ZYQB 1WJKA 4I5QA 2FUG2 2WCIA 2KLXA 1V98A 1OVNA 1A2JA 3TUEA 13GSA 1TRSA 3KMNA 3VFIA 1GTIA 4DVCA 1LBKA 5G5FA 1GLQA 1F2EA 3TDGA 2HT9A 4MP4A 5GSTA 2BTOT 1I9DA 1SK1A 4XHMA 1K3YA 5DALA 3IC4A 3LSZA 1U87A 3KP8A 2ZCTA 3WT2A 4OCFA 3I69A 2R4VA 1X9SB 4IGJA 4IP6A 3TJFA 3WD6A 3ZFBA 2OADA 4I6XA 3IV4A 3IAM2 5HQPA 3TKSC 3WGEA 5D9XA 4JBBA 4EC0A 2GQKA 2AHEA 1PSQA 3AY8A 2VL9A 5IMFA 1GP1A 4LLRA 5DQYA 4D73A 5HFGA 3F4TA 5GZZB 1CQHA 2GQLA 4PNGA 1MEKA 2IMEA 3ZVJA 1XW5A 1G6YA 1EV9A 5EVOA 5ECOB 5IO2A 3ERWA 3U5RE 3QAWA 1X5EA 3VWXA 3BD2A 3KJYA 5L71A 3QPMA 2BMXA 3UBLA 1UC7A 3MWHA 2F8FA 4HOJA 4OO5A 2JADA 5D93A 4TXOA 1V57A 3ZTLA 2K9FA 5EL8A 1XOAA 4KW6A 2HZEA 4RQRA 2F51A 1AQVA 1BAYA 2HSHA 4TN8A 5H5SA 4Z7XA 4WF5A 4YQUA 2FD3A 5IM9A 4MZCA 3GMFA 2H30A 3FYGA 3F6DA 4J2FA 1FVJA 4HZ2A 2YANA 5KN2A 1GSFA 3EMPA 5INYA 2O87A 3Q18A 3KMOA 4HQSA 3CTGA 1Z3EA 2L4QA 1K0MA 1ZGNA 3HJOA 1KNGA 1M9BA 1PX7A 3FR3A 1A8YA 2LQOA 4KSOA 2DBCA 1NHYA 2KP1A 2C80A 1GSQA 5DCHA 2IWTA 1I5GA 3C73A 3HDCA 3UIWA 2PGTA 5G1KA 4Q5NA 3VWUA 4MPFA 4MJCA 2N5BA 3TKQA 1TI1A 1HQOA 4K0GA 2H6YA 1SL1B 5HR0A 3M8NA 3F9UA 3TRPA 4X43A 2I81A 5ID2A 2H66A 3QCPA 4J57E 3F3RA 3TRXA 2LEGA 1Z6MA 2M80A 4ZIJA 1K0NA 4WF4A 3DVXA 2OBKA 4TVEA 1C72A 4IN0A 5G30A 3FEUA 2LJKA 1PL2A 1TTZA 4L0UA 3GURA 2X64A 1KTEA 2OE3A 2MZCA 1SU9A 4ZBBA 1TP9A 2V1MA 2WS2A 1GUMA 1R26A 1X9MB 1ML6A 1Q4JA 2PVOC 1G7OA 3O6TA 2VM1A 1F3BA 2XBIA 4POBA 5J3RA 2YWMA 3VPQA 2H0HA 2MYGA 2H01A 3NOFA 5CRWA 4DSSA 4KX4A 3QFAC 1SL0B 2H76A 1DBYA 3CSJA 1VF3A 1FVKA 3IAS2 4WR5A 1PN9A 2L5LA 1U3AA 1NHOA 5AIXA 5ECRB 3GUSA 1FHEA 1JLVA 2JSZA 4I8BA 3R2QA 4GQFA 1ZOFA 2WRTA 2WDUA 1XZOA 4ZL9A 1QMVA 2LRNA 3DGQA 5IIZA 4JZQA 3MNGA 1QXHA 2O85A 4HQZA 1K3LA 1SKSB 1EEJA 3FZ9A 1XWKA 2DJ3A 4IBPA 3GTUA 4GXZA 2GGTA 2RM6A 4V2MA 2HXKA 3DEXA 1BJXA 4O7HA 1OC9B 3TRQA 4IJ3A 5B6NA 2L6DA 2GT6A 1NW2A 3LFLA 4HEA2 3FR6A 2DC5A 2GVPA 1GSEA 2B5XA 2LRCA 4KNDA 1O8WA 3PINA 4KDUA 3G7IA 3W8JA 2JZTA 3EURA 1QGVA 5D9TA 1B9XC 1YF0A 5CYYA 1ZCPA 2MBSA 3TKSA 3DWVA 2VCZA 1S3CA 3IRAA 5IPHA 4YQMA 5IMZA 4KGIA 4WKWA 3L9UA 3GFKA 1X0RA 2NPBA 3GV1A 3UMAA 2ZUPA 3I6AA 4PURA 1SK0A 5J41A 3HJMA 2B3SA 3F6FA 1FAAA 4PQIA 2R2JA 2EIRA 2OE1A 2RLIA 3EVIA 1OAZA 3DKSA 5G2ZA 4EKZA 1PL1A 2ES7A 1XFLA 2WFCA 1GSUA 1QFNA 2VCWA 2X99A 2L6CA 4K2DA 5G31A 3ZIVA 1FW1A 3F0IA 4V2LA 3US3A 3KM6A 1ZZYA 4MF6A 4N11A 4F0CA 2B7JA 2CV4A 4MF5A 2AV4A 3HA9A 4YAPA 12GSA 2CVKA 2GZYA 17GSA 5DVBA 3F4SA 2VLVA 1VF2A 1T7PB 1AUCA 5IPGA 4GF0A 3NZNA 3A5WA 1TOFA 2LSTA 4POMA 1JZRA 4ULXA 4X0XA 6GSSA 2IFQB 1ACVA 1PMTA 1UVZA 4AGSA 2OE0A 4HZ4A 4IVFA 1GNEA 4MJBA 4QL9A 5J5NA 2DJ0A 3GYKA 3Q74A 5EPFA 4IQ1A 5A5KA 1GNWA 20GSA 3IOSA 3A2VA 1XWCA 2GDRA 1F37A 3QAVA 1Z5YE 1B4QA 2IL3A 4XTSA 2D2ZA 5D96A 1RK4A 5ECIB 1TU8A 3LGCA 3H79A 1YEPA 1WE0A 3WGXA 4OFTA 1GUHA 3C1RA 1YQ1A 2QGVA 1X9WB 1ILOA 3DXBA 2VL3A 3HZ8A 1E2YA 5JCWA 5JCUA 4BWQA 4EO3A 2LRTA 3WGDA 1AC1A 4AF2A 5C00A 3ZL5A 5IOWA 1N2AA 1M7TA 3ZREA 2QSIA 1PRXA 1A23A 5CRHA 4EVMA 2FY6A 4V1Ag 4WXTA 2NBSA 4XS4B 4BA7A 4MPGA 4DEJA 3NIVA 1J0FA 4EE0A 4NHZA 5A4VA 2VCTA 2FWEA 2B6MA 4GSTA 3H4KA 4PQHA 1KEBA 2O8VB 1GLPA 1THOA 2PBJA 1AXDA 1SENA 4K8MA 2IMFA 2YOIA 3WT1A 1SYXA 2A2RA 1R4WA 2H73A 5DAKA 3LXTA 5IMVA 5KN3A 3LEFA 2C8UA 4V2NA 1V2AA 5ECMB 2IN3A 3FR9A 2H6XA 4TXVA 2E2GA 2TRCP 4DSRA 3L0HA 1Y6EA 5LCZA 2I3YA 4JU5A 3QD9A 4MDCA 4GCIA 5AIVA 3CBUA 3CSIA 4PXOA 1WWJA 5GAND 4ID0A 2A4VA 3KEBA 5B7CA 4JR4A 2HRFA 1A24A 2VUPA 1MD4A 4LA1A 1CQGA 4EDYA 3GTUB 1VRSD 3N9JA 1R5AA 3PH9A 1WPIA 14GSA 3VURA 5G1LA 4NAXA 3KXOA 3E0UA 3LYPA 4HU7A 1B9YC 4ILFA 3DYRA 5DJMA 1F3AA 1MDIA 4I2TA 4EXJA 2HYXA 3HVXA 4WEYA 2C1YA 3C8EA 4OMVA 4YH2A 4J56E 2WB9A 3WYWA 1USBA 2XPEA 3EYTA 4G10A 3RDWA 1XBSA 1OC3A 3D6IA 4NPBA 4YAVA 2CQ9A 1GRXA 2X8GA 1EEMA 1R7HA 1XVQA 5FT3A 2H1AA 3UARA 2VL2C 3SWLA 2HSYA 4XIHA 5ECHB 4XCSA 2P5RA 1G6WA 4ZXGA 1EGRA 3FZAA 1URMA 1H4OA 4KSMA 3ZVJD 3FZ4A 4PNFA 4BVXA 5EY6A 4OO4A 1SJZA 3TJGA 1M9AA 2OA7A 1MDKA 2QC7A 2L5OA 5C04A 1XW9A 2IIYA 4GTUA 5E59A 3D0ZA 1T3BA 1K3OA 2C0EA 1ERWA 2QKEA 5HFIA 1A2MA 1ERTA 1BX9A 4XS6A 3KZQA 3H8QA 4OCEA 1V9WA 3KH9A 3D21A 4Q5QA 2L59A 3RPNA 3HY2A 1X5CA 1M0UA 2G0FA 1BQ7A 4OFNA 1NM3A 2ZNMA 2H0IA 3D5JA 3HKRA 3KTBA 1GWCA 1F6MC 3DVWA 1TW9A 3QAGA 3FW2A 2IJYA 5B6MA 3TGZA 2P5QA 1IYIA 4O92A 5CREA 1GH2A 5HFKA 2C4JA 1EWXA 1Y25A 2GSSA 1GSDA 4E8EA 2HRNA 4HJ2A 1Z7PA 4ZBDA 3I9V2 2FHEA 4CDOA 2H75A 3VPTA 5DQSA 1JZOA 4GSNA 4N10A 3EU4A 3HHVA 1F9MA 2BJXA 3D4MA 1S3AA 2VCQA 3GKNA 3GKKA 3O3TA 2DIYA 2FLSA 10GSA 6GSWA 2JSYA 2FWGA 4ZL7A 1K0DA 1FO5A 3DIEA 3LJRA 4HS1A 2B1LA 1HNAA 2K8VA 5B8AA 3G7JA 2H70A 7GSSA 3EC3A 1AQWA 2H0GA 1RQMA 4EL1A 4PQ1A 1YJ6A 3GH9A 3HVVA 1TJDA 2CAQA 3ZFLA 2C3QA 1XVWA 1TDIA 3A2WA 1W89A 2L4CA 3BJ5A 4OWYA 3VWWA 1SYRA 3TJBA 2J23A 2EC4A 1UA5A 2K18A 3A2XA 4K0NA 2MMNA 1YDKA 4GWRA 3HXSA 3ZMLA 1OE7A 2CZ3A 16GSA 1PGTA 22GSA 3CRUA 2YNXA 5FWGA 1TK5B 1MDJA 1WRYA 3GN3A 2YWNA 2YV9A 4F03A 1Z9HA 4FH8A 2R3XA 5IMCA 4LL4B 2WULA 1YZXA 2MMZA 4WR4A 3APQA 5F8BA 4NWYA 3L9SA 5LD0A 1FB6A 1BYEA 1XIYA 1PX6A 2PMTA 1EP7A 2NDOA 4FYUA 2YZHA 4AJ7A 5A4UA 1U88A 4ECIA 2YP6A 5DALB 5KN1A 2E0QA 1T1VA 1A0FA 1T00A 5IQYA 2TIRA 2R5GA 3O76A 4GQCA 4GLTA 3I43A 2GT5A 3D4TA 6GSUA 3ZITA 3FY7A 5D73A 4TR4A 2CA8A 5JWQB 1TRWA 2WJUA 5J4UA 1B48A 1O81A 3M9JA 4D73B 3GKMA 4HU9A 2B5YA 2PU9C 2H8LA 4IQAA 5IMAA 3VLNA 2VM2A 1HNCA 2XHFA 2E7PA 1AAZA 4LMVA 3KH7A 3GX8A 3UL3A 3F4RA 4ZILA 2V2GA 1TU7A 2YJHA 2VL2A 3KIJA 4TXOB 4N0ZA 3FKFA 1U3IA 1MTCA 2OBIA 2FCHA 2PWJA 3MAKA 2Z9SA 5HR1A 2HZEB 3UVTA 2CX3A 1G0TA 3F8UA 1JFUA 3RHCA 2LKUA 5DCGA 5E4WA 2OJLA 2YV7A 1O6JA 1ABAA 4ZB8A 2FNOA 4KH7A 4XRAA 4BPYA 3GSTA 2VLUA 1ERUA 4GRFA 2DIZA 1SD9A 2VLTA 4BL7A 3FZ5A 2GZZA 4KUNA 4OD7A 2LJAA 3IDVA 3Q19A 3Q6OA 4PUFC 1HD2A 4F9ZA 4TW5A 2RIIA 5F06A 1NSWA 2CX4A 3KTLA 1JZWA 4HJMA 5CP1A 5J9BA 2CVDA 5A4WA 3CTFA 4IJIA 3M9KA 3IE3A 3GSSA 3IR4A 1ST9A 4G2EA 2G2QA 1A0RP 3M0FA 1SJIA 3A3TA 2CZ2A 2IPAA 2R37A 3L9VA 4MH2A 3ZRDA 1JLWA 4LMWA 1ZL9A 1DSBA 4MZBA 4ZB6A 1J08A 1TI3A 3LXZA 2AJQB 2LJRA 2GSRA 1Z7RA 4MLYA 1TK0B 1O73A 2REMA 1DE2A 2C3TA 4Q5RA 4ECCA 3TB2A 4OFMA 5FHIA 2FWFA 2FWHA 5ID2B 2VCXA 1GL8A 1X5DA 4ML1A 3J7Yb 1SJ6A 3BCKA 4K9ZA 4N0VA 5CAXA 4AJ8A 1PQNA 3GIXA 4FYBA 3TJJA 3ZZXA 4K7NA 2VAFA 4IW9A 2LTKA 3UEMA 3GX0A 4MH3A 2L57A 2GS3A 4PGTA 1GTBA 5D9WA 5J9CA 2IMKA 3P8WA 5IO0A 2GQMA 3BOAA 2O89A 2O7KA 3LWAA 2I1UA 4DSSB 4BVYA 4EF0A 2YWIA 1WIKA 3EINA 3GH6A 1FB0A 2YPMA 4RQXA 3TJKA 4FO5A 4POKA 4QL7A 3TCOA 2H1DA 2XBQA 1PKZA 5JWRB 1QK8A 2OKAA 1WP0A 5GAPD 1H75A 2PN8A 2VD1A 3MSZA 1XOBA 3HJPA 3ZMKA 5CO3A 2H74A 3E9JB 3TOTA 2VCVA 4POLA 3W8SA 4KCEA 3GRXA 2B5EA 5F07A 4H86A 1OC9A 5IOXA 5JWOB 4ECBA 3ERFA 1ZMAA 2HZFA 3IXRA 1HYUA 5IMDA 4I97A 4CW9A 9GSSA 2XC2A 4IKHA 1U6TA 3SBCA 3P90A 4G19A 2P31A 2F9SA 5ECNB 2V32A 3ERGA 3IA1A 5ECKB 8GSSA 3RPPA 4TOPA 2AUVA 3H93A 4HDEA 1XCCA 2M72A 2DMMA 4NMUA 3APSA 1M2BA 2YN1A 2VOCA 2B1KA 4FIWA 4WBRD 1WOUA 1N8JA 1K0BA 3DMLA 2RUEA 3TKRA 3QOUA 1XWGA 4HUAA 4KDYA 5F0GA 4L8EA 4K6XA 4TRXA 5CNWA 5F05A 4F0BA 1OYJA 3APOA 1SL2B 4TKYA 1K0OA 1Z6NA 1JHBA 2C3NA 3LG6A 1ZYEA 2TRXA 4K7OA 3VI5A 5KEJA 3CYNA 3G9BA 3ME8A 4KAEA 4N30A 3ZLPA 1R5PA 3CRTA 3C1SA 3M3MA 2RUFA 3PGTA 1LJRA 2CVBA 1EGOA 3LQ7A 4MJEA 3LORA 3GA4A 1O85A 2J9HA 1A8LA 4I2UA 2VO4A 3GL3A 3QR6A 3GHAA 1V40A
chains in the Genus database with same CATH superfamily
2IMDA 3EWLA 2JACA 4NHWA 2KP2A 1ON4A 2LNSA 1TKDB 3P7XA 1SKRB 3ISOA 1V58A 2JL4A 2LS5A 3J7Yk 2IFQA 3G7YA 5AISA 5BRTA 1T4ZA 2H1GA 3IPZA 4MABA 4BL7B 1GTAA 3HCZA 4L5OA 4ACSA 3KD0A 2MMOA 3EE2A 3L4NA 3MDKA 1SK2A 2A2SA 3C7MA 2K8SA 19GSA 1EOGA 3DD3A 4MA9A 4IS0A 4EUYA 2H72A 1W4VA 3D22A 2V41A 1VF1A 2MMAA 3BBYA 2PPTA 18GSA 4PX1A 1XWAA 2NTOA 1HNBA 4TR1A 4JEDA 4K1FA 4LL1B 2DJ1A 4YKFA 2HLSA 4X1UA 2F3MA 1K0CA 1EOHA 2P0GA 3UOMA 3VI7A 5JCGA 4JRRA 4KCAA 2V6KA 3P2AA 2CAIA 4G9HA 1YKAA 2DSAA 2DJJA 4MCUA 2HFDA 4RI6A 4CHSA 3F63A 2I4AA 1PKWA 1S3RA 6GSTA 4QQ7A 2N5AA 2LNTA 1K0AA 4NV5A 3GL5A 4XS4A 1ERVA 2RM5A 3FHKA 2CT6A 4RUVA 2JZRA 5DDLA 3KCMA 4NXIA 3UAPA 1SKWB 1T4YA 2C0GA 4BWSA 3EMXA 3BCIA 4P3YB 3VK9A 11GSA 3OR5A 2X8HA 3LYKA 3IBHA 2JU5A 1O8XA 4Q5FA 2PVQA 1OKTA 2GZPA 2H6ZA 3IK7A 1SD8A 2LQQA 1LU4A 3M1GA 4KA0A 4IHUA 2JZSA 2X8CA 5DAKB 5D9VA 3FMWA 2HNLA 5ECQB 1GTUA 3TKPA 2VD0A 1JZDA 1Q98A 2H19A 4V1Ap 4KE3A 5H5RA 1EP8A 1QUWA 5ECLB 1VF4A 1GSYA 4WBJA 3GNJA 2LUSA 1PD21 2EIOA 5CRGA 1TXXA 3K8NA 2KUCA 4FYCA 4O5RA 2N5FA 1T8EB 2QA2A 4MZWA 2KOKA 2HE3A 3VWVA 5H5QA 1O7UA 1A2LA 1XXUA 4IP1A 4MK3A 1GSSA 5CRDA 2R0PA 4NV2A 1FOVA 2YZUA 2LV3A 4O32A 2IMIA 3ME7A 4XRDA 3H1NA 1XPVA 4AJ6A 2C0DA 2YJ7A 3EPTA 4KDXA 1B4PA 1YEXA 2DMLA 2E2MA 5B8BA 1WMJA 4HI7A 4L5LA 5DJLA 4JE1A 1EV4A 2GSQA 3CXGA 1THXA 4YQVA 3JCML 2H1BA 6GSXA 1RW1A 3V1WA 3UVHA 3ZYWA 3TOUA 1BEDA 3R3EA 5GSSA 2FA4A 4KB3A 1TK8B 2I9HA 1PA3A 2AYTA 1YF1A 2DJKA 3E3EA 3RBTA 1IYHA 3MYDA 1J9BA 2HRAA 2WGRA 4ZL8A 5HR2A 4EDZA 3W6GA 4BVXB 5ELGA 2WZ9A 2PUKC 3QMXA 4RI7A 1QQ2A 2XPDA 5COHA 1EZKA 2V6OA 2EIQA 1YY7A 1M2DA 4F82A 3ED3A 4K2XA 5AN1A 4ISDA 3HZ4A 2C0FA 2YWOA 3FRCA 3U6VA 5ELAA 1GUKA 4MF7A 4E8HA 1E6BA 4MJAA 3IC8A 4CY6A 4PUAA 3QFBC 3RHBA 3GKXA 4DSQA 2VIMA 2K6VA 5ECPB 3RAZA 2OACA 2M46A 3HVSA 3N5OA 2KHPA 4L0WA 6GSVA 4YKGA 2B7KA 2AB6A 2GSTA 6GSYA 3L78A 4XS1A 3QDNA 1M99A 1XWBA 1BG5A 5AGYA 3F3QA 1AW9A 2ON5A 3CMIA 2H71A 2FA8A 4ZB9A 3KP9A 1DUGA 4ML6A 5G5EA 1S3DA 1AIUA 4MMMA 4TR1B 5ECSA 5DBQA 3PR8A 1MD3A 4PTSA 2HI7A 2NVLA 5D8IA 1G7EA 3S9FA 2ON7A 1B8XA 2DLXA 3ZIJA 3EU3A 1VGLA 2AAWA 4ECJA 1UN2A 2F8AA 3UJ1A 5ENUA 4F2IA 5BMUA 1XW6A 1TRUA 5ABRA 4JR6A 3CSHA 1OC8A 3UBKA 1GULA 3MIXA 2R6KA 2YCDA 4GSSA 1M2AA 5HR3A 3HVNA 1OKDA 1FG4A 3TKSE 2DJ2A 1YKCA 3IHQA 2FGXA 1KBNA 1TRVA 3HYPA 3IK9A 1AQXA 3FK8A 4WETA 4ZBAA 3HD5A 3DRNA 5KN0A 2PERA 3C71A 1OE8A 2GTUA 5LNKe 4IELA 3KGKA 4K7IA 4TR0A 4TR3A 2R0CA 1DE1A 2GLRA 2ALBA 2MBTA 1ZYQB 1WJKA 4O5QA 4I5QA 2FUG2 2WCIA 2KLXA 1V98A 1OVNA 1A2JA 3TUEA 13GSA 1TRSA 3KMNA 3VFIA 1GTIA 4DVCA 1LBKA 5G5FA 1GLQA 1F2EA 3TDGA 2HT9A 4MP4A 5GSTA 2BTOT 1I9DA 1SK1A 4XHMA 1K3YA 5DALA 3IC4A 3LSZA 1U87A 3KP8A 2ZCTA 3WT2A 4OCFA 3I69A 2R4VA 1X9SB 4IGJA 4IP6A 3TJFA 3WD6A 3ZFBA 2OADA 4I6XA 3IV4A 3IAM2 4KF9A 5HQPA 3TKSC 3WGEA 5D9XA 4EIQA 4JBBA 4EC0A 2GQKA 2AHEA 1PSQA 3AY8A 2VL9A 5IMFA 1GP1A 4LLRA 5DQYA 4D73A 5HFGA 3F4TA 5GZZB 1CQHA 3LW9A 2GQLA 4PNGA 1MEKA 2IMEA 3ZVJA 1XW5A 1G6YA 1EV9A 5EVOA 5ECOB 5IO2A 3ERWA 3U5RE 3QAWA 1X5EA 3VWXA 3BD2A 3KJYA 5L71A 3QPMA 2BMXA 3UBLA 1UC7A 3MWHA 2F8FA 4HOJA 4OO5A 2JADA 5D93A 4TXOA 1V57A 3ZTLA 2K9FA 5EL8A 1XOAA 4KW6A 2HZEA 4RQRA 2F51A 1AQVA 1BAYA 2HSHA 4TN8A 5H5SA 4Z7XA 4WF5A 4YQUA 2FD3A 5IM9A 4MZCA 3GMFA 2H30A 3FYGA 3F6DA 4J2FA 1FVJA 4HZ2A 2YANA 5KN2A 1GSFA 3EMPA 5INYA 2O87A 3Q18A 3KMOA 4HQSA 3CTGA 1Z3EA 2L4QA 1K0MA 1ZGNA 3HJOA 1KNGA 1M9BA 1PX7A 3FR3A 1A8YA 2LQOA 4KSOA 2DBCA 1NHYA 2KP1A 2C80A 1GSQA 5DCHA 2IWTA 1I5GA 3C73A 4G0IA 3HDCA 3UIWA 2PGTA 5G1KA 4Q5NA 3VWUA 4MPFA 4MJCA 2N5BA 3TKQA 1TI1A 1HQOA 4K0GA 2H6YA 1SL1B 5HR0A 3M8NA 3F9UA 3TRPA 4X43A 2I81A 5ID2A 2H66A 3QCPA 4J57E 3F3RA 3TRXA 2LEGA 1Z6MA 2M80A 4ZIJA 1K0NA 4WF4A 3DVXA 1PN0A 2OBKA 4TVEA 1C72A 4IN0A 5G30A 3FEUA 2LJKA 1PL2A 1TTZA 4L0UA 3GURA 2X64A 1KTEA 2OE3A 2MZCA 1SU9A 4ZBBA 1TP9A 2V1MA 2WS2A 1GUMA 1R26A 1X9MB 1ML6A 1Q4JA 2PVOC 1G7OA 3O6TA 2VM1A 4HSCX 1F3BA 2XBIA 4POBA 5J3RA 2YWMA 3VPQA 2H0HA 2MYGA 2H01A 3NOFA 5CRWA 4DSSA 4KX4A 3QFAC 1SL0B 2H76A 1DBYA 3CSJA 1PFOA 1VF3A 1FVKA 3IAS2 4WR5A 1PN9A 4G0LA 2L5LA 1U3AA 4BVYB 1NHOA 5AIXA 5ECRB 3GUSA 1FHEA 1JLVA 2JSZA 4I8BA 2UZ8A 3R2QA 4GQFA 1ZOFA 2WRTA 2WDUA 1XZOA 4ZL9A 1QMVA 2LRNA 3DGQA 5IIZA 4JZQA 3MNGA 1QXHA 2O85A 4HQZA 1K3LA 1SKSB 1EEJA 3FZ9A 4ICYA 1XWKA 2DJ3A 4IBPA 3GTUA 4GXZA 2GGTA 2RM6A 4V2MA 2HXKA 3DEXA 1BJXA 4O7HA 1OC9B 3TRQA 4IJ3A 5B6NA 2L6DA 2GT6A 1NW2A 3LFLA 4HEA2 2A4HA 3FR6A 2DC5A 2GVPA 1GSEA 2B5XA 2LRCA 4KNDA 1O8WA 3PINA 4KDUA 3G7IA 3W8JA 2JZTA 3EURA 1QGVA 5D9TA 4Z2TA 1B9XC 1YF0A 5CYYA 1ZCPA 2MBSA 3TKSA 3DWVA 2VCZA 1S3CA 3IRAA 5IPHA 4YQMA 5IMZA 4KGIA 4WKWA 3L9UA 3CQFA 4K5SA 3GFKA 1X0RA 2NPBA 3GV1A 3UMAA 2ZUPA 3I6AA 4PURA 1SK0A 5J41A 3HJMA 2B3SA 3F6FA 1FAAA 4PQIA 2R2JA 2EIRA 2OE1A 2RLIA 3EVIA 1OAZA 3DKSA 5G2ZA 4EKZA 1PL1A 2ES7A 1XFLA 2WFCA 1GSUA 1QFNA 2VCWA 2X99A 2L6CA 4K2DA 5G31A 3ZIVA 1FW1A 3F0IA 4V2LA 3US3A 3KM6A 1ZZYA 4MF6A 4N11A 4F0CA 1XG8A 2B7JA 2CV4A 4MF5A 2AV4A 3HA9A 4YAPA 12GSA 2CVKA 2GZYA 17GSA 5DVBA 3F4SA 2VLVA 1VF2A 1T7PB 1AUCA 5IPGA 4GF0A 3NZNA 3A5WA 1TOFA 2LSTA 4POMA 1JZRA 4ULXA 4X0XA 6GSSA 2IFQB 1ACVA 1PMTA 1UVZA 4AGSA 2OE0A 4HZ4A 4IVFA 1GNEA 4MJBA 4QL9A 5J5NA 2DJ0A 3GYKA 3Q74A 5EPFA 4IQ1A 5A5KA 1GNWA 20GSA 3IOSA 3A2VA 1XWCA 2GDRA 4USSA 1F37A 3QAVA 1Z5YE 1B4QA 2IL3A 4XTSA 2D2ZA 5D96A 1RK4A 5ECIB 1TU8A 3LGCA 3H79A 1YEPA 1WE0A 3WGXA 4OFTA 1GUHA 3C1RA 1YQ1A 2QGVA 1X9WB 1ILOA 3DXBA 2VL3A 3HZ8A 1E2YA 5JCWA 5JCUA 4BWQA 4EO3A 2LRTA 3WGDA 1AC1A 4AF2A 5C00A 3ZL5A 5IOWA 1N2AA 1M7TA 3ZREA 2QSIA 1PRXA 1A23A 5CRHA 4EVMA 2FY6A 4V1Ag 4WXTA 2NBSA 4XS4B 4BA7A 4MPGA 4DEJA 3NIVA 1J0FA 4EE0A 4NHZA 5A4VA 2VCTA 2FWEA 2B6MA 4GSTA 3H4KA 4PQHA 1KEBA 2O8VB 1GLPA 1THOA 2PBJA 1AXDA 1SENA 4K8MA 2IMFA 2YOIA 3WT1A 1SYXA 2A2RA 1R4WA 2H73A 5DAKA 3LXTA 5IMVA 5KN3A 3LEFA 2C8UA 4V2NA 1V2AA 5ECMB 2IN3A 3FR9A 2H6XA 4TXVA 2E2GA 2TRCP 4DSRA 3L0HA 1Y6EA 5LCZA 2I3YA 4JU5A 5KOXA 3QD9A 4MDCA 4GCIA 5KOWA 5AIVA 3CBUA 3CSIA 4PXOA 1WWJA 5GAND 4ID0A 2A4VA 1ZYNA 3KEBA 5B7CA 4JR4A 2HRFA 1A24A 2VUPA 1MD4A 4LA1A 1CQGA 4EDYA 3GTUB 1VRSD 3N9JA 1R5AA 3PH9A 1WPIA 14GSA 3VURA 5G1LA 4A5PA 4NAXA 3KXOA 3E0UA 3LYPA 4HU7A 4X4JA 1B9YC 4ILFA 3DYRA 5DJMA 1F3AA 1MDIA 4I2TA 2R0GA 4EXJA 2HYXA 3HVXA 4WEYA 2C1YA 3C8EA 4OMVA 4YH2A 4J56E 2WB9A 4K5RA 3WYWA 1USBA 2XPEA 3EYTA 4G10A 3RDWA 1XBSA 1OC3A 3D6IA 4NPBA 4YAVA 2CQ9A 1GRXA 2X8GA 1EEMA 1R7HA 1XVQA 5FT3A 2H1AA 3UARA 2VL2C 3SWLA 4Z2RA 2HSYA 4XIHA 5ECHB 4XCSA 2P5RA 1G6WA 4ZXGA 1EGRA 3FZAA 1URMA 1H4OA 4KSMA 3ZVJD 3FZ4A 4PNFA 4BVXA 5EY6A 4OO4A 1SJZA 3TJGA 1M9AA 2OA7A 1MDKA 2QC7A 2L5OA 5C04A 1XW9A 2IIYA 4GTUA 5E59A 3D0ZA 1T3BA 1K3OA 2C0EA 1ERWA 2QKEA 5HFIA 1A2MA 1ERTA 1BX9A 4XS6A 3KZQA 3H8QA 4OCEA 1V9WA 3KH9A 3D21A 4Q5QA 2L59A 3RPNA 3HY2A 1X5CA 1M0UA 2G0FA 1BQ7A 4OFNA 1NM3A 2ZNMA 2H0IA 3D5JA 3HKRA 3KTBA 1GWCA 1F6MC 3DVWA 1TW9A 3QAGA 3FW2A 2IJYA 5B6MA 3TGZA 2P5QA 1IYIA 4O92A 5CREA 1GH2A 5HFKA 2C4JA 1EWXA 2A2PA 1Y25A 2GSSA 1GSDA 4E8EA 2HRNA 4HJ2A 1Z7PA 4ZBDA 3I9V2 2FHEA 4CDOA 2H75A 3VPTA 5DQSA 1JZOA 4GSNA 4N10A 3EU4A 3HHVA 1F9MA 2BJXA 3D4MA 1S3AA 2VCQA 3GKNA 3GKKA 3O3TA 2DIYA 2FLSA 10GSA 6GSWA 2JSYA 2FWGA 4ZL7A 1K0DA 1FO5A 3DIEA 3LJRA 4HS1A 2B1LA 1HNAA 2K8VA 5B8AA 3G7JA 2H70A 7GSSA 3EC3A 1AQWA 2H0GA 1RQMA 4EL1A 4PQ1A 1YJ6A 3GH9A 3HVVA 1TJDA 2CAQA 3ZFLA 4O5UA 2C3QA 1XVWA 1TDIA 3A2WA 1W89A 2L4CA 3BJ5A 4OWYA 3VWWA 1SYRA 3TJBA 2J23A 2EC4A 1UA5A 2K18A 3A2XA 4K0NA 2MMNA 1YDKA 4GWRA 3HXSA 3ZMLA 1OE7A 2CZ3A 16GSA 1PGTA 22GSA 3CRUA 2YNXA 5FWGA 4CY8A 1TK5B 1MDJA 1WRYA 3GN3A 2YWNA 2YV9A 4F03A 1Z9HA 4FH8A 2R3XA 5IMCA 4LL4B 2WULA 1YZXA 2MMZA 4WR4A 3APQA 5F8BA 4NWYA 3L9SA 5LD0A 1FB6A 1BYEA 1XIYA 1PX6A 2PMTA 1EP7A 2NDOA 4FYUA 2YZHA 4AJ7A 5A4UA 1U88A 4ECIA 2YP6A 5DALB 5KN1A 1M3IA 2E0QA 1T1VA 1A0FA 1T00A 5IQYA 2TIRA 2R5GA 3O76A 4GQCA 4GLTA 3I43A 2GT5A 3D4TA 6GSUA 3ZITA 1FOHA 3FY7A 4FQUA 2HRKA 5D73A 4TR4A 2CA8A 5JWQB 2DKHA 1TRWA 2HSMA 2WJUA 5J4UA 2QA1A 1B48A 1O81A 3M9JA 4D73B 3GKMA 4HU9A 2B5YA 2PU9C 2H8LA 4IQAA 5IMAA 3VLNA 2VM2A 1HNCA 2XHFA 2E7PA 1AAZA 3PPUA 4LMVA 3KH7A 3GX8A 3UL3A 3F4RA 4ZILA 2V2GA 1TU7A 2YJHA 2VL2A 3KIJA 4TXOB 4N0ZA 3FKFA 1U3IA 4Z2UA 1MTCA 2OBIA 2FCHA 2PWJA 3MAKA 2Z9SA 5HR1A 2HZEB 3UVTA 2CX3A 1G0TA 3F8UA 1JFUA 3RHCA 2LKUA 5DCGA 5E4WA 2OJLA 2YV7A 1O6JA 1ABAA 4ZB8A 2FNOA 4KH7A 4XRAA 4BPYA 3GSTA 2VLUA 1ERUA 4GRFA 2DIZA 1SD9A 2VLTA 4BL7A 3FZ5A 2GZZA 4KUNA 4OD7A 2LJAA 3IDVA 4BIKA 3Q19A 3Q6OA 4PUFC 1HD2A 4F9ZA 4TW5A 2RIIA 5F06A 1NSWA 2CX4A 3KTLA 1JZWA 4HJMA 4G0KA 5CP1A 5J9BA 2X4AA 2CVDA 5A4WA 3CTFA 4IJIA 3M9KA 3IE3A 3GSSA 3IR4A 1ST9A 4G2EA 2G2QA 2X49A 1A0RP 3M0FA 1SJIA 3A3TA 2CZ2A 2IPAA 2R37A 3L9VA 4MH2A 3ZRDA 1JLWA 4LMWA 1ZL9A 1DSBA 4MZBA 4ZB6A 1J08A 1TI3A 3LXZA 2AJQB 2LJRA 2GSRA 1Z7RA 4MLYA 1TK0B 1O73A 2REMA 1DE2A 2C3TA 4Q5RA 4ECCA 3TB2A 4OFMA 5FHIA 2FWFA 2FWHA 5ID2B 2VCXA 1GL8A 1X5DA 4ML1A 3J7Yb 1SJ6A 3BCKA 4K9ZA 4N0VA 5CAXA 4AJ8A 1PQNA 3GIXA 4FYBA 3TJJA 3ZZXA 4K7NA 2VAFA 4IW9A 2LTKA 3UEMA 3GX0A 4MH3A 2L57A 2GS3A 4PGTA 1GTBA 5D9WA 5J9CA 2IMKA 3P8WA 5IO0A 2GQMA 3BOAA 2O89A 2O7KA 3A5IA 3LWAA 2I1UA 4DSSB 4BVYA 4EF0A 2YWIA 1WIKA 3EINA 3GH6A 1FB0A 2YPMA 4RQXA 3TJKA 4FO5A 4POKA 4QL7A 3TCOA 3IHGA 1ZYPA 2H1DA 2XBQA 1PKZA 5JWRB 1M3JA 1QK8A 2OKAA 4MNNA 1WP0A 5GAPD 1H75A 2PN8A 2VD1A 3MSZA 1XOBA 3HJPA 3ZMKA 5CO3A 2H74A 3E9JB 3TOTA 2VCVA 4POLA 3W8SA 4KCEA 3GRXA 2B5EA 5F07A 4H86A 1OC9A 5IOXA 5JWOB 4ECBA 3ERFA 1ZMAA 2HZFA 3IXRA 1HYUA 5IMDA 4I97A 4CW9A 9GSSA 2XC2A 4IKHA 1U6TA 3SBCA 3P90A 4EIPA 4G19A 2P31A 2F9SA 5ECNB 2V32A 3ERGA 3IA1A 5ECKB 8GSSA 3RPPA 4TOPA 2AUVA 3H93A 4HDEA 1XCCA 2M72A 2DMMA 2DKIA 4NMUA 3APSA 1M2BA 2YN1A 2VOCA 2B1KA 4FIWA 4WBRD 1WOUA 1N8JA 1K0BA 3DMLA 2RUEA 3TKRA 3QOUA 1XWGA 4HUAA 4KDYA 5F0GA 4L8EA 4K6XA 4TRXA 5CNWA 5F05A 4F0BA 1OYJA 3APOA 1SL2B 4TKYA 1K0OA 1Z6NA 1JHBA 2C3NA 3LG6A 1ZYEA 2TRXA 4K7OA 3VI5A 5KEJA 3CYNA 3G9BA 3ME8A 4KAEA 4N30A 3ZLPA 1R5PA 3CRTA 3C1SA 3M3MA 2RUFA 3PGTA 1LJRA 2CVBA 1EGOA 3LQ7A 4MJEA 3LORA 3GA4A 1O85A 2J9HA 1A8LA 4I2UA 2VO4A 3GL3A 3QR6A 3GHAA 1V40A
chains in the Genus database with same CATH topology
2IMDA 3EWLA 2JACA 4NHWA 2KP2A 1ON4A 2LNSA 1TKDB 3P7XA 1SKRB 3ISOA 1V58A 2JL4A 2LS5A 3J7Yk 2IFQA 3G7YA 5AISA 5BRTA 1T4ZA 2H1GA 3IPZA 4MABA 4BL7B 1GTAA 3HCZA 4L5OA 4ACSA 3KD0A 2MMOA 3EE2A 3L4NA 3MDKA 1SK2A 2A2SA 3C7MA 2K8SA 19GSA 1EOGA 3DD3A 4MA9A 4IS0A 4EUYA 2H72A 1W4VA 3D22A 2V41A 1VF1A 2MMAA 3BBYA 2PPTA 18GSA 4PX1A 1XWAA 2NTOA 1HNBA 4TR1A 4JEDA 4K1FA 4LL1B 2DJ1A 4YKFA 2HLSA 4X1UA 2F3MA 1K0CA 1EOHA 2P0GA 3UOMA 3VI7A 5JCGA 4JRRA 4KCAA 2V6KA 3P2AA 2CAIA 4G9HA 1YKAA 2DSAA 2DJJA 4MCUA 2HFDA 4RI6A 4CHSA 3F63A 2I4AA 1PKWA 6GSTA 4QQ7A 2N5AA 2LNTA 1K0AA 4NV5A 3GL5A 4XS4A 1ERVA 2RM5A 3FHKA 2CT6A 4RUVA 2JZRA 5DDLA 3KCMA 4NXIA 3UAPA 1SKWB 1T4YA 2C0GA 4BWSA 3EMXA 3BCIA 4P3YB 3VK9A 11GSA 3OR5A 2X8HA 3LYKA 3IBHA 2JU5A 1O8XA 4Q5FA 2PVQA 1OKTA 2GZPA 2H6ZA 3IK7A 1SD8A 2LQQA 1LU4A 3M1GA 4KA0A 4IHUA 2JZSA 2X8CA 5DAKB 5D9VA 3FMWA 2HNLA 5ECQB 1GTUA 3TKPA 2VD0A 1JZDA 1Q98A 2H19A 4V1Ap 4KE3A 5H5RA 1EP8A 1QUWA 5ECLB 1VF4A 1GSYA 4WBJA 3GNJA 2LUSA 1PD21 2EIOA 5CRGA 1TXXA 3K8NA 2KUCA 4FYCA 4O5RA 2N5FA 1T8EB 2QA2A 4MZWA 2KOKA 2HE3A 3VWVA 5H5QA 1O7UA 1A2LA 1XXUA 4IP1A 4MK3A 1GSSA 5CRDA 2R0PA 4NV2A 1FOVA 2YZUA 2LV3A 4O32A 2IMIA 3ME7A 4XRDA 3H1NA 1XPVA 4AJ6A 2C0DA 2YJ7A 3EPTA 4KDXA 1B4PA 1YEXA 2DMLA 2E2MA 5B8BA 1WMJA 4HI7A 4L5LA 5DJLA 4JE1A 1EV4A 2GSQA 3CXGA 1THXA 4YQVA 3JCML 2H1BA 6GSXA 1RW1A 3V1WA 3UVHA 3ZYWA 3TOUA 1BEDA 3R3EA 5GSSA 2FA4A 4KB3A 1TK8B 2I9HA 1PA3A 2AYTA 1YF1A 2DJKA 3E3EA 3RBTA 1IYHA 3MYDA 1J9BA 2HRAA 2WGRA 4ZL8A 5HR2A 4EDZA 3W6GA 4BVXB 5ELGA 2WZ9A 2PUKC 3QMXA 4RI7A 1QQ2A 2XPDA 5COHA 1EZKA 2V6OA 2EIQA 1YY7A 1M2DA 4F82A 3ED3A 4K2XA 5AN1A 4ISDA 3HZ4A 2C0FA 2YWOA 3FRCA 3U6VA 5ELAA 1GUKA 4MF7A 4E8HA 1E6BA 4MJAA 3IC8A 4CY6A 4PUAA 3QFBC 3RHBA 3GKXA 4DSQA 2VIMA 2K6VA 5ECPB 3RAZA 2OACA 2M46A 3HVSA 3N5OA 2KHPA 4L0WA 6GSVA 4YKGA 2B7KA 2AB6A 2GSTA 6GSYA 3L78A 4XS1A 3QDNA 1M99A 1XWBA 1BG5A 5AGYA 3F3QA 1AW9A 2ON5A 3CMIA 2H71A 2FA8A 4ZB9A 3KP9A 1DUGA 4ML6A 5G5EA 1S3DA 1AIUA 4MMMA 4TR1B 5ECSA 5DBQA 3PR8A 1MD3A 4PTSA 2HI7A 2NVLA 5D8IA 1G7EA 3S9FA 2ON7A 1B8XA 2DLXA 3ZIJA 3EU3A 1VGLA 2AAWA 4ECJA 1UN2A 2F8AA 3UJ1A 5ENUA 4F2IA 5BMUA 1XW6A 1TRUA 5ABRA 4JR6A 3CSHA 1OC8A 3UBKA 1GULA 3MIXA 2R6KA 2YCDA 4GSSA 1M2AA 5HR3A 1OKDA 1FG4A 3TKSE 2DJ2A 1YKCA 3IHQA 2FGXA 1KBNA 1TRVA 3HYPA 3IK9A 1AQXA 3FK8A 4WETA 4ZBAA 3HD5A 3DRNA 5KN0A 2PERA 3C71A 1OE8A 2GTUA 5LNKe 4IELA 3KGKA 4K7IA 4TR0A 4TR3A 2R0CA 1DE1A 2GLRA 2ALBA 2MBTA 1ZYQB 1WJKA 4O5QA 4I5QA 2FUG2 2WCIA 2KLXA 1V98A 1OVNA 1A2JA 3TUEA 13GSA 1TRSA 3KMNA 3VFIA 1GTIA 4DVCA 1LBKA 5G5FA 1GLQA 1F2EA 3TDGA 2HT9A 4MP4A 5GSTA 2BTOT 1I9DA 1SK1A 4XHMA 1K3YA 5DALA 3IC4A 3LSZA 1U87A 3KP8A 2ZCTA 3WT2A 4OCFA 3I69A 2R4VA 1X9SB 4IGJA 4IP6A 3TJFA 3WD6A 3ZFBA 2OADA 4I6XA 3IV4A 3IAM2 4KF9A 5HQPA 3TKSC 3WGEA 5D9XA 4EIQA 4JBBA 4EC0A 2GQKA 2AHEA 1PSQA 3AY8A 2VL9A 5IMFA 1GP1A 4LLRA 5DQYA 4D73A 5HFGA 3F4TA 5GZZB 1CQHA 3LW9A 2GQLA 4PNGA 1MEKA 2IMEA 3ZVJA 1XW5A 1G6YA 1EV9A 5EVOA 5ECOB 5IO2A 3ERWA 3U5RE 3QAWA 1X5EA 3VWXA 3BD2A 3KJYA 5L71A 3QPMA 2BMXA 3UBLA 1UC7A 3MWHA 2F8FA 4HOJA 4OO5A 2JADA 5D93A 4TXOA 1V57A 3ZTLA 2K9FA 5EL8A 1XOAA 4KW6A 2HZEA 4RQRA 2F51A 1AQVA 1BAYA 2HSHA 4TN8A 5H5SA 4Z7XA 4WF5A 4YQUA 2FD3A 5IM9A 4MZCA 3GMFA 2H30A 3FYGA 3F6DA 4J2FA 1FVJA 4HZ2A 2YANA 5KN2A 1GSFA 3EMPA 5INYA 2O87A 3Q18A 3KMOA 4HQSA 3CTGA 1Z3EA 2L4QA 1K0MA 1ZGNA 3HJOA 1KNGA 1M9BA 1PX7A 3FR3A 1A8YA 2LQOA 4KSOA 2DBCA 1NHYA 2KP1A 2C80A 1GSQA 5DCHA 2IWTA 1I5GA 3C73A 4G0IA 3HDCA 3UIWA 2PGTA 5G1KA 4Q5NA 3VWUA 4MPFA 4MJCA 2N5BA 3TKQA 1TI1A 1HQOA 4K0GA 2H6YA 1SL1B 5HR0A 3M8NA 3F9UA 3TRPA 4X43A 2I81A 5ID2A 2H66A 3QCPA 4J57E 3F3RA 3TRXA 2LEGA 1Z6MA 2M80A 4ZIJA 1K0NA 4WF4A 3DVXA 1PN0A 2OBKA 4TVEA 1C72A 4IN0A 5G30A 3FEUA 2LJKA 1PL2A 1TTZA 4L0UA 3GURA 2X64A 1KTEA 2OE3A 2MZCA 1SU9A 4ZBBA 1TP9A 2V1MA 2WS2A 1GUMA 1R26A 1X9MB 1ML6A 1Q4JA 2PVOC 1G7OA 3O6TA 2VM1A 1F3BA 2XBIA 4POBA 5J3RA 2YWMA 3VPQA 2H0HA 2MYGA 2H01A 3NOFA 5CRWA 4DSSA 4KX4A 3QFAC 1SL0B 2H76A 1DBYA 3CSJA 1VF3A 1FVKA 3IAS2 4WR5A 1PN9A 4G0LA 2L5LA 1U3AA 4BVYB 1NHOA 5AIXA 5ECRB 3GUSA 1FHEA 1JLVA 2JSZA 4I8BA 2UZ8A 3R2QA 4GQFA 1ZOFA 2WRTA 2WDUA 1XZOA 4ZL9A 1QMVA 2LRNA 3DGQA 5IIZA 4JZQA 3MNGA 1QXHA 2O85A 4HQZA 1K3LA 1SKSB 1EEJA 3FZ9A 4ICYA 1XWKA 2DJ3A 4IBPA 3GTUA 4GXZA 2GGTA 2RM6A 4V2MA 2HXKA 3DEXA 1BJXA 4O7HA 1OC9B 3TRQA 4IJ3A 5B6NA 2L6DA 2GT6A 1NW2A 3LFLA 4HEA2 2A4HA 3FR6A 2DC5A 2GVPA 1GSEA 2B5XA 2LRCA 4KNDA 1O8WA 3PINA 4KDUA 3G7IA 3W8JA 2JZTA 3EURA 1QGVA 5D9TA 4Z2TA 1B9XC 1YF0A 5CYYA 1ZCPA 2MBSA 3TKSA 3DWVA 2VCZA 1S3CA 3IRAA 5IPHA 4YQMA 5IMZA 4KGIA 4WKWA 3L9UA 4K5SA 3GFKA 1X0RA 2NPBA 3GV1A 3UMAA 2ZUPA 3I6AA 4PURA 1SK0A 5J41A 3HJMA 2B3SA 3F6FA 1FAAA 4PQIA 2R2JA 2EIRA 2OE1A 2RLIA 3EVIA 1OAZA 3DKSA 5G2ZA 4EKZA 1PL1A 2ES7A 1XFLA 2WFCA 1GSUA 1QFNA 2VCWA 2X99A 2L6CA 4K2DA 5G31A 3ZIVA 1FW1A 3F0IA 4V2LA 3US3A 3KM6A 1ZZYA 4MF6A 4N11A 4F0CA 2B7JA 2CV4A 4MF5A 2AV4A 3HA9A 4YAPA 12GSA 2CVKA 2GZYA 17GSA 5DVBA 3F4SA 2VLVA 1VF2A 1T7PB 1AUCA 5IPGA 4GF0A 3NZNA 3A5WA 1TOFA 2LSTA 4POMA 1JZRA 4ULXA 4X0XA 6GSSA 2IFQB 1ACVA 1PMTA 1UVZA 4AGSA 2OE0A 4HZ4A 4IVFA 1GNEA 4MJBA 4QL9A 5J5NA 2DJ0A 3GYKA 3Q74A 5EPFA 4IQ1A 5A5KA 1GNWA 20GSA 3IOSA 3A2VA 1XWCA 2GDRA 4USSA 1F37A 3QAVA 1Z5YE 1B4QA 2IL3A 4XTSA 2D2ZA 5D96A 1RK4A 5ECIB 1TU8A 3LGCA 3H79A 1YEPA 1WE0A 3WGXA 4OFTA 1GUHA 3C1RA 1YQ1A 2QGVA 1X9WB 1ILOA 3DXBA 2VL3A 3HZ8A 1E2YA 5JCWA 5JCUA 4BWQA 4EO3A 2LRTA 3WGDA 1AC1A 4AF2A 5C00A 3ZL5A 5IOWA 1N2AA 1M7TA 3ZREA 2QSIA 1PRXA 1A23A 5CRHA 4EVMA 2FY6A 4V1Ag 4WXTA 2NBSA 4XS4B 4BA7A 4MPGA 4DEJA 3NIVA 1J0FA 4EE0A 4NHZA 5A4VA 2VCTA 2FWEA 2B6MA 4GSTA 3H4KA 4PQHA 1KEBA 2O8VB 1GLPA 1THOA 2PBJA 1AXDA 1SENA 4K8MA 2IMFA 2YOIA 3WT1A 1SYXA 2A2RA 1R4WA 2H73A 5DAKA 3LXTA 5IMVA 5KN3A 3LEFA 2C8UA 4V2NA 1V2AA 5ECMB 2IN3A 3FR9A 2H6XA 4TXVA 2E2GA 2TRCP 4DSRA 3L0HA 1Y6EA 5LCZA 2I3YA 4JU5A 5KOXA 3QD9A 4MDCA 4GCIA 5KOWA 5AIVA 3CBUA 3CSIA 4PXOA 1WWJA 5GAND 4ID0A 2A4VA 1ZYNA 3KEBA 5B7CA 4JR4A 2HRFA 1A24A 2VUPA 1MD4A 4LA1A 1CQGA 4EDYA 3GTUB 1VRSD 3N9JA 1R5AA 3PH9A 1WPIA 14GSA 3VURA 5G1LA 4A5PA 4NAXA 3KXOA 3E0UA 3LYPA 4HU7A 4X4JA 1B9YC 4ILFA 3DYRA 5DJMA 1F3AA 1MDIA 4I2TA 2R0GA 4EXJA 2HYXA 3HVXA 4WEYA 2C1YA 3C8EA 4OMVA 4YH2A 4J56E 2WB9A 4K5RA 3WYWA 1USBA 2XPEA 3EYTA 4G10A 3RDWA 1XBSA 1OC3A 3D6IA 4NPBA 4YAVA 2CQ9A 1GRXA 2X8GA 1EEMA 1R7HA 1XVQA 5FT3A 2H1AA 3UARA 2VL2C 3SWLA 4Z2RA 2HSYA 4XIHA 5ECHB 4XCSA 2P5RA 1G6WA 4ZXGA 1EGRA 3FZAA 1URMA 1H4OA 4KSMA 3ZVJD 3FZ4A 4PNFA 4BVXA 5EY6A 4OO4A 1SJZA 3TJGA 1M9AA 2OA7A 1MDKA 2QC7A 2L5OA 5C04A 1XW9A 2IIYA 4GTUA 5E59A 3D0ZA 1T3BA 1K3OA 2C0EA 1ERWA 2QKEA 5HFIA 1A2MA 1ERTA 1BX9A 4XS6A 3KZQA 3H8QA 4OCEA 1V9WA 3KH9A 3D21A 4Q5QA 2L59A 3RPNA 3HY2A 1X5CA 1M0UA 2G0FA 1BQ7A 4OFNA 1NM3A 2ZNMA 2H0IA 3D5JA 3HKRA 3KTBA 1GWCA 1F6MC 3DVWA 1TW9A 3QAGA 3FW2A 2IJYA 5B6MA 3TGZA 2P5QA 1IYIA 4O92A 5CREA 1GH2A 5HFKA 2C4JA 1EWXA 2A2PA 1Y25A 2GSSA 1GSDA 4E8EA 2HRNA 4HJ2A 1Z7PA 4ZBDA 3I9V2 2FHEA 4CDOA 2H75A 3VPTA 5DQSA 1JZOA 4GSNA 4N10A 3EU4A 3HHVA 1F9MA 2BJXA 3D4MA 1S3AA 2VCQA 3GKNA 3GKKA 3O3TA 2DIYA 2FLSA 10GSA 6GSWA 2JSYA 2FWGA 4ZL7A 1K0DA 1FO5A 3DIEA 3LJRA 4HS1A 2B1LA 1HNAA 2K8VA 5B8AA 3G7JA 2H70A 7GSSA 3EC3A 1AQWA 2H0GA 1RQMA 4EL1A 4PQ1A 1YJ6A 3GH9A 3HVVA 1TJDA 2CAQA 3ZFLA 4O5UA 2C3QA 1XVWA 1TDIA 3A2WA 1W89A 2L4CA 3BJ5A 4OWYA 3VWWA 1SYRA 3TJBA 2J23A 2EC4A 1UA5A 2K18A 3A2XA 4K0NA 2MMNA 1YDKA 4GWRA 3HXSA 3ZMLA 1OE7A 2CZ3A 16GSA 1PGTA 22GSA 3CRUA 2YNXA 5FWGA 4CY8A 1TK5B 1MDJA 1WRYA 3GN3A 2YWNA 2YV9A 4F03A 1Z9HA 4FH8A 2R3XA 5IMCA 4LL4B 2WULA 1YZXA 2MMZA 4WR4A 3APQA 5F8BA 4NWYA 3L9SA 5LD0A 1FB6A 1BYEA 1XIYA 1PX6A 2PMTA 1EP7A 2NDOA 4FYUA 2YZHA 4AJ7A 5A4UA 1U88A 4ECIA 2YP6A 5DALB 5KN1A 2E0QA 1T1VA 1A0FA 1T00A 5IQYA 2TIRA 2R5GA 3O76A 4GQCA 4GLTA 3I43A 2GT5A 3D4TA 6GSUA 3ZITA 1FOHA 3FY7A 4FQUA 2HRKA 5D73A 4TR4A 2CA8A 5JWQB 2DKHA 1TRWA 2HSMA 2WJUA 5J4UA 2QA1A 1B48A 1O81A 3M9JA 4D73B 3GKMA 4HU9A 2B5YA 2PU9C 2H8LA 4IQAA 5IMAA 3VLNA 2VM2A 1HNCA 2XHFA 2E7PA 1AAZA 3PPUA 4LMVA 3KH7A 3GX8A 3UL3A 3F4RA 4ZILA 2V2GA 1TU7A 2YJHA 2VL2A 3KIJA 4TXOB 4N0ZA 3FKFA 1U3IA 4Z2UA 1MTCA 2OBIA 2FCHA 2PWJA 3MAKA 2Z9SA 5HR1A 2HZEB 3UVTA 2CX3A 1G0TA 3F8UA 1JFUA 3RHCA 2LKUA 5DCGA 5E4WA 2OJLA 2YV7A 1O6JA 1ABAA 4ZB8A 2FNOA 4KH7A 4XRAA 4BPYA 3GSTA 2VLUA 1ERUA 4GRFA 2DIZA 1SD9A 2VLTA 4BL7A 3FZ5A 2GZZA 4KUNA 4OD7A 2LJAA 3IDVA 3Q19A 3Q6OA 4PUFC 1HD2A 4F9ZA 4TW5A 2RIIA 5F06A 1NSWA 2CX4A 3KTLA 1JZWA 4HJMA 4G0KA 5CP1A 5J9BA 2X4AA 2CVDA 5A4WA 3CTFA 4IJIA 3M9KA 3IE3A 3GSSA 3IR4A 1ST9A 4G2EA 2G2QA 2X49A 1A0RP 3M0FA 1SJIA 3A3TA 2CZ2A 2IPAA 2R37A 3L9VA 4MH2A 3ZRDA 1JLWA 4LMWA 1ZL9A 1DSBA 4MZBA 4ZB6A 1J08A 1TI3A 3LXZA 2AJQB 2LJRA 2GSRA 1Z7RA 4MLYA 1TK0B 1O73A 2REMA 1DE2A 2C3TA 4Q5RA 4ECCA 3TB2A 4OFMA 5FHIA 2FWFA 2FWHA 5ID2B 2VCXA 1GL8A 1X5DA 4ML1A 3J7Yb 1SJ6A 3BCKA 4K9ZA 4N0VA 5CAXA 4AJ8A 1PQNA 3GIXA 4FYBA 3TJJA 3ZZXA 4K7NA 2VAFA 4IW9A 2LTKA 3UEMA 3GX0A 4MH3A 2L57A 2GS3A 4PGTA 1GTBA 5D9WA 5J9CA 2IMKA 3P8WA 5IO0A 2GQMA 3BOAA 2O89A 2O7KA 3A5IA 3LWAA 2I1UA 4DSSB 4BVYA 4EF0A 2YWIA 1WIKA 3EINA 3GH6A 1FB0A 2YPMA 4RQXA 3TJKA 4FO5A 4POKA 4QL7A 3TCOA 3IHGA 1ZYPA 2H1DA 2XBQA 1PKZA 5JWRB 1QK8A 2OKAA 4MNNA 1WP0A 5GAPD 1H75A 2PN8A 2VD1A 3MSZA 1XOBA 3HJPA 3ZMKA 5CO3A 2H74A 3E9JB 3TOTA 2VCVA 4POLA 3W8SA 4KCEA 3GRXA 2B5EA 5F07A 4H86A 1OC9A 5IOXA 5JWOB 4ECBA 3ERFA 1ZMAA 2HZFA 3IXRA 1HYUA 5IMDA 4I97A 4CW9A 9GSSA 2XC2A 4IKHA 1U6TA 3SBCA 3P90A 4EIPA 4G19A 2P31A 2F9SA 5ECNB 2V32A 3ERGA 3IA1A 5ECKB 8GSSA 3RPPA 4TOPA 2AUVA 3H93A 4HDEA 1XCCA 2M72A 2DMMA 2DKIA 4NMUA 3APSA 1M2BA 2YN1A 2VOCA 2B1KA 4FIWA 4WBRD 1WOUA 1N8JA 1K0BA 3DMLA 2RUEA 3TKRA 3QOUA 1XWGA 4HUAA 4KDYA 5F0GA 4L8EA 4K6XA 4TRXA 5CNWA 5F05A 4F0BA 1OYJA 3APOA 1SL2B 4TKYA 1K0OA 1Z6NA 1JHBA 2C3NA 3LG6A 1ZYEA 2TRXA 4K7OA 3VI5A 5KEJA 3CYNA 3G9BA 3ME8A 4KAEA 4N30A 3ZLPA 1R5PA 3CRTA 3C1SA 3M3MA 2RUFA 3PGTA 1LJRA 2CVBA 1EGOA 3LQ7A 4MJEA 3LORA 3GA4A 1O85A 2J9HA 1A8LA 4I2UA 2VO4A 3GL3A 3QR6A 3GHAA 1V40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMD A;  3EWL A;  2JAC A;  4NHW A;  2KP2 A;  1ON4 A;  2LNS A;  1TKD B;  3P7X A;  1SKR B;  3ISO A;  1V58 A;  2JL4 A;  2LS5 A;  3J7Y k;  2IFQ A;  3G7Y A;  5AIS A;  1T4Z A;  2H1G A;  3IPZ A;  4MAB A;  1GTA A;  3HCZ A;  4L5O A;  4ACS A;  3KD0 A;  2MMO A;  3EE2 A;  3L4N A;  3MDK A;  1SK2 A;  2A2S A;  3C7M A;  2K8S A;  19GS A;  1EOG A;  3DD3 A;  4MA9 A;  4IS0 A;  4EUY A;  2H72 A;  1W4V A;  3D22 A;  2V41 A;  1VF1 A;  2MMA A;  3BBY A;  2PPT A;  18GS A;  4PX1 A;  1XWA A;  2NTO A;  1HNB A;  4TR1 A;  4JED A;  4K1F A;  4LL1 B;  2DJ1 A;  2HLS A;  4X1U A;  2F3M A;  1K0C A;  1EOH A;  2P0G A;  3UOM A;  3VI7 A;  5JCG A;  4JRR A;  4KCA A;  2V6K A;  3P2A A;  2CAI A;  4G9H A;  1YKA A;  2DSA A;  2DJJ A;  4MCU A;  2HFD A;  4RI6 A;  4CHS A;  3F63 A;  2I4A A;  1PKW A;  6GST A;  4QQ7 A;  2N5A A;  2LNT A;  1K0A A;  4NV5 A;  3GL5 A;  4XS4 A;  1ERV A;  2RM5 A;  3FHK A;  2CT6 A;  4RUV A;  2JZR A;  5DDL A;  3KCM A;  4NXI A;  3UAP A;  1SKW B;  1T4Y A;  2C0G A;  4BWS A;  3EMX A;  3BCI A;  4P3Y B;  3VK9 A;  11GS A;  3OR5 A;  2X8H A;  3LYK A;  3IBH A;  2JU5 A;  1O8X A;  4Q5F A;  2PVQ A;  1OKT A;  2GZP A;  2H6Z A;  3IK7 A;  1SD8 A;  2LQQ A;  1LU4 A;  3M1G A;  4KA0 A;  4IHU A;  2JZS A;  2X8C A;  5DAK B;  5D9V A;  2HNL A;  5ECQ B;  1GTU A;  3TKP A;  2VD0 A;  1JZD A;  1Q98 A;  2H19 A;  4V1A p;  4KE3 A;  5H5R A;  1EP8 A;  1QUW A;  5ECL B;  1VF4 A;  1GSY A;  4WBJ A;  3GNJ A;  2LUS A;  1PD2 1;  2EIO A;  5CRG A;  1TXX A;  3K8N A;  2KUC A;  4FYC A;  4O5R A;  2N5F A;  1T8E B;  4MZW A;  2KOK A;  2HE3 A;  3VWV A;  5H5Q A;  1O7U A;  1A2L A;  1XXU A;  4IP1 A;  4MK3 A;  1GSS A;  5CRD A;  4NV2 A;  1FOV A;  2YZU A;  2LV3 A;  4O32 A;  2IMI A;  3ME7 A;  4XRD A;  3H1N A;  1XPV A;  4AJ6 A;  2C0D A;  2YJ7 A;  4KDX A;  1B4P A;  1YEX A;  2DML A;  2E2M A;  5B8B A;  1WMJ A;  4HI7 A;  4L5L A;  5DJL A;  4JE1 A;  1EV4 A;  2GSQ A;  3CXG A;  1THX A;  4YQV A;  3JCM L;  2H1B A;  6GSX A;  1RW1 A;  3V1W A;  3UVH A;  3ZYW A;  3TOU A;  1BED A;  5GSS A;  2FA4 A;  4KB3 A;  1TK8 B;  2I9H A;  1PA3 A;  2AYT A;  1YF1 A;  2DJK A;  3E3E A;  3RBT A;  1IYH A;  1J9B A;  2WGR A;  4ZL8 A;  5HR2 A;  4EDZ A;  3W6G A;  5ELG A;  2WZ9 A;  2PUK C;  3QMX A;  4RI7 A;  1QQ2 A;  2XPD A;  5COH A;  1EZK A;  2V6O A;  2EIQ A;  1YY7 A;  1M2D A;  4F82 A;  3ED3 A;  5AN1 A;  4ISD A;  3HZ4 A;  2C0F A;  2YWO A;  3FRC A;  3U6V A;  5ELA A;  1GUK A;  4MF7 A;  4E8H A;  1E6B A;  4MJA A;  4PUA A;  3QFB C;  3RHB A;  3GKX A;  4DSQ A;  2VIM A;  2K6V A;  5ECP B;  3RAZ A;  2OAC A;  2M46 A;  3HVS A;  3N5O A;  2KHP A;  4L0W A;  6GSV A;  2B7K A;  2AB6 A;  2GST A;  6GSY A;  3L78 A;  4XS1 A;  3QDN A;  1M99 A;  1XWB A;  1BG5 A;  5AGY A;  3F3Q A;  1AW9 A;  2ON5 A;  3CMI A;  2H71 A;  2FA8 A;  4ZB9 A;  3KP9 A;  1DUG A;  4ML6 A;  5G5E A;  1S3D A;  1AIU A;  4MMM A;  4TR1 B;  5ECS A;  5DBQ A;  3PR8 A;  1MD3 A;  2HI7 A;  2NVL A;  5D8I A;  1G7E A;  3S9F A;  2ON7 A;  1B8X A;  2DLX A;  3ZIJ A;  3EU3 A;  1VGL A;  2AAW A;  4ECJ A;  1UN2 A;  2F8A A;  3UJ1 A;  5ENU A;  4F2I A;  1XW6 A;  1TRU A;  5ABR A;  4JR6 A;  3CSH A;  1OC8 A;  3UBK A;  1GUL A;  2R6K A;  2YCD A;  4GSS A;  1M2A A;  5HR3 A;  1OKD A;  1FG4 A;  3TKS E;  2DJ2 A;  1YKC A;  3IHQ A;  2FGX A;  1KBN A;  1TRV A;  3HYP A;  3IK9 A;  1AQX A;  3FK8 A;  4WET A;  4ZBA A;  3HD5 A;  3DRN A;  5KN0 A;  2PER A;  3C71 A;  1OE8 A;  2GTU A;  5LNK e;  4IEL A;  3KGK A;  4K7I A;  4TR0 A;  4TR3 A;  1DE1 A;  2GLR A;  2ALB A;  2MBT A;  1ZYQ B;  1WJK A;  4I5Q A;  2FUG 2;  2WCI A;  2KLX A;  1V98 A;  1OVN A;  1A2J A;  3TUE A;  13GS A;  1TRS A;  3KMN A;  3VFI A;  1GTI A;  4DVC A;  1LBK A;  5G5F A;  1GLQ A;  1F2E A;  3TDG A;  2HT9 A;  4MP4 A;  5GST A;  2BTO T;  1I9D A;  1SK1 A;  4XHM A;  1K3Y A;  5DAL A;  3IC4 A;  3LSZ A;  1U87 A;  3KP8 A;  2ZCT A;  3WT2 A;  4OCF A;  3I69 A;  2R4V A;  1X9S B;  4IGJ A;  4IP6 A;  3TJF A;  3WD6 A;  3ZFB A;  2OAD A;  4I6X A;  3IV4 A;  3IAM 2;  5HQP A;  3TKS C;  3WGE A;  5D9X A;  4JBB A;  4EC0 A;  2GQK A;  2AHE A;  1PSQ A;  3AY8 A;  2VL9 A;  5IMF A;  1GP1 A;  4LLR A;  5DQY A;  4D73 A;  5HFG A;  3F4T A;  5GZZ B;  1CQH A;  2GQL A;  4PNG A;  1MEK A;  2IME A;  3ZVJ A;  1XW5 A;  1G6Y A;  1EV9 A;  5EVO A;  5ECO B;  5IO2 A;  3ERW A;  3U5R E;  3QAW A;  1X5E A;  3VWX A;  3BD2 A;  3KJY A;  5L71 A;  3QPM A;  2BMX A;  3UBL A;  1UC7 A;  3MWH A;  2F8F A;  4HOJ A;  4OO5 A;  2JAD A;  5D93 A;  4TXO A;  1V57 A;  3ZTL A;  2K9F A;  5EL8 A;  1XOA A;  4KW6 A;  2HZE A;  4RQR A;  2F51 A;  1AQV A;  1BAY A;  2HSH A;  4TN8 A;  5H5S A;  4Z7X A;  4WF5 A;  4YQU A;  2FD3 A;  5IM9 A;  4MZC A;  3GMF A;  2H30 A;  3FYG A;  3F6D A;  4J2F A;  1FVJ A;  4HZ2 A;  2YAN A;  5KN2 A;  1GSF A;  3EMP A;  5INY A;  2O87 A;  3Q18 A;  3KMO A;  4HQS A;  3CTG A;  1Z3E A;  2L4Q A;  1K0M A;  1ZGN A;  3HJO A;  1KNG A;  1M9B A;  1PX7 A;  3FR3 A;  1A8Y A;  2LQO A;  4KSO A;  2DBC A;  1NHY A;  2KP1 A;  2C80 A;  1GSQ A;  5DCH A;  2IWT A;  1I5G A;  3C73 A;  3HDC A;  3UIW A;  2PGT A;  5G1K A;  4Q5N A;  3VWU A;  4MPF A;  4MJC A;  2N5B A;  3TKQ A;  1TI1 A;  1HQO A;  4K0G A;  2H6Y A;  1SL1 B;  5HR0 A;  3M8N A;  3F9U A;  3TRP A;  4X43 A;  2I81 A;  5ID2 A;  2H66 A;  3QCP A;  4J57 E;  3F3R A;  3TRX A;  2LEG A;  1Z6M A;  2M80 A;  4ZIJ A;  1K0N A;  4WF4 A;  3DVX A;  2OBK A;  4TVE A;  1C72 A;  4IN0 A;  5G30 A;  3FEU A;  2LJK A;  1PL2 A;  1TTZ A;  4L0U A;  3GUR A;  2X64 A;  1KTE A;  2OE3 A;  2MZC A;  1SU9 A;  4ZBB A;  1TP9 A;  2V1M A;  2WS2 A;  1GUM A;  1R26 A;  1X9M B;  1ML6 A;  1Q4J A;  2PVO C;  1G7O A;  3O6T A;  2VM1 A;  1F3B A;  2XBI A;  4POB A;  5J3R A;  2YWM A;  3VPQ A;  2H0H A;  2MYG A;  2H01 A;  3NOF A;  5CRW A;  4DSS A;  4KX4 A;  3QFA C;  1SL0 B;  2H76 A;  1DBY A;  3CSJ A;  1VF3 A;  1FVK A;  3IAS 2;  4WR5 A;  1PN9 A;  2L5L A;  1U3A A;  1NHO A;  5AIX A;  5ECR B;  3GUS A;  1FHE A;  1JLV A;  2JSZ A;  4I8B A;  3R2Q A;  4GQF A;  1ZOF A;  2WRT A;  2WDU A;  1XZO A;  4ZL9 A;  1QMV A;  2LRN A;  3DGQ A;  5IIZ A;  4JZQ A;  3MNG A;  1QXH A;  2O85 A;  4HQZ A;  1K3L A;  1SKS B;  1EEJ A;  3FZ9 A;  1XWK A;  2DJ3 A;  4IBP A;  3GTU A;  4GXZ A;  2GGT A;  2RM6 A;  4V2M A;  2HXK A;  3DEX A;  1BJX A;  4O7H A;  1OC9 B;  3TRQ A;  4IJ3 A;  5B6N A;  2L6D A;  2GT6 A;  1NW2 A;  3LFL A;  4HEA 2;  3FR6 A;  2DC5 A;  2GVP A;  1GSE A;  2B5X A;  2LRC A;  4KND A;  1O8W A;  3PIN A;  4KDU A;  3G7I A;  3W8J A;  2JZT A;  3EUR A;  1QGV A;  5D9T A;  1B9X C;  1YF0 A;  5CYY A;  1ZCP A;  2MBS A;  3TKS A;  3DWV A;  2VCZ A;  1S3C A;  3IRA A;  5IPH A;  4YQM A;  5IMZ A;  4KGI A;  4WKW A;  3L9U A;  3GFK A;  1X0R A;  2NPB A;  3GV1 A;  3UMA A;  2ZUP A;  3I6A A;  4PUR A;  1SK0 A;  5J41 A;  3HJM A;  2B3S A;  3F6F A;  1FAA A;  4PQI A;  2R2J A;  2EIR A;  2OE1 A;  2RLI A;  3EVI A;  1OAZ A;  3DKS A;  5G2Z A;  4EKZ A;  1PL1 A;  2ES7 A;  1XFL A;  2WFC A;  1GSU A;  1QFN A;  2VCW A;  2X99 A;  2L6C A;  4K2D A;  5G31 A;  3ZIV A;  1FW1 A;  3F0I A;  4V2L A;  3US3 A;  3KM6 A;  1ZZY A;  4MF6 A;  4N11 A;  4F0C A;  2B7J A;  2CV4 A;  4MF5 A;  2AV4 A;  3HA9 A;  4YAP A;  12GS A;  2CVK A;  2GZY A;  17GS A;  5DVB A;  3F4S A;  2VLV A;  1VF2 A;  1T7P B;  1AUC A;  5IPG A;  4GF0 A;  3NZN A;  3A5W A;  1TOF A;  2LST A;  4POM A;  1JZR A;  4ULX A;  4X0X A;  6GSS A;  2IFQ B;  1ACV A;  1PMT A;  1UVZ A;  4AGS A;  2OE0 A;  4HZ4 A;  4IVF A;  1GNE A;  4MJB A;  4QL9 A;  5J5N A;  2DJ0 A;  3GYK A;  3Q74 A;  5EPF A;  4IQ1 A;  5A5K A;  1GNW A;  20GS A;  3IOS A;  3A2V A;  1XWC A;  2GDR A;  1F37 A;  3QAV A;  1Z5Y E;  1B4Q A;  2IL3 A;  4XTS A;  2D2Z A;  5D96 A;  1RK4 A;  5ECI B;  1TU8 A;  3LGC A;  3H79 A;  1YEP A;  1WE0 A;  3WGX A;  4OFT A;  1GUH A;  3C1R A;  1YQ1 A;  2QGV A;  1X9W B;  1ILO A;  3DXB A;  2VL3 A;  3HZ8 A;  1E2Y A;  5JCW A;  5JCU A;  4BWQ A;  4EO3 A;  2LRT A;  3WGD A;  1AC1 A;  4AF2 A;  5C00 A;  3ZL5 A;  5IOW A;  1N2A A;  1M7T A;  3ZRE A;  2QSI A;  1PRX A;  1A23 A;  5CRH A;  4EVM A;  2FY6 A;  4V1A g;  4WXT A;  2NBS A;  4XS4 B;  4BA7 A;  4MPG A;  4DEJ A;  3NIV A;  1J0F A;  4EE0 A;  4NHZ A;  5A4V A;  2VCT A;  2FWE A;  2B6M A;  4GST A;  3H4K A;  4PQH A;  1KEB A;  2O8V B;  1GLP A;  1THO A;  2PBJ A;  1AXD A;  1SEN A;  4K8M A;  2IMF A;  2YOI A;  3WT1 A;  1SYX A;  2A2R A;  1R4W A;  2H73 A;  5DAK A;  3LXT A;  5IMV A;  5KN3 A;  3LEF A;  2C8U A;  4V2N A;  1V2A A;  5ECM B;  2IN3 A;  3FR9 A;  2H6X A;  4TXV A;  2E2G A;  2TRC P;  4DSR A;  3L0H A;  1Y6E A;  5LCZ A;  2I3Y A;  4JU5 A;  3QD9 A;  4MDC A;  4GCI A;  5AIV A;  3CBU A;  3CSI A;  4PXO A;  1WWJ A;  5GAN D;  4ID0 A;  2A4V A;  3KEB A;  5B7C A;  4JR4 A;  2HRF A;  1A24 A;  2VUP A;  1MD4 A;  4LA1 A;  1CQG A;  4EDY A;  3GTU B;  1VRS D;  3N9J A;  1R5A A;  3PH9 A;  1WPI A;  14GS A;  3VUR A;  5G1L A;  4NAX A;  3KXO A;  3E0U A;  3LYP A;  4HU7 A;  1B9Y C;  4ILF A;  3DYR A;  5DJM A;  1F3A A;  1MDI A;  4I2T A;  4EXJ A;  2HYX A;  3HVX A;  4WEY A;  2C1Y A;  3C8E A;  4OMV A;  4YH2 A;  4J56 E;  2WB9 A;  3WYW A;  1USB A;  2XPE A;  3EYT A;  4G10 A;  3RDW A;  1XBS A;  1OC3 A;  3D6I A;  4NPB A;  4YAV A;  2CQ9 A;  1GRX A;  2X8G A;  1EEM A;  1R7H A;  1XVQ A;  5FT3 A;  2H1A A;  3UAR A;  2VL2 C;  3SWL A;  2HSY A;  4XIH A;  5ECH B;  4XCS A;  2P5R A;  1G6W A;  4ZXG A;  1EGR A;  3FZA A;  1URM A;  1H4O A;  4KSM A;  3ZVJ D;  3FZ4 A;  4PNF A;  4BVX A;  5EY6 A;  4OO4 A;  1SJZ A;  3TJG A;  1M9A A;  2OA7 A;  1MDK A;  2QC7 A;  2L5O A;  5C04 A;  1XW9 A;  2IIY A;  4GTU A;  5E59 A;  3D0Z A;  1T3B A;  1K3O A;  2C0E A;  1ERW A;  2QKE A;  5HFI A;  1A2M A;  1ERT A;  1BX9 A;  4XS6 A;  3KZQ A;  3H8Q A;  4OCE A;  1V9W A;  3KH9 A;  3D21 A;  4Q5Q A;  2L59 A;  3RPN A;  3HY2 A;  1X5C A;  1M0U A;  2G0F A;  1BQ7 A;  4OFN A;  1NM3 A;  2ZNM A;  2H0I A;  3D5J A;  3HKR A;  3KTB A;  1GWC A;  1F6M C;  3DVW A;  1TW9 A;  3QAG A;  3FW2 A;  2IJY A;  5B6M A;  3TGZ A;  2P5Q A;  1IYI A;  4O92 A;  5CRE A;  1GH2 A;  5HFK A;  2C4J A;  1EWX A;  1Y25 A;  2GSS A;  1GSD A;  4E8E A;  2HRN A;  4HJ2 A;  1Z7P A;  4ZBD A;  3I9V 2;  2FHE A;  4CDO A;  2H75 A;  3VPT A;  5DQS A;  1JZO A;  4GSN A;  4N10 A;  3EU4 A;  3HHV A;  1F9M A;  2BJX A;  3D4M A;  1S3A A;  2VCQ A;  3GKN A;  3GKK A;  3O3T A;  2DIY A;  2FLS A;  10GS A;  6GSW A;  2JSY A;  2FWG A;  4ZL7 A;  1K0D A;  1FO5 A;  3DIE A;  3LJR A;  4HS1 A;  2B1L A;  1HNA A;  2K8V A;  5B8A A;  3G7J A;  2H70 A;  7GSS A;  3EC3 A;  1AQW A;  2H0G A;  1RQM A;  4EL1 A;  4PQ1 A;  1YJ6 A;  3GH9 A;  3HVV A;  1TJD A;  2CAQ A;  3ZFL A;  2C3Q A;  1XVW A;  1TDI A;  3A2W A;  1W89 A;  2L4C A;  3BJ5 A;  4OWY A;  3VWW A;  1SYR A;  3TJB A;  2J23 A;  2EC4 A;  1UA5 A;  2K18 A;  3A2X A;  4K0N A;  2MMN A;  1YDK A;  4GWR A;  3HXS A;  3ZML A;  1OE7 A;  2CZ3 A;  16GS A;  1PGT A;  22GS A;  3CRU A;  2YNX A;  5FWG A;  1TK5 B;  1MDJ A;  1WRY A;  3GN3 A;  2YWN A;  2YV9 A;  4F03 A;  1Z9H A;  4FH8 A;  2R3X A;  5IMC A;  4LL4 B;  2WUL A;  1YZX A;  2MMZ A;  4WR4 A;  3APQ A;  5F8B A;  4NWY A;  3L9S A;  5LD0 A;  1FB6 A;  1BYE A;  1XIY A;  1PX6 A;  2PMT A;  1EP7 A;  2NDO A;  4FYU A;  2YZH A;  4AJ7 A;  5A4U A;  1U88 A;  4ECI A;  2YP6 A;  5DAL B;  5KN1 A;  2E0Q A;  1T1V A;  1A0F A;  1T00 A;  5IQY A;  2TIR A;  2R5G A;  3O76 A;  4GQC A;  4GLT A;  3I43 A;  2GT5 A;  3D4T A;  6GSU A;  3ZIT A;  3FY7 A;  5D73 A;  4TR4 A;  2CA8 A;  5JWQ B;  1TRW A;  2WJU A;  5J4U A;  1B48 A;  1O81 A;  3M9J A;  4D73 B;  3GKM A;  4HU9 A;  2B5Y A;  2PU9 C;  2H8L A;  4IQA A;  5IMA A;  3VLN A;  2VM2 A;  1HNC A;  2XHF A;  2E7P A;  1AAZ A;  4LMV A;  3KH7 A;  3GX8 A;  3UL3 A;  3F4R A;  4ZIL A;  2V2G A;  1TU7 A;  2YJH A;  2VL2 A;  3KIJ A;  4TXO B;  4N0Z A;  3FKF A;  1U3I A;  1MTC A;  2OBI A;  2FCH A;  2PWJ A;  3MAK A;  2Z9S A;  5HR1 A;  2HZE B;  3UVT A;  2CX3 A;  1G0T A;  3F8U A;  1JFU A;  3RHC A;  2LKU A;  5DCG A;  5E4W A;  2OJL A;  2YV7 A;  1O6J A;  1ABA A;  4ZB8 A;  2FNO A;  4KH7 A;  4XRA A;  4BPY A;  3GST A;  2VLU A;  1ERU A;  4GRF A;  2DIZ A;  1SD9 A;  2VLT A;  4BL7 A;  3FZ5 A;  2GZZ A;  4KUN A;  4OD7 A;  2LJA A;  3IDV A;  3Q19 A;  3Q6O A;  4PUF C;  1HD2 A;  4F9Z A;  4TW5 A;  2RII A;  5F06 A;  1NSW A;  2CX4 A;  3KTL A;  1JZW A;  4HJM A;  5CP1 A;  5J9B A;  2CVD A;  5A4W A;  3CTF A;  4IJI A;  3M9K A;  3IE3 A;  3GSS A;  3IR4 A;  1ST9 A;  4G2E A;  2G2Q A;  1A0R P;  3M0F A;  1SJI A;  3A3T A;  2CZ2 A;  2IPA A;  2R37 A;  3L9V A;  4MH2 A;  3ZRD A;  1JLW A;  4LMW A;  1ZL9 A;  1DSB A;  4MZB A;  4ZB6 A;  1J08 A;  1TI3 A;  3LXZ A;  2AJQ B;  2LJR A;  2GSR A;  1Z7R A;  4MLY A;  1TK0 B;  1O73 A;  2REM A;  1DE2 A;  2C3T A;  4Q5R A;  4ECC A;  3TB2 A;  4OFM A;  5FHI A;  2FWF A;  2FWH A;  5ID2 B;  2VCX A;  1GL8 A;  1X5D A;  4ML1 A;  3J7Y b;  1SJ6 A;  3BCK A;  4K9Z A;  4N0V A;  5CAX A;  4AJ8 A;  1PQN A;  3GIX A;  4FYB A;  3TJJ A;  3ZZX A;  4K7N A;  2VAF A;  4IW9 A;  2LTK A;  3UEM A;  3GX0 A;  4MH3 A;  2L57 A;  2GS3 A;  4PGT A;  1GTB A;  5D9W A;  5J9C A;  2IMK A;  3P8W A;  5IO0 A;  2GQM A;  3BOA A;  2O89 A;  2O7K A;  3LWA A;  2I1U A;  4DSS B;  4BVY A;  4EF0 A;  2YWI A;  1WIK A;  3EIN A;  3GH6 A;  1FB0 A;  2YPM A;  4RQX A;  3TJK A;  4FO5 A;  4POK A;  4QL7 A;  3TCO A;  2H1D A;  2XBQ A;  1PKZ A;  5JWR B;  1QK8 A;  2OKA A;  1WP0 A;  5GAP D;  1H75 A;  2PN8 A;  2VD1 A;  3MSZ A;  1XOB A;  3HJP A;  3ZMK A;  5CO3 A;  2H74 A;  3E9J B;  3TOT A;  2VCV A;  4POL A;  3W8S A;  4KCE A;  3GRX A;  2B5E A;  5F07 A;  4H86 A;  1OC9 A;  5IOX A;  5JWO B;  4ECB A;  3ERF A;  1ZMA A;  2HZF A;  3IXR A;  1HYU A;  5IMD A;  4I97 A;  4CW9 A;  9GSS A;  2XC2 A;  4IKH A;  1U6T A;  3SBC A;  3P90 A;  4G19 A;  2P31 A;  2F9S A;  5ECN B;  2V32 A;  3ERG A;  3IA1 A;  5ECK B;  8GSS A;  3RPP A;  4TOP A;  2AUV A;  3H93 A;  4HDE A;  1XCC A;  2M72 A;  2DMM A;  4NMU A;  3APS A;  1M2B A;  2YN1 A;  2VOC A;  2B1K A;  4FIW A;  4WBR D;  1WOU A;  1N8J A;  1K0B A;  3DML A;  2RUE A;  3TKR A;  3QOU A;  1XWG A;  4HUA A;  4KDY A;  5F0G A;  4L8E A;  4K6X A;  4TRX A;  5CNW A;  5F05 A;  4F0B A;  1OYJ A;  3APO A;  1SL2 B;  4TKY A;  1K0O A;  1Z6N A;  1JHB A;  2C3N A;  3LG6 A;  1ZYE A;  2TRX A;  4K7O A;  3VI5 A;  5KEJ A;  3CYN A;  3G9B A;  3ME8 A;  4KAE A;  4N30 A;  3ZLP A;  1R5P A;  3CRT A;  3C1S A;  3M3M A;  2RUF A;  3PGT A;  1LJR A;  2CVB A;  1EGO A;  3LQ7 A;  4MJE A;  3LOR A;  3GA4 A;  1O85 A;  2J9H A;  1A8L A;  4I2U A;  2VO4 A;  3GL3 A;  3QR6 A;  3GHA A;  1V40 A; 
#chains in the Genus database with same CATH topology
 2IMD A;  3EWL A;  2JAC A;  4NHW A;  2KP2 A;  1ON4 A;  2LNS A;  1TKD B;  3P7X A;  1SKR B;  3ISO A;  1V58 A;  2JL4 A;  2LS5 A;  3J7Y k;  2IFQ A;  3G7Y A;  5AIS A;  5BRT A;  1T4Z A;  2H1G A;  3IPZ A;  4MAB A;  4BL7 B;  1GTA A;  3HCZ A;  4L5O A;  4ACS A;  3KD0 A;  2MMO A;  3EE2 A;  3L4N A;  3MDK A;  1SK2 A;  2A2S A;  3C7M A;  2K8S A;  19GS A;  1EOG A;  3DD3 A;  4MA9 A;  4IS0 A;  4EUY A;  2H72 A;  1W4V A;  3D22 A;  2V41 A;  1VF1 A;  2MMA A;  3BBY A;  2PPT A;  18GS A;  4PX1 A;  1XWA A;  2NTO A;  1HNB A;  4TR1 A;  4JED A;  4K1F A;  4LL1 B;  2DJ1 A;  4YKF A;  2HLS A;  4X1U A;  2F3M A;  1K0C A;  1EOH A;  2P0G A;  3UOM A;  3VI7 A;  5JCG A;  4JRR A;  4KCA A;  2V6K A;  3P2A A;  2CAI A;  4G9H A;  1YKA A;  2DSA A;  2DJJ A;  4MCU A;  2HFD A;  4RI6 A;  4CHS A;  3F63 A;  2I4A A;  1PKW A;  1S3R A;  6GST A;  4QQ7 A;  2N5A A;  2LNT A;  1K0A A;  4NV5 A;  3GL5 A;  4XS4 A;  1ERV A;  2RM5 A;  3FHK A;  2CT6 A;  4RUV A;  2JZR A;  5DDL A;  3KCM A;  4NXI A;  3UAP A;  1SKW B;  1T4Y A;  2C0G A;  4BWS A;  3EMX A;  3BCI A;  4P3Y B;  3VK9 A;  11GS A;  3OR5 A;  2X8H A;  3LYK A;  3IBH A;  2JU5 A;  1O8X A;  4Q5F A;  2PVQ A;  1OKT A;  2GZP A;  2H6Z A;  3IK7 A;  1SD8 A;  2LQQ A;  1LU4 A;  3M1G A;  4KA0 A;  4IHU A;  2JZS A;  2X8C A;  5DAK B;  5D9V A;  3FMW A;  2HNL A;  5ECQ B;  1GTU A;  3TKP A;  2VD0 A;  1JZD A;  1Q98 A;  2H19 A;  4V1A p;  4KE3 A;  5H5R A;  1EP8 A;  1QUW A;  5ECL B;  1VF4 A;  1GSY A;  4WBJ A;  3GNJ A;  2LUS A;  1PD2 1;  2EIO A;  5CRG A;  1TXX A;  3K8N A;  2KUC A;  4FYC A;  4O5R A;  2N5F A;  1T8E B;  2QA2 A;  4MZW A;  2KOK A;  2HE3 A;  3VWV A;  5H5Q A;  1O7U A;  1A2L A;  1XXU A;  4IP1 A;  4MK3 A;  1GSS A;  5CRD A;  2R0P A;  4NV2 A;  1FOV A;  2YZU A;  2LV3 A;  4O32 A;  2IMI A;  3ME7 A;  4XRD A;  3H1N A;  1XPV A;  4AJ6 A;  2C0D A;  2YJ7 A;  3EPT A;  4KDX A;  1B4P A;  1YEX A;  2DML A;  2E2M A;  5B8B A;  1WMJ A;  4HI7 A;  4L5L A;  5DJL A;  4JE1 A;  1EV4 A;  2GSQ A;  3CXG A;  1THX A;  4YQV A;  3JCM L;  2H1B A;  6GSX A;  1RW1 A;  3V1W A;  3UVH A;  3ZYW A;  3TOU A;  1BED A;  3R3E A;  5GSS A;  2FA4 A;  4KB3 A;  1TK8 B;  2I9H A;  1PA3 A;  2AYT A;  1YF1 A;  2DJK A;  3E3E A;  3RBT A;  1IYH A;  3MYD A;  1J9B A;  2HRA A;  2WGR A;  4ZL8 A;  5HR2 A;  4EDZ A;  3W6G A;  4BVX B;  5ELG A;  2WZ9 A;  2PUK C;  3QMX A;  4RI7 A;  1QQ2 A;  2XPD A;  5COH A;  1EZK A;  2V6O A;  2EIQ A;  1YY7 A;  1M2D A;  4F82 A;  3ED3 A;  4K2X A;  5AN1 A;  4ISD A;  3HZ4 A;  2C0F A;  2YWO A;  3FRC A;  3U6V A;  5ELA A;  1GUK A;  4MF7 A;  4E8H A;  1E6B A;  4MJA A;  3IC8 A;  4CY6 A;  4PUA A;  3QFB C;  3RHB A;  3GKX A;  4DSQ A;  2VIM A;  2K6V A;  5ECP B;  3RAZ A;  2OAC A;  2M46 A;  3HVS A;  3N5O A;  2KHP A;  4L0W A;  6GSV A;  4YKG A;  2B7K A;  2AB6 A;  2GST A;  6GSY A;  3L78 A;  4XS1 A;  3QDN A;  1M99 A;  1XWB A;  1BG5 A;  5AGY A;  3F3Q A;  1AW9 A;  2ON5 A;  3CMI A;  2H71 A;  2FA8 A;  4ZB9 A;  3KP9 A;  1DUG A;  4ML6 A;  5G5E A;  1S3D A;  1AIU A;  4MMM A;  4TR1 B;  5ECS A;  5DBQ A;  3PR8 A;  1MD3 A;  4PTS A;  2HI7 A;  2NVL A;  5D8I A;  1G7E A;  3S9F A;  2ON7 A;  1B8X A;  2DLX A;  3ZIJ A;  3EU3 A;  1VGL A;  2AAW A;  4ECJ A;  1UN2 A;  2F8A A;  3UJ1 A;  5ENU A;  4F2I A;  5BMU A;  1XW6 A;  1TRU A;  5ABR A;  4JR6 A;  3CSH A;  1OC8 A;  3UBK A;  1GUL A;  3MIX A;  2R6K A;  2YCD A;  4GSS A;  1M2A A;  5HR3 A;  3HVN A;  1OKD A;  1FG4 A;  3TKS E;  2DJ2 A;  1YKC A;  3IHQ A;  2FGX A;  1KBN A;  1TRV A;  3HYP A;  3IK9 A;  1AQX A;  3FK8 A;  4WET A;  4ZBA A;  3HD5 A;  3DRN A;  5KN0 A;  2PER A;  3C71 A;  1OE8 A;  2GTU A;  5LNK e;  4IEL A;  3KGK A;  4K7I A;  4TR0 A;  4TR3 A;  2R0C A;  1DE1 A;  2GLR A;  2ALB A;  2MBT A;  1ZYQ B;  1WJK A;  4O5Q A;  4I5Q A;  2FUG 2;  2WCI A;  2KLX A;  1V98 A;  1OVN A;  1A2J A;  3TUE A;  13GS A;  1TRS A;  3KMN A;  3VFI A;  1GTI A;  4DVC A;  1LBK A;  5G5F A;  1GLQ A;  1F2E A;  3TDG A;  2HT9 A;  4MP4 A;  5GST A;  2BTO T;  1I9D A;  1SK1 A;  4XHM A;  1K3Y A;  5DAL A;  3IC4 A;  3LSZ A;  1U87 A;  3KP8 A;  2ZCT A;  3WT2 A;  4OCF A;  3I69 A;  2R4V A;  1X9S B;  4IGJ A;  4IP6 A;  3TJF A;  3WD6 A;  3ZFB A;  2OAD A;  4I6X A;  3IV4 A;  3IAM 2;  4KF9 A;  5HQP A;  3TKS C;  3WGE A;  5D9X A;  4EIQ A;  4JBB A;  4EC0 A;  2GQK A;  2AHE A;  1PSQ A;  3AY8 A;  2VL9 A;  5IMF A;  1GP1 A;  4LLR A;  5DQY A;  4D73 A;  5HFG A;  3F4T A;  5GZZ B;  1CQH A;  3LW9 A;  2GQL A;  4PNG A;  1MEK A;  2IME A;  3ZVJ A;  1XW5 A;  1G6Y A;  1EV9 A;  5EVO A;  5ECO B;  5IO2 A;  3ERW A;  3U5R E;  3QAW A;  1X5E A;  3VWX A;  3BD2 A;  3KJY A;  5L71 A;  3QPM A;  2BMX A;  3UBL A;  1UC7 A;  3MWH A;  2F8F A;  4HOJ A;  4OO5 A;  2JAD A;  5D93 A;  4TXO A;  1V57 A;  3ZTL A;  2K9F A;  5EL8 A;  1XOA A;  4KW6 A;  2HZE A;  4RQR A;  2F51 A;  1AQV A;  1BAY A;  2HSH A;  4TN8 A;  5H5S A;  4Z7X A;  4WF5 A;  4YQU A;  2FD3 A;  5IM9 A;  4MZC A;  3GMF A;  2H30 A;  3FYG A;  3F6D A;  4J2F A;  1FVJ A;  4HZ2 A;  2YAN A;  5KN2 A;  1GSF A;  3EMP A;  5INY A;  2O87 A;  3Q18 A;  3KMO A;  4HQS A;  3CTG A;  1Z3E A;  2L4Q A;  1K0M A;  1ZGN A;  3HJO A;  1KNG A;  1M9B A;  1PX7 A;  3FR3 A;  1A8Y A;  2LQO A;  4KSO A;  2DBC A;  1NHY A;  2KP1 A;  2C80 A;  1GSQ A;  5DCH A;  2IWT A;  1I5G A;  3C73 A;  4G0I A;  3HDC A;  3UIW A;  2PGT A;  5G1K A;  4Q5N A;  3VWU A;  4MPF A;  4MJC A;  2N5B A;  3TKQ A;  1TI1 A;  1HQO A;  4K0G A;  2H6Y A;  1SL1 B;  5HR0 A;  3M8N A;  3F9U A;  3TRP A;  4X43 A;  2I81 A;  5ID2 A;  2H66 A;  3QCP A;  4J57 E;  3F3R A;  3TRX A;  2LEG A;  1Z6M A;  2M80 A;  4ZIJ A;  1K0N A;  4WF4 A;  3DVX A;  1PN0 A;  2OBK A;  4TVE A;  1C72 A;  4IN0 A;  5G30 A;  3FEU A;  2LJK A;  1PL2 A;  1TTZ A;  4L0U A;  3GUR A;  2X64 A;  1KTE A;  2OE3 A;  2MZC A;  1SU9 A;  4ZBB A;  1TP9 A;  2V1M A;  2WS2 A;  1GUM A;  1R26 A;  1X9M B;  1ML6 A;  1Q4J A;  2PVO C;  1G7O A;  3O6T A;  2VM1 A;  4HSC X;  1F3B A;  2XBI A;  4POB A;  5J3R A;  2YWM A;  3VPQ A;  2H0H A;  2MYG A;  2H01 A;  3NOF A;  5CRW A;  4DSS A;  4KX4 A;  3QFA C;  1SL0 B;  2H76 A;  1DBY A;  3CSJ A;  1PFO A;  1VF3 A;  1FVK A;  3IAS 2;  4WR5 A;  1PN9 A;  4G0L A;  2L5L A;  1U3A A;  4BVY B;  1NHO A;  5AIX A;  5ECR B;  3GUS A;  1FHE A;  1JLV A;  2JSZ A;  4I8B A;  2UZ8 A;  3R2Q A;  4GQF A;  1ZOF A;  2WRT A;  2WDU A;  1XZO A;  4ZL9 A;  1QMV A;  2LRN A;  3DGQ A;  5IIZ A;  4JZQ A;  3MNG A;  1QXH A;  2O85 A;  4HQZ A;  1K3L A;  1SKS B;  1EEJ A;  3FZ9 A;  4ICY A;  1XWK A;  2DJ3 A;  4IBP A;  3GTU A;  4GXZ A;  2GGT A;  2RM6 A;  4V2M A;  2HXK A;  3DEX A;  1BJX A;  4O7H A;  1OC9 B;  3TRQ A;  4IJ3 A;  5B6N A;  2L6D A;  2GT6 A;  1NW2 A;  3LFL A;  4HEA 2;  2A4H A;  3FR6 A;  2DC5 A;  2GVP A;  1GSE A;  2B5X A;  2LRC A;  4KND A;  1O8W A;  3PIN A;  4KDU A;  3G7I A;  3W8J A;  2JZT A;  3EUR A;  1QGV A;  5D9T A;  4Z2T A;  1B9X C;  1YF0 A;  5CYY A;  1ZCP A;  2MBS A;  3TKS A;  3DWV A;  2VCZ A;  1S3C A;  3IRA A;  5IPH A;  4YQM A;  5IMZ A;  4KGI A;  4WKW A;  3L9U A;  3CQF A;  4K5S A;  3GFK A;  1X0R A;  2NPB A;  3GV1 A;  3UMA A;  2ZUP A;  3I6A A;  4PUR A;  1SK0 A;  5J41 A;  3HJM A;  2B3S A;  3F6F A;  1FAA A;  4PQI A;  2R2J A;  2EIR A;  2OE1 A;  2RLI A;  3EVI A;  1OAZ A;  3DKS A;  5G2Z A;  4EKZ A;  1PL1 A;  2ES7 A;  1XFL A;  2WFC A;  1GSU A;  1QFN A;  2VCW A;  2X99 A;  2L6C A;  4K2D A;  5G31 A;  3ZIV A;  1FW1 A;  3F0I A;  4V2L A;  3US3 A;  3KM6 A;  1ZZY A;  4MF6 A;  4N11 A;  4F0C A;  1XG8 A;  2B7J A;  2CV4 A;  4MF5 A;  2AV4 A;  3HA9 A;  4YAP A;  12GS A;  2CVK A;  2GZY A;  17GS A;  5DVB A;  3F4S A;  2VLV A;  1VF2 A;  1T7P B;  1AUC A;  5IPG A;  4GF0 A;  3NZN A;  3A5W A;  1TOF A;  2LST A;  4POM A;  1JZR A;  4ULX A;  4X0X A;  6GSS A;  2IFQ B;  1ACV A;  1PMT A;  1UVZ A;  4AGS A;  2OE0 A;  4HZ4 A;  4IVF A;  1GNE A;  4MJB A;  4QL9 A;  5J5N A;  2DJ0 A;  3GYK A;  3Q74 A;  5EPF A;  4IQ1 A;  5A5K A;  1GNW A;  20GS A;  3IOS A;  3A2V A;  1XWC A;  2GDR A;  4USS A;  1F37 A;  3QAV A;  1Z5Y E;  1B4Q A;  2IL3 A;  4XTS A;  2D2Z A;  5D96 A;  1RK4 A;  5ECI B;  1TU8 A;  3LGC A;  3H79 A;  1YEP A;  1WE0 A;  3WGX A;  4OFT A;  1GUH A;  3C1R A;  1YQ1 A;  2QGV A;  1X9W B;  1ILO A;  3DXB A;  2VL3 A;  3HZ8 A;  1E2Y A;  5JCW A;  5JCU A;  4BWQ A;  4EO3 A;  2LRT A;  3WGD A;  1AC1 A;  4AF2 A;  5C00 A;  3ZL5 A;  5IOW A;  1N2A A;  1M7T A;  3ZRE A;  2QSI A;  1PRX A;  1A23 A;  5CRH A;  4EVM A;  2FY6 A;  4V1A g;  4WXT A;  2NBS A;  4XS4 B;  4BA7 A;  4MPG A;  4DEJ A;  3NIV A;  1J0F A;  4EE0 A;  4NHZ A;  5A4V A;  2VCT A;  2FWE A;  2B6M A;  4GST A;  3H4K A;  4PQH A;  1KEB A;  2O8V B;  1GLP A;  1THO A;  2PBJ A;  1AXD A;  1SEN A;  4K8M A;  2IMF A;  2YOI A;  3WT1 A;  1SYX A;  2A2R A;  1R4W A;  2H73 A;  5DAK A;  3LXT A;  5IMV A;  5KN3 A;  3LEF A;  2C8U A;  4V2N A;  1V2A A;  5ECM B;  2IN3 A;  3FR9 A;  2H6X A;  4TXV A;  2E2G A;  2TRC P;  4DSR A;  3L0H A;  1Y6E A;  5LCZ A;  2I3Y A;  4JU5 A;  5KOX A;  3QD9 A;  4MDC A;  4GCI A;  5KOW A;  5AIV A;  3CBU A;  3CSI A;  4PXO A;  1WWJ A;  5GAN D;  4ID0 A;  2A4V A;  1ZYN A;  3KEB A;  5B7C A;  4JR4 A;  2HRF A;  1A24 A;  2VUP A;  1MD4 A;  4LA1 A;  1CQG A;  4EDY A;  3GTU B;  1VRS D;  3N9J A;  1R5A A;  3PH9 A;  1WPI A;  14GS A;  3VUR A;  5G1L A;  4A5P A;  4NAX A;  3KXO A;  3E0U A;  3LYP A;  4HU7 A;  4X4J A;  1B9Y C;  4ILF A;  3DYR A;  5DJM A;  1F3A A;  1MDI A;  4I2T A;  2R0G A;  4EXJ A;  2HYX A;  3HVX A;  4WEY A;  2C1Y A;  3C8E A;  4OMV A;  4YH2 A;  4J56 E;  2WB9 A;  4K5R A;  3WYW A;  1USB A;  2XPE A;  3EYT A;  4G10 A;  3RDW A;  1XBS A;  1OC3 A;  3D6I A;  4NPB A;  4YAV A;  2CQ9 A;  1GRX A;  2X8G A;  1EEM A;  1R7H A;  1XVQ A;  5FT3 A;  2H1A A;  3UAR A;  2VL2 C;  3SWL A;  4Z2R A;  2HSY A;  4XIH A;  5ECH B;  4XCS A;  2P5R A;  1G6W A;  4ZXG A;  1EGR A;  3FZA A;  1URM A;  1H4O A;  4KSM A;  3ZVJ D;  3FZ4 A;  4PNF A;  4BVX A;  5EY6 A;  4OO4 A;  1SJZ A;  3TJG A;  1M9A A;  2OA7 A;  1MDK A;  2QC7 A;  2L5O A;  5C04 A;  1XW9 A;  2IIY A;  4GTU A;  5E59 A;  3D0Z A;  1T3B A;  1K3O A;  2C0E A;  1ERW A;  2QKE A;  5HFI A;  1A2M A;  1ERT A;  1BX9 A;  4XS6 A;  3KZQ A;  3H8Q A;  4OCE A;  1V9W A;  3KH9 A;  3D21 A;  4Q5Q A;  2L59 A;  3RPN A;  3HY2 A;  1X5C A;  1M0U A;  2G0F A;  1BQ7 A;  4OFN A;  1NM3 A;  2ZNM A;  2H0I A;  3D5J A;  3HKR A;  3KTB A;  1GWC A;  1F6M C;  3DVW A;  1TW9 A;  3QAG A;  3FW2 A;  2IJY A;  5B6M A;  3TGZ A;  2P5Q A;  1IYI A;  4O92 A;  5CRE A;  1GH2 A;  5HFK A;  2C4J A;  1EWX A;  2A2P A;  1Y25 A;  2GSS A;  1GSD A;  4E8E A;  2HRN A;  4HJ2 A;  1Z7P A;  4ZBD A;  3I9V 2;  2FHE A;  4CDO A;  2H75 A;  3VPT A;  5DQS A;  1JZO A;  4GSN A;  4N10 A;  3EU4 A;  3HHV A;  1F9M A;  2BJX A;  3D4M A;  1S3A A;  2VCQ A;  3GKN A;  3GKK A;  3O3T A;  2DIY A;  2FLS A;  10GS A;  6GSW A;  2JSY A;  2FWG A;  4ZL7 A;  1K0D A;  1FO5 A;  3DIE A;  3LJR A;  4HS1 A;  2B1L A;  1HNA A;  2K8V A;  5B8A A;  3G7J A;  2H70 A;  7GSS A;  3EC3 A;  1AQW A;  2H0G A;  1RQM A;  4EL1 A;  4PQ1 A;  1YJ6 A;  3GH9 A;  3HVV A;  1TJD A;  2CAQ A;  3ZFL A;  4O5U A;  2C3Q A;  1XVW A;  1TDI A;  3A2W A;  1W89 A;  2L4C A;  3BJ5 A;  4OWY A;  3VWW A;  1SYR A;  3TJB A;  2J23 A;  2EC4 A;  1UA5 A;  2K18 A;  3A2X A;  4K0N A;  2MMN A;  1YDK A;  4GWR A;  3HXS A;  3ZML A;  1OE7 A;  2CZ3 A;  16GS A;  1PGT A;  22GS A;  3CRU A;  2YNX A;  5FWG A;  4CY8 A;  1TK5 B;  1MDJ A;  1WRY A;  3GN3 A;  2YWN A;  2YV9 A;  4F03 A;  1Z9H A;  4FH8 A;  2R3X A;  5IMC A;  4LL4 B;  2WUL A;  1YZX A;  2MMZ A;  4WR4 A;  3APQ A;  5F8B A;  4NWY A;  3L9S A;  5LD0 A;  1FB6 A;  1BYE A;  1XIY A;  1PX6 A;  2PMT A;  1EP7 A;  2NDO A;  4FYU A;  2YZH A;  4AJ7 A;  5A4U A;  1U88 A;  4ECI A;  2YP6 A;  5DAL B;  5KN1 A;  1M3I A;  2E0Q A;  1T1V A;  1A0F A;  1T00 A;  5IQY A;  2TIR A;  2R5G A;  3O76 A;  4GQC A;  4GLT A;  3I43 A;  2GT5 A;  3D4T A;  6GSU A;  3ZIT A;  1FOH A;  3FY7 A;  4FQU A;  2HRK A;  5D73 A;  4TR4 A;  2CA8 A;  5JWQ B;  2DKH A;  1TRW A;  2HSM A;  2WJU A;  5J4U A;  2QA1 A;  1B48 A;  1O81 A;  3M9J A;  4D73 B;  3GKM A;  4HU9 A;  2B5Y A;  2PU9 C;  2H8L A;  4IQA A;  5IMA A;  3VLN A;  2VM2 A;  1HNC A;  2XHF A;  2E7P A;  1AAZ A;  3PPU A;  4LMV A;  3KH7 A;  3GX8 A;  3UL3 A;  3F4R A;  4ZIL A;  2V2G A;  1TU7 A;  2YJH A;  2VL2 A;  3KIJ A;  4TXO B;  4N0Z A;  3FKF A;  1U3I A;  4Z2U A;  1MTC A;  2OBI A;  2FCH A;  2PWJ A;  3MAK A;  2Z9S A;  5HR1 A;  2HZE B;  3UVT A;  2CX3 A;  1G0T A;  3F8U A;  1JFU A;  3RHC A;  2LKU A;  5DCG A;  5E4W A;  2OJL A;  2YV7 A;  1O6J A;  1ABA A;  4ZB8 A;  2FNO A;  4KH7 A;  4XRA A;  4BPY A;  3GST A;  2VLU A;  1ERU A;  4GRF A;  2DIZ A;  1SD9 A;  2VLT A;  4BL7 A;  3FZ5 A;  2GZZ A;  4KUN A;  4OD7 A;  2LJA A;  3IDV A;  4BIK A;  3Q19 A;  3Q6O A;  4PUF C;  1HD2 A;  4F9Z A;  4TW5 A;  2RII A;  5F06 A;  1NSW A;  2CX4 A;  3KTL A;  1JZW A;  4HJM A;  4G0K A;  5CP1 A;  5J9B A;  2X4A A;  2CVD A;  5A4W A;  3CTF A;  4IJI A;  3M9K A;  3IE3 A;  3GSS A;  3IR4 A;  1ST9 A;  4G2E A;  2G2Q A;  2X49 A;  1A0R P;  3M0F A;  1SJI A;  3A3T A;  2CZ2 A;  2IPA A;  2R37 A;  3L9V A;  4MH2 A;  3ZRD A;  1JLW A;  4LMW A;  1ZL9 A;  1DSB A;  4MZB A;  4ZB6 A;  1J08 A;  1TI3 A;  3LXZ A;  2AJQ B;  2LJR A;  2GSR A;  1Z7R A;  4MLY A;  1TK0 B;  1O73 A;  2REM A;  1DE2 A;  2C3T A;  4Q5R A;  4ECC A;  3TB2 A;  4OFM A;  5FHI A;  2FWF A;  2FWH A;  5ID2 B;  2VCX A;  1GL8 A;  1X5D A;  4ML1 A;  3J7Y b;  1SJ6 A;  3BCK A;  4K9Z A;  4N0V A;  5CAX A;  4AJ8 A;  1PQN A;  3GIX A;  4FYB A;  3TJJ A;  3ZZX A;  4K7N A;  2VAF A;  4IW9 A;  2LTK A;  3UEM A;  3GX0 A;  4MH3 A;  2L57 A;  2GS3 A;  4PGT A;  1GTB A;  5D9W A;  5J9C A;  2IMK A;  3P8W A;  5IO0 A;  2GQM A;  3BOA A;  2O89 A;  2O7K A;  3A5I A;  3LWA A;  2I1U A;  4DSS B;  4BVY A;  4EF0 A;  2YWI A;  1WIK A;  3EIN A;  3GH6 A;  1FB0 A;  2YPM A;  4RQX A;  3TJK A;  4FO5 A;  4POK A;  4QL7 A;  3TCO A;  3IHG A;  1ZYP A;  2H1D A;  2XBQ A;  1PKZ A;  5JWR B;  1M3J A;  1QK8 A;  2OKA A;  4MNN A;  1WP0 A;  5GAP D;  1H75 A;  2PN8 A;  2VD1 A;  3MSZ A;  1XOB A;  3HJP A;  3ZMK A;  5CO3 A;  2H74 A;  3E9J B;  3TOT A;  2VCV A;  4POL A;  3W8S A;  4KCE A;  3GRX A;  2B5E A;  5F07 A;  4H86 A;  1OC9 A;  5IOX A;  5JWO B;  4ECB A;  3ERF A;  1ZMA A;  2HZF A;  3IXR A;  1HYU A;  5IMD A;  4I97 A;  4CW9 A;  9GSS A;  2XC2 A;  4IKH A;  1U6T A;  3SBC A;  3P90 A;  4EIP A;  4G19 A;  2P31 A;  2F9S A;  5ECN B;  2V32 A;  3ERG A;  3IA1 A;  5ECK B;  8GSS A;  3RPP A;  4TOP A;  2AUV A;  3H93 A;  4HDE A;  1XCC A;  2M72 A;  2DMM A;  2DKI A;  4NMU A;  3APS A;  1M2B A;  2YN1 A;  2VOC A;  2B1K A;  4FIW A;  4WBR D;  1WOU A;  1N8J A;  1K0B A;  3DML A;  2RUE A;  3TKR A;  3QOU A;  1XWG A;  4HUA A;  4KDY A;  5F0G A;  4L8E A;  4K6X A;  4TRX A;  5CNW A;  5F05 A;  4F0B A;  1OYJ A;  3APO A;  1SL2 B;  4TKY A;  1K0O A;  1Z6N A;  1JHB A;  2C3N A;  3LG6 A;  1ZYE A;  2TRX A;  4K7O A;  3VI5 A;  5KEJ A;  3CYN A;  3G9B A;  3ME8 A;  4KAE A;  4N30 A;  3ZLP A;  1R5P A;  3CRT A;  3C1S A;  3M3M A;  2RUF A;  3PGT A;  1LJR A;  2CVB A;  1EGO A;  3LQ7 A;  4MJE A;  3LOR A;  3GA4 A;  1O85 A;  2J9H A;  1A8L A;  4I2U A;  2VO4 A;  3GL3 A;  3QR6 A;  3GHA A;  1V40 A; 
#chains in the Genus database with same CATH homology
 2IMD A;  3EWL A;  2JAC A;  4NHW A;  2KP2 A;  1ON4 A;  2LNS A;  1TKD B;  3P7X A;  1SKR B;  3ISO A;  1V58 A;  2JL4 A;  2LS5 A;  3J7Y k;  2IFQ A;  3G7Y A;  5AIS A;  5BRT A;  1T4Z A;  2H1G A;  3IPZ A;  4MAB A;  4BL7 B;  1GTA A;  3HCZ A;  4L5O A;  4ACS A;  3KD0 A;  2MMO A;  3EE2 A;  3L4N A;  3MDK A;  1SK2 A;  2A2S A;  3C7M A;  2K8S A;  19GS A;  1EOG A;  3DD3 A;  4MA9 A;  4IS0 A;  4EUY A;  2H72 A;  1W4V A;  3D22 A;  2V41 A;  1VF1 A;  2MMA A;  3BBY A;  2PPT A;  18GS A;  4PX1 A;  1XWA A;  2NTO A;  1HNB A;  4TR1 A;  4JED A;  4K1F A;  4LL1 B;  2DJ1 A;  4YKF A;  2HLS A;  4X1U A;  2F3M A;  1K0C A;  1EOH A;  2P0G A;  3UOM A;  3VI7 A;  5JCG A;  4JRR A;  4KCA A;  2V6K A;  3P2A A;  2CAI A;  4G9H A;  1YKA A;  2DSA A;  2DJJ A;  4MCU A;  2HFD A;  4RI6 A;  4CHS A;  3F63 A;  2I4A A;  1PKW A;  6GST A;  4QQ7 A;  2N5A A;  2LNT A;  1K0A A;  4NV5 A;  3GL5 A;  4XS4 A;  1ERV A;  2RM5 A;  3FHK A;  2CT6 A;  4RUV A;  2JZR A;  5DDL A;  3KCM A;  4NXI A;  3UAP A;  1SKW B;  1T4Y A;  2C0G A;  4BWS A;  3EMX A;  3BCI A;  4P3Y B;  3VK9 A;  11GS A;  3OR5 A;  2X8H A;  3LYK A;  3IBH A;  2JU5 A;  1O8X A;  4Q5F A;  2PVQ A;  1OKT A;  2GZP A;  2H6Z A;  3IK7 A;  1SD8 A;  2LQQ A;  1LU4 A;  3M1G A;  4KA0 A;  4IHU A;  2JZS A;  2X8C A;  5DAK B;  5D9V A;  3FMW A;  2HNL A;  5ECQ B;  1GTU A;  3TKP A;  2VD0 A;  1JZD A;  1Q98 A;  2H19 A;  4V1A p;  4KE3 A;  5H5R A;  1EP8 A;  1QUW A;  5ECL B;  1VF4 A;  1GSY A;  4WBJ A;  3GNJ A;  2LUS A;  1PD2 1;  2EIO A;  5CRG A;  1TXX A;  3K8N A;  2KUC A;  4FYC A;  4O5R A;  2N5F A;  1T8E B;  2QA2 A;  4MZW A;  2KOK A;  2HE3 A;  3VWV A;  5H5Q A;  1O7U A;  1A2L A;  1XXU A;  4IP1 A;  4MK3 A;  1GSS A;  5CRD A;  2R0P A;  4NV2 A;  1FOV A;  2YZU A;  2LV3 A;  4O32 A;  2IMI A;  3ME7 A;  4XRD A;  3H1N A;  1XPV A;  4AJ6 A;  2C0D A;  2YJ7 A;  3EPT A;  4KDX A;  1B4P A;  1YEX A;  2DML A;  2E2M A;  5B8B A;  1WMJ A;  4HI7 A;  4L5L A;  5DJL A;  4JE1 A;  1EV4 A;  2GSQ A;  3CXG A;  1THX A;  4YQV A;  3JCM L;  2H1B A;  6GSX A;  1RW1 A;  3V1W A;  3UVH A;  3ZYW A;  3TOU A;  1BED A;  3R3E A;  5GSS A;  2FA4 A;  4KB3 A;  1TK8 B;  2I9H A;  1PA3 A;  2AYT A;  1YF1 A;  2DJK A;  3E3E A;  3RBT A;  1IYH A;  3MYD A;  1J9B A;  2HRA A;  2WGR A;  4ZL8 A;  5HR2 A;  4EDZ A;  3W6G A;  4BVX B;  5ELG A;  2WZ9 A;  2PUK C;  3QMX A;  4RI7 A;  1QQ2 A;  2XPD A;  5COH A;  1EZK A;  2V6O A;  2EIQ A;  1YY7 A;  1M2D A;  4F82 A;  3ED3 A;  4K2X A;  5AN1 A;  4ISD A;  3HZ4 A;  2C0F A;  2YWO A;  3FRC A;  3U6V A;  5ELA A;  1GUK A;  4MF7 A;  4E8H A;  1E6B A;  4MJA A;  3IC8 A;  4CY6 A;  4PUA A;  3QFB C;  3RHB A;  3GKX A;  4DSQ A;  2VIM A;  2K6V A;  5ECP B;  3RAZ A;  2OAC A;  2M46 A;  3HVS A;  3N5O A;  2KHP A;  4L0W A;  6GSV A;  4YKG A;  2B7K A;  2AB6 A;  2GST A;  6GSY A;  3L78 A;  4XS1 A;  3QDN A;  1M99 A;  1XWB A;  1BG5 A;  5AGY A;  3F3Q A;  1AW9 A;  2ON5 A;  3CMI A;  2H71 A;  2FA8 A;  4ZB9 A;  3KP9 A;  1DUG A;  4ML6 A;  5G5E A;  1S3D A;  1AIU A;  4MMM A;  4TR1 B;  5ECS A;  5DBQ A;  3PR8 A;  1MD3 A;  4PTS A;  2HI7 A;  2NVL A;  5D8I A;  1G7E A;  3S9F A;  2ON7 A;  1B8X A;  2DLX A;  3ZIJ A;  3EU3 A;  1VGL A;  2AAW A;  4ECJ A;  1UN2 A;  2F8A A;  3UJ1 A;  5ENU A;  4F2I A;  5BMU A;  1XW6 A;  1TRU A;  5ABR A;  4JR6 A;  3CSH A;  1OC8 A;  3UBK A;  1GUL A;  3MIX A;  2R6K A;  2YCD A;  4GSS A;  1M2A A;  5HR3 A;  1OKD A;  1FG4 A;  3TKS E;  2DJ2 A;  1YKC A;  3IHQ A;  2FGX A;  1KBN A;  1TRV A;  3HYP A;  3IK9 A;  1AQX A;  3FK8 A;  4WET A;  4ZBA A;  3HD5 A;  3DRN A;  5KN0 A;  2PER A;  3C71 A;  1OE8 A;  2GTU A;  5LNK e;  4IEL A;  3KGK A;  4K7I A;  4TR0 A;  4TR3 A;  2R0C A;  1DE1 A;  2GLR A;  2ALB A;  2MBT A;  1ZYQ B;  1WJK A;  4O5Q A;  4I5Q A;  2FUG 2;  2WCI A;  2KLX A;  1V98 A;  1OVN A;  1A2J A;  3TUE A;  13GS A;  1TRS A;  3KMN A;  3VFI A;  1GTI A;  4DVC A;  1LBK A;  5G5F A;  1GLQ A;  1F2E A;  3TDG A;  2HT9 A;  4MP4 A;  5GST A;  2BTO T;  1I9D A;  1SK1 A;  4XHM A;  1K3Y A;  5DAL A;  3IC4 A;  3LSZ A;  1U87 A;  3KP8 A;  2ZCT A;  3WT2 A;  4OCF A;  3I69 A;  2R4V A;  1X9S B;  4IGJ A;  4IP6 A;  3TJF A;  3WD6 A;  3ZFB A;  2OAD A;  4I6X A;  3IV4 A;  3IAM 2;  4KF9 A;  5HQP A;  3TKS C;  3WGE A;  5D9X A;  4EIQ A;  4JBB A;  4EC0 A;  2GQK A;  2AHE A;  1PSQ A;  3AY8 A;  2VL9 A;  5IMF A;  1GP1 A;  4LLR A;  5DQY A;  4D73 A;  5HFG A;  3F4T A;  5GZZ B;  1CQH A;  3LW9 A;  2GQL A;  4PNG A;  1MEK A;  2IME A;  3ZVJ A;  1XW5 A;  1G6Y A;  1EV9 A;  5EVO A;  5ECO B;  5IO2 A;  3ERW A;  3U5R E;  3QAW A;  1X5E A;  3VWX A;  3BD2 A;  3KJY A;  5L71 A;  3QPM A;  2BMX A;  3UBL A;  1UC7 A;  3MWH A;  2F8F A;  4HOJ A;  4OO5 A;  2JAD A;  5D93 A;  4TXO A;  1V57 A;  3ZTL A;  2K9F A;  5EL8 A;  1XOA A;  4KW6 A;  2HZE A;  4RQR A;  2F51 A;  1AQV A;  1BAY A;  2HSH A;  4TN8 A;  5H5S A;  4Z7X A;  4WF5 A;  4YQU A;  2FD3 A;  5IM9 A;  4MZC A;  3GMF A;  2H30 A;  3FYG A;  3F6D A;  4J2F A;  1FVJ A;  4HZ2 A;  2YAN A;  5KN2 A;  1GSF A;  3EMP A;  5INY A;  2O87 A;  3Q18 A;  3KMO A;  4HQS A;  3CTG A;  1Z3E A;  2L4Q A;  1K0M A;  1ZGN A;  3HJO A;  1KNG A;  1M9B A;  1PX7 A;  3FR3 A;  1A8Y A;  2LQO A;  4KSO A;  2DBC A;  1NHY A;  2KP1 A;  2C80 A;  1GSQ A;  5DCH A;  2IWT A;  1I5G A;  3C73 A;  4G0I A;  3HDC A;  3UIW A;  2PGT A;  5G1K A;  4Q5N A;  3VWU A;  4MPF A;  4MJC A;  2N5B A;  3TKQ A;  1TI1 A;  1HQO A;  4K0G A;  2H6Y A;  1SL1 B;  5HR0 A;  3M8N A;  3F9U A;  3TRP A;  4X43 A;  2I81 A;  5ID2 A;  2H66 A;  3QCP A;  4J57 E;  3F3R A;  3TRX A;  2LEG A;  1Z6M A;  2M80 A;  4ZIJ A;  1K0N A;  4WF4 A;  3DVX A;  1PN0 A;  2OBK A;  4TVE A;  1C72 A;  4IN0 A;  5G30 A;  3FEU A;  2LJK A;  1PL2 A;  1TTZ A;  4L0U A;  3GUR A;  2X64 A;  1KTE A;  2OE3 A;  2MZC A;  1SU9 A;  4ZBB A;  1TP9 A;  2V1M A;  2WS2 A;  1GUM A;  1R26 A;  1X9M B;  1ML6 A;  1Q4J A;  2PVO C;  1G7O A;  3O6T A;  2VM1 A;  1F3B A;  2XBI A;  4POB A;  5J3R A;  2YWM A;  3VPQ A;  2H0H A;  2MYG A;  2H01 A;  3NOF A;  5CRW A;  4DSS A;  4KX4 A;  3QFA C;  1SL0 B;  2H76 A;  1DBY A;  3CSJ A;  1VF3 A;  1FVK A;  3IAS 2;  4WR5 A;  1PN9 A;  4G0L A;  2L5L A;  1U3A A;  4BVY B;  1NHO A;  5AIX A;  5ECR B;  3GUS A;  1FHE A;  1JLV A;  2JSZ A;  4I8B A;  2UZ8 A;  3R2Q A;  4GQF A;  1ZOF A;  2WRT A;  2WDU A;  1XZO A;  4ZL9 A;  1QMV A;  2LRN A;  3DGQ A;  5IIZ A;  4JZQ A;  3MNG A;  1QXH A;  2O85 A;  4HQZ A;  1K3L A;  1SKS B;  1EEJ A;  3FZ9 A;  4ICY A;  1XWK A;  2DJ3 A;  4IBP A;  3GTU A;  4GXZ A;  2GGT A;  2RM6 A;  4V2M A;  2HXK A;  3DEX A;  1BJX A;  4O7H A;  1OC9 B;  3TRQ A;  4IJ3 A;  5B6N A;  2L6D A;  2GT6 A;  1NW2 A;  3LFL A;  4HEA 2;  2A4H A;  3FR6 A;  2DC5 A;  2GVP A;  1GSE A;  2B5X A;  2LRC A;  4KND A;  1O8W A;  3PIN A;  4KDU A;  3G7I A;  3W8J A;  2JZT A;  3EUR A;  1QGV A;  5D9T A;  4Z2T A;  1B9X C;  1YF0 A;  5CYY A;  1ZCP A;  2MBS A;  3TKS A;  3DWV A;  2VCZ A;  1S3C A;  3IRA A;  5IPH A;  4YQM A;  5IMZ A;  4KGI A;  4WKW A;  3L9U A;  4K5S A;  3GFK A;  1X0R A;  2NPB A;  3GV1 A;  3UMA A;  2ZUP A;  3I6A A;  4PUR A;  1SK0 A;  5J41 A;  3HJM A;  2B3S A;  3F6F A;  1FAA A;  4PQI A;  2R2J A;  2EIR A;  2OE1 A;  2RLI A;  3EVI A;  1OAZ A;  3DKS A;  5G2Z A;  4EKZ A;  1PL1 A;  2ES7 A;  1XFL A;  2WFC A;  1GSU A;  1QFN A;  2VCW A;  2X99 A;  2L6C A;  4K2D A;  5G31 A;  3ZIV A;  1FW1 A;  3F0I A;  4V2L A;  3US3 A;  3KM6 A;  1ZZY A;  4MF6 A;  4N11 A;  4F0C A;  2B7J A;  2CV4 A;  4MF5 A;  2AV4 A;  3HA9 A;  4YAP A;  12GS A;  2CVK A;  2GZY A;  17GS A;  5DVB A;  3F4S A;  2VLV A;  1VF2 A;  1T7P B;  1AUC A;  5IPG A;  4GF0 A;  3NZN A;  3A5W A;  1TOF A;  2LST A;  4POM A;  1JZR A;  4ULX A;  4X0X A;  6GSS A;  2IFQ B;  1ACV A;  1PMT A;  1UVZ A;  4AGS A;  2OE0 A;  4HZ4 A;  4IVF A;  1GNE A;  4MJB A;  4QL9 A;  5J5N A;  2DJ0 A;  3GYK A;  3Q74 A;  5EPF A;  4IQ1 A;  5A5K A;  1GNW A;  20GS A;  3IOS A;  3A2V A;  1XWC A;  2GDR A;  4USS A;  1F37 A;  3QAV A;  1Z5Y E;  1B4Q A;  2IL3 A;  4XTS A;  2D2Z A;  5D96 A;  1RK4 A;  5ECI B;  1TU8 A;  3LGC A;  3H79 A;  1YEP A;  1WE0 A;  3WGX A;  4OFT A;  1GUH A;  3C1R A;  1YQ1 A;  2QGV A;  1X9W B;  1ILO A;  3DXB A;  2VL3 A;  3HZ8 A;  1E2Y A;  5JCW A;  5JCU A;  4BWQ A;  4EO3 A;  2LRT A;  3WGD A;  1AC1 A;  4AF2 A;  5C00 A;  3ZL5 A;  5IOW A;  1N2A A;  1M7T A;  3ZRE A;  2QSI A;  1PRX A;  1A23 A;  5CRH A;  4EVM A;  2FY6 A;  4V1A g;  4WXT A;  2NBS A;  4XS4 B;  4BA7 A;  4MPG A;  4DEJ A;  3NIV A;  1J0F A;  4EE0 A;  4NHZ A;  5A4V A;  2VCT A;  2FWE A;  2B6M A;  4GST A;  3H4K A;  4PQH A;  1KEB A;  2O8V B;  1GLP A;  1THO A;  2PBJ A;  1AXD A;  1SEN A;  4K8M A;  2IMF A;  2YOI A;  3WT1 A;  1SYX A;  2A2R A;  1R4W A;  2H73 A;  5DAK A;  3LXT A;  5IMV A;  5KN3 A;  3LEF A;  2C8U A;  4V2N A;  1V2A A;  5ECM B;  2IN3 A;  3FR9 A;  2H6X A;  4TXV A;  2E2G A;  2TRC P;  4DSR A;  3L0H A;  1Y6E A;  5LCZ A;  2I3Y A;  4JU5 A;  5KOX A;  3QD9 A;  4MDC A;  4GCI A;  5KOW A;  5AIV A;  3CBU A;  3CSI A;  4PXO A;  1WWJ A;  5GAN D;  4ID0 A;  2A4V A;  1ZYN A;  3KEB A;  5B7C A;  4JR4 A;  2HRF A;  1A24 A;  2VUP A;  1MD4 A;  4LA1 A;  1CQG A;  4EDY A;  3GTU B;  1VRS D;  3N9J A;  1R5A A;  3PH9 A;  1WPI A;  14GS A;  3VUR A;  5G1L A;  4A5P A;  4NAX A;  3KXO A;  3E0U A;  3LYP A;  4HU7 A;  4X4J A;  1B9Y C;  4ILF A;  3DYR A;  5DJM A;  1F3A A;  1MDI A;  4I2T A;  2R0G A;  4EXJ A;  2HYX A;  3HVX A;  4WEY A;  2C1Y A;  3C8E A;  4OMV A;  4YH2 A;  4J56 E;  2WB9 A;  4K5R A;  3WYW A;  1USB A;  2XPE A;  3EYT A;  4G10 A;  3RDW A;  1XBS A;  1OC3 A;  3D6I A;  4NPB A;  4YAV A;  2CQ9 A;  1GRX A;  2X8G A;  1EEM A;  1R7H A;  1XVQ A;  5FT3 A;  2H1A A;  3UAR A;  2VL2 C;  3SWL A;  4Z2R A;  2HSY A;  4XIH A;  5ECH B;  4XCS A;  2P5R A;  1G6W A;  4ZXG A;  1EGR A;  3FZA A;  1URM A;  1H4O A;  4KSM A;  3ZVJ D;  3FZ4 A;  4PNF A;  4BVX A;  5EY6 A;  4OO4 A;  1SJZ A;  3TJG A;  1M9A A;  2OA7 A;  1MDK A;  2QC7 A;  2L5O A;  5C04 A;  1XW9 A;  2IIY A;  4GTU A;  5E59 A;  3D0Z A;  1T3B A;  1K3O A;  2C0E A;  1ERW A;  2QKE A;  5HFI A;  1A2M A;  1ERT A;  1BX9 A;  4XS6 A;  3KZQ A;  3H8Q A;  4OCE A;  1V9W A;  3KH9 A;  3D21 A;  4Q5Q A;  2L59 A;  3RPN A;  3HY2 A;  1X5C A;  1M0U A;  2G0F A;  1BQ7 A;  4OFN A;  1NM3 A;  2ZNM A;  2H0I A;  3D5J A;  3HKR A;  3KTB A;  1GWC A;  1F6M C;  3DVW A;  1TW9 A;  3QAG A;  3FW2 A;  2IJY A;  5B6M A;  3TGZ A;  2P5Q A;  1IYI A;  4O92 A;  5CRE A;  1GH2 A;  5HFK A;  2C4J A;  1EWX A;  2A2P A;  1Y25 A;  2GSS A;  1GSD A;  4E8E A;  2HRN A;  4HJ2 A;  1Z7P A;  4ZBD A;  3I9V 2;  2FHE A;  4CDO A;  2H75 A;  3VPT A;  5DQS A;  1JZO A;  4GSN A;  4N10 A;  3EU4 A;  3HHV A;  1F9M A;  2BJX A;  3D4M A;  1S3A A;  2VCQ A;  3GKN A;  3GKK A;  3O3T A;  2DIY A;  2FLS A;  10GS A;  6GSW A;  2JSY A;  2FWG A;  4ZL7 A;  1K0D A;  1FO5 A;  3DIE A;  3LJR A;  4HS1 A;  2B1L A;  1HNA A;  2K8V A;  5B8A A;  3G7J A;  2H70 A;  7GSS A;  3EC3 A;  1AQW A;  2H0G A;  1RQM A;  4EL1 A;  4PQ1 A;  1YJ6 A;  3GH9 A;  3HVV A;  1TJD A;  2CAQ A;  3ZFL A;  4O5U A;  2C3Q A;  1XVW A;  1TDI A;  3A2W A;  1W89 A;  2L4C A;  3BJ5 A;  4OWY A;  3VWW A;  1SYR A;  3TJB A;  2J23 A;  2EC4 A;  1UA5 A;  2K18 A;  3A2X A;  4K0N A;  2MMN A;  1YDK A;  4GWR A;  3HXS A;  3ZML A;  1OE7 A;  2CZ3 A;  16GS A;  1PGT A;  22GS A;  3CRU A;  2YNX A;  5FWG A;  4CY8 A;  1TK5 B;  1MDJ A;  1WRY A;  3GN3 A;  2YWN A;  2YV9 A;  4F03 A;  1Z9H A;  4FH8 A;  2R3X A;  5IMC A;  4LL4 B;  2WUL A;  1YZX A;  2MMZ A;  4WR4 A;  3APQ A;  5F8B A;  4NWY A;  3L9S A;  5LD0 A;  1FB6 A;  1BYE A;  1XIY A;  1PX6 A;  2PMT A;  1EP7 A;  2NDO A;  4FYU A;  2YZH A;  4AJ7 A;  5A4U A;  1U88 A;  4ECI A;  2YP6 A;  5DAL B;  5KN1 A;  2E0Q A;  1T1V A;  1A0F A;  1T00 A;  5IQY A;  2TIR A;  2R5G A;  3O76 A;  4GQC A;  4GLT A;  3I43 A;  2GT5 A;  3D4T A;  6GSU A;  3ZIT A;  1FOH A;  3FY7 A;  4FQU A;  2HRK A;  5D73 A;  4TR4 A;  2CA8 A;  5JWQ B;  2DKH A;  1TRW A;  2HSM A;  2WJU A;  5J4U A;  2QA1 A;  1B48 A;  1O81 A;  3M9J A;  4D73 B;  3GKM A;  4HU9 A;  2B5Y A;  2PU9 C;  2H8L A;  4IQA A;  5IMA A;  3VLN A;  2VM2 A;  1HNC A;  2XHF A;  2E7P A;  1AAZ A;  3PPU A;  4LMV A;  3KH7 A;  3GX8 A;  3UL3 A;  3F4R A;  4ZIL A;  2V2G A;  1TU7 A;  2YJH A;  2VL2 A;  3KIJ A;  4TXO B;  4N0Z A;  3FKF A;  1U3I A;  4Z2U A;  1MTC A;  2OBI A;  2FCH A;  2PWJ A;  3MAK A;  2Z9S A;  5HR1 A;  2HZE B;  3UVT A;  2CX3 A;  1G0T A;  3F8U A;  1JFU A;  3RHC A;  2LKU A;  5DCG A;  5E4W A;  2OJL A;  2YV7 A;  1O6J A;  1ABA A;  4ZB8 A;  2FNO A;  4KH7 A;  4XRA A;  4BPY A;  3GST A;  2VLU A;  1ERU A;  4GRF A;  2DIZ A;  1SD9 A;  2VLT A;  4BL7 A;  3FZ5 A;  2GZZ A;  4KUN A;  4OD7 A;  2LJA A;  3IDV A;  3Q19 A;  3Q6O A;  4PUF C;  1HD2 A;  4F9Z A;  4TW5 A;  2RII A;  5F06 A;  1NSW A;  2CX4 A;  3KTL A;  1JZW A;  4HJM A;  4G0K A;  5CP1 A;  5J9B A;  2X4A A;  2CVD A;  5A4W A;  3CTF A;  4IJI A;  3M9K A;  3IE3 A;  3GSS A;  3IR4 A;  1ST9 A;  4G2E A;  2G2Q A;  2X49 A;  1A0R P;  3M0F A;  1SJI A;  3A3T A;  2CZ2 A;  2IPA A;  2R37 A;  3L9V A;  4MH2 A;  3ZRD A;  1JLW A;  4LMW A;  1ZL9 A;  1DSB A;  4MZB A;  4ZB6 A;  1J08 A;  1TI3 A;  3LXZ A;  2AJQ B;  2LJR A;  2GSR A;  1Z7R A;  4MLY A;  1TK0 B;  1O73 A;  2REM A;  1DE2 A;  2C3T A;  4Q5R A;  4ECC A;  3TB2 A;  4OFM A;  5FHI A;  2FWF A;  2FWH A;  5ID2 B;  2VCX A;  1GL8 A;  1X5D A;  4ML1 A;  3J7Y b;  1SJ6 A;  3BCK A;  4K9Z A;  4N0V A;  5CAX A;  4AJ8 A;  1PQN A;  3GIX A;  4FYB A;  3TJJ A;  3ZZX A;  4K7N A;  2VAF A;  4IW9 A;  2LTK A;  3UEM A;  3GX0 A;  4MH3 A;  2L57 A;  2GS3 A;  4PGT A;  1GTB A;  5D9W A;  5J9C A;  2IMK A;  3P8W A;  5IO0 A;  2GQM A;  3BOA A;  2O89 A;  2O7K A;  3A5I A;  3LWA A;  2I1U A;  4DSS B;  4BVY A;  4EF0 A;  2YWI A;  1WIK A;  3EIN A;  3GH6 A;  1FB0 A;  2YPM A;  4RQX A;  3TJK A;  4FO5 A;  4POK A;  4QL7 A;  3TCO A;  3IHG A;  1ZYP A;  2H1D A;  2XBQ A;  1PKZ A;  5JWR B;  1QK8 A;  2OKA A;  4MNN A;  1WP0 A;  5GAP D;  1H75 A;  2PN8 A;  2VD1 A;  3MSZ A;  1XOB A;  3HJP A;  3ZMK A;  5CO3 A;  2H74 A;  3E9J B;  3TOT A;  2VCV A;  4POL A;  3W8S A;  4KCE A;  3GRX A;  2B5E A;  5F07 A;  4H86 A;  1OC9 A;  5IOX A;  5JWO B;  4ECB A;  3ERF A;  1ZMA A;  2HZF A;  3IXR A;  1HYU A;  5IMD A;  4I97 A;  4CW9 A;  9GSS A;  2XC2 A;  4IKH A;  1U6T A;  3SBC A;  3P90 A;  4EIP A;  4G19 A;  2P31 A;  2F9S A;  5ECN B;  2V32 A;  3ERG A;  3IA1 A;  5ECK B;  8GSS A;  3RPP A;  4TOP A;  2AUV A;  3H93 A;  4HDE A;  1XCC A;  2M72 A;  2DMM A;  2DKI A;  4NMU A;  3APS A;  1M2B A;  2YN1 A;  2VOC A;  2B1K A;  4FIW A;  4WBR D;  1WOU A;  1N8J A;  1K0B A;  3DML A;  2RUE A;  3TKR A;  3QOU A;  1XWG A;  4HUA A;  4KDY A;  5F0G A;  4L8E A;  4K6X A;  4TRX A;  5CNW A;  5F05 A;  4F0B A;  1OYJ A;  3APO A;  1SL2 B;  4TKY A;  1K0O A;  1Z6N A;  1JHB A;  2C3N A;  3LG6 A;  1ZYE A;  2TRX A;  4K7O A;  3VI5 A;  5KEJ A;  3CYN A;  3G9B A;  3ME8 A;  4KAE A;  4N30 A;  3ZLP A;  1R5P A;  3CRT A;  3C1S A;  3M3M A;  2RUF A;  3PGT A;  1LJR A;  2CVB A;  1EGO A;  3LQ7 A;  4MJE A;  3LOR A;  3GA4 A;  1O85 A;  2J9H A;  1A8L A;  4I2U A;  2VO4 A;  3GL3 A;  3QR6 A;  3GHA A;  1V40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...