4FZ5A

Crystal structure of human tirap tir-domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
141
structure length
116
Chain Sequence
b'SRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSGAISELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEGCTIPLLSGLSRAAYPPELRFVDGRGPDGGFRQVKEAVMRYLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll/interleukin-1 receptor domain-containing adapter protei
publication title X-ray Crystallographic Structure of TIR-Domain from the Human TIR-Domain Containing Adaptor Protein/MyD88 Adaptor-Like Protein (TIRAP/MAL)
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 116
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4fz5A00
4C6TA 2Z5VA 1FYXA 1FYWA 3UB3A 4EO7A 3UB2A 4LQDA 1O77A 2M1XA 5KU7A 4C7MA 2J67A 4W8HA 4LQCA 3OZIA 5FORA 4FZ5A 1FYVA 4C6SA 4OM7A 4W8GA 5H3CA 3JRNA 4C6RA 3H16A 4C6TB 4LZPA 1T3GA 3UB4A 2JS7A 2Y92A 4DOMA
chains in the Genus database with same CATH superfamily
3Q3EA 2XBUA 1OA0A 2Q3CA 4E5KA 1TJPB 3U56A 2JIZA 3MB5A 2AXQA 2UVPB 3RYIB 3K1AB 1KFBB 3QVSA 3USES 5HIKA 1CZKA 5IZCC 5E7JA 2KX7A 9ABPA 1G59A 4BFSA 2P8JA 4I8IA 4C88A 3BRWA 1FDWA 3T95A 5AYVA 3EQZA 1G2IA 3UJ6A 2QMUA 3HY6A 4CGYA 4TQ9A 5U9CA 4RK6A 4IHJF 4TWZA 1XQVA 2B99A 3AILA 3QF4B 4DAOA 1KU0A 3KTOA 4IDFA 4U2FA 1UBFA 3H4TA 3GQBA 1YR2A 1JDBB 2Q4DA 4TKVA 2ALJA 5FKJA 4TOIA 3EXEA 2TECE 3T41A 4QJ4A 4AC9A 1E2BA 3UG7A 4D0GA 3CQ9A 4H6VA 3LDAA 1E2UA 1PGJA 1RAIA 2XZLA 1E5DA 3I2YX 4DDVA 4EK9A 1EFUA 4E07A 1G63A 5ILOA 1C8BA 3P9CA 3UPTA 2J3QA 1T43A 1BHO1 2OHXA 4BEBA 3JAKB 1Y1SA 121PA 3PE3A 4LXYA 2I6QA 4D92A 4A0SA 4RETA 1RJFA 1ECCA 1VBNA 4KFSA 4F5EA 5B6JA 1PCXA 2ZLBA 1FPMA 2WVJA 3K7EA 3PEFA 3PRJA 2ROQA 1W36B 1Z8HA 3Q6NA 5H3HA 4KACA 1NY6A 1T0BA 1U1EA 3OQPA 2VNKA 2A35A 3AH8A 4KG7A 4KN6A 4KQIA 4ARZB 1VP9A 5A6VA 3JQGB 2QD4A 5JCZA 1XN1A 4L15A 5CT4A 4EKEA 5CH5A 2CMDA 2H2DA 1I0LA 4KP7A 3VHQA 2ZZMA 3QEAZ 5F35A 5CFPA 1ISFA 3IIIA 2F59A 1WW8A 4WFQA 5FDFA 3IP3A 3SR4A 5LNK1 1W4CA 2P3QA 2ZTSA 3HA7A 5TGDA 5EFZA 2NTVA 3KJIA 3CLRC 1IATA 4JQSA 3W8EA 3DEZA 1IY1A 4NFYA 4R9SA 3ANYB 3T3PB 3BK1A 3ADDA 3HJBA 4WX2B 3UT0A 5AOBA 2FYTA 1AC5A 1U0SY 3BIFA 1TKRA 2W48A 4YCAA 1RJWA 1MNQA 5EPOA 1FX0A 4DBLE 3GCZA 3Q3HA 3EC7A 4RKEA 3WRYA 6ABPA 1EFAA 1V1MB 2H18A 3GPIA 5AKZA 2ZPTX 2JLUA 2ZUFA 4Y0AA 1GGFA 1RQGA 3TSOA 3NV9A 2G9VA 3VTFA 2GJAA 3TFOA 1MG5A 2WF6A 4NJOA 1C0PA 2FEPA 4NSNA 1J4AA 4URYR 2EEPA 2J5XA 2VTEA 4CU5A 4NBSA 4IDPA 1GFSA 3QOYA 4PBSA 2B35A 4TS1A 2IKSA 1BG6A 3QG1A 1DCFA 1CZOA 4IFEA 3KCQA 4YB8A 3WMGA 2YDYA 3B6MA 3H4IA 4JR1A 4D81A 1KAMA 2BAGA 4C4TA 4Q4HA 1Z6GA 2D13A 2H29A 4FN4A 2V6FA 4N5DA 2ZJBA 3SQMA 4EOGA 4HWPA 2VCHA 3VR4H 1E6CA 3PHBE 4YWHA 2A8YA 3EZYA 1NAIA 1L4GA 1R6XA 3FSGD 5H59A 1N3YA 2R9VA 1R4NA 4P4SA 2ZM5A 1YUMA 4W82A 1PQPA 2ZIXA 3OURA 5EQTA 2PNJA 5IT4A 4KO4S 3CPSA 2EJTA 3NWBA 4LYAA 4PIPA 2HMVA 3KKLA 4I4TF 3Q8MA 1CUBA 1IVNA 3F5QA 3H0CA 4TQUS 5JPDA 5ALQA 3MM4A 1U1DA 3ESRA 5DASA 2PWZA 2XCRB 1W47A 1ZJYA 3BFXA 3C3DA 2DLDA 5ECYA 5EN4A 4LWZA 4Z4EA 1R0XA 1YVUA 1RM0A 2B7BA 1SA0A 2ZJ2A 3HY4A 1ULSA 4RF3A 1IVYA 3ZXXA 5DN6D 2P2NA 3U3MA 2W6ZA 3P9IA 1DBPA 2JHGA 4JJZA 1TF7A 3V8NA 2D1YA 1RP1A 2PLAA 3B85A 3OQHA 4LBWA 4D3ZA 5E6UA 2ZVQX 1UL1X 5EQJB 3LLCA 3LHKA 4MS4B 1TKAA 1FQKA 3KSBC 4EI8A 2I8AA 1ZC4A 4FDUA 3RU2A 2ARKA 3PR1A 2VH2A 3QLJA 1L3BA 2FJPA 1L5SA 3B20A 4IUDS 4RQTA 3OLQA 1G291 2VF2A 4KTVE 1BD3A 2QIPA 2BEVB 1GQYA 3BQ9A 5ESXA 5AW5A 4ID9A 4QXMA 3BF7A 4D4KA 3LBAA 4JCCA 3FFAA 3RB8A 2B34A 1TDJA 4HLUC 4K6GA 1NWHA 2PWBA 3DE6X 3OJXA 4ZRDA 1WQ4A 1I32A 3HV0A 2HHAA 1DE0A 4ND4A 1OFUX 3SJUA 4MQUA 1R0RE 2HBYA 3WISA 2WPDD 3IAAA 2NU9B 3GFSA 1YOVA 1FFBA 1FDVA 4JMLA 2DB3A 2CY0A 3SC3A 1KWGA 4I0WB 5FTWA 3I9KA 2O2SA 2VPIA 3DR3A 1QORA 1USVA 1CF2O 3B78A 3KB6A 5CEJA 4U0KA 2WTBA 2QT9A 2GHIA 1Y5LA 2JFGA 3O0DA 5JCJD 5B12A 5C1PA 1P19A 1RAEA 1AXEA 1NXWA 2J0UB 4B3HA 2BMDA 1FTQA 4NZMA 1QAOA 1E7MA 1CC1S 1TADA 2J1LA 1V9SA 5ABPA 1KWKA 2PLWA 3DOFA 3H8SA 1VJ0A 4DBLC 5A9SA 3TLMA 5EKUA 3S7ZA 4UXHA 3EX7C 3MINA 4UARA 3L3BA 4MQFA 3UJ7A 2QQ0A 2WP0A 4NE9A 2NU8A 2SKCA 4LJ7A 4CM8A 1QIFA 1CY0A 1V6AA 4DLLA 4F96A 4Q3BA 2GPNA 2ZRFA 2BTQB 2O3JA 1WF6A 3BCUA 4P83A 3UB4A 3V8EA 3ZY2A 4DSUA 1UFOA 3UATA 2ZDGA 5JECA 4Q7MB 1N3BA 4X1IB 1LPNA 4DJDC 4U6QA 3BH7A 1J2JA 2VAVA 2VUTA 3K30A 3KXPA 2QX9A 3EXIB 5FOVA 4Q1VA 5CD9A 5HRAA 4LF9B 4RM2A 5A2GA 3ZY4A 4Z4GA 2C9OA 1RD4A 2PZFA 1YL5A 3SIXA 4BRSA 2GVNA 1YZNA 5EMHA 3I04M 1A7KA 3W90A 1A5AB 3IPXA 2HL6A 3V5NA 2VDWB 4BIIA 1HNWB 2IC5A 2LW7A 4P7FA 1K6IA 2I3DA 3ISJA 4U2DA 4AZWA 2BFFB 2Q9AA 5JAUA 2HHCA 5EEGA 1B74A 2X76A 4JH0A 5M29A 5IBPA 1DKMA 4MX8A 2G40A 4QOFA 3N8NA 3UUWA 3N70A 4HWOA 2GPWA 2ZW9A 2XCOA 2IZ5A 2J41A 3RT9A 2Y0EA 5J4HA 2ATEA 3JQAD 3VA7A 1GLGA 1II8B 3DONA 4IJWA 3QIVA 2PFGA 3EMBA 2PSEA 3HVUA 4FEGA 3AYZB 2BM0A 5TPWB 2B36A 3E7PA 3UW3A 4UUQA 2AW3A 4CLOA 2V9ZA 2VI5A 3DXYA 1IHDA 3MS4A 1U0HC 3RJ5A 3FVRA 4ZYYA 3RNLA 3BWCA 2E5WA 4IQFA 1RRVA 3O4VA 1NBIA 1GVNB 4CKBA 2BUAA 4PU0A 1YTUA 2II6A 4IDAA 2SCUB 1P74A 4DLVA 4CBVA 3BWBA 4HB4A 1IJFA 1YS9A 1O54A 2BP7B 2PEYA 3OJOA 1ONNA 2YWBA 4QUAA 5AKIA 1XN4A 1XZIA 2VDKB 5F5XA 1UDXA 5HCNA 3M3PA 1RWMA 3H9QA 1I5EA 2P6PA 4KRYA 2HGZA 4CCYA 1Q7TA 3U6KA 4NAVA 5D1HA 4EVQA 2ODNA 3L1HA 1O7JA 3QA9A 4YH1A 2Q4TA 4IZOA 4LDNA 2HF2A 5A71A 1DJOA 1K7YA 4NYJR 4QFMA 2QSUA 5U1PA 3X1YA 1GIAA 4N82A 3U60B 4ND8A 4KPYA 2DYKA 4GGMX 3IHWA 1OIWA 4ZV7A 1F12A 1PT6A 1SZCA 3GOQA 1FDUA 3P19A 3PVSA 1TM3E 3EEFA 4WLNA 2JLSA 4BTVA 3N76A 1L7DA 2AFHB 1YDWA 1U11A 2C82A 1Y3AA 2KW5A 2QY9A 3NBFA 1BDMA 2ZEJA 4FLEA 4ZO4A 5JVDA 2C1EA 2Q3JA 2E82A 2LXNA 4JODA 3L43A 1HV8A 3D0OA 2RKOA 4RLQA 1FW8A 4B7XA 2OHHA 1RWVA 3MLEA 4RVOA 1C8LA 1U8FO 3HCFA 4NEHB 2O8DA 1AA9A 1M3SA 1A9XB 1RRPA 2IEDA 5UKDA 1HWYA 3PTZA 4PZYA 3BT7A 2XKAA 4DWJA 2IH2A 1XDZA 1Z9BA 2X8BA 4DR7B 2VPQA 4GYYA 3OQMA 2R79A 4OFZA 2J3HA 4IIJB 4PLWA 5BNFA 4AX8A 5IKMA 4MV1A 2XB4A 3LBFA 1IWOA 3M6VA 4IEFB 3QKWA 3V7YA 3JXEA 1KMHB 1ZN7A 4QT0A 3TNFA 5FYQA 2EOAA 4QQ8A 1RABA 3OBBA 3KKQA 4DCCA 2GCNA 3F5SA 5H9WA 1FUUA 2BF4A 3HCPA 2F3TA 3ZDYB 4ER5A 5DHUA 1AQIA 3KSUA 4N5IX 4QUEA 1P3JA 3I0ZA 5TQ0A 2AH5A 4BJ5A 1BA3A 2Q9BA 2X9NA 5IANA 1BCSB 1ZUNB 1QVVA 3GC6A 1JRLA 3G2KA 4XJXA 1TOAA 5HIAA 1HZJA 5CVDA 4EPTA 1GAEO 2NNWB 4J90A 2RK6A 2YYZA 5JOQA 4S1PA 5HHTA 4EG0A 5I4BA 4F2WA 1HRKA 2KSQA 4JI5B 3TLGB 1YE8A 3I6BA 4F7WA 2PGOA 1RVDA 2X40A 4KIFA 5DI9A 1NUAA 3SC6A 5BQFA 1F6BA 2ZKLA 2DR2A 4E51A 1VHJA 2NV6A 1QF9A 1ZW6A 4K0RA 3I39X 3I45A 5AI9A 2QTHA 1SBQA 1O6FA 3E0XA 3D2BA 3ICVA 1NJ8A 3RF7A 3STVA 2JL1A 2AG8A 1O96B 1GYPA 1TA9A 2GCOA 2OECA 2VPXA 1EE2A 3NHPA 1RRFA 4KWIA 2O7NA 2HX1A 2PRZA 2JLZA 5TMEA 1PWYE 4FKMA 1O1YA 2C2OA 1M7BA 2BZ1A 5J4YA 2NZ8A 3EGCA 4EY5A 5DGXA 1DUIA 1PFKA 1YACA 1XC7A 2GLXA 4F0JA 2IYVA 3SP1A 4CM3A 2JAWA 3ZV4A 1YV9A 4D0RA 1ORHA 4XWTA 4JQZA 4QJ5A 4TUYB 2ZRLA 5LIPA 3TR6A 5BY2A 4Q37A 2FLVA 2JFBA 1T29A 3G02A 1YZ3A 2UUPA 5KDDA 5FBQB 2QV0A 3PPWA 4X91A 3W77A 2E89A 4UTXA 2GBFA 2OESA 2O8DB 3FNIA 4H1TA 4K46A 1WW3A 5GIPE 3CVYA 1WUTA 2IS6A 3KSAC 4HZIA 1ST2A 4D3DA 2Z5VA 4MRSA 5DSXA 5C34B 2W8BB 4PG4A 3G0HA 2ORWA 4QPCA 4TV8F 4CCWA 3COPA 3QHPA 3HO1A 1CYEA 3CR3C 4BQPA 4EMBA 3ETJA 5CDSA 1USKA 4P2GA 3CUSA 4RGBA 4Q01A 3RUDA 1REQB 3TGPA 2QM8A 3A2MA 3QKTA 4YJGA 1PEDA 5JWOA 4RTSA 1CJVC 1Q5PA 4MYRA 5EHNA 1CE8B 4PZPA 2QTNA 1IQUA 1IY9A 1O57A 2HPVA 1CJKC 1UM9B 4MEAA 3RSLA 3HFGA 4HDMA 1BXKA 3ZNQA 3N59A 2JG3A 1Z22A 3JS5A 2GKOA 2HAEA 3T7IA 5CNKA 3H8WA 4Y2PA 5CH8A 4BGDA 5HPYB 4K05A 2BI4A 3IKTA 4ZTZB 4QARA 1PYGA 1ADJA 1W2HA 2VWQA 1BH2A 1A9OA 1QX4A 5E1BA 2QP3A 3A14A 1BVYF 2EP5A 3A27A 2CMFA 3WRVA 2W98A 1DMRA 4DGSA 2ZXUA 1EM8A 4M9ZA 4QOIA 5J2UA 3H3JA 4WDQA 4QJ3A 1O0BA 3FDZA 5DLDA 1SBNE 3AB3A 1BROA 4KK4A 5DTJA 5I01A 1ZY2A 2QN9A 3J7TA 3LUHA 3WIDA 2Y1CA 3HJFA 2FHPA 3L1VA 1Y8QA 4FBGA 3ZCPA 4H6XA 5FBWB 4ENQA 3F3KA 4I55B 2O0MA 2P35A 2XNCA 4ZJYA 1G5FA 3IJ5A 3P96A 2WF7A 3NC1C 1T2DA 1GQ2A 3LC7O 1SOVA 3DL4A 1CUYA 1MIOA 1FFDA 2VXCA 3N8IA 4BNFA 3V55A 3ISVA 3OM9A 1PV1A 1KIMA 2QL9A 4S3MA 4XGIA 4YRAA 2N0SA 3LUDA 5L7TA 4PHTA 1LUAA 3H16A 4AP9A 1TA0A 3DPUA 4M1YA 4R1UA 1QDLB 2CHFA 1NVTA 2J9RA 3A1DA 4LDAA 4NDAA 1PV4A 3LUJA 1SD2A 2AJTA 1O95C 1WP4A 4INZA 4MJLA 5AK6A 2J3LA 1U0EA 2ZQZA 1L6IA 4Q47A 2JDID 1UJ5A 1XZBA 3ZQKA 1XDSA 3QUQA 1U9IA 3OQIB 3PI7A 2ZJ0A 4RY8A 3WP1B 4B4VA 4B4OA 2XR1A 3AR7A 2G9UA 3C5EA 5DKFA 4ZT2A 5ER6A 1L4KA 1M83A 2PA3A 2QW0X 3CF6R 2CBZA 3AFHA 3ELYA 2JJ8A 3NQ41 1RQNA 1XJCA 4M0DA 1EBFA 4WMLA 4X54A 5E9AA 2Z1DA 1M75A 5EXSA 3TZLA 3VO8A 4F4UA 1E2FA 1Y42X 1R7RA 2EC5A 3AFIA 3PTLA 4RNCA 3A6ZA 3JCZA 4GE0A 3UJ9A 3VZBA 2W6QA 4JLKA 2ICAA 3RM3A 1OY1A 3WL7A 5EWJB 2OOKA 1GXSA 3L6EA 5D3KA 4UREA 4YQEA 4CHGA 2IY7A 4JI2B 2VJMB 4QOSA 4WLFA 2ZJYA 1XD8A 4QC2A 3V8PA 4EHDA 3TTUA 3QFCA 4E4RA 4UOZA 2XTJA 4F60A 2ZSBA 2IP4A 3QA3E 3SEAA 2XVMA 1W0CA 1Z3CA 3ADOA 3P0EA 3VMFA 2G36A 1MFPA 3C6XA 3M1YA 1HOTA 1OLXA 1PEAA 2QPLA 3EGDA 4JJKA 2FN4A 2PZAA 5AWFC 3I2JA 5KYUA 1KOLA 1E1DA 1GGMA 4MGHA 4F04A 4RIGA 2I7TA 1E58A 2RI0A 3D4BA 4K6MA 2QD3A 3DBOB 4PCUA 4WLEA 4ZC1A 4HUTA 3B1ZA 4HWTA 2PGLA 3WRXA 1EXDA 3FCAA 3GEBA 3T7SA 3H3XA 2XD9A 3RUCA 2EX4A 2QVZX 4A23A 4BFTA 4NTZA 5JNUA 3UMMA 3MHTA 1N5RA 2QYHA 4I99A 1IG0A 3OKAA 2E2WA 4GU5A 3HM2A 3WDSA 2E5FA 2Z8ZA 3CN7A 4PPYA 3CFYA 2FEKA 1F8FA 2C3UA 4KGZA 2W4IA 2YBEA 3B1VA 2Z1NA 1PR2A 4AJIA 4GNKA 5HNKA 3OZSA 4ZZ2A 2WSMA 1PW7A 3BKXA 4WACA 2QE7A 3VU0A 3C97A 4RMNA 2PAFA 3WBKA 3WP0A 4ENTA 2BL4A 2Z4RA 5JYCA 4CW7A 4I1OA 2O8EB 1G8AA 1NONA 2IF2A 2C5AA 1IYZA 3H13A 4P3XA 4DJ5X 3ADBA 2VDMB 1YL6A 2ACVA 1EUDA 2R7AA 4HF7A 3PJEA 2Q3HA 2IYZA 3GLUA 3QE4A 4HX2A 3RPEA 1DXQA 3R77A 4QTZA 2FWMX 2OCLA 5CNJA 4YVFA 4D4JA 3RAFC 3RLFA 3E3OA 2AB0A 4CN9A 1K1EA 5L45A 1FYDA 1K7EB 2BFNA 4NARA 5K2MA 5F98A 1C3VA 3PYMA 1M6NA 3AG6A 3F4BA 2VKQA 4NK4A 1EZ1A 1E4YA 3ON5A 4KWTA 2W6MA 4L2IA 1L9XA 4FONA 1Q91A 2W6IA 421PA 3VX4A 4C29A 2VXYA 4LE2A 4ZHSA 2BHLA 2OCKA 2NUAB 2J7PD 2OORA 1BXRA 3QE3A 4FCVA 1R8YA 1SQGA 2QRNA 4POAA 5DBGA 3H4VA 1T3HA 4ZKDA 2IEZA 4W6QA 1R0ZA 2CXRA 3STWA 1L5QA 5B3AA 4YRMA 2QVLA 4KDEA 4LBZA 2JGDA 5EG5A 4FYHA 2AOXA 3ZHSA 4CQMA 2H3EA 1IQPA 2YWJA 5JSZA 2FCAA 1S2LA 3FPSA 4O2BA 1LX6A 2VJAA 3B6IA 1LU9A 4REOA 1RS0A 4X84A 3ANSA 4OXQA 5AQEA 1YL7A 4NJEB 1EFRD 2A3RA 1TVKA 4H1UA 1UJ6A 1NN1A 1ZVVA 1WLSA 3CUWA 2P77A 4FYXA 1CK4A 4A5OA 1R88A 3VHXB 2MCFA 3LWDA 4PGMA 2OCBA 4PYLA 3FRJA 4YLGA 4CDGA 4DF3A 4X62B 3QW4B 4C7OB 2C7GA 4HGZA 3T7AA 3TMYA 1KBOA 1EDEA 4D6PA 1T8WA 1JEJA 3CR7A 5E1DA 5IEJA 3FPLA 3UH0A 3V97A 2W0MA 4R1SA 4EHJA 1I4OA 3L18A 1L5OA 1RZRA 4ND1A 2IX3A 4C01A 1RXYA 2AGVA 5EE9A 2NO6A 4Z9FA 4DQUA 1M72A 1PG5A 1XZFA 1D1SA 3K9WA 3Q72A 3ZK9A 2HYIC 1U3WA 5E1MA 4A36A 4C78A 4O3MA 2WF9A 2AFIE 2JGMA 2FOXA 1QB7A 1FSZA 1MH1A 5MFPA 2B9VA 1P91A 2R8YA 4Z6KA 1PL7A 3JQ9C 1US8B 1LQUA 2IW1A 4H7KA 4JIMA 3K8QA 4OM7A 3AM1A 2ZBFA 3DL7A 4B35A 3CIFA 1S5PA 2FWIA 2BFWA 4TTVA 4X1KB 3JASA 3ORRA 3H11A 2JD0A 4NV0A 5T8KC 5BWLA 2H4WA 2IHKA 4KMSA 4G1MB 4ER6A 3LCCA 4D41A 1VE1A 2GK4A 3A4TA 3ONEA 3SN6A 3HKBB 3IOYA 5LC1A 5K6AA 3F7NA 3HB4X 4R8MA 3ZXSA 1MD9A 5KNDH 5K5EA 3NYIA 4W5QA 2QBYA 1KIFA 1LI5A 1N2ZA 3JZFA 4FFNA 2XHZA 3NNSA 1G8MA 4H3HB 4PFQA 4TLLB 3RVQA 2NVOA 2PGAA 4YWJA 3WK5A 2VK2A 3GX1A 3CUEF 3KOUA 3COVA 1ZMTA 1NULA 3I6MA 4UVDA 3DAFA 1U2QA 2ZU6A 3KYCB 5EUQB 5JH7F 2Z3VA 1J5PA 4MAMA 1VKOA 4RHFA 1SUPA 5AW7A 4K8OA 1OX5A 4UPEA 3MD9A 4YO8A 3ZDQA 1JIKA 4EVRA 1V9CA 1N33B 2P75A 2PM8A 2WVGA 2ZXFA 2J3IA 3ANNA 1WCYA 1YZQA 4TTRA 1M1NB 3H6HA 1LCIA 4BNHA 1KJIA 2BEKA 2FR8A 1PSWA 3ZU5A 721PA 1E89A 3E7XA 5JNTA 5JZBA 4X7RA 4Q21A 1NZDA 2HFJA 5SV2A 3GZNA 2YVLA 4B7ZA 4BRZA 4M46A 5J4LA 4UU8A 2FSIA 1X1BA 2B82A 4L3OA 2DHRA 2P6OA 2PKEA 3NDRA 2ERXA 3QLEA 1XTQA 4AYXA 2QL7A 3BRQA 4H0FA 4Z99A 1OLOA 2I6SA 3ZCSA 1VTKA 2ET6A 2K7ZA 3H5OA 1LVGA 2GWRA 2XUFA 4LXHA 1UDAA 3PNPA 2A9RA 3FHOA 1LK5A 4JSTA 1ZCAA 4CG0A 1E7QA 4XWWA 1MOQA 2FZLA 3DEHA 1EJBA 4MWTA 4ZQBA 3L4BA 3VGJA 1BMFD 3PCTA 4R2MA 3A9RA 4B45A 3G82C 2BEWA 3KQPA 5KWJA 4OKSA 1H65A 3CM0A 3DC7A 4E08A 3NFYA 2ZAYA 3AFGA 1NW6A 2Q2WA 3GVPA 3LY9A 2ZUCA 4MW1A 4EG5A 4JJAA 1SRQA 5AOAA 5L4NA 4TN1A 1N3IA 2QL5A 4B4WA 2ZUWA 1C7ZA 4TRMA 4NFLA 4YBRA 3OQVA 1D1QA 4FQ5A 4NVRA 1V11B 5GM2A 3DBIA 3GGJA 3KU1A 1GHTA 3GN1A 3IB6A 4J6FA 3G2NA 4C4YA 5AVTA 3GLHE 4BQRA 3B2QA 4BNDB 4NBRA 4WY2A 1O4WA 2HZ7A 2H8GA 3RIXA 1BC5A 4F85A 2YJ6A 4M0UA 3Q9NA 2WSLA 2AF4C 1JZTA 2FRVA 5EQDA 3TR5A 1XK6A 4L4ZA 2QTWB 4N0EA 5HZHA 2NVBA 1H93A 3IQGX 4C0JA 1PL0A 4FMDB 3R4CA 5EE0A 1CY8A 1TM2A 4TQAA 2I55A 3ZLVA 3KHTA 2ZYDA 1YQWA 2ZK7A 5EXEA 3DWEX 1PQUA 4RZQA 1GN8A 2FWBA 4E15A 1F7VA 1B8NA 1Q1ZA 4A4DA 4BVGA 2XBLA 3LUPA 5ALMA 2XAAA 3TX2A 3ZWCA 2E6UX 3H9GA 4Y67A 2FJUA 1E99A 1ZM3A 5DHTA 1V7PC 3I3SR 3N3AC 3FNRA 1C41A 4D9GA 4R16A 1I7QB 4E33A 2YFYA 4NKRA 3HL0A 3BE6A 4LE0A 3UAGA 3VC2A 3TW4A 2DBZA 1CUVA 3MUFA 1J42A 1QKJA 3U4DA 2A9QA 3EVGA 1CRLA 3NRJA 2P4SA 3UCFA 4D9BA 5DNEA 2FWAA 1IK6A 1YBMA 1YCFA 4IV5A 1DWPA 4B0OA 1ZL2A 4L74A 4O5OA 3M6WA 2C77A 3PDWA 3RWOA 2D4HA 3L0YA 1UAGA 4PTLA 4ZOLF 3T5MA 2O7SA 3V2UA 3VNQA 4DHEA 3F7TA 5PNTA 3C8DA 4MV8A 4U7JA 4G5YA 3ZD8A 3IEMA 1C3LA 4QU8A 2XMDA 4IVRA 2OR3A 3BB3A 4H7IA 2HJRA 2VQEB 4Q12A 2GCGA 2SECE 3HXLA 4MV0A 1WO8A 3WV4A 3TIFA 1P4SA 4PCVA 1QP7A 1TCVA 1XZHA 4YMLA 5KOHB 4N54A 1KO7A 1JHXA 4B48A 2CLDX 3DMTA 1JG3A 3AQ4A 1JSRA 1U7ZA 2W2TA 3PYXA 4DV7B 3WGUA 4QXQA 4GOOD 3TAUA 3WIOA 2OE2A 4CKEA 4C7MA 1E77A 2GPYA 3ASUA 4DLKA 3SBDA 4G0OA 3MMZA 1NXXA 2YQ5A 4GSKA 3V33A 2P7IA 3I37X 3VDXA 3AMVA 3D6MA 3IRUA 3KP1A 3VAYA 4GVLA 1SXQA 2VLBA 2XECA 3UFXB 4B87A 2IW3A 5HSGA 4BNWA 1PV2A 4FILA 2JCVA 1Y6JA 3F8TA 2YXNA 3KWLA 3L93A 2VJKA 1Y81A 4TV9F 3ROXA 1TJ4A 4S35A 5DWVA 2YDXA 4UEQA 1PT9A 1ZNXA 2VPWA 3BH6A 3KUKA 4G8DA 5TF0A 1S6YA 1UBOS 1Y8ZA 1R9MA 2AMVA 1YZFA 3T12A 3CWZA 3IEUA 2FZKA 2GSDA 4J2TA 4F97A 3R6GA 2XCTB 3JQAB 3Q2KA 2ACKA 5CYFA 3W3AA 1YC5A 5L9AA 3FMPB 2G6BA 5F12A 2F7SA 3C4JA 1RR6A 1WXFA 4N6GA 1ZVQA 2BFOA 4ZCLA 4YXWA 3VPCA 3FOWA 2PX2A 1NF3A 1R27A 2Z5FA 3PKZA 2PWAA 4O4HB 2J09A 3DAGA 4E4YA 1AUOA 2Z0MA 3GH3A 3ONFA 5FWXA 3G2PA 1FYFA 1N57A 5LZ5A 4RH0A 5T4BA 1JSLA 2ETXA 2FX3A 3A2KA 4JI1B 4IS3A 4Q15A 4Q7LA 3EXHB 4TLMB 5LSAA 3A6KA 1OIVA 4LNHA 3TQIA 1XJWA 5DBHX 3O82A 4ZT5A 1RCUA 4MCHA 3U3XA 1NI3A 2F00A 2FLKA 4HQNA 4YLEA 1E3DA 1EUCB 2OAEA 2C3MA 1XSEA 4ASUD 4N3AA 3FWNA 3A06A 3CSSA 4FHFA 4N0MA 4OHUA 3E5NA 4BE4A 4EB6A 1T5TA 1DJLA 3EIEA 1JFLA 5CH3A 2XQGA 3AFMA 4BLSA 4BNUA 4K9PA 3ZGVA 1OU4A 3K09C 3WFJA 1DAMA 3KJNA 4UEWA 1LQ2A 3HQ4O 2CMGA 2NUPA 3GXBA 1G6HA 1G5IA 3G9TA 5A9TA 1NVMB 4RA9B 3I9MA 3ZU6A 5DLQC 2C99A 1U6IA 1OAKA 1JKFA 3OE5A 1ZMBA 4R1MA 4R3WA 4QSHA 4D8UA 5BORA 4RTQA 1U9CA 3GUUA 1RADA 3UQYS 2G9RA 3OICA 1FVXA 1WPQA 4BCDA 1W75A 4CODB 2J4DA 4LA4A 1SCUB 2EZ4A 3NHKA 3QX8A 1WUHS 2G4VA 3HDHA 1YH3A 3DHYA 3UB2A 3F71A 3GB9A 1FNMA 4B8YA 1ACJA 5D6NA 3DFFA 4AROA 2HV9A 4K26A 2H4YA 4L50A 5FLXA 1Q92A 1D0SA 2R6R1 2ZPAA 4N7MA 3TCNA 3TD2A 2AHRA 3VU9A 3D8BA 4DYVA 2I7XA 3P5SA 4MSUA 1NBME 3JYNA 4U9IS 4BZZA 3EDMA 1PR4A 4PSCA 4F72A 3WAGA 3GLVA 1Z4PX 2QUJA 1ZD8A 4UE2A 3LT1A 3IKMB 2GAFA 2IV3A 2QPAA 3P9ZA 3RSZA 1IEQA 3NTVA 3CO0S 2GM4A 3EH1A 1LQTA 1JSXA 4HFMA 3VKFA 1CVIA 1IE3A 3WG9A 2I2DA 1F14A 4QDKA 5TF4A 3CA8A 4KEAA 4ARIA 1C7QA 2P62A 5AUOB 1KKUA 1JR3D 5IK2A 3PX7A 2G67A 2JFYA 2AR9A 2IU4A 4PC6A 4F21A 1D2EA 2ZT8A 3P9KA 3RFVA 5BRAA 2W2KA 5JAPA 5M5BA 1TT5B 3IIMA 1EA7A 1U2ZA 2PRYA 1XZPA 3C8ZA 4GRDA 4LZNA 4E5YA 2PXCA 3QKUA 5FUQA 1FFYA 2QMHA 2FW1A 1NT2A 5T4EA 2WOJA 1U9ZA 4U8GA 4BFLA 2IVZA 1DBSA 3IV6A 4B2YA 2PGNA 3SHWA 5H3LA 4NNOA 1AT1A 1RWNA 3GRYA 1BE0A 4HNHA 4A7PA 3QX7A 2YXPX 2J6IA 3H8VA 1PVOA 4LZAA 3W4JA 4C4SA 2AC7A 3I6YA 1UPFA 1XKQA 2BR5A 4UU1A 3PRHA 1T3LA 3DZ8A 4FJ2A 4DRYA 3EH2A 3B51X 2BH9A 3HXMA 3A36A 3NBUA 4QECA 1QRAA 4YQFA 3R1IA 3R23A 2C07A 2C8VA 4WFIA 3ICQB 3QITA 5ELXA 2Q8PA 4FFBA 4QUDA 1J8VA 1QH8B 4MUYA 5LU9A 3SVTA 2AX3A 3Q9UA 2YWDA 4HR7A 3T7CA 5IYZB 1TYCA 1ARZA 3DBVO 3VH2A 3TPFA 4EUEA 4KYIB 4HH0A 1E3WB 1Z17A 3IXLA 2PBFA 1U7XA 2C5BA 3H2BA 2PRIA 4I5DA 1T0PA 4BIMA 4MMZB 3TD6A 3MSCA 3NTLA 5FEMA 2CB0A 2NSJA 4E1BA 4DILA 3ZCVA 4NCAA 5FCDA 2Q49A 3PGLA 4KIWA 2FOIA 3MA0A 1F6DA 4TMZA 4D6YA 2J6BA 1LLCA 2H0QA 1MJFA 3K0SA 2V6BA 3NJRA 3NHMA 3O3MB 3NHYA 1PUIA 3FZNA 3NR2A 4ZAFA 1OI7A 1DV2A 2QE6A 1DC8A 2R2GA 3JVUA 4NBKA 3LNCA 2WPNA 3WK6A 2XUZA 3FTNA 4EG7A 3LT2A 5YASA 4TSKA 4YAGA 1MX1A 1XMJA 4G86A 1DG1G 3TQQA 2JRLA 5CA0F 4R2WA 3MTBA 4C5CA 2VDNB 1UZUA 2QGFA 3CSDA 4U7WA 3W5JA 3LHFA 5GJVC 3WLIA 5J47A 3DJYA 3F3YA 3H2YA 3ZBTA 1QSGA 3ZKWA 4I50F 3ZNOA 1BJRE 1Z29A 3E23A 4N9QA 3LBNA 3IT1A 1E2HA 4MVJA 4DMCA 3DDZX 3P2MA 4D97A 4X61A 2AKYA 1MJHA 3CU5A 1QIKA 2C3OA 3U2QA 2XMCA 3FI0A 4RIEA 4ND5A 4P86A 2GJ4A 1BDJA 2PS9A 3GP8A 4R7TA 2ZM6B 1XLVA 2YUIA 5C5IA 2ZRKA 3ZZMA 2FN9A 3HUUA 3JQDA 3MEQA 4UHDA 4ZXFA 3HLYA 1MHTA 4LF4B 3OD1A 5DM0A 5KVSA 1MVOA 1U5BB 5C2JB 1IY0A 4A8JB 1C7JA 3FWZA 1MJGA 4QDXA 4R1OA 3TL6A 3LK7A 4AJKA 3SXJA 1UZNA 1XLUA 2C04A 1H2EA 3PC4A 4WJLA 5EZSA 5JZSA 4UFPA 3B52X 3CCCA 1PQYA 2AN5A 2F3SA 1GPKA 2BCGY 2AEEA 2ZXEA 2QOEA 3O7WA 3EF3A 3RUAA 3SNKA 1N77A 2F8TA 1XNGA 3PHCA 5LKAA 2R84A 4KXMA 3TQRA 4CF5A 4ESOA 3FYUC 4TS3A 3KUXA 4JLDA 1Y9DA 1OHHD 2QUIA 3M6UA 4Y2JA 3RC9A 3ZHVA 3RHZA 2E1PA 2Z9BA 1P2SA 2R8RA 4P53A 1JKIA 2QWXA 4EPWA 4B3IA 1V5EA 2VHTA 4JWKA 4PQYA 3UMBA 4DSAA 2IEGA 1RI3A 2XQVA 5K0JA 2IUYA 1J09A 1W4AA 3FUUA 1VL1A 1PJ2A 1YVEI 3ZE1B 1XDDA 3A9UA 1ISMA 1X8JA 1NP6A 1GKUB 1FVFA 4XM0A 5DNAA 3N2ZB 3S1AA 2XE6A 3LP5A 4N5NA 4BMDA 4M8LA 1A5BB 4NU0A 1XZQA 1UMBA 4XQ0A 3C87A 5J1SB 3RBVA 2WAOA 1UPTA 1LV8A 3ECAA 5GGYA 3QBJA 2XB9A 4C89A 4EL0A 5LU8A 2YX1A 5DX1A 1T5BA 3EWAA 4KVAA 4MXDA 4CM4A 4PIMA 2IU3A 4TM8A 3GD5A 1ZUWA 1ICIA 4BDSA 4QATA 4LX8A 4D43A 1JZSA 4H1WA 5H7XA 2L19A 5BUCA 8LDHA 2IYPA 2D62A 2GUGA 2EKPA 1T6BY 1HZZA 3ROGA 2V7TA 1CRQA 1F7UA 3PRKE 4N8DA 4U9UA 4MQ4A 3TTVA 3WLQA 2X7HA 4REQB 4ZAXA 5CVJA 2EBWA 3QHQA 2E4UA 3EAQA 4N1AA 4E7OA 4EITA 3C6MA 1HRDA 2P6NA 1ZI6A 3DAYA 3FRIA 4Z1MA 2X22A 3RRZA 3KK0A 3DDNA 5DGIA 3VO1A 3HU2A 1CFZA 4XUCA 5JRDS 2ZTHA 3PNMA 4OMCA 2X6QA 3SZMA 2ODEA 5A4AA 1NSFA 4MUNA 4KSCA 4PRLA 4R8RA 1NNSA 1Z7BA 4P82A 2HQOA 4QHYA 3R74A 4CMIA 4YT2A 1AV7A 2WYUA 1N7GA 1XZAA 3QWFA 1FLVA 2VSOA 4HLUA 5TEWA 2ZBDA 2O06A 3X2EA 5JSUA 4GX5A 1O3YA 5G02A 4BNVA 2R00C 2XTMA 1E2NA 4TKVB 3ABQB 1ZHFA 3MOIA 1XMIA 1YUBA 2OP0A 2VUHB 3PDJA 5IULC 1R3UA 2PO7A 2QLBA 5BOSA 3A0RB 2Q4OA 3EY4A 3HZOA 1QNFA 3I2GA 2QVXX 1LS6A 3LVFO 3M2PA 3QKIA 4NZPA 4Y0VA 4ENUA 1PJAA 3DMHA 4H4EA 1XAIA 1BCRB 3T94A 1EP1B 2WW8A 1EVLA 4GPAA 1SFRA 2V7UA 4HVTA 4Z5XA 2WZBA 3S7TA 5LZ9A 3QOFA 5LN1A 2WWYA 5K3BA 3ZZNA 5HILA 4MUIA 1E59A 2CWWA 5GP1A 4DMGA 5L7YA 4Y18A 2PKCA 4EDFA 4PPFA 1TX4B 5K05A 1HSOA 2HIAA 2G88A 5CNMA 2YZNA 1GTJ1 4R9RA 3KQLA 1ZGZA 4UTOA 5THQA 3T3DA 2B8TA 5JAIA 3KJFA 1PWEA 1LPPA 4FDAA 4DSOA 1AGYA 2OL4A 3AC0A 2JHFA 3E4DA 4LZZA 3H6GA 1EESA 1V7QA 5BRNA 3LZDA 1VG8A 1KEPA 4AJ1A 5BPHA 3EPLA 1M2EA 1RZ3A 1CS4C 2WKRA 2ZULA 3OOYA 5A4IS 4M86A 2ZB7A 5CA0A 3D8RA 4ZD6A 1QJ4A 2D06A 2NZ2A 1AA6A 3IMGA 4O1MA 4YY3B 4PO9A 5CD1A 3M4XA 2HJGA 3OWXA 4OHCA 3NAZA 2F64A 4Q9JA 3QE0A 4YBZA 4M3NA 4RVFA 4UDYX 1P7CA 3P0JA 4BQFA 2EGUA 4FB5A 5DTEA 2O1EA 2YV2A 3G5AA 1U0FA 4HHEA 3PIDA 1M8FA 2P40A 5B55A 2UZ0A 3RARA 1V6SA 1XKLA 3H04A 3UICA 3R9WA 3WLJA 1KE2A 1O94D 3FNBA 5D1NA 3HJAA 1ORVA 4AWAA 3ERCA 3HVRA 3F47A 1HX7A 3Q1LA 4O4JA 1GRVA 3BG5A 3MG9A 3Q9LA 1D1PA 2O7RA 4LJYA 4IIBA 3SMVA 5A5VA 4D25A 4KQ1A 3H9JA 2X6TA 1MAUA 3IEIA 2BGNA 3SKVA 1WY5A 2PO5A 1DX9A 5BW4A 2P2ZA 3SBXA 1EHIA 4NATA 5F7OA 3VUFA 3BJZA 2SHKA 3OUZA 4IIHA 2EFHB 3DL0A 1N3LA 4R01A 5F2NA 4Q4HB 3IUQA 1UPXA 4ZTBA 4C4AA 1UDCA 1V37A 2FMTA 2CHQA 2ZSHA 4LCBA 3ZWVA 2MYPA 3TF5A 1ZUHA 1YB1A 2AC4A 3NJ8A 4TMTA 1FMTA 3VZQA 2ECFA 3FLEA 4P4SB 1JIXA 3OSZA 4WBNB 3NAQA 1KAQA 3EZ7A 4WRRA 4CIXA 3O6VA 2VPZA 3GAMA 4ITUA 3F3SA 3GJXC 2XWBF 1DSSG 2G8LA 4PBTA 3IO5A 3AM5A 4M7RA 5CAEB 2VYCA 4ZHQF 4ZODA 3KZVA 2QTVA 4V1CA 3CMMA 3O5AA 4XCQA 3RFXA 1GDHA 1ULHA 1CUSA 1H6DA 1ID8A 2GETA 2H5EA 3RTGA 3IAM6 2RH4A 3O8DA 4C07A 3AIIA 5DP2A 3U3JA 2BTEA 1ND5A 4CMAA 1N1MA 2FW7A 2AI1A 2FGJA 3NU1A 4TMWA 4NDNE 3TMAA 4H3VA 5E6UB 4DMHA 2FDRA 3C6ZA 1KMCA 3E48A 2QI9F 4L8LA 2QT1A 1JHDA 4K6HA 4MUAA 4R84A 2XRZA 1O5TA 1NMYA 1U6JA 1KZYC 2FPXA 2VXBA 3FHCB 5BYKA 1RLUA 1U8ZA 4LAFA 1E1QD 3OOEA 3PR3A 1QTRA 5BXQC 4CXMA 4FS3A 3AEUA 1J21A 1JDBC 1NBOA 4IG9A 1XWWA 5HDQA 3F78A 5ALWA 1C7FA 4KRGA 1BDHA 3H9UA 4AY6A 4CI0B 1Z5PA 1M1XB 3LCVB 3GELA 3ZWMA 3ZDDA 1JDSA 5CCDA 2YNMC 2D2EA 4RTNA 3HI4A 1J6UA 1PL6A 3BZUA 3MCWA 1UFQA 3PGA1 3FUTA 2OGZA 2QJFA 4NNJA 2WJHA 4NQZA 3G49A 1CU1A 1CS0A 1XR3A 5AXBA 1CQPA 1CPYA 1V8PA 4FYYA 4G97A 4ZU3A 4D96A 3SVLA 1GGNA 1EK6A 1PJTA 2XT6A 1GPAA 1AZLA 3LT4A 2FLWA 1UXOA 4JX8A 4RA9A 4UCQA 1KYYA 1L5GB 4MWSA 3F73A 2AOVA 4ZCQA 3LDHA 2CK3D 3A6LA 2YINC 5IDVA 1NVFA 2RSLA 2ZRHA 2Q21A 2RHRA 1A97A 4RCZA 4Y9RA 3CVVA 3RVPA 4M54A 3MJSA 4FQ8A 4R69A 3JR3A 3QU7A 2P4UA 1OBCA 1XRQA 2HXSA 3I5MA 4FXOA 4PG5A 1YB2A 3GCGA 2YVQA 5IC5A 3EK2A 5A9SB 3V1LA 1FIUA 1M1ZA 4G0QA 2ORED 4DQVA 1T1RA 3GQVA 2R4TA 1M54A 3F9CA 1P1IA 2NQ8A 2NU8B 3D4LA 1ISGA 3JTMA 2BGUA 4C6SA 3V32A 3VR3A 2IPMA 4YI5A 4AN0A 1SRRA 4EB0A 2PE5A 1YFKA 5AQ1A 1BX3A 3MERA 1AGRA 1J06A 2H57A 1CUGA 2POCA 4IIEA 4PAQA 2EFGA 4IICA 1E1KA 2XMQA 4S0ZA 4IL5A 5U4QA 3NEPX 1C3JA 1Y82A 2GESA 2V4MA 2QG9A 4UTVA 1XZNA 3AJEA 3FLMA 3OQ1A 4RELA 1VFPA 3WLRA 1A8PA 2PBLA 1XRRA 1UKEA 2IK8A 4NFHA 1NTRA 4WESB 4Q18A 4LGYA 4V03A 5TJHA 3VPFA 2C3YA 4QBKA 3V80A 5LP6B 1YS2X 1KEVA 1ILEA 3CKMA 4OVKA 5BVHA 5FOQA 3TZ6A 1XP8A 3VO9A 3C3EA 3FNFA 3ORYA 3ZDFA 5BUZA 1JQJC 4RVDA 1KDTA 3D3KA 2HTEA 4OGWA 3HRIA 4ND3A 1E0AA 1FS4A 1LX7A 4GLOA 2X8JB 4QJIA 1M8KA 2WP8J 4H08A 4LHZA 3OIUA 4X93A 4AIRA 1YHYA 2E4ZA 2HWXA 2PKQO 4F9GA 4G1FA 1XLTC 3KKEA 4Q5IA 3SJ7A 4L02A 5KQPA 3PI6A 4D82A 4DMUB 2YN4A 2Y92A 2FEWB 4MNTA 3M5WA 5JZMA 5JSYA 1TGYA 3NDIA 1HFKA 1FJGB 1YS4A 2GZAA 1ULBA 5IAKA 3CCFA 4MKHA 3I2KA 4CLOB 4KIJA 1RMYA 3CF4G 1MEOA 4I3FA 3P0RA 1N2GA 4Z9XA 4BO6A 1JG2A 3X2SA 3BIXA 3CLUC 5C9ZA 3LQ1A 2I1QA 3PFHA 1R10A 4HGQA 2NSYA 4KUGA 4M89A 4NV3A 4X00A 1YK0A 4RYDA 2DBYA 1CDDA 3AWDA 3IS3A 3SGLA 3W2TA 2BR4A 3QVVA 1HXHA 2FQ1A 3PNKA 4GMKA 4LCJA 5B37A 4QFCA 2PPVA 2HFKA 3OU7A 1N7JA 2IITA 5GZ3A 2HXGA 2L82A 3BULA 3EPPA 4GZMA 1DBRA 2C8LA 3G2OA 3RK4A 1R6VA 3IESA 2N3ZA 4GKJB 5D6OA 2A5DA 4E46A 4HPJB 4UCXA 4G5FA 3O1JC 2VRNA 3LBIA 2RCYA 2XNJA 3ETHA 1Q44A 1KYIA 5JU6A 3BHIA 3QWIA 1IHXA 1R1DA 1O97C 2WJJA 1HDOA 1H5NA 3W78A 2ZR7A 3OWHA 4UD2A 1IMJA 5AW8A 1CF4A 2PD4A 3A1FA 2FZGA 3VTAA 3OG9A 3DDCA 5L3ZA 1XI2A 1Q57A 3DD1A 4BFCA 1NGSA 4R71A 4N01A 2IYLD 1U65A 3DEKA 2GEUA 1FXSA 3T9BA 1J2RA 4DS3A 2VQ3A 3C6YA 1IB0A 1EB8A 2I62A 3E18A 3KEOA 5ERXA 3TBHA 1O95A 2GILA 4PAOA 3AB8A 2IYTA 3GLFB 1FNDA 1NG9A 2GZHA 1BEUB 1D2CA 1E5LA 1DKRA 2AFHE 4A73A 3AB7A 3ENWA 3ZCRA 4CM9A 2NADA 3D2CA 1TEHA 5AT1A 2WTMA 3LCUA 3ROPA 3L84A 1I7PA 5IF3A 3K9LA 2BCJQ 2PSFA 2Z2XA 4L3WA 3DV2A 3O4RA 3THRA 3CRW1 1VOTA 5WRFA 3SBEA 1NR5A 2O2YA 2OBBA 4JT9A 2PIDA 3PGXA 5JW6A 1QCDA 4JLVA 3QELA 4IVQA 3WWPA 1YDFA 1WCIB 4DCTA 4IILA 4G07A 2ZE6A 4OQQA 3LUCA 4BP8A 3AHCA 3GJ3A 3JU3A 4BQIA 5JADA 2QRVB 3L82B 3PQ4A 5H9VA 4MRMB 5TQ0B 1KOFA 2GFQA 3T7RA 1OXBB 1BD4A 4YUVA 4BBJA 4M2LA 1PYOA 1GNQA 1CETA 1L4NA 1FXUA 1Y6QA 2XLBA 3M9WA 3NTOA 4BO7A 3OOHA 1NATA 2YV4A 4HAOA 2QN8A 1TECE 2IUEA 1K8QA 2OUIA 4IDDA 7ABPA 1GSHA 3U3ZA 5ESRA 2UUCB 3JQEA 4ZK2A 3SLKA 4C0HA 2YL2A 1CX9B 3BICA 4DCUA 3PDIB 5JY1A 1D0VA 3DULA 1QO0A 4I8DA 4RYLA 2HB6A 4X7MA 1U7OA 5FORA 5KMGA 4PC1A 1X0VA 5BUQA 4GQBA 2JGLA 1JIUA 4F45A 4XUDA 4HBGA 1W52X 2DC1A 2DMRA 4KQ6A 3DT8A 1IUNA 4M76B 4MRRA 2EARA 2VATA 1V8ZA 2OGTA 5AHXA 1M7GA 3HRHA 4ZYVA 4CRWB 3PD7A 4TZKA 1GZ5A 1MENA 2YN0A 1RE0A 4YHHB 4HWKA 4KV7A 1PZXA 4XSVA 5FTMA 3DUFB 1G8YA 5A06A 1NJSA 3K5PA 4UBIA 5AVWA 3HWSA 2UXDB 2HSEA 4MICA 2O48X 5BMVF 2GA8A 2KI5A 3KJGA 3K92A 2YHIA 2YFQA 1P77A 5DSZA 3AVOA 3FSJX 4PLYA 1XCPA 4NOJA 2FPMA 1C5KA 4KOEC 3B3FA 1W30A 3JRWA 4DPLA 4N39A 4QTUB 2JJ1D 5REQA 4BBZA 3GD7A 3ZWPA 3W4IA 4O8CA 3IVXA 2V9CA 5FWYB 1DAPA 3VOAA 2FEOA 3AEXA 4WNIA 1NZJA 1BIFA 1A2QA 2IDMA 3FX2A 3QVKA 2UYYA 4NE2A 4S1VA 1GCOA 1Q7BA 3N7UA 5BQPA 2K2WA 4OB7A 4RJTA 3F7OA 3QTLA 1NLFA 2CE2X 3DCYA 5TMBA 2HHJA 4OQYA 4M7WA 4Y98A 1W88B 4A6XA 5IHPA 1EZZA 1B6RA 3II6X 3OCZA 3RKSA 4NPCA 3OTOB 1I5RA 5D3ZA 1OW3B 1Z12A 3A6DA 2WVHA 4MKZA 4CHTA 1K98A 4LJRA 3CF4A 1RWPA 2C5HA 2ZRQA 3LPAA 4HDAA 4N47A 1DEHA 4MQ5A 2N42A 3RHSA 1PFYA 4RD1A 4DJJA 2IVFA 1G7SA 2AXPA 2JIQA 5AP9A 1TTHA 4JK3A 1NBAA 2ZAMA 3P9RA 3MBOA 4ZVNA 1ZMOA 1D2HA 4FLFA 1FBTA 1S8AA 1Y8QB 2P41A 3ABOB 2FPUA 3UK6A 3JWIA 2AYZA 2FPLA 5C7LO 2VBFA 4C87A 3QPVA 4DABA 1XZ8A 2M98A 5DP1A 4E94A 5LDDC 2HK9A 1MDBA 1E7WA 3LXXA 4JKOA 2VHQA 3BS4A 4ZIRA 3FSEA 3QFFA 1MIOB 1ZN9A 4CR7A 7ADHA 3SIRA 2AWNA 1HMPA 1KKLA 2JBHA 3VZSA 1L4UA 2VK4A 2GERA 3WYNA 1QRRA 4YLYA 3SEZA 1K75A 5KNCH 2P9QA 1W6RA 4G0XA 3C3JA 2XIQA 2ZSIA 4PX5A 3GUVA 4U7HA 2EIXA 4UHBA 4Q9HA 5HJEA 3AEZA 1JE0A 2IHJA 3TJRA 2BKLA 1G16A 3AJAA 2QTLA 3MJFA 4MGEA 4HZUA 3U7QA 1RI2A 1I3CA 2R8EA 1DX6A 4C6TA 5KWEA 5AMXA 2E4VA 1WUYA 3FKJA 3HDJA 2ORVA 1QDEA 4YJKA 3JWGA 5IT5A 1X2EA 4LECA 3VYSB 1CY1A 2WMDA 4Y1RB 5E4TA 3TEMA 3E35A 5LQSA 2FGKA 4K6FA 1F0PA 4HATA 2JGRA 1X9GA 3VU1A 5JVDF 3JQ9A 1IXYA 1N32B 2P6MA 4I5IA 4NMLA 4ZT4A 2FDCA 1X74A 4EIWA 3BHNA 5A9RA 5GONF 1Y7TA 4D4MA 2G09A 5FLEX 3K2QA 3CX4A 1GXSB 4DG9A 4IFIA 4ECEA 5JTTA 3F2VA 4JOCA 1Y1RA 4MYUA 5JS6A 5D84A 4DSZA 2WB4A 1FXWA 2QZ4A 4H3KB 2VH5R 1TJNA 1P33A 2A94A 1DLJA 3RE1A 3OX2A 4NS1A 4AJLA 2HRRA 3SZOA 1IZZA 1K0FA 1CUJA 3LKBA 4RU1A 5LB4A 3TNDA 3Q1KA 2XVXA 1NDUA 1CVRA 4DDTA 3UVEA 1OMOA 1ZHHA 4E5NA 2H2FA 1N92A 2XA1A 3FCYA 3I1JA 2RGXA 2UXBB 2C03A 3UUEA 4C0BA 3BDAA 3ZWAA 1KRHA 1OXSC 2ZANA 3DT9A 4R5MA 4B84A 3QVGA 5JSFA 1FP1D 4HVLA 1WPXA 1KDOA 1KSHA 1CY4A 3L06A 3AI3A 2DCUA 4JUDX 3IAXA 2G1UA 3EUFA 3E9QA 3ZLTA 4EBFA 1I9CA 1VP3A 2BM1A 1ST3A 3JARA 3LT5A 4GWGA 4QFBA 1BOFA 3HB0A 4WGFA 4B6PA 3AF4A 2AZXA 1YT5A 1E66A 1XQXA 2K2QB 2JJ2A 1KYWA 4U8HA 1FP7A 2XQFA 3RI3A 1Y4DE 1J9EA 2FW9A 1HH4A 5LYJF 2Z6AA 1TUEA 2XUDA 5LNK6 1TB4A 1LTQA 3W1VA 2B4QA 1JHOA 1EXNA 1CJTC 2PZJA 5JCPA 1B76A 1JAHA 2D5IA 3LRXA 4WSOA 2IT1A 3WK4A 6REQB 3ESAA 1H3NA 1WZIA 2HCJB 3OLCX 2DWPA 2FVXA 3S2IA 1VGVA 2D7DA 2WABA 5TIIA 3OFNA 4E5DA 1NRWA 3E9MA 1WRBA 4M9SA 4UASA 4P0PB 2M9MA 4JKYA 4YCSA 3DV9A 4D8TA 2J32A 4ZPJA 4UNRA 3ZIAD 4EF5A 2CXPA 4DMRA 2E49A 3ZTYA 3L0PA 1LK0A 4UBMA 4A5SA 4F4CA 3U6BA 4BLWA 4O4LA 1JX6A 1OXKB 2AKEA 3R6LA 1VJGA 4TT3A 2FWPA 1QP4A 4JGBA 5K0EA 1YKGA 1D4AA 4YJHB 2PN1A 5LR6A 4E70A 2GAIA 1SCBA 2FQXA 2MU1A 1BXRB 1IZYA 3HCAA 4Q1CA 2O0HA 4QGSA 2WSYB 3L7JA 2R2AA 3KR9A 1KR2A 1CQZA 4GT1A 2FF5A 3IT2A 3HXKA 4JDPA 4MZXA 3TKLA 2VHCA 3OAAD 4YP0A 3THYA 2P4HX 3KEMA 2QSZA 3RWBA 5JSZB 1GG5A 1G6Q1 3OU2A 4O2BB 1POXA 4K40A 2IGBA 1CQJA 2AFIA 1XZCA 3ASYA 5IARA 1RJ9A 1TVKB 3MELA 1KI3A 1QYCA 1A69A 1FNCA 5B7PA 4LNUA 1XHLA 3VR5D 3IHLA 2GN4A 4DB4A 1YAJA 3EN0A 3OY2A 3UG6A 3O92A 1UOQA 5J2UF 1Y9AA 3WBFA 4BX0A 2VBIA 4WKPA 4U5XA 4K81B 4YAIA 3PA6A 4Z4HA 3PGVA 3JALB 3X1KA 4Z3KA 1X87A 3NOXA 2NSLA 4NENA 2BGMA 2RD2A 2GB4A 1MO5A 3PNQA 2I3GA 3LYUA 3OQJA 3TBFA 2RAFA 2HJHA 1XKTA 2CKDA 2ZJ1A 3VZPA 2XGMA 1U3DA 4A8TA 1BOOA 1M6HA 3PEEA 3KKPA 1C1DA 1P5RA 4OV6B 1DT5A 2ZRNA 4HDCA 5HBRA 5GGXA 5IDXA 5KEIA 4IRMA 1W87A 3W6ZA 4JYBA 2Z1MA 2FHSA 3JASB 4JNKA 2Q1SA 3EZ9A 3TLXA 4DIBA 5LP1A 3DMFA 3RF6A 5D85A 4B6RA 2J07A 3AEYA 3IOMA 3U9TA 4AICA 2GSWA 4HN2A 5JIBA 3U09A 1Z5OA 2TYSB 2YRXA 3NBYC 5IFKA 4LMRA 3W05A 1AZWA 4KPUB 4HFNA 1U8TA 4KZKA 4U2EA 3RK1A 5I9NA 3CEMA 2EFYA 1JHVA 3TZKA 3GJ6A 5A4FS 1K89A 4E21A 3D8SA 5TVKA 1E1CA 2R68A 5CFZA 4I66A 4ZT3A 1GLVA 1U8YA 3S8YA 4JN6B 1ENPA 1C4OA 1P73A 4XVRA 3MJDA 4A1OA 4BXOA 1SUBA 1JDJA 1U9YA 4U7TB 4WZAB 1VMEA 2EYUA 4BMSA 3MT0A 4X65B 4Z7JA 4YAEA 1UJNA 2CNWD 4EP1A 3MQ2A 4WH0A 1RJGA 4KFTA 3ZTWA 3REQA 3TQHA 5J23A 1A1VA 2H2HA 1CIJA 3RLIA 3E9RA 1OWPA 1QKIA 5K20A 4TRNA 3IXQA 2YYSA 2WBLC 4L73A 2RC6A 4EHAA 3ZD7A 1WCXA 1QXSA 3PP8A 3U1TA 1WXQA 2YJTD 2FXIA 2EZ8A 4EYSA 4G5SA 2A9KA 5AKHA 2HY7A 1SMKA 3I12A 3MWFA 4EHLA 5L8VA 1FJ2A 5HUHA 4ZO8A 4MYSA 3UK7A 1HE8B 1SXPA 3MD0A 1AKUA 3RAEC 1W5AA 1AUXA 2WYOA 3GZNB 3KSDO 3IVCA 2I4OA 3D6NB 3HWWA 5KOYA 3K0FB 1HTWA 1ZOPA 1V5FA 3GLHA 4L51A 1FMJA 5GIOE 4C9BA 1H3EA 1G5TA 3T5DA 5KOIA 2FUG1 3L9XA 5AIAA 3Q2OA 4HN4B 4XTRA 2F55A 3HXTA 2CJWA 4BBPA 3TLJA 4E1VA 2EJBA 3MTQA 4F84A 2EG5A 2REXB 2PXAA 1A2BA 2GPTA 1F2TA 1FUEA 2BEWB 4US1R 2D00A 3IVGA 1S96A 1D1TA 2ID9A 5FOUA 4KAXA 3W6OA 3EVDA 3NEJA 5EMMA 3SDBA 2B7LA 1J9ZA 3ORHA 1VIYA 1ODKA 2OFFA 1SBYA 3AKYA 3SQXA 3AU9A 5K3AA 3W2FA 4OHOA 3WKDA 3VR3D 3BGIA 4TMKA 4OB8A 5K8UA 1FFCA 2XVAA 5HFJA 4LF5B 3DFKA 1WW2A 4NLLA 2BGKA 2HMSA 1OFHA 3P4XA 1R37A 1VC2A 2HCRA 4ESVA 1J2EA 1D5CA 3ANLA 4D74A 2V7QA 2AOUB 3GLIB 4YUYA 1I6MA 4S05A 4XRGA 3VR4D 1M9NA 5CB4B 4II3A 3DVAB 3CT4A 5KI6A 5IJ0A 1C8KA 3B7PA 2YS7A 3EA5A 3SR3A 5IHXA 2JJMA 1TRKA 2GTPA 1V39A 1C2YA 3RSHA 4XDYA 2PGIA 3STHA 1LB1B 1HLGA 3BWMA 3ZD6A 2FQYA 1TMYA 2NZVG 2XYQA 2HDWA 4MV6A 4UM9D 2VJBA 4WKNA 4BNTA 3UHFA 1G1AA 3TI9A 3U7IA 2J85A 4CPDA 4H27A 3Q8LA 3ACBA 1XTKA 3DE1X 3D8UA 3ZWQA 4YUXA 1S8NA 1HT1E 2VYNA 3WNDA 1NM5A 4IZIA 4KXYA 4JUFA 5EE1A 5FUYA 3RSCA 5KYWB 4LVUA 4C76A 3D02A 2A9VA 2JZNA 3NT5A 5EXPA 1RI1A 2BFBA 1KTVA 2V65A 1FU4A 3D7MA 3GBPA 4JLUA 1EFKA 1N5IA 4PSVA 3KFVA 4QREA 2GBLC 3EQ8A 3I9NA 4HMQA 1XTRA 1J2UA 2I1VB 1VJ5A 2WUWE 2YOFA 4LY6A 3AKCA 1E61A 3GJ4A 3PX2A 4ALNA 2JI8A 1RHJA 1JBEA 2PSSA 5K3EA 5A7HA 2IBSA 3D7RA 3IPRA 2FEXA 4DDKA 4YMWA 2RARA 1P1CA 4HTFA 4E1AA 2C7RA 5EKSA 1PR1A 1O6GA 2X2FA 1L4MA 4QUIA 2OAGA 3H5LA 3IKVA 3OFVA 5FHQA 4X85A 2BV3A 1HG1A 1LDYA 6GPBA 4X7PA 4OOEA 2QR2A 1C4XA 2W37A 3F6BX 4F2PA 4QUBA 3CLTD 1EU1A 2IPXA 4MPPA 1Q1BA 1LPBB 1NRIA 3VH4A 1CDEA 3X1MA 1DAKA 2NZWA 4G56A 4RZSA 5AOVA 1E1LA 3NONA 5F4BA 5FADA 2FEAA 3V9AA 3WMFA 2I80A 2OHGA 3DO5A 4JASB 2ZZKA 3AJ8A 3V1MA 4N7BA 3K5IA 2AOTB 1C0IA 3K0CC 4PANA 3VHLB 3PC2A 2R5FA 1CJSA 3TTSA 1JFRA 1JEQA 4EA7A 3N2KA 4FFDA 4IIYA 4JLNA 3A3KA 4XQCA 1XF1A 1GPYA 4TWBA 4LJ5A 3AP2A 3S99A 3NHFA 3AERB 2PUFA 4OHPA 2AFRA 2JD1A 5HWSA 3M3DA 1KH1A 4OSPA 2RHHA 1L5ZA 2FI1A 2RJOA 5IRCD 2AMLA 3B70A 3NKLA 1N9GA 1UXHA 1JA9A 4RKYA 2XKJE 5T4FA 3ZW9A 3UOGA 1I94B 1MO3A 4WCFB 1UMDA 1FC0A 3AFNA 1ZK4A 1A7JA 1MO4A 4W1PA 4MCJA 4BKPA 1ZR4A 3MAGA 2F62A 2WT4A 4ONEA 4PLTA 2BGWA 4RXTA 4BPRA 1GDDA 3LMKA 3NKFA 4PNEA 2WQ7A 2AXEA 3PU6A 4QU5A 4L07A 2KLBA 4KO1S 4P58A 1IN6A 3LPCA 3WJ7A 3MYRA 1SHLA 2D5BA 4UU7A 5IM4F 3ISTA 4KZPA 1FPQA 5CT8A 3EC1A 3QV2A 1MZPA 1YRBA 3BAZA 2BGGA 2IHZA 4KQWA 3U49A 1KTIA 2RMKA 1T15A 3MOSA 3QJYA 3IJEB 4A6DA 1Q17A 1O58A 2Q07A 4HCJA 3MGGA 4IOKA 4ZVRA 1FLDA 3IB3A 5AJVB 3VV2A 5KBYA 2CUTA 2H92A 4X20A 2A88A 4EG1A 2Y1EA 3DJFA 3ZVNA 2QG4A 1XNQB 5E4JA 3ELDA 4I1PA 2ZTLA 3VR5H 2YIMA 4WWHA 2OBFA 3GZTB 1OREA 3F96A 3L1KA 3TNJA 2QN6A 3FOEC 4IV0A 2VTKA 2ZIAA 3DLIA 3GNTA 1F3OA 2O5RA 3KVRA 3ZY3A 4B4DA 4RHXA 5JDCA 2JZOA 4N4AA 4PAWA 3RFUA 1FMFA 4YJ2B 4K88A 2NYVA 3CRQA 4W5NA 2V6JA 2DE0X 3I4FA 3GIWA 3ZZUA 2XRFA 4ER0A 3DKPA 1WKBA 4I9HA 4TMVA 3BM5A 4HB0A 1NBMA 4HQFA 3TRJA 5AK4A 3BILA 2LD4A 5EHGA 4EB6B 1CRWG 1R4MA 5DMHA 2CHEA 2YVAA 5I9LA 3KZ1E 4PZ0A 3S55A 1AHNA 2X2EA 4KQKA 1L5MA 4EEZA 3KPYA 4KIUA 4J43A 3D6AA 4Y2XA 2FUKA 4M1QA 1PNTA 1IQ0A 2XCLA 2B5OA 1GPMA 3FIUA 2V3WA 5DXJA 2IYUA 1KI6A 3D5TA 2V74B 3FVVA 1M0EA 4HRXA 1DKUA 3FA2A 5FL3A 3L8ZA 1VI2A 3BJMA 1LY1A 1Z26A 5CDHA 1G8FA 2WIAA 2HQSA 5K3SA 3ZQJA 3PCRB 2HRBA 1RXSA 1AKTA 4LDQA 3GNLA 4EENA 2GPBA 1Q7EA 5CT9A 3CV3A 1P1FA 3BTOA 2GBIA 1G3IA 1DLIA 4G85A 4MO2A 3EF1A 1T1JA 1PSDA 4OGGA 2VJDA 5ALGA 3D7NA 1RQXA 2X4IA 2GN0A 8ATCA 3A26A 1OASA 3ZTTA 4AJHA 4ARUA 4FZ5A 3UXHA 2Z2KA 5CXXA 5JAZA 4URZR 4WHMA 5HJ2A 1QR2A 1GZ7A 4OK3A 1Z8NA 4Z51A 5FPQA 1U3TA 2B5WA 3OT5A 1S2OA 5B6IA 4RE5A 1XVIA 1JYEA 3KT0A 1K8RA 1ZA2A 2FMXA 3BMOA 4ZRNA 5EZYA 1G6OA 3WSWA 2Y0DA 1AB6A 3LPMA 1ZIDA 3UJHA 3ZV3A 1QK3A 2QZSA 4PV7A 1DFIA 3MJVA 3GYBA 5KJEA 4D57A 4PZEA 3D1VA 5A5EA 4CTKA 1K5HA 2YTZA 5BR1A 4EJSB 5KAMA 1Z8DA 1I3MA 4JI0B 2BBOA 2ZYVX 3ELBA 3Q6MA 2VJCA 4DR5B 4YP5A 3RYCA 1MMFB 3AF1A 3IKLA 2FPPA 4NICA 3DWFA 1Q3KA 1AS2A 5HMLA 1VRCA 3RSOA 3OU6A 4YMUA 3SR0A 2Z57A 1MT0A 5D5HA 3OIWA 4HAZA 2GDJA 2H1CA 3SE0A 4YUAA 2O05A 5JT1A 1QOQB 1R8XA 4CF7A 2PVCA 3B1FA 4JITA 1T4DA 4DJAA 3L7LA 3EVAA 4HQ6A 3QFRA 5AKXA 4KW7A 4RPLA 4FFBB 3NHAA 1NXPA 5FBZA 1ZD4A 2CB9A 3D7SA 3IT3A 4L4YA 1QLHA 4FFRA 2XT0A 2OVFA 1JKMA 1Y4SA 3OX4A 4JLOA 1N1GA 1UBLS 1Q20A 4NBTA 4UULA 1DO0A 3KR2A 4UMEA 5AO9A 3I76A 3OHSX 2QX8A 4JAVC 3LZ6A 1H0HA 2CJFA 2XVYA 3AVXA 3QG5A 1NW4A 2WWXA 3NASA 5ALSA 5JS7A 1ULUA 1FUYB 1N5LA 1UODA 1ZIPA 3ROQA 3UM9A 4OD0A 4OUDA 2R65A 1ZRNA 2RH5A 3JSXA 4KQ9A 3RU9A 1ABFA 3F90A 5KCMA 1I0ZA 1M6VA 1UK7A 2DX7A 3BL5A 3INTA 1Z2AA 5SICE 2NAPA 1UFKA 1MOSA 1G5PA 4OJTA 3EXHC 3IBYA 2WJPA 3AI7A 3FOFC 3VR2D 5FOWA 2OSVA 2YW9A 3RC2A 1UOPA 2HRQA 3QKSA 1NSYA 4GOLD 4MS3B 1KQ3A 1G8HA 3FMFA 2WYIA 4MQBA 3ICCA 1JWBB 4DTIA 2ZRPA 1R64A 1JEEA 3ZKWB 3RYHB 3OLZA 4QNRA 4LV6A 1NVAA 5LOVB 2VRCD 3FCOA 3BF8A 3HDYA 3E9ZA 3ZCUA 4EY3A 1N4DA 4AUEA 1AURA 4QOHA 1BKYA 1H2RS 4DG8A 1DTWA 2UUOA 4X3PA 5ARBA 2XOKA 3GV0A 1X19A 3WMEA 4PCLA 3BXXA 4D2IA 4YX9A 4Z49A 1MW9X 1SBTA 1KYQA 2VR1A 4KQGA 4WBXC 5DGTA 9MHTA 4Q82A 1VHLA 1J8FA 4FYPA 2HK6A 2Q5QA 3I2FA 5KWVA 3DKVA 3CIOA 3NOOA 5F3WB 2PZKA 3H84A 4IF4A 1B8OA 2ECPA 3BMCB 3DR5A 4LQCA 4R98A 1W0KA 5I8WA 3HK2A 2C7QA 3OHPA 3RADC 1FRNA 3M49A 1SUDA 2W2MA 2B6HA 1DUVG 1PZEA 5FJIA 3TTYA 5B2FA 1Y6GA 1PJ4A 1MDFA 2IIBA 4IO1A 3PZBA 4WNAA 621PA 4DV2B 1WU8A 3PWZA 3JR7A 1MQ9A 2OQRA 2PRKA 4HXFB 4YRDA 5FA6A 2DLNA 3KOMA 1X3LA 5EXXA 4HNVA 4GC5A 3B2EA 3NRCA 4OLBA 4B6GA 2XEXA 3UK1A 5HOEA 2BJVA 1KO5A 4PWYA 1TEZA 3VOBA 1G20B 1UKBA 3P20A 5AR1A 3VR0A 4C4ZA 4AMYA 4DDHA 4FZRA 3S3TA 1P0FA 4Z7QB 4DDUA 4JUCA 3URMA 2A1TR 4LMBA 3M83A 1O9HA 1QLWA 3AUTA 3P9PA 4ALMA 3S1AB 1C29B 1J0CA 5CNIA 3Q15C 3BWDD 2KBEA 1B3BA 1L7EA 1UMBB 4URUR 5JPCA 4ZO7A 4XPIA 1Z0ZA 3T5GA 3WGLA 4YRCA 5E38A 2NO1A 4PXAA 2UZAA 2RHGB 2Y93A 4UBLA 1R4AA 3NALA 2V1UA 4YAKA 2N9UA 2R6JA 1KMIY 5KTTA 2MR5A 3L7AA 1AOXA 1AS3A 3HXQA 2J3KA 2YXBA 3R7SA 3FZEA 1WVIA 4TSFD 2V6GA 2RHMA 3BE5A 1W4RA 4JA2A 5LQJA 3DMGA 3BQNB 2YJZA 2O2DA 3M89A 1VE5A 1ZR2A 1UOEA 2HLDA 3QF4A 3VTZA 4BYGA 1OH7A 2QENA 4GKAA 1RLJA 2GYYA 3D8HA 3ESCA 1E3EA 1GKKA 4JJ7A 4LBYA 3WJ1A 2XCSB 3FDIA 3UJDA 3IIEA 4L9RA 1H8HA 2KE5A 4AJ4A 3KQYA 4HRAA 2DVMA 4JROA 1D4FA 5EIEA 2IYSA 3C6QA 5GM1A 1NRXA 3IXMA 3OZFA 4C2TA 4FGSA 1ZJZA 4EO4A 2AV6A 1IFXA 3IMCA 5ALRA 2WDPA 1F60A 1L7RA 2BKVA 4BX8A 3JAKA 1RYEA 1Y8CA 5IVKA 1L5FA 1H8EA 1O03A 3FPHA 2QN2A 3SX4A 1RCTE 3DLAA 3GDOA 1BTOA 2ZJFA 3EIWA 3RS0A 2QLFA 3VZCA 5BOSB 1KI2A 2H6EA 3BMNA 5FNVF 1YGYA 4OHFA 4DPKA 2Q5IA 1M0TA 3E8SA 1FP4A 2W6OA 5HUJA 5TRTA 2ZFUA 1EK0A 1JH8A 3PXBA 4MKRA 4ZPXA 1SHZA 3V9PA 3ZV7A 4KXLA 4EUFA 1AQJA 1P9WA 1VZ3A 3ZGYA 1MAWA 2E1RA 3QXGA 1H23A 4ZWNA 1ODSA 2CFSA 3I04A 1G38A 1WB4A 1Z18A 3A25A 3EEOA 1WTAA 3ND7A 2HPZA 1P0IA 5C1IA 1SVLA 5HRUA 4PRZA 4DCSA 2OZPA 3WB9A 2B2NA 1C50A 3Q87B 1NYLA 4BNZA 1UJBA 4JUBA 2BRUA 4DCNA 1NFFA 5G53C 3H42B 4L57A 3IO3A 3LTNC 4JP1A 4NBWA 3S27A 5E95A 4ZALA 5A5DA 2GK3A 3CVJA 5BV1A 2FG5A 5ENDA 2HCTA 3OZBA 2HUPA 2G17A 1AMOA 2G07A 1KA9H 4Q1FA 3F97A 2YFHA 2H5IA 4TPKA 5HMMA 3SHFA 4A8JC 2C92A 2FPIA 4IGFA 4RFSB 4CMEC 4S1OA 4J9VA 3M4YA 4L9WA 1NAHA 2BM9A 4MJXA 4Q7JB 1EINA 3IV7A 4AAYA 5FTLA 1EX9A 4Z1OA 1FCJA 1L4LA 2XUHA 2A78A 3L7CA 2FY8A 2WE7A 1J0EA 3CBGA 3G89A 4M9CA 5EA2A 1TF2A 1UT5A 3MBIA 3AVQA 1V2GA 4ZAWA 3ABRB 4I9UA 3FW1A 1DRUA 2YJGA 2C29D 4JXJA 3ZNNA 2FA9A 1G8JA 1SOAA 2W71A 4O4JB 1QDUA 2ZJ4A 3BJEA 2Q0QA 1BHQ1 1EUQA 5J5CA 3LX5A 2EV9A 2WJIA 4B6OA 1U2SA 1HDXA 2PJDA 2O2GA 3E7WA 2VAMA 3G2HA 2J3MA 4G3XA 4LJ8A 4WKCA 1DWUA 4Q9KA 4B74A 1YIOA 2UZIR 3K9QO 3FN4A 2YJNA 4TL7A 3H8JA 3V34A 2R8OA 1WPRA 4IV8A 1UADA 2CLLB 2JCSA 2PS3A 1RQPA 1SQSA 1IPFA 1HUQA 1ZWLA 3RD5A 2C2HA 3BHMA 4AXBA 3ER8A 3F4KA 4EKNB 1RYZA 4YRGA 2WSSD 3K70D 3PC8A 1R12A 1OB5A 5JARA 4W8HA 3PSAA 4MUXA 1HPLA 3FTFA 2C31A 4E2WA 5ICGA 3EFOA 4E2XA 4L85A 2CBGA 2FWJA 1JXOA 3SXUA 2GARA 1JG6A 5LA6F 1PR5A 5K6RA 4D3SA 4RTMA 3OI7A 4MS4A 2PMBA 5TT1A 1GZ4A 2HBRA 1R6UA 4P4TA 5SYAA 3RU3A 3SSMA 2WD9A 2Z08A 1HDYA 4M8NE 2O8VA 4RUKA 3TQTA 5DCLA 1A3CA 4DCVA 1RTKA 4OXXA 5IUKC 3B6EA 2PLNA 4IXMA 4KE7A 3DLCA 3E3AA 3V2IA 1ML3A 5KU1A 1MW8X 3UWPA 3D64A 1M10A 3DE0X 3U5ZB 3WYCA 3SZRA 4YPOA 1UAAA 3OD5A 4W9RA 1QV9A 2BR3A 1U8AA 4LUCA 4YQZA 2NP6A 1FK8A 3W8DA 1K3FA 4HMPA 4RE6A 5GVSA 4II2A 4MR9B 4MVCA 1E6EA 3R7WB 2H9YA 3KDSE 2WINI 5COAA 3TLEA 2F8SA 4J0EA 4KNYA 4OP3A 3JYPA 4C22A 2ZT6A 3G3EA 3AF6A 3NORA 3CSUA 4PF1A 2NU9A 1VIAA 3AEUB 3RRFA 4CE6A 3U44B 4UMFA 3PWKA 1ISSA 2V7XA 1CWUA 1ENOA 1NL3A 3F8WA 3QJGA 5KJFA 1T1IA 3N6VA 1NR1A 2CNKA 3EMVA 3I64A 3FR8A 1PD0A 3OTGA 4A16A 5JRZA 4H35A 4A82A 4ENRA 2Y76A 2DPHA 2VYQA 2VYVA 3KB8A 2O2JA 4V0LA 4IOLA 4KQMA 5KNBH 4ITRC 1CF9A 4LTNA 4RPCA 3CMCO 2J0UA 4KBYA 4MA5A 3HEAA 3R0IA 4CV2A 4EFNA 5E1OA 5IS2A 1ZLXA 5M7EA 2C4TA 4XI9A 4N3GA 5LXTA 1NMZA 1VM6A 5K0SA 2VDUE 1AKNA 2DY0A 2EJWA 3OQBA 2AVNA 4BV2A 1ZFNA 4BC1A 2FMKA 3H05A 4EL5A 3C3WA 2WIDA 2VO1A 4B17A 3RDPA 3N0VA 1ISIA 3SU8A 1JIVA 1SWWA 2IWRA 4FHZA 2BTQA 2G80A 2BSXA 4HAIA 4R7GA 3SJZA 4X1IA 1FRVA 1GZDA 3OETA 5JBIA 3GCXA 2AI3A 4EMTA 2EATA 3EXIA 5D2CA 2OCDA 2V9PA 3WYBA 1F2VA 1DRJA 3SJCA 1RSZA 1Z4LA 4BVKA 2YMMA 1DIGA 4R81A 3F1LA 4LXGA 5FTKA 2WWGA 2LZ0A 4UVIA 3GEEA 2VDWA 4ND7A 1MV8A 3DYBA 2M32A 4NJMB 1A9QA 3TOCA 3WRYC 1S3SA 4HLCA 4DIUA 1XAJA 1I9GA 2BFFA 2I2CA 3LY7A 5BV8A 3C3PA 4WN3A 1J07A 2ZT5A 1G5QA 1OWLA 3DA8A 3ORQA 5CVUA 3JD1A 1P6XA 3BDVA 2FK8A 4BB5A 2H9IA 4Q3KA 4AI6A 1XL1A 5EIFA 2VPTA 1OKKD 2OCGA 1D7OA 1II8A 1EE9A 2CEAA 4R9VA 3KQHA 2REQB 5TPWA 1KZHA 4LFBB 1AH2A 1THTA 1NDHA 2B7CA 3NT4A 4FX5A 4R05A 2Q1XA 4CM7A 1RNLA 1ZOIA 5COQA 3CX6A 3M6LA 3W5CA 4EZBA 2WIBA 3PNBA 1IBKB 3MCAA 3PHJA 2ZUSA 4YMSA 2IBMA 1YZVA 5BSRA 3H2JA 3PICA 3Q8WA 1JALA 4AJPA 6NULA 3K71B 1M6WA 1YCHA 3Q40A 2IYWA 1XVTA 4Y2SA 2ZUBA 3KT6A 1HTTA 1PGPA 3I30X 3MCTA 4KAFA 3GMIA 4QAJA 5IW8A 1LFDB 1CUZA 1R2QA 1DKOA 1PR3A 1RQLA 2HJSA 2SCUA 3EJ6A 1R0YA 1P6UA 2GN8A 4FFSA 4H4CA 3EOBI 2EX0A 4RSMA 5BSKA 5BSHA 2BP7A 2IYRA 1PTJC 1N6PA 1VKRA 2ISQA 2CLOB 1U2RA 2R48A 2VDRB 3EHDA 4IR7A 4UDNA 2OBYA 4EO7A 3O2QB 1CR2A 3VSCA 4JL6A 3LJKA 2GF2A 4RQAA 2AC2A 4BO0A 3JQFC 3HDQA 3AK4A 1ODTC 1XTJA 4K9QA 2QNRA 4EPYA 1NR7A 2ZJ6A 3PRYA 3FJOA 3GZ4A 3JQPA 3QFHA 4W5TA 3ZHCA 1OA1A 3SPXA 5B7NA 2OG1A 1BHJA 3JWHA 4QWMA 3UJPA 1PT5A 1SC1A 1XOIA 5LM3A 1G6KA 1J1ZA 4RS3A 3T1TA 4DLWA 4UQLA 1PNQA 2C97A 2Q46A 3IAHA 5A04A 3LIPA 3ODGA 4C21A 1MB4A 2AN1A 1E1YA 3BGDA 4ZU1X 2BEJA 5I7VA 5LQKA 2WSIA 4MV5A 2AFHA 5CVVA 2XTZA 2OGSA 3VR6A 5BSWA 3VQTA 1QB8A 2YV3A 4KPFC 3MMPA 1YMVA 3GBSA 2NN3C 4OMUA 2HZBA 3I53A 4FK8A 4N3BA 2WT9A 1ORRA 3FJYA 1GZSA 2Q7OE 3I42A 1N8KA 4JOSA 4A0FA 2QU8A 1JPVA 3A4IA 1RWOA 2IUSA 4X1OA 3TIIA 1PJBA 1A9XA 1Z4OA 2RHBA 2ISCA 4RL4A 5DJ5A 3M82A 4G1CA 4MLCA 5H68A 1YZLA 3OLWA 5ITSA 4OFWA 3Q5EA 4Q03A 1M8JA 1Y9EA 4ZDIA 1LSSA 4M87A 3B9QA 1GPJA 5JROA 4DR4B 2PU5A 2XXBA 3LG2A 3VO2A 4DAEA 1J8DA 3H5IA 5E3HA 1EUZA 2HIGA 3FMVA 1DIBA 2A1TS 4IDNA 3V4FA 3ZDXB 2GEBA 4XFDA 3JYLA 4CIYA 2VRBA 4PSDA 2A5LA 4B3BA 2OG2A 4C03A 5J9FA 4X8HA 2PLRA 1LPAB 1ULZA 1G60A 1LDGA 4FX2A 4I5FA 4J4HA 1L8XA 2ATXA 1NI4B 2CUNA 1VCHA 2BPOA 2GWHA 2H16A 1BCSA 1ZUNA 2ODQA 2Q3DA 1AK2A 3HZZA 3I4LA 3O38A 4B7AA 4LDPA 3FNEA 1MO6A 2HTFA 3QLUA 2AIRA 5EUMA 2HHLA 1IG3A 4JELA 3RVJA 3GLFE 2X8WA 3FPBA 2CVPA 1NJ6A 3EE6A 3QELB 1ZYUA 4HX9A 4YP7A 3SCZA 3RROA 3TLGA 1QG2A 2FW0A 2AZ4A 3VC7A 2XNHA 4V0KA 3VDMA 1B15A 5KKNB 3Q0EA 5EP2A 2CYCA 1E9CA 1GCAA 3RQIA 2OQVA 2GXQA 1QFMA 3H19A 1ND6A 3SHOA 2FQWA 4J49A 3SDZA 3DPIA 4X92A 1X7XA 1BWSA 3NHBA 4K7JA 5GJCA 1YB6A 3DLTA 4FCTA 1TD1A 3Q2IA 4RLSA 2VDPB 1B8VA 4LCEA 3DDHA 3TL2A 3JQ8B 3U9SA 4MI3A 4IQ4A 4J7AA 5LD2B 2FB9A 4KV9A 1RWBA 1YZTA 2ECKA 1XJQA 1PGNA 1IRIA 2J9ZB 4YDSA 2ZBUA 2C9YA 2NPIA 2H4XA 1TMKA 1YHZA 2OSBA 2QQFA 3AP1A 1KI1A 4G1BA 4H1HA 1KEEA 3R4VA 5LP6C 3ZR4B 1Q3HA 1HMYA 2QD2A 3ZU3A 4G01B 4C3OB 1GP2A 2HU8A 1ZI9A 2JD2A 5GOTA 4ETIA 5I8ZA 1QZXA 3T3OA 2V0CA 2ZSFA 3GGCA 3MNFA 4NULA 3TCXB 4Q3DA 4E3ZA 4C7JA 3A4VA 2Q1YA 1ZH4A 5HF8A 3W7VA 3U7FB 1FX1A 2NQ2C 1OTYA 3G1WA 2X3UA 1RACA 4KOAA 1IZ7A 3IDZA 4RFVA 1L5LA 2BI7A 5JASA 1FZTA 5K0FA 4Z9YA 3BH0A 2Q2NA 2WF8A 1CFJA 1U0NA 2WUGA 4L0DA 4RZXA 4G5QA 3WL8A 1Z4IA 2O07A 5FV4A 1UAYA 1ZJ6A 3O3NB 1VJTA 1QQ6A 4YRKA 4HFJA 1Q0TA 2GZ3A 4J07A 1J2TA 3AVTA 2YHIB 3O3CA 4NZZA 4W9MC 4G5OA 1KAHA 2I87A 3E5MA 1K5GA 4PVCA 1KI8A 1CE8A 3ENKA 2OXIA 4EY4A 2C61A 1SELA 2ONCA 4R1QA 5KSZA 3IQIX 2P0YA 3KSZO 4L5YA 1TU3A 4WAUA 1Y80A 4R5HA 5EHQA 1UM9A 3R44A 1JQKA 4WKOA 1VCMA 1I7DA 1Z5ZA 1W6UA 3GPBA 2UVQA 2X5OA 1W2WB 4NMHA 5KNDD 1UBRS 4LSGA 4ZK6A 3H99A 2GJ9A 4JDUA 4BFWA 4EKGA 5JJIA 5JNSA 3HUFA 2RCNA 2WJVA 2LV8A 2GMWA 4O4IF 4X7BA 2H4HA 2B8EA 2ZYRA 1H2HA 4U0JA 1G9XA 1I3KA 1PR9A 4NCHA 1TC2A 3AR8A 1VE3A 1K7SN 3OIDA 1PJZA 2NXCA 4QEZA 4QVIA 3S68A 1T9DA 5JCOA 5CJ2A 3L8EA 5F52A 3OEEA 1WBJB 1J00A 4I55A 4RV4A 2Z4SA 3U39A 1JR3E 1GU7A 1GTL1 3RABA 3FCCA 5CMLA 1FNNA 4LXXA 4XYEA 4Q7KA 4KREA 2H1RA 2FX5A 3K9CA 2Q4BA 3ZX4A 3BCSA 4WKGA 3CE9A 4GECA 4TWAA 4EA8A 2WA1A 3QW2A 4UAVA 4CKWA 1L7PA 5IVHA 3FAZA 1GVHA 3G85A<