4FZ5A

Crystal structure of human tirap tir-domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
141
structure length
116
Chain Sequence
b'SRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSGAISELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEGCTIPLLSGLSRAAYPPELRFVDGRGPDGGFRQVKEAVMRYLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll/interleukin-1 receptor domain-containing adapter protei
molecule tags Immune system
source organism Homo sapiens
publication title X-ray Crystallographic Structure of TIR-Domain from the Human TIR-Domain Containing Adaptor Protein/MyD88 Adaptor-Like Protein (TIRAP/MAL)
doi rcsb
total genus 24
structure length 116
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4fz5A00
2J67A 1FYXA 1O77A 3UB3A 4FZ5A 4C6TA 4LZPA 3OZIA 4C6TB 4C6SA 5FORA 4EO7A 4LQCA 3UB2A 4C6RA 4C7MA 4W8HA 4DOMA 4W8GA 1T3GA 2JS7A 4OM7A 5KU7A 1FYVA 4LQDA 3UB4A 2M1XA 2Z5VA 3H16A 2Y92A 5H3CA 1FYWA 3JRNA
chains in the Genus database with same CATH superfamily
2OXFA 3FOWA 2R6JA 1PWYE 3ZE6A 5JAMA 1PGJA 4OJTA 5ADUS 3B5IA 3W8RA 1AS0A 3H4MA 1L7OA 3EXEB 1WB5A 4AULA 1E0SA 1H69A 1AKVA 5G1OA 2WV7A 3DYVA 1D8AA 2IUSA 4BEBA 1X80B 3DFKA 2W37A 1U8XX 4Z4QA 3ZR4B 2RB5A 3KIPA 1W96A 3OZGA 4F4FA 4QWWA 5FULA 1XK7A 3GL9A 4V1CI 1KSFX 4S2EA 3V1KA 4C6HA 5DTJA 2FSGA 5CLIA 4D98A 1VP3A 1KKMA 5AI9A 5FHRA 2VNJA 5JZBA 1BE1A 4URWR 4PSKA 1FFEA 4IVRA 1L5WA 1Y1QA 2B1IA 1YKFA 1ZXLA 2PZJA 3LW7A 4ZTBA 3IEKA 4QG3A 2X5NA 4BZPA 2O3RA 1KSJA 4E31A 4MVJH 1V4BA 3U4QB 5JRJA 3LSYA 3MTDA 2C2YA 1JEYB 1L5MA 2VAWA 4IYJA 2P2ZA 4PC3A 4GR9A 4PYLA 4BTLA 3RAEC 1SKMA 4GYKA 2HT1A 1XZCA 2ZUEA 5C81A 2E4VA 4F7DA 5CXXA 4MKIA 2A84A 4EJ6A 3ET4A 2CBXA 2XKBA 1YDMA 4GP6A 2LUOA 2I2CA 1OV6A 2CHUA 5BWBA 4EDHA 1JMKC 4HN4B 2C96A 1VB3A 2ADMA 4BPBA 1UJ4A 1HOTA 2H29A 3NOQA 3V2IA 5SZIA 1C30B 2VK8A 1NIPA 1BXKA 2WMYA 4YMIA 5EUQB 4TKVA 2B34A 1A8UA 3QLTA 1KK2A 3DGEC 5F64A 1U0HC 1P1CA 1NNI1 2GM9A 4QRHA 4AZ0B 2ZRKA 3CF4G 5LMZA 5JTUA 1RW4A 4P1ZA 4M54A 4B35A 4RAQA 4N12A 3HYNA 3DKIA 1WU8A 5C2JB 2OV4A 3ON5A 4GLFA 1GNRA 3LRTA 4U63A 3JQFA 2QTVB 3FBGA 4C88A 3WGVA 2A58A 4HP8A 3LUPA 1P73A 1ZG3A 4OH7A 1TVEA 1XKLA 1PYDA 2FCAA 2O0LA 3I73A 3BB3A 4TV9F 4Q1FA 5B2ZA 3VZQA 3QHAA 4CHGA 4EK9A 5AW9A 3X2FA 3M0EA 5DHUA 3REGA 1TMKA 1G4HA 2C4HA 2I54A 2PSJA 1E0KA 2QEQA 2SCUB 1JE1A 3PPIA 4NK4A 3QUTA 5AKYA 2X4DA 4PPFA 1THZA 1AN0A 1W1WA 4JBXA 5FUVA 1Y3FE 3ABSB 4YBZA 1U9JA 4LYHA 2Y93A 4LHWA 3KRTA 1GZ7A 3QXJA 1W5EA 1KQOA 1HYBA 3EVNA 1BRMA 1XQ6A 2JL1A 1KP2A 4QARA 2ZRGA 9LDTA 4KWHA 5IN5A 2OHJA 4YRQA 3FOCA 3ANYB 2H9YA 3JQ8A 2PYIA 4BZXA 3OAAD 1Y3IA 2VKTA 5KAMA 4HGQA 4JP3A 5U4XA 4NZZA 4B43A 5BYAA 4XVCA 3RYTC 2QK4A 3MAAC 2MHCA 2MOKA 4OGWA 2FR1A 1X15A 2E1RA 4Q1AA 1P1IA 4RBNA 5EYPA 4RF4A 421PA 1J8VA 4DARA 3SZRA 1N7IA 4RLHA 4KXXA 4RKEA 5BNWA 3L0OA 1X1CA 4H7DA 4LISA 3RK1A 4DLUA 3E9DA 1WHSB 3ESAA 3DM9B 4FLMA 4KFUA 3LZ6A 1UBGA 3JQ8B 4HDOB 1JFLA 2FLVA 4JYPA 5EXXA 4PQFA 5H4HA 5HKKA 3LXMA 4P92A 3Q3GE 1R0YA 1YDWA 5F1OA 5CYOA 3CVJA 3R7FA 4S04A 1JLLB 3WZ2A 1HEYA 5EJEA 2QRGA 4R40A 2CNLA 4ZCLA 1RE1A 3VYWA 4NDNE 1ZBDA 3HVIA 5KDDA 1N2OA 1BDMA 4BP1A 2KPOA 3K09A 2P2GA 3CZCA 5AICA 2FWAA 3SNHA 4BBPA 3EH1A 5J47A 3OWHA 3X43A 2NU9A 2C4UA 3HO6A 5ICFA 3MT8A 1OTHA 4BX9A 5LN1A 4LHXA 4Y7CA 4B3TB 3CLVA 3OX4A 4PLVA 3T5BA 4BNVA 1VMEA 2VP5A 1PZHA 4NU6A 5JY1A 3KWLA 3VKUA 2ZRQA 1M2HA 4TSKA 2MR5A 5EKXA 3GD7A 5GQSA 1PQYA 2C42A 4X1YA 3ROFA 2XJ4A 3UJHA 3ASZA 5A4AA 4L51A 2FTKE 1FDOA 1ZWLA 4OQYA 1C9JA 4MEJA 4CFSA 4KR3A 3C4JA 4DPKA 2C4WA 2O48X 3V1UA 4J2OA 4U9UA 4CDGA 2QLFA 2IPOA 1K2VN 1E7YA 1WKBA 4RV4A 2XT0A 3H11B 1YB4A 2H1SA 2XXJA 4G4SO 3SZGA 3TINA 1LQTA 2QA5A 2W8BB 3LKVA 2P9HA 3S2UA 5KTTA 4MV9A 3RJZA 5IT4A 2ZDGA 4ZN6A 1OYYA 5MDHA 2IC5A 5CLLA 2JBWA 1KJIA 3GGGA 3DTVD 4HRXA 4R69A 4M86A 4YX9A 4URXR 3NNNA 4EP1A 3THSA 2EKDA 3BTVA 3DQZA 3H6GA 4FB4A 3GEGA 1PLKA 1BFKA 4WKBA 5CNMA 1FBNA 4ZQEA 3VU8A 4M9UA 2JIBA 2IUUA 1UBLS 2W6OA 2HYIC 4PC1A 2WKSA 1TF2A 4J3NA 1RWPA 4J75A 4BQEA 4QYSA 4CT0A 1Y7LA 1AKMA 1XN4A 3K53A 3TTSA 4EARA 3OIUA 4IXWA 2J85A 2NSJA 4WVFA 2N0SA 2PIAA 1OCEA 2DULA 2XITA 1XEAA 4RVOA 4YP6A 2PEYA 4OXYA 3DFZA 1VC2A 5ELLA 5J4KA 2I6SA 3UG7A 2ACWA 2X8BA 4BCCA 1KEEB 4M0MA 4LRXA 5HMLA 2II6A 1P9NA 1SCKA 5LDHA 2JW5A 3EVDA 4KNVA 5EP2A 2C0PA 1GCGA 3GRUA 4YUVA 2DTDA 2VPWA 3C39A 2Q9AA 3NYQA 3OQ1A 3WYEA 3WLPA 3ZV3A 2IXFA 1L5ZA 4YT2A 5KTYA 1BEEA 3CGWA 1KTVA 1G21E 2EJWA 1ZGBA 3F97A 4NCHA 1MJGA 1HNXB 1NMYA 4M1OA 5EEGA 3PVZA 5ENZA 4AUKA 5WRFA 2YHIA 3GDHA 2L19A 4RHTA 2EBUA 2CMFA 4JT9A 3L77A 2HJWA 3MB5A 3RSHA 4WQMA 5TSDA 3N2NA 4D8XA 5E38A 2YWGA 3WIUA 4J0CA 2VF8A 4OQQA 5CBPB 1Z6XA 5B2EA 1WR8A 4BRSA 5JOQA 4IJKA 5J3JA 3B1WA 4BQSA 2UKDA 3BH0A 4YH1A 3TIFA 5LQRA 4KQIA 3IO5A 3BK1A 2D1QA 3I09A 4WDQA 4FFOA 4DC1A 4LZJA 4MKZA 3GLIA 4OQNA 4HUQB 4EOGA 2FEWB 3KOUA 1JSRA 1BMTA 4EENA 4I9GA 1AKEA 4U7HA 2CK3A 1U8FO 2ZJ7A 3D0OA 4QYIB 3DSRA 2JGEA 3BXEA 3GI1A 1D4ZA 1OMOA 5SY9A 4OLFA 1E9DA 3ROQA 4QHSA 4V0SA 4WCVA 1E5LA 3BWYA 2X1HA 4PAOA 1DBWA 2OZLB 4JLAA 3TTYA 3EY9A 5KQRA 1TTPB 1F0NA 2HQOA 1KHTA 1LX7A 2JIQA 2F3QA 4LCBA 4MS4B 4RCZA 5BORA 1ICIA 4EJ0A 1I14A 2AQ8A 1J1UA 2OBXA 3IAUA 4ZJUA 5DWQA 1DIAA 1PT9A 1QIEA 4LHYA 5IAKA 3FSGA 1NT4A 3BHIA 3FAKA 1PNQA 1QQ7A 2GKGA 1O0SA 3BWBA 3H5VA 1K1EA 3LYUA 4HAYA 3BUSA 4MLCA 2R2GA 1W2HA 2C58A 3I28A 3IBTA 1PJSA 1B8OA 4FZRA 4RL6A 4WNYA 3ETLA 8ABPA 2JLSA 4QOEA 1HGXA 4HS9A 1RR6A 1Q12A 1SIOA 3HVKA 4LWPA 5DIZA 1JAYA 3S68A 2HW8A 4WL0A 3FFXA 2X6QA 1Q7GA 3CXUA 1L7PA 2GKOA 1J0AA 3O4VA 1OBHA 3OG9A 2HB6A 4BB6A 3PLAE 1IUOA 2P78A 1XTKA 1Z8DA 2UZ1B 1PGOA 1M0TA 3HMQA 2VP3A 3KZXA 4R8LA 5E1DA 3CUSA 4JKIA 4NULA 3RVBA 1QH1A 4Z9XA 2JGDA 4U7FA 4MQ4A 4QODA 3OA0A 2XA1A 3NT4A 4NBWA 1KYYA 1Z56C 4CR7A 4V3BA 4ZU1X 1P8JA 1XZMA 3KB2A 3L92A 4PN7A 3VSCA 1QQBA 2SKCA 3FGNA 4GX0A 4IP0A 3BE6A 4R1QA 3PUXA 3NZEA 3WHPA 4PRYA 1F0PA 1V95A 1NU6A 4PLPA 1E3WA 2LW7A 3DBIA 2J6CA 4Z4HA 4JEIA 4HMOA 3ZC3A 1H8ED 3BAZA 3EXHA 2QQGA 3OPYB 2BDTA 1H5UA 2B1RA 4WLUA 3R7WB 1TB4A 3DT6A 3HLKA 5TDHA 3R6WA 4DYDA 2Y9PB 2O5EA 1DOAA 1I3LA 3CVOA 2B82A 3RHZA 2XF2A 3RB8A 2XB2A 3A11A 3DTVB 1W25A 2JI7A 4CF5A 4M1KA 1JNYA 5EOVA 3CZ4A 1NQXA 2ES4A 4RK1A 2NUBA 3INRA 1HV8A 2FZKA 3I12A 4GL4A 4INOA 4KBYA 2AMVA 5JSKA 4DQUA 1KY5A 5HCUA 4N5NA 5JAQA 4AX8A 1FLAA 3GHYA 4LCEA 3LCCA 5DM1A 2VSXA 1QVVA 3DBRA 4FXPA 3K9QO 5AO9A 1VLJA 3Q6IA 6PFKA 1OV4A 2B9VA 4QPDA 4L72A 5HQ3A 1SCUB 4PLGA 4WOJA 5IDYA 1Y1TA 3L3BA 1D4OA 2Q0QA 5HOQA 4MQ5A 4FIZA 1QH8B 3OMXA 4UVEA 3L6UA 5BW4A 3RNOA 1GNLA 4HEQA 1XTQA 4KFCA 3ZHTA 3VR4H 1I4OA 2JPDA 3KR2A 1F5SA 4ALMA 2Q3CA 4DCVA 3QE9Y 2FPRA 2CNKA 4LFCB 4QICA 1E1NA 2DBZA 2FJPA 4NZYA 3MOGA 4DSTA 4ESHA 2I9KA 4NCBA 3PPYA 5BOSA 1NXQA 1XHFA 1TA9A 3ZY5A 3JTEA 3FM9A 4G86A 4CEHB 4IUYA 1W34A 2NXCA 3QXGA 4B6SA 1QGYA 2H2HA 3IBSA 4Q03A 3S0JA 1VLQA 5DN6A 3RVNA 3LPCA 5MN6A 1EA5A 2ZWMA 3TRHA 5AFSA 1QGDA 5ALYA 3H19A 5KYXB 2IZ0A 1YK0A 2H1WA 3TLKA 2ZE8A 4IILA 2H7CA 3ADBA 4LYEA 1GM5A 2P9BA 3K05A 1W5SA 2HIMA 3FSEA 5HJ2A 1UPXA 5FTLA 2F8SA 2JATA 2IE0A 4D0GA 3L7AA 4KQHA 5FOUA 5KYTA 1T1EA 4KVAA 4PHGA 2A9PA 3H99A 2DHDA 3WXMA 2ZJFA 3BIJA 3FOZA 1J2TA 3PWZA 3CR3C 5DHTA 3IR5A 4I6JA 1RQGA 1H2ZA 5ITZB 1EWRA 2D3TA 4RWEA 4INZA 3T38A 1YVDA 3WQQA 1YMQA 4WAUA 1JHUA 3AOEC 2EFJA 4FK8A 4RKQA 4YCDA 3OCYA 2PUJA 2XRYA 1E2DA 2GARA 4PWZA 4TRNA 3Q88A 3QLUA 3T15A 5B12A 3FYSA 2EHJA 3QPVA 4YJ3F 5DDIP 1F51E 3ZU4A 3UAZA 1HE1C 3KDSE 3O03A 3MG9A 3H6KA 2ACKA 1TI7A 2J4CA 4OTZA 1ZNZA 1AX9A 4EKEA 3FMIA 4FU0A 5TLSA 1LDNA 1G8SA 1X80A 2WVAA 3OCCA 3DYIA 3L1VA 1JIVA 3V4RA 1LJUA 2PVCA 4FQ5A 1U3TA 1V35A 1PR2A 1E1CB 1R6VA 1DLIA 2AG5A 5AQEA 2AZTA 4UHHA 1ZJ4A 3H2SA 5LZ9A 1IQRA 1K7YA 3CLUD 1K7FB 5B1DA 3ROEA 1R6DA 3NGLA 3JZAA 1PZGA 2AOUA 3WWOA 2VWHA 2PRIA 3ZCRA 1MOSA 1GFIA 3I8SA 1LPBB 3RIMA 3VU9A 4PYQA 1Z6AA 2H3HA 3AEKA 3RF6A 1OZAA 3RM3A 2JFOA 2E1PA 1NF9A 1ULTA 3GLVA 2IKQA 4R0NA 2TMKA 1QVRA 4V0ME 3B53X 1MD9A 3O1LA 5JPDA 5CVCA 2HWWA 3IBYA 4F60A 1XZQA 2FPIB 3AT1A 2BYTA 1WDLA 4BNIA 3UMYA 1VKHA 2D00A 1W1UA 3EXAA 3RGWS 1CVIA 3K71B 2FP3A 2VHQA 4CMCA 1PJ8A 4FN5A 4HGPA 4UJ5A 4AUEA 4CIWA 3W6NA 1G64A 4Y6PA 2ATXA 3SZOA 1QG4A 2HA5A 2ZRFA 2C82A 3EH2A 4I6GA 5AJHA 4EZIA 3VPSA 2HXGA 3WE7A 1RZRD 3HU2A 4ONEA 4XCXA 5FBWB 4B3JA 5A71A 2HNKA 3VGJA 4BP9A 4BZZA 5IT9A 2V0NA 3TW8B 4UCWA 4MTCA 4Q48A 4B76A 3N0RA 4ER6A 2AR9A 3BRQA 1IU9A 3A4YA 4UNSA 1JKFA 4DFDA 2Q1UA 1E3MA 1O77A 4TTVA 3L1JA 1ZEMA 3OEHA 3PFHA 3RVRA 4LRUA 5LQJA 1PVDA 5GIPE 1U80A 1CF4A 4AL4A 2CL5A 2M6RA 2JGIA 1OLOA 3U19A 5AK4A 4RIEA 2O1XA 4D8WA 4O8ZA 4UEKA 2JLZA 5K09A 4BU1A 5DBFA 2NU6B 2Z57A 4L9WA 1VQ1A 4B47A 4UNQA 3Q9SA 3GVIA 4KODA 4ZPXA 4I99A 3FKSD 1TA0A 1XMPA 1NSFA 3ESZA 4WZBA 3PFGA 4Q15A 4AO8A 1NVMB 2Z5VA 3K30A 1N6LA 4WNAA 1EFHA 1Z7WA 2AHRA 2SECE 3ZWXA 4ZHQF 5DT9A 1Z0ZA 5TQ0B 2PJUA 3ZUPA 1X13A 1O9GA 1N7JA 1T1RA 4BLVA 1BMDA 4LRYA 3UA3A 4HSEA 4HDSB 2APJA 3QPCA 2C7RA 3KZ1E 1JN0A 2FZ4A 3BFKA 3H2IA 5A7GA 4KAAA 1VHTA 3ICWA 2F8LA 1J4AA 2X8JB 4TKZA 5BMVB 5GZ1A 2PA0A 3JQCA 2YC4C 2SBTA 1KK0A 3WRXA 1A9YA 3GGDA 2C3OA 4N0EA 5CXSA 1EX6A 3NDBB 4MA4A 2GVDC 5A02A 1C8BA 3ZU5A 3AL3A 2ZXEA 4BBAA 5FWDA 1MJGM 1ULSA 1C4XA 1Y4DE 3I6QA 1TJ5A 2XBUA 4Q02A 5KTKA 3HXQA 3W8NA 5JBIA 2ZWAA 1JWAB 1UXKA 1Y1RA 2YBEA 3EF1A 2QX9A 2J4DA 1U9YA 4PYKA 5AESA 5I8PA 4QTZA 3V4SA 3DCYA 3U62A 1BD3A 1JR4A 2BI4A 1WX1A 3FETA 3VXKA 5JYCA 1HDRA 1T36A 3GT0A 5DLEA 1HSZA 4CV0A 1WDKA 1ML4A 4Q9HA 2GS9A 1OVMA 1J21A 3ITNA 2X0DA 2YHSA 2QL5A 1PDOA 3UK6A 1HLPA 1QTRA 1RQ2A 3MJFA 4BO6A 1G41A 2R6R1 5HS6A 2WNIA 4RDXA 4DMFA 1PS0A 3IT1A 1BOOA 1M73E 4MVCA 4TSFA 1VKNA 3AJ8A 3PJDA 4D9IA 1JU4A 1S7GA 3ADKA 4WBNA 1JNXX 5KYNA 2QLNA 2ZT5A 4Z8YA 2YHBA 1FA9A 3LWDA 4I1SA 5C1BA 1TTHA 1G38A 1U3CA 1X1EA 4YP7A 1PWHA 5AT1A 4J1TC 4DKXA 1M2FA 1JWLA 2C3PA 2C61A 1LF0A 2IPLA 4DMKA 1IJKA 4ZCTA 3OQOA 3DF9A 1DKRA 2VHZA 4HH1A 1R5BA 3JD4A 2VEOA 2QDKA 3GLFB 4HUQA 4XARA 3H8SA 4K3VA 4RFSA 2WQZA 4H3SA 3UUFA 4X1YB 1G2OA 2DLCX 3QFSA 2PYDA 1NAIA 3M5DA 3GV0A 3OI7A 4RPHA 5AYVA 2IZ1A 1Y6GA 1U90A 4DCOA 4KE6A 1DL5A 1VGQA 3CW9A 3MHPA 4AJ9A 5CB0A 5KNDA 2IQIA 2JJ1A 2QF7A 2PTHA 4DMLA 4Q3LA 4RPJA 1VIAA 5IVPA 3RHSA 1NNUA 2QGZA 4IIJB 4IFEA 4OHFA 3DA8A 1FSFA 1ZW6A 3RT9A 5LYYA 2YZNA 4CM3A 2IPMA 3MRXA 1B7GO 1XLUA 2AEJA 4ZFNA 1WQ1R 1UKYA 3H16A 3JQ6A 2CDNA 2MMGA 1IK6A 2DPMA 3D1LA 1L8QA 3KUKA 3PC2A 4MW6A 3N7TA 4FMBB 4Q39A 1KVUA 1C1DB 1FDRA 2IF0A 5ECWA 1Q91A 3ZBPA 4DSNA 5CA1F 5DSZA 3UB3A 3BCUA 4WFKA 1O9HA 4AY5A 4E21A 2XUGA 2VNHA 4EB3A 4YT4A 1E1LA 4GRIA 3VKVA 4JASB 5H9WA 3OE7A 1VPWA 3JPWA 4C0AC 4AO7A 1I7QB 4DJTA 2CUZA 3V8RA 1USGA 2FPLA 2OG2A 5FBRB 2M32A 3FI0A 4EITA 5JS1A 1EFUA 3ET5A 1Z26A 2I66A 3A3KA 3QTTA 4LC9A 1RM0A 4YRGA 4QYTA 1QV9A 4OHWA 5DBOA 5GJCA 5JD3A 4OI0A 5E7JA 3KK0A 1GPDG 2QMHA 1Q0RA 1IOLA 2NO9A 4BIIA 4R54A 3UXHA 1C2TA 4L3VA 5EHIA 2J0EA 4X66B 2GB4A 1UPBA 2X8WA 4Y67A 1BS9A 3A6DA 5M04A 1LV8A 2Z1NA 2ZYSA 3FF4A 2Q5HA 3GARA 3FROA 1F60A 4IIDA 2A1TR 4LC0A 4PZDA 4U7GA 3RUEA 3V1LA 1HL7A 3X1YA 1QYWA 1MO6A 4NZOA 4Z3KA 5L3ZA 2A0UA 2VCEA 4MICA 1WSDA 4XW2A 1B0UA 1F2UA 5JDIC 3BMCA 1MFPA 3PFFA 4A4DA 4X6YA 2O9JA 3H3XA 2GXUA 1U1IA 2W6ID 4HTFA 4HYYA 4MR9B 5FP0A 3UJPA 1COWD 2QMOA 4HZIA 1WUJS 3LYHA 4CW7A 3LBIA 3RREA 2W71A 3ZHRA 2OHXA 3T0GA 3CEJA 4F1JA 1PD1A 3RKUA 3E48A 1HT0A 2A9FA 4LE1A 4DJAA 5G4KA 1EBBA 2CLKB 4PZPA 4WN9A 3A8TA 4Q9IA 1O3YA 2ADFA 2ORIA 3D0KA 4IRXA 3OZDA 2QTLA 4YB8A 3THYB 3EEBA 3OZRA 2C8KA 3EZNA 3UPUA 2HLNA 4WGGA 4ZVOA 3AUAA 2WFLA 1HC7A 1KPGA 4QUHA 3P97A 4FZVA 2YC2C 3SQOA 3WXBA 3A31A 2EFDB 5JDCC 2OMKA 3O7WA 5BN5B 2DWOA 4D74A 1D1QA 2XKAA 4R01A 2AB0A 5CUQA 2RGBA 3PGA1 4J7AA 1PLJA 1KVRA 1K86A 2Q6VA 2WIJA 3BQNB 2I8CA 5D6NA 2EFEB 3UOGA 3RS5A 4TTQA 1G1MA 1NN0A 4TSRA 5LQDA 4KYVA 5ALKA 1N3LA 1PSZA 2FLKA 4DIBA 3NWPA 5B3LA 1Y1LA 4YK7A 5EQTA 3HUTA 1AKTA 3FSGD 3TB4A 4E32A 1IATA 1D2AA 2DQ4A 5ES4B 2OPBA 1QP4A 1TZCA 1XRNA 2BISA 1CJTC 5FF9A 1A77A 3U40A 1FRFS 4WECA 3INTA 2PWBA 2G72A 4BX8A 4P84A 1PCXA 5I8ZA 2PUHA 3VZPA 2QS9A 1DC4A 1G66A 1Z17A 4RTQA 4MW2A 2CFCA 2OCKA 4C4YA 3ZI7A 1R6AA 3N0TA 2ZAMA 3PE3A 4Y2UA 4QGSA 3ORQA 5AVTA 3P0HA 4YRJA 3WMEA 1NQAO 2AVNA 1BVHA 1EUDA 1CY0A 2QD1A 2ZBEA 4W9MC 1NTOA 3JVIA 1UBEA 3DZGA 5E0KB 3ZX5A 3T94A 4ZV9A 2ZYGA 4G8JA 1L7DA 1V26A 3LTEA 3U4IA 1I1OA 3P8ZA 3WNQA 3MMNA 3JQ9C 2GK7A 5E6UB 1LKZA 2NZ2A 1NUTA 2EGGA 3P9PA 1C4WA 2PU5A 5KI6A 3I2FA 3DUWA 4OK6A 3AYZB 1NE7A 5F2NA 2PNJA 3OZ7A 4JMPA 2ZTHA 4PGGA 5AKIA 5H16A 2OGZA 5LKRA 4WMLA 4GVXA 2UYQA 2G6TA 3BIFA 1JEAA 5JAPA 1KEZA 2RHLA 4B82A 4C3ZA 3GEDA 1WZCA 4CN9A 1Z34A 4HOYA 4DLZA 1XCMA 3VGPA 4UDOA 4M0PA 5F4ZA 2Y0DA 3J7TA 3S55A 3HL0A 3IQWA 1MEOA 2J1LA 4WBNF 4C22A 1OYOA 1HT2E 4AG6A 1MOZA 3ZE2B 4DVJA 1P2SA 1SQGA 4COOA 1UJ2A 3WLSA 2P1RA 3SM3A 3N8NA 3MT9A 1IBLB 3A32A 4N5IX 2PH3A 3JWHA 1ZBQA 2FUEA 3WIOA 2MU1A 3WNDA 1TF7A 3JYLA 2Z8YA 3A4LA 3K0FB 2VSFA 1FFXA 1ONSA 3MWFA 3KR1A 4M0FA 4XIGS 1YCDA 2FDRA 1VMAA 3BZWA 3ESRA 4NMMA 4QXQA 1UMBB 2FN4A 4GMDA 4WOKA 5I9MA 3UK0A 4CPDA 1UIRA 3KLMX 4FWTA 3TUJC 3EQZA 3QQPA 4BDSA 1ZMOA 4FYJA 5IBRA 4J6FA 1JTEA 5GIOE 2YJ4A 3AP1A 1Q1NA 1O4WA 2UU9B 2UZAA 2ZJYA 5JAUA 4M98A 3HP1A 3LHIA 3QYPA 3A1UA 3IEXA 4OLJA 3K0CC 5FUYA 3SICE 5LU9A 1APBA 2QP3A 1U65A 4ARUA 1P9LA 4EEXA 3H2HA 2HC9A 3N9IA 4MDHA 1Z0FA 1EAYA 1JVSA 3Q11A 1NOKA 2XAAA 3ORHA 3BHNA 3CCBA 4O0LA 1ZU4A 2RCYA 1CBUA 3RV3A 4NJOA 4WX2B 4HNGA 4EEKA 2NU7B 1XALA 1YZLA 2GFIA 4GF5A 4GQIA 1OWMA 1R37A 3HB9A 3B9BA 4IL5A 4AJHA 5CB4F 1ADCA 4UBLA 3F5MA 2ZT7A 4C7JA 3BB4A 5FEUA 4CG2A 4NBLA 4KPFC 5I3CA 1XJ5A 1D9XA 1A8IA 4LJ7A 3UIEA 2ZR9A 5BSRA 1YB7A 1QHSA 2G4CA 2W2VA 1N3YA 4GP9A 4UZSA 1ZH2A 2F48A 2VH5R 1SVIA 2F9LA 1TLTA 3F6CA 4Q3BA 2GK4A 2ZZKA 3ZUGA 3O0TA 4ZKDA 3I2YX 1Z16A 2WSLA 3BJEA 5FADA 2C5LA 4A5SA 5KSPA 4BX0A 1QMPA 3F2VA 4AN1A 1RM3A 2EARA 4YJ2A 2ZTVA 3W90A 4FBLA 5C4IA 5FDFA 5EMNA 4HUTA 1PQUA 1CYEA 3FH0A 4ZEOA 1S1MA 3HCOA 3B9PA 4PSVA 4R3WA 4X3CA 3SFZA 4K0KB 5DLQC 1M2VA 1WRBA 4F38A 2JI9A 5IJ9B 4OXRA 1WVIA 4H3KB 4NECA 4KLRA 2DZDA 5J59A 4RCYA 5I7UA 3BMOB 1LEHA 3MB8A 3JQFC 4ZANA 2QXYA 4F04A 2RHCA 1YB2A 3EIHA 1OJ7A 2VQDA 1NLUA 5IJWA 1ENOA 1N3IA 4MPPA 3E1KA 4XX0B 1YHNA 3AF4A 1NIJA 3C24A 3VHLB 4GZ3A 4DV5B 4DCGA 3FDFA 5B3JC 1UMCA 3KFXA 1I3MA 1X38A 3MK31 2I7VA 3M6VA 3QOWA 4KB5A 2QJRA 1PG5A 4LOLA 2PNFA 4KG7A 4NU5A 2D4AA 2Q1WA 4GOLD 1A7AA 4R41A 3MBKA 1ORRA 2AC7A 2BN4A 2PZGA 1ZMRA 4ZOEA 3FKSA 2ZJ1A 3OTGA 1CRPA 1KP3A 2DQYA 2EWVA 1WXXA 2IODA 2Q9UA 2OD9A 4Q3DA 1KOLA 1NV9A 2ZJOA 3W8EA 1PK8A 3ELDA 4R83A 3TE7A 1XGKA 3TB6A 3HA2A 1WTCA 4FPXA 5A4MS 1N9ZA 2AXQA 3LI2A 1YRAA 1E6UA 1JDUA 1GG2A 1MG0A 2DSNA 2YWBA 3V4OA 4E6EA 1U0EA 2A57A 1G9SA 4AURA 2QN3A 1W581 2ZIWB 3FZYA 4GXNA 2O23A 2QXTA 3T9DA 1R66A 5C18A 2FFAA 3BWDD 4J03A 3BTUA 3ZYCA 3WAGA 1M5RA 4AX4A 3B6KA 4W8GA 5F7JA 1F20A 1DKPA 1NYTA 1W59A 3R4VA 1UDWA 5CA0B 5LNK6 3L4EA 1PF7E 3NEAA 4ZI5A 2V0GA 1UP7A 3G7NA 2KHZA 3K5HA 3QVOA 1ECPA 4EGCB 3DH0A 3NBMA 3KTFA 2ZRHA 4KC0A 3LMKA 2HYDA 3NCTA 1CY6A 1CR6A 4MVJG 1T6YA 2CVQA 5A5DA 3SEQA 5KNCH 4B4WA 3D81A 5DCUA 3QJ5A 4FD3A 1WCIA 3N7UA 4IQ4A 4KXYA 4MR7B 4UBMA 5HA5A 4B6PA 4EUEA 1M6VA 4H59A 1J25A 2VA8A 3HN6A 2PCLA 4QSMA 4KDRA 3UXEA 2WHXA 4LNUA 4YJFA 1PFGA 3MPOA 4UQLA 4HWGA 1QF7A 1E2FA 1X2BA 3BJMA 4RHYA 4EI2A 1CDDA 1ZJ5A 4GBGA 2D3WA 4TM8A 1RZVA 4YLGA 2DH6A 2WZDA 2FQQA 1E7RA 1N2CE 4ND5A 4XWYA 1SUPA 3GLSA 4L28A 4RA9A 2NAFA 3NAMA 1Z08A 5H3CA 4JXXA 3EOAI 3RSGA 1C3VA 5IULC 5DTIA 4C5BA 3KCQA 1GGKA 2WA1A 2WSIA 2RHWA 5IZCC 1VBMA 2HCBA 3WGNA 2YXBA 1UADA 5TQ2B 3D4BA 2I33A 4PLWA 3RFFA 3T3OA 1JQJC 4K6FA 2R6HA 1YUMA 2C29D 4OXNA 1T5DX 2DMRA 3AUXA 4U7PB 3VR6H 4E5VA 4EY7A 3IHKA 2VAXA 5IKXA 1PVVA 2BGNA 1KFBB 1I3OA 3DTYA 2WF5A 3HBLA 4RPGA 1E2EA 4XDYA 4C87A 4I2NA 3JVEA 1YD7A 4LYDA 3FCXA 3FFTA 3Q0EA 2N42A 3E7XA 1FZTA 3A0UA 4EY6A 3PA6A 1JL3A 3SNKA 5KVVA 4FFLA 4ZICA 5C3UA 3GLGE 4D4MA 1BQ3A 2GZHA 1NURA 4QVGA 4KR9A 2XKKA 1R8SA 4YRZA 2AN5A 1FVFA 5KWEA 1J99A 3BK2A 1E58A 2W8BA 3MC1A 4PX2A 2CT8A 4ZOLA 2VH1A 3W1EA 1SCBA 3T7RA 2YXPX 1CZOA 2Q2OA 3BWCA 4MV7A 1A9XA 3NX4A 1ZNQO 3IQXA 2A9RA 5HFAA 1QHHB 2OQRA 1RXVA 1EIWA 1SBHA 3TL6A 4IJUA 1T8RA 1L7EA 5B37A 5G3ZA 3HXPA 4H31A 1UFQA 5FUXA 5B7NA 4P98A 2AFIA 1KQ3A 2EDCA 3I0ZA 3PBKA 1ABFA 4GG1A 4WH0A 3BK7A 3SSNA 3LCMA 3TAXA 3GUYA 4HJXA 3T06B 1XLTA 3NT5A 1Y81A 1OWLA 1H4TA 4M55A 4V0LA 4Z3OA 5LCXA 3CJQA 3UMVA 5DNWA 3AEUA 4GPBA 3IVCA 1K97A 1ZFNA 4FC7A 3RS2A 3G7UA 3PYLA 1XD2B 3HZZA 2OCDA 1MEJA 2RSLA 4LECA 5CG1A 5BNZA 1VZ2A 2CDAA 3R4CA 5F51A 2ZM6B 4C07A 4CVNA 1NSTA 4W1SA 2XXAB 3FPEA 4KQ2A 2LIVA 1TM5E 3LP8A 1XCPA 4DY4A 1I4LD 3UJCA 1F0YA 2PSFA 4YMSA 4MMYB 3HNPA 5CURA 1EX7A 4HLNA 1U8AA 4OSPA 1O95D 2WU4A 3PDHA 2VSNA 1OLXA 1GYQA 3H9UA 3UFXB 1T9AA 3L8FA 4LQ4A 3VR5H 3ZWBA 4W7IA 2XEDA 1RLJA 4NH4A 3T9FA 2QLTA 3HCPA 5BWLA 1E7QA 3EIFA 3TQCA 4FMDB 3V9AA 1KYXA 4NBVA 1YASA 3HGTA 4DM7A 1NJ6A 4W82A 1GCOA 2QM8A 3I8OA 3OKCA 4YALA 5BNIA 1EFAA 2AZXA 1OT3A 3Q8LA 1KRHA 1BO6A 5CG2A 4DJ5X 1UC8A 1Q50A 2BFDB 2FN7A 2P4EA 3A6LA 3GMTA 4MQUA 2K7ZA 3CEMA 4RZUA 1P5ZB 3AHGA 1FXSA 1EK6A 2FF7A 2YOGA 2Y1DA 1U8ZA 3E3AA 4B3RB 2I2DA 3K0CA 1GGJA 3VR2A 3H18A 1WPRA 2AJ8A 5AVRA 1OX4B 1LLQA 1IPFA 2RBEA 1DEAA 2YCBA 3LC7O 4O4HB 4UCXA 4HFRA 2GCOB 1ISGA 4E5MA 4AY2A 2V7XA 4QT4A 3E3NA 1ZEJA 2D1RA 2VZEA 1QM5A 3B8HA 1XAJA 3D2BA 4WINA 2AFVA 3NWEA 5HTOA 4PGHA 4HTAA 1TKRA 3E9QA 3D59A 4JP5A 1IOWA 2D0IA 4XZ3A 1QPGA 2H2DA 5K03A 1HQCA 1C9DB 3SOZA 3GZNA 4P80A 4Q9AA 1GL9B 2FSVC 3QU2A 4C5CA 1H2HA 3C48A 1JHZA 4EBFA 3N8GA 1GKKA 2Y66A 3CO5A 3DVLA 3GRRA 2WJVA 3LA8A 1ILEA 4FVTA 4UNPA 4H7HA 2VUUA 3K15A 1QDUA 2CHFA 3R6DA 4FT4A 4OL9A 4EA9A 1WL8A 5LL6P 4UPDA 5IDWA 3WYGA 3GUHA 4HB2A 4D9NA 3VKGA 3ED1A 1MAVA 1R3UA 1SHUX 4DA4A 4BMDA 3MJDA 5A0TA 3DMTA 5HDQA 3H7IA 4CMBA 3K0SA 1NVAA 2R6ZA 2FCRA 2WHRA 1GYPA 4L3WA 1A76A 1G5PA 1M8PA 1KE1A 1KIMA 1RQNA 1T3SA 1H6DA 1NZFA 3HFJA 1CG6A 3X3HA 1JXQA 5C9ZA 2Q9BA 5E7MA 4ZP1A 3ZVKA 4ZTUB 4HGRA 4LRQA 3M4JA 1S9HA 3HY3A 3UPDA 3RQIA 1VBNA 3PJRA 1QGUA 2NU7A 3OQNA 2QMZA 1H1LB 4MA0A 1FQKA 3HYTA 5D00A 3EXIB 3QU5A 2LPMA 3ZJUA 1DE0A 1II9A 1OZGA 1MLDA 1A97A 1TM1E 2R1ZA 2W22A 1F06A 3AI3A 1NBME 2F3UA 4BFCA 3CUTA 3Q9NA 3CR7A 1K6MA 1EK5A 1KEWA 2V7QD 3JRNA 2A4MA 1RWNA 3FA2A 2JH3A 1N3BA 3AM4A 3PIDA 4BMOB 2C3UA 3SLGA 3IPCA 3N2GB 3F5FA 5DB4A 1U0BB 1QOPB 1W46A 1G3RA 4KFTA 5JD5A 3QKRA 1CXZA 1DLJA 3W1VA 1GDHA 4GVPA 1Y98A 5ISMA 3LVQE 621PA 1LRJA 4EG1A 4E94A 4Y9TA 4GI7A 4G0NA 5AVOA 3T5GA 4MRMA 3IT0A 3QW2A 1ZQ1A 1M2WA 1AQYA 1YAHA 4BNJA 2R1UA 3R74A 1CZKA 5LP6C 1YZKA 1D8TA 4Y1EA 2NM0A 4PYOA 3UV6A 1FXUA 1MAHA 2BL4A 2FH5B 1QH8A 4FR0A 5IJ9A 1H5NA 3FZNA 4MGIR 2NIPA 2BFCA 5JSZB 1RTTA 2RH9B 3RUPA 3WIBA 4Q4HB 2XGSA 3FKJA 4XLZA 5EXPA 1FVXA 3C6ZA 1HLFA 3UICA 4M7PA 5K3AA 3L05A 4X3PA 4EFMA 2ECKA 2BR4A 4RDCA 2F8MA 1P60A 4DCJA 1OTYA 2H2IA 2NO6A 3ZN2A 1U5CA 3EWNA 3FDZA 4R68A 2OQIA 1DRVA 3ZNPA 1N2IA 2Q5LA 3NP7A 1VHQA 4UXIA 2PS0A 2B4YA 3S1AB 1MHTA 1G2QA 1Q44A 3ISVA 3NDIA 4OHMA 1U8TA 2Q1XA 4WZAB 4UUAA 1MJ5A 1NPYA 3BREA 5L7YA 1AKQA 1URPA 3KSZO 3PEEA 4BASA 5JH7A 3FPGA 1HQKA 1TEHA 4MK4A 3ZHVA 2C5AA 3ONVA 1DWUA 2I7XA 3WKDA 3HUUA 4ZVPA 3HCEA 3F1KA 1DXQA 1HH4A 2D5CA 3QELA 4H17A 4ZAXA 4F5ZA 1GPMA 2V6MA 3GMSA 4ENUA 1I6MA 3W6OA 821PA 4EYGA 4UTPA 1J0XO 2XODA 4NONA 1NI5A 3WB1A 3AVOA 1PV2A 2JAXA 4FD2A 1DJQA 4OB8A 4RDHA 3ST7A 3ZIUA 2H9AA 2R65A 2ENWA 4C6SA 4CM8B 3PNVA 4DJEC 3U7EB 4UE2A 2AOTB 3GRCA 1PRYA 4FX5A 3IUEA 3MFQA 3FUXA 4WLEA 2FJ0A 3V2GA 1I51A 3KEFA 3DOIA 2WIDA 1C29B 4XE5A 3LHSA 3LKDA 3E03A 4KN5A 1GNQA 1KQGA 4AJ4A 5H81A 2X9LA 4D2IA 2JD0A 4PPGA 3QBJA 1WHSA 2NT3A 2P11A 3C8MA 3AJ9A 4DBZA 5BXYA 4L0QA 4V02A 1IEWA 5C3MA 2O05A 4DNOA 1ECFA 1JAIA 1UDCA 2PD4A 2PVSA 4YAEA 3C8ZA 3JQ9A 3IEPA 4ES6A 1XTZA 2HA7A 2A4KA 3AF2A 1BXRB 3HDVA 3N87A 4JQSA 4RA6A 1KH1A 4WA7A 2XDQB 5HTKA 3ASYA 3T1HB 3HXTA 4Q16A 5HG0A 3VC2A 4CIYA 4KPGA 1JECA 1EHCA 1NRWA 4B40A 1ULZA 1E60A 2E6KA 4KDCA 1AC5A 4LKOA 3IALA 3GLQA 4V39A 3WSVA 4JR1A 1ATZA 1U2ZA 2AXEA 3PLNA 4MKHA 3WB2A 4E5NA 3L0IB 5FRDA 5C8YA 2Z9BA 5K8LA 1MUUA 3DZKA 4M22A 3DZHA 4YRMA 3NM4A 4FYHA 1ZR2A 1DT3A 2NZXA 5DXJA 3UBTA 4BMSA 2OBNA 4QFCA 1PD0A 1FSGA 1CR4A 2VVTA 3LQQA 5FPTA 3T7DA 5IU6A 4HI0E 4B87A 2YV4A 3GHHA 1JG6A 2IU6A 3CLRD 3ND5A 3ITEA 4X8MA 1VLHA 2GN0A 3H9CA 4FQ8A 3BD7A 2CFTA 4I50A 4QJ4A 1B42A 2AI3A 3TOXA 4L4ZA 1TYEB 1X9GA 1T24A 3IUBA 2Q3FA 3ZHOA 3AKZA 2FW9A 3SYRA 4CKXA 5L8VA 1R8QA 1VKRA 4U7JA 4K9PA 1XROA 3KUDA 3OTWA 3O73A 1OC2A 1C1XA 3ILXA 3IPRA 4G85A 1Y63A 4PTLA 3EX7C 4CM9D 1YRQA 2X0IA 1SCQA 3I42A 3O3MB 3R23A 4GR5A 4W1PA 5FYQA 5K0NA 4QL3A 4QUKA 5CHEA 3I45A 1YQXA 5EIBC 3EQ6A 4FI3F 1M2KA 2XD4A 2DHQA 2YMQA 1Z13A 3NI2A 4FDTA 4YRCA 4IY1A 4AG5A 2HA4A 1GTJ1 1EGHA 1SKQA 3DZFA 3PYXA 4OYHA 2GSDA 4C7VA 4YP9A 3OHSX 5ALWA 2HHJA 3KXPA 1FXWA 5ECDA 2I4LA 2O8BB 1RQLA 2XAUA 4KLNA 4CF4A 5YASA 4XD7A 1GPLA 1KEKA 3U7FB 1U2PA 3C3BA 4QEZA 1VMIA 1N2HA 2IIQA 3B60A 4MWCA 3U1VA 1OFVA 1C9YA 3EYWA 3MSXA 1F4VA 3DOUA 4OB7A 2AK3A 1JJAA 3IV6A 4OI2A 1DWPA 5D5PA 5F12A 1KNQA 4BO7A 4DSAA 5LD2B 1GA6A 1M6VB 4RTLA 2WWGA 1XYVA 3QIAA 5FX2A 4AU1A 4QUGA 2PMEA 1YHZA 1GZUA 2C7BA 3IILA 4E1AA 4UTNA 3HO8A 3NVAA 1FDWA 4QSHA 3OSUA 3KJGA 1Q77A 2O8EA 2AFHE 1NDHA 3UHAA 1XVLA 1E8NA 2IYTA 2ZVQX 2ZYDA 5AM5A 4K40A 1GAXA 1BS2A 1SG6A 4O2AA 2WUVA 4WK2B 2EJVA 2IWHA 3IOYA 5FPYA 1LDEA 2OG1A 2OZKA 1NFRA 4LIPD 4LK2A 2BM9A 3AONB 4MWTA 1JHPA 5HWSA 2JFYA 1DEHA 2R7NA 1FS4A 1GO2A 4POAA 2EKBA 2ZWPA 4KGXA 1Z6YA 1Y6JA 4P8RA 3F3MA 2WJGA 4HH3C 3DWFA 5HIMA 4IF6A 2I6UA 4A0HA 1DAHA 2IEGA 2QJTA 2I78A 1LTHR 1NJSA 5C37A 4QYIA 3C8HA 3NCHA 3TQHA 1DKNA 2I4IA 1C4OA 3L6DA 4D79A 1M34E 2G5TA 4ID9A 3OZVA 2QPLA 3AF5A 1KZ4A 3VPHA 3O84A 4AJ1A 1I80A 2A0KA 1B6SA 1K6XA 5BQ5A 1PU2A 2V6BA 2EFYA 2OKGA 3EJWA 4NG5A 2E4WA 1L8OA 3H75A 3HYSA 1XCJA 1JDBB 1JKXA 1NW3A 1DDOA 4OMCA 3WGUA 3QVMA 3OJLA 4FGLA 3B1YA 1XA3A 1JIUA 2IEZA 1D09A 2G8LA 3ADOA 1X1TA 1G3IA 3SDSA 1Y9JA 5KTSA 3KV3O 4LF7B 4F85A 1P9RA 1FFWA 3KV1A 3TCKA 4ETNA 5IN4A 5ITZA 2JJMA 4D46A 2C9BA 2FEAA 3A4NA 4NR0A 3MN1A 4TWRA 3MTQA 3EDMA 3LW8A 5CIWA 3R9IA 3SF8A 2IVZA 4LYAA 3BT7A 1E7WA 1EDDA 2VJOA 3VKWA 1DQZA 5GZ3A 1UEJA 2R8ZA 3IOCA 2H5IA 5CLGA 4YDSA 4OOEA 3CTPA 1SKYE 2AS0A 3Q8MA 2OFFA 4ZDWA 2ZUDA 2JGDB 5CX4A 5TB5A 4MUMA 2CJFA 4QU9A 2V58A 3H9GA 5CHYA 3CH7A 1ZK4A 4K6MA 4YRPA 4AMGA 4YRAA 1O6GA 1XC7A 1A1VA 4KMRA 3SSMA 2HWUA 3NV9A 2FYTA 4NIMA 1AUQA 1RYNA 4XVUA 3JY6A 3OFND 3OEEA 1RC8A 2A5DA 2GN1A 4A0RA 4HAUA 5A4JA 4E30A 1L5VA 2FPPB 1PKXA 2XQGA 4YJHA 1RI4A 5F4BA 2B5OA 3ZGVA 4EO7A 3T7IA 3BB1A 1EE2A 2CVFA 3CLUC 4JA2A 1EFLA 4GNRA 4P58A 4XGQA 3SF0A 1XTSA 3AESA 4A03A 4CTJA 3CZMA 4QTXA 3PZBA 3RUFA 1PJLA 1A8HA 4MVJI 2YZGA 3O38A 4WNCA 4EPVA 3NGMA 2B4KA 4XUCA 4D45A 2IF2A 1W36B 1UBSB 4LF8B 1E9BA 4FZ3A 5FPQA 1Q2XA 3SX2A 3K8ZA 4LBYA 4DCMA 4ABYA 3QVTA 5F9FA 1ICEA 3K1AA 3O2SB 1Y80A 2QX6A 1ZL0A 5KNBH 2NYUA 4FCWA 4KYUA 3ZZTA 1YR6A 2GCPA 1M2NA 1KPHA 1L6IA 1W5TA 3LBNA 2E5FA 1H0KA 3WRWA 4CMGA 2Y1WA 4E4TA 2JD2A 3L8YA 3DW1X 3VJMA 2FR8A 4FJ2A 2ZVPX 5FL7D 1N2XA 2VDWB 3JZFA 1E2GA 1L5QA 2PA3A 4JLDA 5K6TA 1V8BA 2XDAA 3QKRB 4ZEWA 1IBMB 4RQBA 1OZFA 3QSGA 2HGSA 4RTRA 1P1HA 1D6JA 4M8LA 2CXXA 1L5SA 5K6AA 5CNKA 1X74A 4MJXA 2FRDC 5EWLA 2C1EA 2PS3A 4H0FA 3FTEA 4N6NA 2HTFA 3NJ4A 3M33A 2RHJA 2XECA 5KQSA 3D8HA 2PXHA 3IH5A 3DMFA 4KU4A 2ZRBA 3A05A 4B3XA 1P1KA 1JRLA 4ZVMA 1JZSA 3HYRA 4MNTA 4RIHA 3LY8A 1SIWA 1MAWA 3D8RA 3D4OA 1A2KC 1R0KA 2JFUA 2VK1A 5T3YA 3PGLA 1YDFA 3STTA 5A06A 5AW8A 3IEVA 4W63A 4WESA 1SVWA 4NF2A 1DEXA 1KC1A 16PKA 3EVAA 5G02A 1BDIA 3KS9A 4M1TA 4D6PA 2D1YA 4GPD1 5CVTA 5JYEA 1NXSA 1YI8A 4KEAA 1JJVA 3R5XA 1L7AA 2QTWB 4C4OA 4CQJA 2HRQA 4GYYA 2JKYA 3H1PA 2FZLA 4EI9A 1K8RA 7YASA 3IC5A 1C7RA 4CDNA 3VTFA 2JHAA 5JZSA 3SYTA 2FXIA 3IB3A 1SXIA 2IELA 5KO2A 3RU2A 2FMHA 4Y2TA 3CUKA 3GUCA 3IR7A 1Z4PX 3RSLA 3HNRA 2AZDA 3ER9A 1RJEA 1KF0A 1XXHE 1NKTA 1WTAA 3CX6A 4XGRA 5K0TA 3E9YA 1GRVA 1QBGA 4H77A 3VVLA 1G19A 2VJYA 4GYJA 4NBSA 4GDMA 4ZXPA 5IAEA 1VP9A 1RRVA 3ELYA 5IWAB 5K51A 3LDUA 4ANFA 4FHZA 4NZ9A 3VOAA 3DV9A 3Q0IA 2R8YA 5AR1A 1L7BA 1Z0KA 5BW6B 2PL3A 2WVGA 5E3JA 4E88A 2PFGA 3ANSA 4C0JA 4Z4EA 2O1SA 4ZI2A 2TMGA 4RLSA 4RMJA 2B4AA 2PMFA 1N0HA 3JQAB 2HPZA 1WABA 2P6PA 2P7HA 4GKBA 5KX5A 2IEYA 1GNPA 3UT5B 3PEYA 4IMJB 1QJ4A 3UCXA 3QPUA 4OI4A 4W6ZA 4ZQFA 1IXKA 5JVDA 1QRAA 4IRMA 4DUZB 3NUZA 3R0ZA 3T3NA 2CUTA 2PRKA 4UVDA 1E6LA 3R3HA 2DKNA 5G40A 4D96A 5I51A 5JBNA 1GRRA 4Y1RB 3OZIA 4MIKA 3LT2A 3K0FA 5A0VA 1ISIA 3EFOA 5DM60 1PO7A 4E12A 1IONA 3BWEA 2IEIA 4B48A 1BVYF 4RD6A 1MH1A 4FXOA 2YV2A 1XX6A 1H6CA 3JAKB 4DBVO 3TR5A 1JFFB 3G8BA 3WADA 1KDYA 4MX8A 1WIWA 3JVVA 5HILA 5AUPB 1YMVA 1T3ZA 1JFSA 3AR8A 1LSOA 3K1JA 3MWDB 1O6CA 1UC5B 1T4CB 5EINA 2WZQA 3AIIA 3Q3HA 4U1RA 1NMQA 3OEWA 1B0PA 1HUQA 4DEXA 5D1HA 5GONB 4CI0B 5JHGB 4RVGA 2X40A 2B21A 2C5BA 3V4FA 1VECA 4UE3S 2JGNA 3OLXA 3GCXA 2BE9A 4BGVA 4RULA 2HHHB 3OPNA 2X23A 5JHHB 2GBLC 2PX2A 2HQ1A 4OX9B 1W4ZA 1E96A 1A69A 4IXTA 4F92B 1HE8B 1XK6A 2R47A 2JFXA 3R3UA 1YNSA 3FFBA 4H35A 4ITVA 4OAPA 4RNCA 3T1OA 1Z18A 2DUJA 2JLBA 3BJRA 4FMCB 4ZJYA 5LLDA 3FYTA 3GBSA 3OY2A 4KTTE 1MB2A 2VT6A 3A7DA 4WD3A 1CERA 2R96A 4MUXA 3P9QA 4OHRA 3TZHA 4IHJB 5E1BA 1W49A 2GI4A 2H9IA 2VZ0A 2XKJE 3CLHA 3CW8X 4GT1A 2OQVA 4B6JA 1U2QA 3GA0A 3MWGA 3GPLA 1A8PA 2YWFA 5K0ZA 4QX6A 1C14A 2C9MA 1LW7A 3FRJA 1KYVA 3D6AA 3RS0A 4YV1A 3DLHA 4F91B 4KSCA 1YR1A 1DTSA 1SXJA 2QR3A 3PITA 1L4MA 1OLSA 4EYQA 3RAFC 2BGTA 3K1YA 4B3HA 3IKVA 4BQIA 1K89A 4BYGA 2RGUA 4B4DA 3FF1A 5ER6A 2AOTA 1MA0A 1FNBA 4CEIA 1ZH8A 1YZTA 1DSSG 2PD6A 3MJTA 4MRSA 5B1SA 2CHVA 3ORYA 3KOXA 2XGOA 4I8XA 1O6ZA 1J1ZA 1RLMA 4LZZA 5DTMA 2FSSA 2ZRDA 4EM6A 3LAWA 2ODPA 4LZNA 4G26A 3S6JA 3CVXA 3N59A 5A7FA 4IRUB 4MZDA 4UUOA 3VDRA 3BRWD 3C98A 1FS6A 3I9JA 3JWGA 4ZIRA 3JWJA 1TCAA 3OC0A 2ZB3A 5THXA 1NZDA 3DLBA 2GPAA 2VXYA 1JIIA 2BONA 3K0HA 4FYYA 5I5GA 4ACBA 4RM3A 3FSJX 1CIJA 4F3YA 3OZWA 2FJUA 3PEFA 2HHAA 5IDVA 1L4UA 4UBNA 4NS4A 4V24A 3HM2A 4AYTA 3GQBA 1CF9A 3KEMA 5DI9A 2F7SA 4MQ6A 5DOVA 4D56A 2JANA 1Q7BA 3DZ8A 2BMDA 2YIVX 4W9NA 5DYWA 1RKUA 3EXFB 1Y3DE 3N6XA 4QEKA 1C3LA 3DT8A 2GD2A 1Z6QA 3ABZA 3FYCA 4WFIA 1G5TA 2Y1OA 4BV9A 3HB1A 3MXOA 3CTMA 2Q49A 1KAOA 5T4EA 1LLUA 4C78A 4BDTA 1J8QA 3WL7A 4K88A 3BYZA 4LJ8A 4EY4A 4PIMA 3GJ0A 1NGSA 4IUCS 2QT1A 3S28A 5TMBA 4P7BA 3I9V6 3WWDA 1L1FA 4KSYA 1YCHA 3U9TA 5DNAA 3O91A 2VP6A 3QE2A 2ZQZA 4C05A 3ROXA 1ZNXA 3K16A 2LR0A 1S9DA 3WK5A 2XGGA 3LZDA 3QI2A 4BKUA 3G2KA 5A7HA 1VCNA 1SUBA 2IXEA 4QG7A 5D1NA 5AJVB 3KAKA 2F00A 2R7AA 1KJWA 4G5SA 4Y2XA 4BMYA 3UJBA 1E4EB 4AW9A 4K6CA 1DRWA 3QBEA 4EHNA 3DPUA 2R5NA 2O06A 3LYLA 4AD8A 2Z1DA 2IXGA 1G6OA 3WYFA 1II8B 3EF0A 2AK2A 3PDCA 4MPJA 4MYUA 2CXNA 2R60A 3VH1A 3KD2A 1XIVA 1SVMA 3L8HA 5DJ5A 2G88A 1B1CA 1GTL1 1ZCFA 3ACCA 7MHTA 5FQOA 1QVAA 1RVV1 2GHTA 1YU9A 1SD5A 2ZE7A 3KJIA 3V8VA 1GPNA 3VR4A 4OK5A 1QIGA 1A82A 1DIHA 4GOND 4ZZ1A 1G3QA 3GNTA 1QX3A 1XPJA 2IYOA 2X1MA 5A05A 1WXEA 4H7FA 4ENPA 1PEDA 1DRKA 2BEWB 3W2FA 3G6KA 2FEPA 1ZGGA 3LIPA 3EA5A 4LRWA 3M8KA 2VPPA 4ZAVA 3G85A 3OTHA 2WC1A 3U6BA 2ZSEA 1PSWA 1KDRA 3D7RA 1C1HA 2ETVA 2PSEA 5IG2A 4GWGA 2E4ZA 1R5JA 1R15A 4LSMA 3DMDA 3S1LA 1R0LA 3DL2A 3GBVA 3KQUA 1T0JB 1OIWA 3FUCA 4RGYA 1ZIOA 4XYMA 3M3DA 1OUMA 2R8EA 4W5TA 4JI2B 4RFVA 3CNEA 2X0RA 5HHTA 3EULA 2KLBA 2OV2A 4OHPA 5EFZA 1TT5A 5EZYB 4FI3C 5KSYA 1E7MA 4GS5A 1U7HA 1TC1A 2QM7A 5EFOA 5F98A 1E3TA 1IWBB 1OGIA 1TD9A 1T2EA 2YL2A 4G81A 4RGVA 4IEFB 3W5JA 2A14A 1AF4A 1GZDA 1SUFA 5BN3A 1WPXA 1OAOC 1TPYA 2XUPA 1J2UA 3QP9A 2C9OA 3GNSA 5AVQA 2XBMA 3ZIDA 4JS0A 2REXB 2C95A 3OVMA 4H27A 1U9ZA 4KJZA 1GSIA 1NULA 3WL6A 3TQTA 3MTBA 2B30A 2HK9A 3DGFC 4FSDA 4LYJA 2Z5GA 3QEMB 1B6GA 4DLYA 4ZT5A 2NVUB 4E3ZA 5K0SA 3ZNNA 1QFYA 3IQGX 1A8SA 2HZBA 2BTQA 3K9HA 1QH9A 1RRPA 2HK8A 2ZRNA 3VFDA 3VJLA 4LY6A 2UZIR 3EZ9A 4N6OA 1NG1A 3IPLA 1UBJS 3SHQA 1PJAA 3M4YA 3JQRA 2RARA 4QXPA 1TM2A 1EXVA 5K2OA 1TJ4A 3RRFA 4I19A 5J1SB 4OBWA 3P52A 2BFBB 1KDZA 2O4CA 3GEMA 3LK7A 4RKRA 3FGOA 3TLGB 3F74A 1K8ZB 1P74A 3RASA 2P6RA 5AKLA 4ZQIA 3L6RA 2G08A 2AHOA 1CP2A 1MRZA 1JPUA 4P4NA 3E7WA 1OYWA 2WHQA 3OHMA 3TFWA 2C8JA 4ZOBA 1RAIA 4QATA 3OQMA 1ZYUA 1BKSB 4V0QA 1ZWKA 2CDCA 3FCYA 1WV0A 3QV1A 4UNIA 4WSOA 1JZQA 2BFBA 2XNHA 1M2OB 1KS9A 3INYA 5KTRA 4DZTA 3DUFB 4R3NA 3O8DA 4MQEA 4Q18A 3HXOA 4ZQBA 5GONA 1ISFA 3MCZA 3GRKA 4IQFA 1OI7A 3RADC 2WPNA 1SD2A 1XQYA 3IVMA 1ZGZA 1J9EA 2PV0A 3QOYA 4I4NA 4TZTA 2ORYA 2YNMA 4LBZA 2E0IA 4RF2A 4YRBA 1YHYA 4JUFA 2IS2A 3L46A 4ZYUA 2HSDA 5EHNA 1M0WA 1IHXA 3DDWA 3PWTA 2CHEA 2GPJA 1HDZA 1K66A 3HYCA 3TRJA 1T9HA 1XR3A 3ZGZA 1G8JA 4UOZA 1VL5A 4ER3A 5FWXB 4L57A 1YCFA 1UP6A 1NF3A 2H48A 2JDIA 2IDMA 2ZUFA 2NG1A 4JVNA 4I5GA 4TMYA 1XTPA 1POXA 1FYDA 4FBMA 3JYNA 2P67A 1YFZA 4YO8A 2NN3C 4LVCA 4TV9A 3KVOA 3FMGA 3E27A 3WGHA 4S05A 5CNJA 4NEHB 2X7HA 4NPAA 4P3YA 2IH5A 721PA 2GTHA 1I2ZA 2VATA 4MAFA 1WXQA 1Q1BA 2X5KO 5DI3A 4NV0A 1WEKA 3TW4A 4MH0R 2GCOA 2EATA 4DR5B 3TS1A 1OH5A 3H1GA 4BRZA 1R2QA 4FOOA 2CF6A 1BCSA 2CNWD 1A2OA 4Z9FA 3OJCA 5B1EA 3DMTC 2XJ9A 1JI3A 3KNZA 2JFPA 2NW6A 3A4MA 3PXXA 3ZU6A 1U31A 2Z2JA 4Q0MA 3IESA 3QOXA 4IWXA 2ZIEA 1DAPA 5E4JA 1PR3A 3TVYA 4KUEA 1Z3IX 1VLLA 5LOVA 4LZPA 1OXSC 3AHCA 1LD3A 1IDN1 3NAQA 1SVKA 2WF9A 1UINA 3GJTA 3S99A 1R12A 1LBTA 1HK7A 2AFRA 3ORSA 4JIGA 4Q9JA 3L2OB 2ILVA 3EPJA 4UATA 2GAJA 3MQ4A 1ZRMA 3MNFA 3OY7A 1N25A 5KREA 2VYNA 4KR2A 5AM4A 3KXIA 1NLZA 5AKXA 1SXJC 4IS3A 1I10A 4JDPA 4Y6RA 3Q3VA 1YRYE 2J48A 4IZOA 3HB7A 1UOOA 1Z0AA 1UZNA 3D6HA 5AW4A 1OH8A 5KS2A 3M3PA 5JLJA 4RNDB 1G20A 3GJRA 1CUFA 2J46A 3CZRA 4KN6A 2GN8A 3HMKA 3I9KA 4P3NA 1C7EA 4UUQA 2Z5FA 3DEKA 5KZMB 2B25A 3E5HA 1KOGA 5BYJA 4IFBA 4DMRA 4DR2B 4LN1A 5CYPA 3L5OA 1LFAA 1KMCA 4B75A 3ISJA 5DO9A 3DAPA 2BD0A 3ORFA 3E23A 4DLWA 4GE3A 2WZCA 3GGSA 2C04A 4JHLA 4JB8A 5ANRB 4JJ8A 3U3RA 2HA6A 1YOVA 2QV0A 3IAM1 4NCNA 5F2EA 4UOEA 4ATNA 1GUAA 4Z2YA 4PX9A 3SC2A 1UMDA 2QD4A 1MDFA 1TK3A 1ZVKA 4UBKA 4MROA 2X9QA 3ZVRA 1E4EA 4TWIA 1T1SA 1TQ2A 2G1JA 1V11B 3A1VA 5IJ0B 1NY5A 1QZXA 1YS1X 3MQ2A 3G2IA 1WQ4A 3EK2A 4UHEA 4BKQA 2J0QA 3VOSA 4DBLC 1V9CA 2QT0A 3KZNA 4G67A 4I5EA 3U2QA 5T7BA 3A6PC 3F71A 4HLUA 1INLA 3BKWA 4DPLA 3T3DA 2FFHA 4AKSA 1QU3A 3ICPA 1DKQA 3SC4A 2XSZA 1T5BA 5KMGA 2GN4A 2HD4A 1PDWA 3HKBB 4R2HA 3AETB 2C2WA 2CEKA 2C9YA 1XMIA 2P9GA 3QU4A 4BP8A 4D81A 4F2PA 1UBMS 2P2LA 3IJRA 1KRXA 3L06A 3LBAA 4HVAA 5H0IA 3W2TA 2Y6VA 3HCAA 4P5PA 1A9SA 3O75A 2YASA 3TTVA 3LLSA 2FR8C 2NPIA 4TX1A 2J0UB 1YKSA 3ILVA 1XD9A 1XNJA 3KZKA 4PZ9A 3Q3CA 3WLLA 5DT2A 2VUIB 3H7AA 2W2PA 4Q01A 1EJ0A 1F8FA 1VG8A 2NPOA 1P7WA 4WCDA 3U5TA 1V8OA 1YU6A 3K2BA 1U9CA 4TXMA 4P3KA 1EESA 1IEQA 1U5AA 5AKGA 6AT1A 4NYIQ 4YHHB 3M81A 4MGZR 3UCFA 1O4VA 3LBFA 5G0UA 2GPTA 2ZANA 1QBKC 4XVHA 1H3NA 4TVSA 1WM1A 3VHXA 5L4NA 4LTDA 5KAPA 1CJBA 4B79A 3WL5A 1Y9DA 1TVMA 2R79A 1UXGA 3CWQA 1NVVR 1RIIA 3JQBC 3HADA 4XA8A 4E5UA 5GONF 4DV4B 1YWGO 2GXQA 3HB0A 1JHVA 2H4ZA 1E2UA 1KAMA 3DPSA 4OU5A 1P0IA 3SEFA 4A9AA 2WM8A 4ALNA 3F49S 5TGDA 1JKJB 3LUFA 1OB5A 2YHIB 5DK6A 1BXGA 4Y2SA 4GSYA 1LK7A 4D9BA 4GM1A 4K1XA 3HJBA 3TZCA 2WP0A 3QVXA 1ZGAA 4QRIA 2WM3A 1E5XA 1RDFA 3HSYA 4MAMA 4AY4A 2JAPA 3DE0X 1T5SA 4Z0TA 3JZMA 3F7NA 2ERCA 3MS4A 4CUKA 4N9QA 2O20A 4B6OA 3LQ2A 3H04A 1LV7A 3ETHA 3PKIA 4IVPA 4JT8A 3SBOA 2FRXA 2P2SA 5KUTA 3E18A 1QMGA 2B8NA 2I8LA 1R4AA 2YFHA 3LGXA 3Q5DA 4Y2QA 2O3SA 3EDQA 3G5AA 4OBBA 2XB6A 3IVGA 4QUBA 5CA0A 3T3MB 4D0NA 2J0SA 5BN5A 3TLMA 3U9LA 3JZDA 1XRQA 3TKLA 1VKOA 2C4TA 1ORIA 3ITKA 3OQIB 5NLLA 4RZIA 3LNTA 5TF0A 3BCRA 3LQ4A 5A3SA 1G3MA 1SU6A 1IHOA 2QVCA 4GLLA 3V7YA 3TZ6A 2EXXA 1W6RA 1BW9B 3B9RA 5LLTA 2PGDA 1VYHA 1YVEI 2J3KA 2NXWA 4I7EA 3VPFA 2PZ8A 2C5GA 4YPFA 2G36A 5IMSA 2GCGA 1P4JA 1WAMA 5FI0B 3B85A 2HZ7A 1COWA 4N5HX 4OATA 5E2AA 1UMKA 3PRJA 4K87A 5TPWA 5GPBA 3TDKA 5E4TA 4MOWA 4KK3A 2ODEA 1N2CA 2QX8A 1B3RA 1HF3A 4TTTS 4YR9A 4FNOA 5DBHX 2EP7A 4KR6A 3FLBA 1V1JA 1YBHA 3KKLA 2ZI7A 2XE4A 3DWEX 4LOKA 2PSDA 1HETA 1E3WB 4BC0A 1DKOA 1K6JA 2OEPA 3T61A 1UZLA 1N57A 4HDNA 3WRXC 1NVBA 3OECA 4TTRA 3ZE8A 2DT5A 5L9AA 3TBKA 3ZXSA 5HMMA 3AV0B 1E2KA 1AQ6A 1EINA 2L0XA 3SY8A 4II7A 2BEUA 1P31A 1MN6A 2GT1A 2ZRPA 5KDOA 4ZYZA 1Z5PA 1L3IA 1IXZA 4CQLA 1T4MA 1GG9A 4QFDA 1TEXA 4GC9A 2X15A 3L0PA 3E2MA 4BZWA 4G9EA 1EUQA 2JGKA 4MUAA 1FZQA 3F4LA 4DNFA 2DTXA 1H2WA 1OFIA 2VUTA 1AA6A 4AYWA 4DV0B 2HT6A 3K72B 4YRLA 2V55B 1V43A 3UUGA 5CDHA 5JASA 3RROA 5K0JA 4RHUA 3HG7A 4V2UA 4LJRA 4BWVA 3N0VA 3SXPA 3SIPA 4XXHA 1SQ6A 2UUAB 1XTVA 3RK0A 1G6Q1 5JD4A 1RHRA 2VNAA 3Q3JB 4TS9A 1BJKA 3CEHA 3I52A 5K0BA 4LQCA 1J56A 4RETA 2RC5A 2QVZX 3TQOA 3B48A 1J6UA 3QK7A 3EEQA 5ESXA 1IM2A 1JG1A 2OL4A 2PX3A 3NU1A 4JBHA 5E1OA 2BKUA 4JBYA 5NULA 2VN8A 1G4UR 2JVIA 5KJCA 2HF7A 3ROKA 4LX8A 1L8XA 2ODAA 3PRHA 4IW3B 1SIUA 3URKA 3UA4A 3HJFA 2Z0MA 4LZAA 2EJCA 2DH5A 3R7NA 4A1OA 1IQ0A 5JARA 4FM9A 1IMOA 1U3VA 4BFZA 1RJGA 3AR6A 2FUNB 4R1UA 3ZBUA 4IXDA 4CFZA 4RH0A 2XTMA 1DQRA 1LI7A 2QMEA 3AUFA 4MW4A 3C97A 1C3OB 3LWZA 3C3YA 3NWBA 1AXGA 1CJVC 4AJPA 5TPZD 2XCSB 1HNWB 1GNVA 5JCJA 2GCEA 1KFKB 3BM5A 4B3GA 3KQHA 2ZIVB 3AUSA 3R7AA 1NR5A 1T9BA 2C4MA 2HJVA 1PT8A 5D01A 3P45A 4TSFD 3TZLA 4ESEA 5DHSA 4N65A 2XA9A 5EC8A 1CX9B 1X1DA 4EGQA 3Q12A 1K9SA 1S8FA 3QVUA 4TS3A 5FWXA 4TYNA 1TZMA 2RAUA 4XYEA 3FBWA 1QFSA 1RRMA 3CLRC 3TYXA 2FVYA 1CZUA 3OEYA 3PC8A 4BL5A 3R9XA 5IK2D 1DBVO 3SQNA 2E82A 5KQPA 2HQSA 3H5RA 3G82C 4I66A 5ELMA 3ISTA 1X7XB 2XQJA 4DDHA 1MRSA 1GP2A 5AIAA 1NBWB 2V97A 1D0SA 3G89A 4TGLA 4BTVA 1ODJA 1S3IA 4QGAA 3PX3A 4KMOA 4B2LA 3RUIA 1EKXA 4HC4A 4DT1A 1BWQA 1EU1A 4IIBA 4OQXA 2O1EA 5DTRA 4TKUA 4PZYA 1U94A 3FRIA 3IHTA 3OT5A 1HXHA 1U0FA 2OCGA 4YT8A 1X42A 4IO1A 2J9XB 1ZHHA 1SVSA 1IZ8A 2BF7A 1HZZA 2G17A 3EVCA 1F2TB 2VF2A 3HDHA 4JUAA 4XRRA 4TN5A 3S2YA 3WKEA 1K08A 4DRZA 3OCXA 1FBTA 1THGA 2CW5A 3GFGA 4P4TA 2FWMX 3F5SA 5KHOC 2IK8A 3FVRA 3V42A 2OAQ1 1E3LA 1H8HA 1EFRA 4NQZA 4MGEA 2GA8A 1UOQA 1U2DC 1V16A 4R1PA 1ZJ6A 4QDJA 2IV7A 4AXBA 4CCYB 5JFGA 4DF3A 3AHHA 3EE6A 1GQRA 1JQ5A 1D2HA 3E58A 3BEOA 3VH2A 1OXTA 3U4MA 2BI7A 1A8QA 1F2VA 1QIHA 2Z58A 3GDWA 2H3EA 1KJ9A 1D7OA 3QTBA 4Z6KA 1MB4A 2C3MA 2IXDA 1MVNA 1GWNA 5AVKA 3KYBA 4MRVA 4UEOA 2R1VA 2A0WA 4TM7A 3TKYA 3N70A 1I9CA 1K2WA 2HAEA 3F6RA 5LMCA 3EAFA 4NCAA 3DF7A 3HU5A 2UDPA 2JFFA 3RVDA 4G2TA 5CMLA 2R1TA 1IJEA 3IKJA 5KJ6A 1D2GA 1NUSA 4G5QA 4OQZA 2XH8A 1AJEA 2CLIB 4EB6A 3DUFA 4D41A 3Q2IA 2HMUA 2I7DA 2HMSA 2VSQA 3QUBA 5HIJA 5ABPA 1CRZA 1ODKA 2QRUA 3I1JA 3MLBA 2VHYA 2WQ6A 1L4EA 1TK9A 1UK6A 1NUUA 3M9LA 4ER7A 5BV1A 1SHZA 2O14A 2YXEA 3ZCQA 2P4HX 3WDLA 4C7OB 1JFVA 4ZCQA 5FTMA 2JAUA 3RU9A 3GJ8A 3I2IA 2GEJA 1XJQA 3B3GA 4EB6B 1DELA 1Z62A 1AXEA 1L7XA 2E6UX 1PTJA 4KFSA 1J70A 4TL9A 4E1BA 5EHXA 3FNRA 3I3OA 3DXFA 2XTNA 3N07A 4HZUB 4HGZA 4DG9A 2JIDA 5JYBA 1OAAA 1VJGA 4UUPA 1U5BB 4QDKA 4JC0A 1GKLA 1E8MA 2JFVA 4W4TA 4BUCA 1LBIA 1YQ9A 1EWYA 2EX4A 4IGFA 1DADA 3A4IA 5AOCA 5DWDA 1A9RA 1T0IA 2PWZA 3EIQA 4JD5A 1TFRA 2DG2A 4RHFA 3CZPA 4W8OA 3SHVA 3BWMA 3REQB 1FMCA 5E9QA 4DLTA 3H9JA 2ZRMA 3R41A 4BP3A 1QANA 3PC7A 4IJVA 2B3TA 3ENZA 2HQBA 5DXAA 1FX0A 4MGHA 3SX4A 1R6UA 2DFDA 3ZDCA 1HLGA 3C5CA 4BGUA 1JA9A 3KE9A 3T1YB 3NOXA 3EIXA 1XN1A 3DEHA 3H65A 1Z8HA 3LT1A 4O1HA 3UK2A 1T1JA 4G37A 4LPSA 2DFPA 1X7WB 4F96A 3AVVA 1EI9A 4RESA 2OHHA 3KB6A 3H2JA 4QO7A 1W0JD 3MRVA 3A1SA 1IIRA 4I1YA 3P0IA 1EZ1A 3WLEA 4DHEA 3VPGA 4F3KA 5J58A 1TX4B 5J5CA 1E1RD 1QZ3A 1VE6A 2J7KA 2IY9A 3FFWA 3Q72A 3PVCA 3U4AA 4CMEC 4F6LA 2DUWA 2W2KB 1ECGA 3RIXA 1EGAA 5MGNA 2PRSA 3TVTA 3P4XA 3ZDAA 2P2CA 1RS0A 3M2PA 4FDLA 4QASA 4ZC1A 1O94A 1UBOS 3NKVA 4MYTA 3UV7A 3KC2A 1RBYA 3B6JA 5ESDA 5JS2A 5DNVA 4J43A 2RGYA 1ND6A 4XM1A 3VR0A 5FAKA 3G0HA 1AE1A 4FDAA 1PG2A 2KI5A 4FEGA 2QZPA 4OY3A 3V4PB 5EXEA 3RS8A 5K8JB 4G41A 1TUGA 3CLSD 2VEDA 3BXHA 5T5QA 1YJXA 2RK6A 3TQRA 5KOIA 3CONA 1F5NA 1XA0A 2YJ6A 5JXJA 1ZUNA 2JHCA 3BMQA 5AMXA 4D9KA 2Q4RA 1K7SN 5EI5A 2OV6A 4EUNA 3IUSA 3STYA 1Z5NA 1TQDA 5IP5A 3ZBQA 5IF9A 2OXCA 4LGMA 2YH2A 2VR1A 2GAAA 5F3WB 4CU2A 2WJPA 1IZYA 3IELA 1NJFA 1A9XB 1TFUA 2HSJA 2A9JA 4OJYA 4EFDA 5ALTA 4FKMA 4E08A 1X2EA 1WXGA 1BMFA 4DCTA 2J45A 1QOZA 3M34A 5GZ6A 4KTVE 4AO6A 4FIDA 2Z6UA 4BVKA 2XCRB 4JJKA 1UJCA 3U37A 5B6JA 2G3YA 1XEFA 3C1TA 3T6KA 4AM8A 5EXTA 5DF1A 1TJNA 1DIGA 3OQJA 4IJWA 1ZH0A 4RM2A 4K5QA 4P4SB 3B3JA 5THKA 1J39A 1E64A 2W70A 1D0IA 1KK1A 5H3HA 4MUHA 3TLAA 5E3IA 1OFUA 2D0DA 3GX1A 5TMDA 2ONJA 3C3KA 1BA3A 2BFCB 3ZK8A 2RJ3A 2F9FA 2YDYA 1QDLB 1IM5A 3NONA 4ZVKA 5KNCA 1R0ZA 5FFMA 1BJRE 1SNYA 1SXJD 2XUZA 3E9ZA 4LMRA 4M6WB 1FS5A 1NUHA 1SKUA 1ZU5A 3H1BA 4XWKA 3AETA 5KPDA 9MHTA 2VTEA 1Z22A 2EBHX 3LVRE 3UFXA 4I14A 5BN4B 3QX7A 1H2AS 1BYUA 3JARB 3MAJA 1RCUA 5AUQA 2B4QA 3HDGA 3E22B 4IQ8A 4ZU6X 4V3CA 2CYCA 3K2EA 3H83A 3MCAA 4IMRA 3ASVA 4CKYA 2VYND 1WB9A 3L4JA 1GAQA 1LK0A 1US8A 3NDJA 4EGAA 1J24A 4E5DA 2HWKA 1YC5A 1TW2A 2IYFA 2QRQA 3S40A 5ICGA 4X54A 4UAUA 4QGHA 2H52A 2QRPA 4MUBA 2BHNA 4HH0A 3GRVA 4B3IA 2I91A 5MHTA 3WWYA 3D3JA 1XPOA 1S3GA 2G09A 3P5BA 4TPKA 3SJUA 5AW6A 5JW6A 2ZUUA 4K9KA 4UTOA 5D3ZA 1T6ZA 3DTNA 3SJCA 1RI2A 5IFKA 5EWMA 4NFLA 1N2JA 1U7DA 1KH2A 3FWNA 4FGKA 2O6LA 4KLCA 5LP1A 4YRKA 3FTNA 3I9V1 2OKCA 3RFUA 1E6CA 1P0CA 1BD4A 2XE6A 1V8ZA 5H68A 2O8BA 4B4VA 3GLIE 3RBZA 4NYJQ 4RPKA 5DBGA 3K9LA 1OA1A 2PXXA 2QE7D 1XHLA 3VR6A 2C2HA 5BUSA 5ULLA 4GXRA 3ZWAA 5EIXA 3KVYA 3DHEA 4D9MA 3QGMA 1RMTA 4PXSA 1ELOA 2VQFB 3M1AA 1IPEA 3LQFA 3UHOA 1ID8A 2GHIA 1USVA 1YC2A 2GJ9A 2G80A 3NALA 2E5LB 1CYDA 3CX7A 3GA7A 3TOVA 1W4CA 3VISA 1NVDA 4Z4FA 2GUWA 4I81A 4C6TB 3ODPA 1E66A 1V45E 2R6AA 2VK2A 3D1VA 3LGAA 4WIAA 4WLNA 4AJJA 4ZI7A 2I2WA 1DMRA 1IRXA 2HN9A 2PHZA 3ESQA 3SYMA 2JCXA 4DTIA 4B85A 5K99A 3O47A 3KETA 1XI2A 2EX1A 1B2LA 2PL9A 4P81A 1FRQA 4HLUC 5C5DA 1DCMA 1JQBA 3V33A 4RD2A 4L02A 3WBKA 4CTKA 4EEZA 4GMHA 1YCGA 3OZTA 2EZUA 3OE5A 5CVUA 3RTEA 3D7SA 2VTKA 3W7VA 4PCVA 4F11A 3AW9A 1ARZA 2QRVA 1XZFA 1L5FA 1HT1E 2ASVA 3BSWA 3JCZA 1FFHA 3EGOA 2WWFA 2WJ6A 2VHJA 3K0BA 4L8VA 1RYMA 4RQTA 5AM0A 4LMBA 5EEHA 4ZWNA 5I4BA 1VM6A 4ARIA 1MX5A 2GZ2A 3C3MA 3FPKA 3JSXA 3LCJA 4E4RA 2G6BA 1T2AA 1D03A 3FXAA 3DWIA 4W5WA 1SN7A 4Z3DA 3W04A 2QRKA 3MRTA 4CIBA 3C8DA 4MVJD 3VR4D 3E0XA 1NVUQ 2F67A 2IKSA 5LQCA 2I62A 4X63A 2JLQA 3QHQA 1GGMA 3SYNA 1ACLA 1CZLA 4I1RA 4BQPA 2DAPA 1P2FA 2QE6A 3V9PA 4B5KA 1HTTA 1G42A 1HSOA 3FB1A 3F5QA 3RS3A 1PLLA 2BAGA 1N92A 3F0TA 1XEXA 1E5DA 2GAIA 2WWWA 3RNLA 3LE8A 2O5CA 2H57A 5B58C 2FN3A 4DV3B 3UKDA 3INGA 2OB2A 1BAPA 2CVOA 2D5LA 5AXAA 5IUJC 2WB4A 2WTNA 5FWNA 4D99A 3GB9A 4DUGD 2Z3ZA 3EWAA 1NN3A 2QIPA 3WX0A 3ZOKA 5BR4A 2UXDB 1GFWA 2A78A 4DDMA 1PJQA 4EG0A 3HCDA 4XJVA 1YA8A 7MDHA 2UAGA 2FE4A 3ETCA 1XRMA 2FMKA 1NBMA 2GVZC 4Q4HA 1G7CA 1YVUA 2BFEB 2WI8A 3IAEA 5JUWA 2PO5A 2WTAA 1FDUA 1NVXQ 3LDGA 4WY2A 3VYRB 4QUJA 2IYQA 4H4DA 1L1RA 3RSOA 2JIZA 1TM7E 4FFBB 1PTJC 2LBPA 4KVGA 5HM6A 4I6EA 1V5IA 5F73A 1HPLA 5FPKA 3O1JC 1NHGA 3ETGA 4ZT2A 1MABA 4GOXA 2CLHB 3LXXA 3BFXA 3ZWNA 3UNXA 5CT9A 3JQAA 5KSOA 3PL1A 1SQSA 1QP7A 4HWOA 5FTKA 1GCAA 3C1AA 2PG3A 1R6TA 2H2GA 5D6OA 5KJEA 1M2GA 1N2ZA 2XUHA 2EYQA 3QXCA 3TG8A 4N41A 1M6EX 1SK9A 4NPCA 5IAJA 1Y8CA 2UUPA 3MSCA 5T64A 4W9RA 3L7JA 1B14A 9LDBA 3C5VA 3D02A 1AA9A 1YR8A 3H2YA 1GXSA 2JIPA 2HDHA 1AK1A 4J76A 4ESVA 2W2OA 5C8YF 1MORA 2VJLA 4JELA 1XAIA 3F3SA 1F12A 1X7HA 2ODTX 5JMPA 4AICA 5JSUA 4YMHA 3CRNA 5H82A 4R9SA 5FFFA 3ME5A 2Z4RA 3JPYA 2YZKA 3NC1C 3ZG6A 3UKOA 3IP6A 4FKBA 4F9GA 4ZT3A 4IOKA 5JJ5A 3OQ6A 3FWPA 2O3JA 1M66A 1JEYA 1JT9A 3ESXA 4KE7A 1R9GA 5CP8A 3T3PB 3ZW9A 2QLJA 3HC7A 2WAYA 1MTZA 4K2AA 4KQ1A 3M6WA 3OE4A 4YJ2B 4ZREA 5CH8A 2HPAA 4GYWA 3JWIA 2PBLA 3OZBA 4YIKA 4CF3A 4CMHA 2FPOA 4MWSA 1E18A 2BGLA 2VA9A 1AB5A 4BLTA 5BQFA 1BX0A 1VBKA 3AFOA 3VV2A 3WRYA 2QSYA 3GH3A 3NYWA 2BEJA 3ZXIA 1EAMA 2ZCJA 4FT2A 4MVYA 2YNMC 4O4LA 2Q6LA 2VTVA 3HJAA 4CMAA 5CXUA 2AUMA 1ZI6A 2DETA 4OLBA 2AJLI 4ZEMA 1YZVA 3A4VA 2HU2A 4B4OA 1Z0UA 3BDIA 1CUYA 3HVJA 2FXVA 4Z0PA 1KA9H 3SKYA 1Y3BE 1XF9A 2A3RA 5LZ7A 1CUXA 2X4LA 1IBKB 1RYFA 4RJLA 1B93A 1ACMA 2X42A 5CNIA 1GCUA 1QE0A 4NICA 5AI5A 4LXTA 3SBXA 3BFVA 3S7ZA 4LE0A 5ARDA 1WUYA 4KO3S 3N28A 3E70C 4RD4A 4DZZA 3ZJVA 3HKCB 3IPYA 1HE3A 5D5QA 4EHBA 3EDYA 2OGSA 5DNEA 5HUJA 1FDTA 4FQ7A 3BOSA 1RQXA 4PNHA 4CKCA 4DLKA 1JPNA 5C52B 2HR1A 5H59A 2C2GA 4HS4A 5GOZA 3LSTA 4GXTA 2XUIA 3W78A 3RS7A 5HUHA 4RSMA 4OMDA 2VHVA 2FMIA 1NX9A 5HKLA 1JIQA 1FJXA 2X0EA 4AB1A 4DHWA 3C8UA 1U6IA 3PL5A 1N7HA 2I4NA 1IY8A 4E03A 1L9KA 1KZ9A 1UBFA 4BLUA 1E6KA 3G8YA 4P7GA 1U8YA 5FHQA 1E63A 3IKLA 1DPGA 2QQFA 3O2NA 3VR3D 3R6TA 4DQDA 2OZPA 3WQBA 2DFNA 3JU3A 2BFPA 5LP6F 4JC8A 1PX0A 1RAAA 3A1NA 2C0CA 5IM5A 3SHOA 2VP2A 1XCOA 2QN9A 1E69A 4JBGA 1H42A 3PD1A 1B15A 1UT5A 1V5FA 2OVBA 2P35A 4GSKA 4UE6A 4XIFA 1N1GA 2P91A 3PT5A 1HG0A 2HY7A 2ZRAA 3PE4A 4U5QA 4YP1A 1MRNA 1RWWA 2IHKA 3UYKA 3V6LA 1Z45A 4TV8B 3WNVA 5LQSA 2WIGA 3MELA 4M37A 4QDOA 4Q93A 4ZYLA 3BX1A 1J09A 1RFLA 4KQCA 1S2NA 3E3LA 1R00A 4I8IA 5EXSA 3WLRA 4WT7A 5F76A 4Z53A 2Z56A 1OB2A 4BE9A 5EP1A 3FPJA 2IYZA 2PBFA 1BOFA 1IEXA 4WK6A 1KR5A 3IKMB 3KKEA 5HSGA 3WC4A 5J2UA 5K9ZA 2MINA 4KX3A 4Z7NB 3MA0A 1YS7A 2BHTA 3GGCA 4B7UA 3RBVA 3N76A 1HMPA 1JYSA 2CLDX 3LL7A 2FZ5A 2JZCA 3FVQA 5A9SB 2XHZA 3V3TA 2FPXA 2HDWA 1KIFA 2QN7A 1PUIA 1NI3A 1FLDA 2V65A 3FHOA 4OKNA 1ORVA 4QD3A 2VZLA 3W5HA 1PUXA 1PP4A 1NDQA 1CHDA 3I5AA 3ESYA 1Z83A 1M1YB 3LHFA 3LXRA 4UDYX 2O0JA 4HQLA 1N1EA 4XCQA 3CH5A 5JBQA 1LFDB 3C3PA 4M0CA 1E89A 5EIBD 1A88A 1TA4A 2L69A 4C04A 2MSCB 2GBCA 4F9TA 2B98A 3VRHA 2OXRA 1TAHA<