4FZ8H

Crystal structure of c11 fab, an adcc mediating anti-hiv-1 antibody.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
233
structure length
222
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGRGLEWVSSISNTSTYIYYADSVEGRFTLSRDNAKNSLYLQMNSLRAEDTAVYYCARANQHFDWLLSLLGGYHYYGMDVWGQGTTVTVSSASTKGPSVFGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB heavy chain of human ANTI-HIV-1 ENV ANTIBODY C11
publication title Crystal structure of C11 Fab, an ADCC mediating anti-HIV-1 antibody.
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 222
sequence length 233
ec nomenclature
pdb deposition date 2012-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fz8H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fz8H01
5L2KE 1FGNH 5DI8B 2HH0L 2Q20A 4L3ED 5EA0L 1YQVH 3FFCE 1BJ1J 5E6IC 2IANA 5LCVH 2BVPB 2AXFA 4ONHB 2Z8RA 4WY7L 1IM9A 3HAEG 1W72L 3UTTA 1T03L 4PUBL 3F6LA 4Z7NE 3IT8D 3P73A 1A9EA 5DD3L 3C6SB 5E8DL 3CFBB 3GHEH 5HHNB 3OR7B 5E2UL 3D85A 4OIIL 1B0GB 4U1LA 4L4VE 1D9KC 2VXTH 2ZP0T 3LKQB 5BCAA 1QSFE 3ZE0E 4LVOB 3DSFL 1FORH 3FB6B 4HPOL 4NKOB 1QFPA 2BCKA 3ARDC 1K9TA 3RPIA 4AT6A 4RDQG 3MV01 4P4RB 5LQBH 5BMFH 4OD3H 1UCBL 4U1MA 5BV7B 4Z9KB 3AMLA 5ESAB 1D9KA 2CIKA 3PE9A 3SKJL 3UTSD 4KQ3L 1JF1B 3T3MF 4R3SB 3WNLA 1G9NL 1G9NC 1S9WA 1DSFL 4FFWD 3RUGE 1EEUA 1HHJB 5C6PB 5GGRY 2F74B 1OARH 2XPGA 3CVHB 5GZNC 3F58H 3T4AB 1JHTB 1RIUH 4GRLD 3RIFK 5CIPA 1RK1A 5HGHB 3V6ZB 1YC7A 4LNVA 5IBTL 1NUGA 3D18B 1HNGA 4GKNA 4X7SL 5ADOH 5C0IB 3MCKB 3WJJC 1S9YA 4U6HA 1OP5H 3TIDA 3TIEB 3I6LE 1V3JA 1U3YA 2F58L 4R7DB 2AEWA 1FNSH 2ZCHH 2W9DL 4NWUL 4U1NB 4W6XB 2KQMA 4J4PA 3RZCC 3MV8D 3IETA 5ALCH 3C6LB 1A6TA 1KCSL 2R0ZH 5INCA 4GMSL 4PYHA 2W0LA 4AQ1B 5JHDD 1LK2A 4Z0XA 1EEZA 1FLRH 2ZUXA 2QR0A 3FZUD 4AJ0A 3BKMH 4YBQD 4WEBL 5ALBL 4XP9H 4OIAA 5IVXF 3BN3B 5DEFA 1B0WA 1CDYA 2JLLA 1WIOA 4XAWH 3BEWB 5EFIA 3BT2H 4L4TD 3D9AH 3HAEB 1MVUA 3ES6A 1IL1A 3HB3D 4I3GA 4DN4L 5KSBE 2H32B 1SMAA 4GW1A 3EIFA 4IBLT 3KPOB 3HI1A 3MOAH 5C0BB 4DN3L 4WFED 3IGAA 3ARFC 1RHHB 3LQZA 4WTXA 2EEDA 4ODXB 3QUZD 3QI9D 4JRYD 3SGDI 4O02L 4PREB 3HE6D 1OPGL 4L5FL 5T33H 2HRLA 4NHCH 4P23B 1TCRA 5ESVB 1ORSB 3N9GH 1G6RB 3RGVC 1DZBA 3ARFA 1XMWA 3MV11 1R5IA 3FMGH 2VZ3A 2O5ZL 3MROB 1XIWA 1T6WA 3PWJA 1F5WA 4RQQB 5HVHC 2E7LA 4JY4A 5FGRA 2R0LH 4MD0A 1CGYA 3RGVA 5E8PA 4MQXD 1CZ8H 5DJZB 4GAJH 2J4WL 3W9DA 4JPKL 5DQJB 5DD0H 3E6HA 5D1ZC 4HFWB 3ZDYE 5IJKA 3MRJA 1RUPH 2ED7A 4AG4H 4UIMA 1CGSH 4HBCH 1DQDL 4CW1A 5DJDA 1R0AL 4GAGL 1NH6A 5EU5B 2E6PA 1MHEA 5GS2H 3H42H 5EZOL 1LK3H 5D1ZA 4JJ5B 4H8WH 1PY9A 1I9JL 2X4RA 5C09D 4X4YA 5CCKL 1FYHB 2VXSL 3KLHC 2FL5B 2R1YB 2X4SA 2FHBA 1U8HB 1SEQL 1VFAB 4NQED 4CVXA 1BJ8A 2AEPH 2SEBB 1CG9A 1C1EH 4ZSOB 5IW1B 4UT6L 3FHAA 5GHWL 3RY6A 2WSKA 3NA9H 4YQXL 4MWFA 4ZUTA 5C0FA 4U6YB 1P7KA 4NRZB 2PN5A 5IB2A 3L5XH 1TCMA 2W91A 5I17B 1I1YB 3DHMA 3SDYL 4LNRB 3BKYL 4KVNH 4ZYKA 1QFUL 1CF8L 2PYEB 1V3MA 3LN4A 4YPJA 1ZGLM 4HUMB 4DCQA 3DARA 5F7DB 4XWGL 2V2TB 2D0FA 1IAIH 3ARBC 2M2DA 4N0RA 2EO1A 4HK0A 1P7QB 4R96B 3IDNA 2AI0L 4F15C 5DMGC 2ICEB 4W81A 4MLSA 2C3XA 3BPNC 2DDQL 2DLHA 4YDVB 3B9AA 5AUMA 4R4FH 2FECI 3WXWL 1NGPL 3ARBA 2Y6SC 2HMID 1IT9L 1Z5LB 1T7XA 4LFHG 5E2TL 4IRJB 2MPAL 4J23A 1TJIH 2DQIL 5FV1L 5IB5A 2H9GB 2HLAA 2PTVA 1TJHH 2OM5A 3HE7C 1XGQB 2VERN 4JZNB 4GXVL 4LCYB 5FUOL 2J12B 3UTPE 1VPOH 3V5HB 2APBA 4D0DA 1T1XB 3CFKA 1AXSB 5AZEL 5MEPA 2P46B 5EU7E 3MUHL 5DYOB 2V2XA 3C5SA 4WRLA 3WHE0 2R56L 1Y6NR 2QKIA 4MJ5A 3C8KB 5FEBA 3JWNC 5D70L 5KTEH 1FYTA 1CTOA 1KT2B 1BQLL 4FQJL 3B2VH 5C0BE 3D39D 4KXZI 1AQDB 2YD2A 4LOUD 3MUGB 5I2IA 5D7LD 2ZWLT 3KPSB 2DQGL 4JFFD 2G60L 4G43B 5ILTH 1K8DA 3NCJL 5FYKH 4QHUB 3CU7A 2FJHB 1DEEB 3VD9A 1RUQL 5I1CH 4RISH 3VW3L 4ZUVB 5ID0A 2OLDA 2VITA 5ICXA 5DUPH 5T3XD 3FO0H 4BA8A 3OV6A 3FO1A 4PGZA 4XMPH 3S6CA 4LHUG 5L88H 4XMKH 1KC5L 1TENA 5FHAL 1J7VR 1RQ5A 2XNAB 2X4QA 4AM0B 6FABH 4NO0A 3OGCA 4XPBL 1U2CA 3JV6B 3WIFA 4KRPD 1TDQA 3M8OL 3RI5K 2A74A 2P5ED 4CUCA 1BOGA 4KHTL 4PY7B 5C08D 1VFBA 1INEL 2NYYC 4ZFGH 4M7ZC 2VR9A 4DKEL 3KJ4C 5IG7A 1OW0C 2HT4D 3MSPA 4KKNA 4HIIA 1WJ3A 4B7LA 2E8ZA 3CFEB 3GSUA 2QSVA 3SKOA 4R4NC 2VDRH 3P9LA 5HGDA 1P4BH 2NQCA 1U3JA 3FFDB 4JFZL 4TPRL 3HPJB 1MRFL 4Z7WA 5DS8A 1CD1A 1DBML 4J8RA 2H2PC 3RKPA 4PRBA 2PXYA 5CGTA 4ZSOE 2J1KA 5HPMA 3MACL 4QRTB 3N1MC 4YO0A 3NFSH 5TFSH 1EFXA 3DWTA 2HWZL 4LPTA 1WBZA 2KZ1B 3VXMA 1T04A 3Q5YA 2EO9A 5DMJB 1F11B 1OP5K 2PYEE 1SHMA 4D3CL 4FQXB 2VLLA 5KW9H 4XNXL 5CBAB 2X2YA 2EYRB 2X7LB 4PJ8C 1Q9LB 4MVBD 1Q0YL 3B3IB 4LKCA 4PGCA 1YECH 1A6UL 1MJ8L 3BAEH 4PRDB 5GGTL 3C2SA 4QHNA 1R3HB 4OFIA 5T1LA 4H88H 1C5DB 4PJ8A 3OJMB 3G5XB 1UKTA 1XEDA 4CN4A 4OTXL 4U6VH 4HV8A 1I7TB 1YMMB 4JO3L 4LDLB 2Z91B 4OF0A 2ZUSA 4JREB 2YRPA 1A2YA 3O6FD 1ZHLB 1JPTL 2OTPA 5I15L 1IKFL 4POZC 5A40E 2F53B 4MA3A 4AMKH 1CU4H 2QTEA 4EDXA 3LDBB 4ERSL 2OR8A 4LPWA 4PJ7B 4N5ED 4NO3B 4L3CB 4X98A 4XNYL 1KOAA 5IEHB 5KVGH 1G7LA 4Q9RL 1EH9A 5ERWB 3WIHH 1JTTA 1OY3B 3RWJA 3ZKQD 4PJ9D 3RFZC 4HMDA 3O3EB 5KS9B 4L9LC 4OLVL 1M05A 2HP4A 4LK4A 3KAAA 5MEND 3KPSE 1OSPH 2FWOB 1FO0L 2VSCA 5D7SL 5KVEL 1WEJL 5GS0L 5GS0C 2E7CA 3CAFA 5EO9B 3NIDF 3BYYA 1SBBA 4WW2C 4OSUH 1ACYH 3X3FL 3F7YA 3LH2L 4UT9L 3ROLB 3RWDA 2ZKHH 1MJUH 5HDLA 3A67H 5GSRA 1Q94A 3A6BL 4YC2C 1A0QL 3T2PA 4XP1H 43CAB 3PXHA 1C5CH 35C8L 1KPUA 4U3CA 1WK0A 5A2KH 1ZWIB 1JPGB 3ZL4L 1ES0A 2ERJB 1CL7H 3QISA 2Q87A 4M1DH 3O11A 4ZO6A 2N4IA 1O0VA 1OAQL 2Z92A 1J86A 3ESVF 2OXGA 3MRIB 2OK0H 4KJPD 2YD8A 3BD5A 3LB6D 5DA0B 4P2OA 2PTTA 3CUPA 4K9EL 4K9EC 1J18A 2ZZUT 4GW4B 5CP7A 1DBBL 4HC1A 4OD2B 3RNKB 5D71H 4GW5B 1XGRA 3MTRA 4OV5A 1JNHB 1F6AB 3U0TB 4M8QA 4I2XA 4OFVA 4AQOA 4ZO8A 3ARWA 3DUUA 1DFBH 3MXWH 4JLRA 5FGSA 4NZTL 2VLJD 4OFDA 1YEGH 3CNKA 4Z7WF 4DWHA 1A6AA 3RWHB 5JQ6H 3QQ9C 4PG2A 3GI8L 5D9SB 4NOBA 1ZS8B 2FO4B 1AD0B 1NEZA 1MJJB 4LVOC 1EFQA 1L6ZA 4O51A 4JHAL 4ZFFB 4C83A 2MWCA 1IEBB 5I76A 4EXKA 2NY2D 1BD2D 2G2RA 5GZOD 3CFBA 3GMMA 3VU2A 3OR7A 4NBXB 5F7MC 1F4YH 1S7QA 5BV7L 5BV7C 2Y25A 1CD9B 2UZXB 4UTBH 3FB6A 3GSOB 3RKDC 3QIWB 5J12B 5LWYL 5SX4H 5CD3A 2GJZB 2WQ8A 4Q9BA 3K81A 5HDBF 3T4YA 3CVHL 4U31A 3QG6B 3IJHB 1YEJL 1BVZA 4TNVF 3U48A 4LVNB 4WUUD 3EYQC 1M7DA 3RWEB 2LAGB 3MBEA 3VXSB 3U7WL 1G0XA 1YMME 3EOAA 3GSNH 4XAKE 1SBSH 4HX1B 1T0NB 2CLVB 4ZUWB 4Y16C 2F74A 1DJSA 4OZGA 1OAKH 3WFDL 4M1GL 3U4BH 2IBZY 4I9WD 2F53E 5HHOB 5IW6B 4KKCD 2QSCL 3MA7A 4PJ7E 4TRPH 3PIQA 3QH3A 1UA6H 4XP6H 1XF5A 3MRCB 4Y16A 4NBZB 3PP4H 2C3GA 3RJQB 3OG6B 3D18A 5J6HB 5LGHL 1FC1A 3HC3H 5IWLC 5TE7H 3C6LC 3Q2CA 3QXDB 4EBQH 1CR9H 2KBGA 3QCTL 5I1IL 2ORBL 5KS9E 1CFVH 4MAYB 4KI1A 1AY1H 1NCBL 4WO4D 3ARUA 4OLWL 4M93B 4U1NA 5CLWA 1MNUL 3VFRB 5EU7C 3WLBB 4E9LA 1FGVL 1JWMB 4RFOL 2F19H 5IB4B 3AM8C 3GUTB 5D1XA 1BFVL 1F3DJ 3UPCA 3VFOB 2NZ9D 1CFQB 3BQUD 3O2VH 4RGND 3ZTJG 3NIGF 1YNKH 3CH8A 3DETD 4LVEA 4NUGL 1JZ4A 1S5IH 1ZA6A 3QPXL 3BSZL 3QEQA 3F12B 4IOIB 4Q58C 4XNQB 2KKQA 3MBXH 3OJDA 5EH1A 5BS0A 1A8JH 3AREA 4P23C 4PRIA 2ICWI 4FRWA 4M62L 5JW4Q 1G6RL 4G8IA 5I8EB 3P30L 4ODXA 3G9AB 1KEGH 1M71B 3GSRA 4DQOL 2FR4A 2IH3B 1OLLA 4KRLB 2WIMA 2Q6WB 4P23A 4HDIB 3GGWB 5IF0B 5DJ6A 1MAML 4NM4L 3X12B 5EBGA 1ZV5A 5FOJA 1IFHH 4LU5L 2P8LA 3MROA 4MDIA 2XG5A 2PW1A 1IVLA 1DLHB 5CILL 5J13B 1YY8A 1LEIB 2WUBH 4HXBH 1OP3K 2OTUA 1L0QA 1MHPL 1A7RH 2VTFA 4NNPH 4OZ4A 5A16B 1YPZA 4S0TD 1KJVA 4Y4FC 1B4JL 1YEHL 4TOYL 4HFWA 2EKJA 3QJFA 1RY7B 2APFA 2PCPA 2NTFB 4UT7H 3KDMB 5EOCH 1NGQH 1ZHKB 4OUUA 4RMRA 1QFWI 1XR8A 3K80A 3M45A 4Y4FA 3VXTB 1PSKH 4CVZA 1NMCB 4NOFA 2NY0B 4JN2B 4XRCA 3O2DA 5IGXH 2FL5A 1FIGH 3ZYIA 2SEBA 4YXLL 3IS1X 5C7XL 1NCCH 5E9DD 1CFTB 2P47B 2VQ1B 4TULH 3ULVE 5CEXB 1S78D 5ISZB 4NRZA 4QRQB 1NDMB 5I17A 1I1YA 3VXSE 4NO2B 4QEGA 2XQYG 2EDHA 3IF1B 2BXYA 1J0KA 1JNLL 1HEZA 4K2UL 4LPYA 4R26H 4CGTA 4IRSB 1E6OH 1IKNA 5HHOE 1W0VB 4LDOB 4LKXB 3SQOL 2V2TA 1BGXH 4MA8L 4OZGF 2R69L 4IRJC 4LP5A 5FYJE 5IFHH 2DM3A 4JO4H 1GGIH 3RAJL 4NQDA 4YDVA 1JMZA 4HUKB 4HCRL 3A6CH 4QLRA 3VFWA 5I1AA 1J1PH 4L8DA 5DZOA 4KTDH 4Z6AT 2A6KB 5BVPH 4Z7VB 3RDTD 4YUEL 3R8QA 4LQFL 4LCYA 5TDNA 2ENSA 3MOQA 4LCUB 1JPST 1FNGB 1LD9A 4MHHI 1AXSA 2H1PL 3IDXL 3AS3A 3IAGC 4BK4A 4QNPE 3I3DA 4D0CA 4I0PB 4N8VG 1DTUA 3RP1A 4QXUH 2DMBA 2R1XB 1J5OH 5KZCB 3C8KA 3QDJD 4OT1L 4N0FA 2H41A 1LE5B 4PIRF 4S1SL 4HG4J 4ZUUA 3Q6GH 3HMWH 3PDGA 1OGTA 4X8JB 3MUGA 3OB0H 2DWDA 3L3GA 1Z9OA 1KIRA 5KBNC 3KPSA 3CLFH 2VO5A 5HYIA 1MHHB 4ZS6D 5I74B 4X5LA 1A6VH 3EJJX 3RU8H 2FJHA 1CIUA 1DEEA 3SE8H 2ADGB 3RTQD 3WFHA 4LSTL 5F21B 1EAPB 5C07B 1KTLA 4HJGA 1CK0H 1HK6A 1C08B 1D5MB 4JO2H 2D7PA 3G04B 2IBGA 3QPQC 4Z78B 4F7CB 5I1EH 2AK4B 3D6GA 2D03H 4EXPX 4F8QA 1KN4L 1JFQL 3MX0A 1YEKH 4MD4B 4LGSB 2OI9B 3BD3A 1NBQA 3ALWA 1MELA 3JWDL 3JWDC 4P5KA 1CGVA 4XP5L 1YPZF 3V0AC 4HEPG 2DOCA 4PY7A 4S1QL 3LQAL 3LQAC 3U30B 4JY6B 5AAWA 1QR1A 3DRQB 3PL6D 4MQ7B 4NJ9L 2JJVA 5E8OA 4CNIB 3IRPX 1S7XA 1HQRA 1ZA3A 2BSRB 4EI5C 3DBXB 3VXUD 1BOYA 2EXYD 1HILA 4M61B 3O9WA 2VE6A 1IC5H 1MCCA 4HIHA 4X6DA 4XB8A 1I8MB 3D87B 1QBAA 4ELMA 4Z8FH 2DD8L 4YDIL 1G7QA 4JDZB 2AV1B 5EBMB 3VXQA 4N9GB 4EI5A 3B5HA 1S8DB 3T8XB 4FQXC 5ISZE 1NLBH 4WFGE 3G6DH 1TJGH 4A2MA 4RA0C 3P4MA 5CZXC 2CO6B 4HIEA 3GMOA 3EKCA 4N8VB 2Y7QB 5CZVL 3MLYL 1MRDL 3ZMRA 1WFOA 1BZ7A 1F11A 1A14H 2P42B 4KROB 2H2SD 3UZEA 4DVRL 4UNUA 1NGZA 3ARYA 4O9HH 2WWKO 5ID1B 3V6OE 3I50H 4FQXA 4JKPH 2BRRL 3UTTD 4U1HB 2CDGB 3UO1H 4KK9C 5IMKA 1TTUA 4Z7QE 1IGCL 3VGGA 2HT3C 1PVHA 5E6ID 1U8OA 3B3IA 1A3LL 1S7UA 3D85D 2YD9A 4NNXB 3OKDA 1Q9KA 4PJEA 2J7LA 4CDHA 3DOSA 4M4RA 2Q8AH 1UG9A 2X89A 4JREC 1LP9B 1UB5B 3O4LB 3VA6A 3NFNB 2EYSB 3HNSH 3LDBC 4Z7VE 3EHBC 1DQQA 4LLQB 4N8PA 1D9KD 3LRSB 4S1RH 1JRHI 1T5XA 3NTCL 1LMKA 3BIAX 3ARDD 1ZHLA 1QHPA 2G75A 3HCVB 3QHFL 4I18A 3UBXA 4BKLA 3QUKA 1HKFA 3CVIL 3TN0A 4MSWB 4TUOB 4HKZA 1WFNA 4L3CA 5IEHA 3G6JB 2YPVL 1JHLH 2XWJB 3HRZB 1AI1L 1TZGH 1ZVSB 2LVCA 5F7WC 3HPLA 1C16B 2NW2A 3I6KB 3G5YB 5KS9A 5FK9A 1Y18A 2PYFB 3EYVB 1AP2B 1RU9L 1JCKA 4ODHH 4YXKH 5GZND 2MCPH 2P48B 2CLRA 4QT5B 1DL7L 4PJ5B 3JSSA 4LQ1A 4D9QE 2XQBH 2BNRB 4FA8A 1P7HL 4V1DB 3ULUC 3ULUL 1E4XH 1LO3H 4QYOB 3SY0A 3BZFA 4JPWL 3HZYA 2ERJC 5C07E 5INDA 1AD9B 5KSAA 1WISA 5E1AB 2EDNA 4WI2A 2CRIA 3MO1A 3BKJH 4KZEL 2AK4E 2VL5A 3BHBB 3O6LH 3DVNA 3RZCD 4UDUA 3WKML 3I75B 4FXKB 4Q9QH 2UWEB 1JTPA 3CMOL 5D72H 2CIIB 5LG1A 3CH1A 5EULV 2WQRA 1MREL 5L6YL 1ZT7A 4WCYH 1YJDL 1YJDC 4ZDHB 4AEHH 5F9AC 3DURB 4F33A 1QBLH 4PJBA 1KCRH 3OKEB 3W39A 1X4XA 4KU1A 5IFAL 5SWZB 4ELKA 3RNKA 2VC2H 3F65A 1D5IL 4I5BB 3C2AH 3BEVA 4QRSB 4J6RL 4F7PA 1S7VB 3U0TA 1WLHA 4YFLF 2VH5L 3WL9A 4R0LA 1WGOA 4PV8A 3BMVA 2AABH 5TGBB 4X6DF 4GG6B 5F6HJ 3RWHA 4ELMF 1H3VA 5KVFH 3FOMB 2AS5M 3QJHA 4GRMB 4R9HA 3TA3B 1LO4H 3RX7A 4WWKB 3T65A 3VXNA 1RJYB 5DVNA 4NCC1 1QG3A 3RGVD 4XXCA 2XICA 3J8F7 2VDMH 1S3KL 3QIWC 4PY8I 5J12C 2FB4H 4IOFC 1X5XA 4BZ2H 4HT1L 3HFMH 2Q8BH 1JZ7A 1I1AB 3L95A 3ARGA 3DTXA 4UIKL 3ULVL 2LU3A 4LVNC 3ULVC 1A4JB 1YQ2A 1R3LA 1WBYB 1FH5L 4DGIH 1EV2E 3SKMA 1HSBA 3X3GL 3QIWA 5DTFB 2E27L 3BXNA 5B38G 2NCMA 3SCMC 3QG6A 4G9FB 5JNYB 1LP9E 3IFOA 3O4LE 2VXVH 1P5VA 4PJEF 1S9VA 1VFMA 3VFTB 4ACPA 3TVMB 1UXWA 3FQWB 4HPYL 3GK8L 3GMQA 4AIZB 5FYJL 2V5RA 4B7IA 3GBNH 3ULSB 1PG7H 2JJTA 4ZUWA 1QLFB 4ZD3L 1HHKB 1VACB 3SCMA 3KLHD 1EGJA 1FNHA 4G7VH 1ZSDB 1IQWH 1GZPB 1N3NB 3OB0K 2Q7NA 4FG6C 5HHOA 5IW6A 5K9KB 4XCNB 4X7FC 1JN6A 3GMPB 4IS6A 4KKLC 5F96L 1H9VA 4M93C 3MA9L 1QQDB 3G6JE 5A3IC 3HC0A 4NN7B 4PGEB 4KWUA 4OKVB 1MIML 1RPQA 1EZVX 5JPMB 5TDPB 3INUH 3MRRA 2R9HC 3BVNA 3VG9B 1FFRA 3M17B 5F9WB 3BH8A 2JKXA 1G0DA 2I9TA 2P5WB 2Q7YA 5EOTB 1T2QL 3SGEH 4Y2DB 4LARL 1U8MB 5T3ZD 5KS9F 3PHQB 4PJ5E 4ZMAT 2BNRE 3K8KA 1JK8B 4U0RB 3G5VA 5DMGD 2HAZA 3FRPA 4OGAD 4V1DE 4YJZL 1UXSB 3GUTA 4BZ1H 1DN0A 1CXIA 3L9RA 4AL8H 4MGXA 4OGZA 3B43A 4PJDA 1CFQA 2DLFL 2EZ0C 3IDMB 2Y6SD 3MV7D 4PGDA 1FP5A 4HIJA 3JBG7 2DQUL 1NANH 2R0WH 5E99L 2VAAB 4PJAB 4IOIA 1S9XB 5CUSH 5J1SC 4ZNEA 3HE7D 2Y07L 5T1MB 2UWEE 2B2XL 2BVEA 4XC3H 1IGFH 3ULUF 5SWSD 1OB1B 4W4NA 1QD0A 3FN0H 2J6EL 4AYFA 1MPAL 4MB4A 1KTDA 4KAQL 1M71A 4NCC2 4U3XA 4OLZH 2IH3A 3RWGB 5J13C 4UB0L 5K9JH 5SWZE 2XZQH 2Q6WA 1KFAH 1OGAD 2HKHH 4OCSH 4PB0L 5B38B 4HDIA 5IF0A 3OX8A 1EXUA 1JL8A 3H9SB 3O81A 4PJBF 1JMXA 4BFGA 3BP4A 2FJGA 4Q2ZA 3K4AA 2HRPL 2J6EA 4Y19B 5DEZA 3TH3T 1A7QL 3LHPH 4XCCH 1HIMH 4IHOA 5FYKE 3SDDC 1YUHA 1GHFL 4GG6E 4RMVA 3VFVA 3RIFF 1FL3B 5C6TH 4CJ0A 1OF2A 4WGWB 1NMCC 3M1BB 3DHJA 2NY0C 5I71B 1L7IL 1GYAA 4Z95H 1CVSC 3CK0H 4KQ4L 5IROC 3SDDA 4EOWH 3CSGA 3H9ZA 1A1NA 4I4WB 3HNTL 5F7FA 3FOLA 1RULL 3IXAB 1I85A 1AXTH 2JJUA 4LF3B 3TF7C 4LEOB 1JZ3A 5BQ7B 2J8HA 4YHIB 4OFYD 3HS0B 3V52L 5IROA 4M7LL 3IAPA 5M7QA 1CS6A 4H25B 3UJJH 4XCEA 1FSKB 1FGNL 1RZIB 3N1FC 5HI4C 1JGLH 2XN9A 3BWUC 1YQVL 4G9FE 2Y36H 1N0XH 1QR4A 2VQ1A 4IRSC 2NYYD 4PBVC 1E4WH 5LCVL 5ISZA 4TQEH 5L2KD 3MLZH 1MAJA 4NO2A 3VMNA 4HGWA 3FFCD 1PYWB 4KJWC 1EFXD 3IF1A 4JPIB 3DYOA 3VGEA 5EPMB 4LCCB 5ESQB 3OXSB 3GHEL 1NC2A 4DKAA 2YOCA 4NO5B 1ETZB 2XIDA 2H2PD 3LIZH 1QUNA 4K3DH 2VXTL 3AGVA 3ZZ1A 2NW3A 1FORL 3RL2B 1OHQA 4GOSA 3S4SA 4L4VD 3QCVH 5LQBL 5BMFL 4OD3L 3SE9L 1QSFD 5GJSH 4OZIB 2DLIA 1SVCP 4K55A 4XZUA 1EEQA 4GG8B 2P5WE 4TTGA 2XYCA 1VEOA 1GGCH 1BP3B 3DVGA 4I0PC 1OAUH 5T1LD 1OARL 3JV4B 4KI5E 3FQRB 3QFDA 2JELH 1YY9C 1SEBB 1P1ZB 3F58L 3D0LA 4P4KA 3CXHK 1RIUL 3MRPA 3IDIA 3GSNB 4OFKA 4N1CA 2IWGA 4EEEA 1TZIB 2R1XA 4PJDF 4PJAE 3S35X 2KDGA 2YXFA 1KLGB 2EC9U 1NFIB 5I74C 2FDBP 5IHLB 4D9LH 3EO1A 1MI5B 5F3BA 1FNSL 2ZCHL 5LVEA 4X8JA 4POZD 2IGFH 1QNZH 2ICCA 5F70A 3STLA 5ALCL 4Y5VB 2R0ZL 1BREA 3I6LD 5E8EA 3F5WB 1CQKA 5KG9B 1FLRL 3H9SE 4IIQB 3BKML 5EZJB 2OBGA 1J0JA 1JI2A 2YD4A 5I66B 2OI9C 3BKCH 4QRRA 3WSQH 5BJTB 3H9HA 4XP9L 1U3ZA 3IB4A 1LNUA 4Y19E 3B5GA 5D8JH 4X5XB 4XAWL 3BT2L 3BWAB 3D9AL 4PRPA 3UTQB 3U30C 1JYWA 3I2CL 2KPNA 4XXDA 1HDMA 2D31B 2DBLH 2IMMA 3MOAL 3K0WA 4PJHB 3PDOA 1J0YA 1Q0XH 1KCKA 5GS0D 5J9PA 2V5MA 5EB9A 1BQHG 4HWBA 4M02A 5F8RC 2CRZA 4ZPTA 3MREA 4IMLA 5T33L 3VI4E 4XC1L 3AU1B 5I8CB 4QXTB 4NHCL 4GRLB 4RWYH 3N9GL 2FRGP 4KJYB 3FB8B 4I3SH 3FMGL 43C9A 1E27A 2FHCA 2WMPA 4U6XA 1T21B 2XKNA 1YEDB 2BVOA 3BN9C 5E5RB 3QIUA 5TH2B 5IR1A 3QDGB 2A6IA 1PY4A 3KPRA 3IVKA 2R0LL 5FKAA 5H2BB 2OXHA 4XNZC 1YMHB 4KROC 3BPCB 1CZ8L 2X1OA 4GAJL 3KLSA 3P4NB 3QDMA 5EU4B 3DX9B 5CJXC 3VDAA 3WIIH 2EDDA 3EBAA 4S11A 1NDGB 4R7NA 1MCKA 4AG4L 2C7UA 3Q1SH 2FIRT 1CGSL 4HBCL 1AGDB 2Y7QA 4PJCB 1Y6MR 2ZCKH 1WBXA 1K2DB 1KPRB 3OL2A 5F1NA 2FLRT 5JORB 3H42L 2YPLA 1LK3L 3NPZB 5CJXA 5ID1A 3OKMB 4X6CB 4H8WL 4H8WC 1JWUB 2CDGA 4U1HA 4JDTL 3GMNB 3MRLB 1IGMH 5EO0A 1B4RA 4ENEC 3TEUA 4YK4B 5F97E 5IBUG 3ZKSD 4F9LC 4RGMC 5K9QG 4PGBB 2PETA 4Z7QF 2AEPL 3FONB 5DHXB 1C1EL 4OZIE 5JLZB 3NA9L 1QRKA 2CXKA 4G6AC 2V2WA 2X42A 1RJZA 3WEXA 1XCQB 3L5XL 1GIGH 3PGCB 4KVNL 1IRAY 1X44A 1NMBH 4MNHA 1C12B 5ECJE 3RI5F 3RKDD 1RZ7H 5SWQA 3HCVA 4GRWH 4HLJA 2RFXB 4P49A 1IAIL 3G6AA 4YHPA 4ISVB 2BSED 4MSWA 3SJVB 1DBAH 4MA7H 1FQ9C 4TUOA 5DDHA 3TNNB 3KXFD 4N0YH 1BQHB 1J05A 2YN5A 4G6JH 1NL0H 1DCLA 4NQCB 4R4FL 2ARJB 4XNMB 1A4KB 1MI5E 4DGVH 1CDBA 4Y4HB 2A9MH 4P3CH 3D25A 1TJIL 5F9JA 1EEYB 1JV5B 3VWKA 1YNLL 1TJHL 3V79C 2H8PB 3P40A 2HFEB 1VPOL 1FRGH 3UYRH 1I7UA 4V1DA 3MR9B 3C6LD 2APVA 3ZSTA 3NCBB 4X7TA 4YDLB 3UTPD 1AD9A 3I02B 3QEUB 4OV6F 2D7NA 3K3QA 4U49A 4G80A 5E1AA 1EHAA 4KKBC 2PW2A 1HXMB 1TMCB 1B2WH 3BHBA 5KTEL 2XRAH 4JGMA 1FNEA 1X7QB 5DRNB 2EDWA 3B2VL 5EC1A 5GRXG 4PJHE 4QHMB 1FVDB 3DUSB 3HR6A 4EI6A 4Y8AA 2R29H 4KGLA 3UTZA 2B4CH 3ZE2F 1AFVH 4ZDHA 3MRBB 5CSBA 5DD1H 5IBUB 5C0BD 1IAIM 5ILTL 2IMNA 1CFNB 5FYKL 3CPLB 3D3VB 3VFNB 3KPLA 2GY7B 3WE6B 4I5BA 5I1CL 3VFMA 4QRSA 1MCLA 3T77A 1XAUA 5DUPL 3FO0L 4P23D 3BPLB 4PRAA 4J12A 4WWKC 4XMPL 1T2JA 5CP3H 1R5VB 5FA4B 5L88L 3QDGE 5ELIA 3VXRA 3G5ZA 3S96A 1T1WB 3MRGA 2EEBA 5IHZB 5L2JB 4GG6A 3MRFA 4WHYH 6FABL 1UM5H 3CZFA 1SYVB 1DUZB 1JZ5A 1MCOH 4XVTH 3EYSH 3CSYB 1I1AC 3DPBA 1RJYA 3OKNA 4RRPG 3KPNB 4RZCB 4PJCE 4MAUH 4QWWC 3DGCR 3OKOA 4ZFGL 4W4OA 1DDHA 3Q6FB 3C8HA 1T1ZB 4X6CE 1TETH 2X4NA 2I27N 1U8IB 4WHCA 1CFSB 4Y7MA 2VDRL 3TO4C 1P4BL 5IM7A 1QRNA 5GGVH 2MQ0A 5D93B 3V4UH 5K59F 1S5HB 2IF7A 4JRXB 3PQYD 1YC8A 4XPGH 1KIPA 4RNRA 5DR5H 3NFSL 5TFSL 3UC0H 3TO4A 4MA1B 3VFTA 3TO2B 3V0WH 1I7ZA 3QUYB 4RX4A 1YEIH 5GRZA 5KOMC 4WI5A 3N85H 5F89A 5IMLB 2CD0A 4NN7C 3ULSA 2PUQT 1X5YA 3QT2A 2W60B 3CSPA 4MS8C 4P46B 4F7EB 2HJKA 4KTEH 5KW9L 2BVQB 3VG9C 2PYED 3GMPA 3IJYB 3SJVE 3WD5H 2VLRB 5C8JA 2ESVB 2OJZH 3IDGB 2A2QT 1G9EA 2OCFD 5I75C 3BAEL 1VDGA 2YD6A 1P7QD 1Z9SA 5JPMA 4U0RC 3GSQA 2Z31A 4NQCE 1BLNB 3T0EA 4KI5C 2X4TA 4PB9H 4LCWA 5EO1A 2UUDK 4H88L 2ED9A 3ET9F 2W65A 2ADFH 2X9YA 5EOTA 3AVEA 4U6VL 2PO6B 2GK2A 1RJCA 1U8MA 1B90A 3X11A 4HUWA 2ZUWA 4IRJD 2VMFA 1UH3A 1QZ1A 1CGUA 2IPUK 4NPYA 1MWAH 4GBXC 3DROB 5JA8B 1CU4L 1ZKAA 4M43L 4I13B 3IDMA 4MJ6B 2NLJB 5KVGL 5CJ8A 3V7MA 1FZJA 1K4DB 3IDJB 3WIHL 4QRUA 2WP3O 1HINH 1NAMH 4NWTH 1BIHA 4GBXA 4RAVB 2HN7B 4LLYB 2HVKA 2N7BA 4J1UA 5EU3A 4NUJB 5I1LA 5DHVH 3HG1B 5DJ2A 1MLBB 4HQQH 3WIHA 3BE1H 1OSPL 1QPPA 4IRZH 3U36A 5IUSA 1VB9A 2DICA 3RA7H 5SX5K 3D3VE 2ADJB 2YD5A 1KJMB 1P9MA 3RVUC 4HWNA 5CD5C 4OSUL 2V7NA 4OLUH 1E28B 4M6NH 2V17H 2A73B 1JZ2A 2ZKHL 1MJUL 5I71C 3ZDXF 4ETQA 1AJ7H 4CU8A 5I1DB 2P8MB 4XP1L 2XY2A 1C5CL 1ODAA 1L0XA 1NPUA 4MXQC 1IE5A 2VL4A 2WINB 4OI8A 1CL7L 1KB9K 2JJWA 2WIIA 4M1DL 3VH8G 2NX5B 4GG6F 3P4OA 3GB7B 4NSKA 1DANU 5IB1B 2OK0L 4MXVE 2AJXH 3ZT7A 5HGGS 1FSKC 4PP1C 1BM3H 5D71L 3KHOA 3QPQD 2R1WB 4LLMA 3EOTH 4LF3A 5C0JA 1IGIH 1JNJA 2Y72A 3OHXA 2ED8A 5D6DC 3REVB 1DFBL 2R2HA 3MXWL 4KXZH 3QIBB 4H25A 5DFVC 5EU6B 3DX7A 5JQHC 5ENWB 1G1YA 4JRXE 3G08A 1T7VA 4OCMC 1YEGL 4IMKA 5F7UA 4MZ2A 1T5WB 2EECA 1BQUA 1A21A 4LCCC 5JQ6L 1MH5B 5F3HA 1WCBB 3LEYH 3GMLB 1JNNH 5F1OB 3ZHLA 1ZMYA 3CXDH 2BFVH 1PYWA 4EZMA 3BP5B 4JCMA 3O45A 2Y5TA 3QAZB 5EPMA 3OXSA 4Y1AB 2Y5EA 3S36X 2HYMA 1FZMB 4NO5A 1F4YL 2OS7A 5F9OH 3QUMA 3O3DB 5I1HH 2BOCB 1ERNA 2VLRE 1QKZH 4UTBL 2ESVE 5ICZB 4FQXD 5IOPA 5LAXA 4D8PB 1I1CA 5HI3D 1UACH 3CX2A 5CZXD 4MX7A 3SKNB 5JXEC 2Z35A 2C5DC 1L9NA 1NJ9A 2DJSA 1KTRL 1JGDB 2ZPKH 3MLXL 4CADB 4N9OB 3MZGB 4KH2A 3VFPB 5MHSE 4JKWA 4PPTA 3GSNL 3JTSA 1KB5H 1P4LA 4KK9D 1SBSL 3Q5OA 1R3JB 1K3ZA 1A5FH 3ZHKA 2HT3D 1M4KA 4FQIH 4J7RA 1BWWA 4PJGB 5BZDB 3U4BL 1YMMD 4XAKD 3NN8B 3O41B 4G8GB 4HMEA 2XA8H 2YA0A 4JZJA 3RWCB 4KI5F 4S0SD 4E42B 2YA2A 1PGRB 4TRPL 1UA6L 1R5WA 3GSNA 4XP6L 3VH8B 3PF2A 3WHXB 2C3VB 4L3EA 3HRPA 2XG4A 2YZ8A 2VZ1A 3B8YA 3QULA 5HYJB 2F53D 3PP4L 1TZIA 4Y5VC 3HC3L 5TE7L 1HOCB 2I60H 3BZ4B 3EHBD 1BVLA 4MDJA 1CR9L 4EBQL 4Z7UB 2GIYA 1CFVL 3TJEH 1AY1L 1A9BA 5GGSB 4IIQC 4BJLA 3VRLE 3HG1E 4ZQKA 5IMMB 2DQFA 3TBYB 3U46A 4OUOA 3QNZB 3U7YH 4LSUH 2F5AH 4QOKD 3VFUB 2F19L 5SV3A 2GSGA 1BAFH 3H0TB 3B4NA 1TVHB 3UPRA 1FL6B 3JUYA 4WV1B 3B9DA 5FF6B 2G5BB 3EGSB 4CMMB 1WITA 4UDTB 3O2VL 1XGTA 3O8XB 3M07A 3CZJA 4P0DA 1E6JH 2D7QA 1QVOB 4F37K 1MEXH 5D2NB 3LKPA 1S5IL 4G8EA 5C0DA 3UTQA 3MGOB 5CMAB 3MBXL 2D31A 4HWUA 4GRLC 1WZMA 2Q86B 2NX5E 4PJHA 3FRUB 5E5UB 1VENA 3CFJA 3EZJB 1L4IA 1K5NA 1KEGL 3V0VB 2GJ6B 1TLKA 2EH7H 4LLWA 3S8WA 2QSTA 2X4UB 4QXTA 4GRLA 1D6EB 3V5KA 4FQQA 1S7WB 2EDQA 4XHJC 4KJYA 2HG5A 3VWJB 1IFHL 3F7PC 1MCPH 4H26A 4WW1A 1HHGA 3L7FB 3QEHB 3BGMB 5C0CB 4IDLA 5EU6E 4LSQH 2VOTA 3S37X 5TH2A 4OB5H 2WUBL 3QDGA 4HXBL 4PRHB 4WO4B 3ZDZE 4JDVB 4C56A 1A7RL 4OCXH 4NNPL 5EUOA 3LY6A 4I48A 4AENA 5DLMH 1A7BA 3P4NA 3MV8A 2ZSVB 3THMH 4Q0XH 4TSAH 1NDGA 4YFLI 4NKIH 4UT7L 5JHDA 2Q76A 4YK4C 2X4OA 5EOCL 1NGQL 2K3TA 1CYGA 1NGXA 2WNGA 2XV6B 5JDSA 4Y1AE 3W5MA 5HHQB 5DMYA 1PSKL 4LRIA 1I4FB 3U0PA 5IQ7H 5DJCA 1YYLH 3LKOA 3MV9B 3QUZC 4L4TA 4XH2A 1ZLSH 1VERA 1NFDA 4CL7A 3VXPB 3FQXB 4FHBD 1FIGL 3BGFB 3OF6D 3TFKC 2EEAA 5JW5A 1ZTXL 1DUYB 1X5JA 4FTVB 1NCCL 4KV5E 5C9JB 3QUZA 4TULL 3KLDA 3QI9A 5TE4H 3QIWD 2OZ4A 1MFAH 4IOFD 5KSUA 3EO9H 1T1YA 3DV4B 5C0EA 3HE6A 3MUJA 3I6GB 2YKLH 4C58B 1D5XB 4JR9H 4GFTB 4PRNB 3PGCA 3ULVD 3O3AB 4H0IA 4PJGE 4X5WA 4R26L 1E6OL 3VXSD 1UVQB 1W8NA 3MOBH 4EKXA 4NRYB 4G8GE 4LAJH 1BGXL 4LHQB 1HHIB 4Y4HC 2FGWH 2AEIT 5IFHL 1UQSA 5IMOA 4MNQB 3ZSSA 4JO4L 5HYJE 5HHOD 1GGIL 5E1HB 1BZ9A 5HHMB 4CKVX 5IT2H 5F7NC 3HI5H 3UDWA 1OSZA 1GRWA 3AB0B 4Z7UE 3PWVA 5FYJD 4U1SA 4FOMA 3A6CL 1N8ZA 1J1PL 2X4PA 4JANA 2YPKA 4AEEA 3OXRA 3NGBB 4KTDL 1JV5A 4YDLC 5BVPL 2QBWA 4FG6D 5DRZB 3REWB 3GI9H 3UYOD 5BZWB 5MEOB 4MAYD 4Q74A 4J3OC 1FCGA 5A3ID 3PWLB 5C09A 1U91A 4WFFE 3HHRB 4UAOB 4HKBB 3E3QE 4NQEA 4I0KA 2O93L 1TQBB 2EH8H 4AH2A 5K9OB 2R9HD 1ZEAH 3E1F1 2XI9A 4YHKH 5D2NE 3DXAD 4QXUL 1J5OL 5F7EL 4XBPB 1HXMA 3OGOE 3VJ6B 4NKDA 4HH9B 5GGUB 1Q9WB 1BX2B 1AKJD 5B8CB 3Q6GL 3HMWL 4NDMB 4J3TA 1FVDA 2YXMA 3DUSA 2NR6D 4LMQE 5KVDH 3RVVC 1KPVB 5KSVA 1U8KB 3BPLC 3CLFL 4PJHF 3KYNB 2GJ6E 2VUYA 5KANI 3SGJC 3H2WA 4EJ1C 2VDPH 1A6VL 5F1IA 1JGVH 5DC9B 3D3VA 1T80A 1AGCB 3L7EA 3H8NA 5J1TC 5DWUH 4RSVA 2OP4H 3SE8L 1N4XH 1PG7W 2I24N 1AGEB 4XPAH 5C0CE 1CK0L 1BJMA 1P84K 4JO2L 3NZHH 4PRHE 5TF1H 3U1SH 2CLZA 5I1EL 3VGDA 1TTGA 1SY6H 2PNDA 2D03L 5JW4M 1YEKL 2P8PB 2UVFA 3RDTB 3ISWA 1SYVA 1DUZA 2FIKA 3GSWA 1S7TA 2C1PB 5EUOF 4JQIH 3L3DA 4MJIB 5D7IA 2FO1A 1W2KT 2LTQB 5T5NG 2LE9A 3ZYZA 5D6CB 4L4JA 5D93C 3T1WA 1FFOA 2EIEA 1DQJB 2XTJB 5F88A 4YDJB 1CQYA 4LOUC 3MJ9A 3MV9E 5GRUH 2YRLA 4U1JA 4BQ6A 2D9CA 1U8IA 2DKSA 4G8FB 1YDPA 1IC5L 2KUTA 2IQAA 1GZQB 4YAQB 3QUYC 3N50A 4Z8FL 3SE3A 3W11D 5DRWA 2NY0D 3D39A 1ZHBB 3I9GH 2C4FT 2BHYA 1NFDF 4FTVE 2MCG1 5C86A 2PF6A 1FNFA 4P46C 5D7LA 4YGVA 4DKFH 4JFYB 2JJSC 4BFIB 4CU7A 3G6DL 1MCNA 4J3UA 1TJGL 4RFNB 3W9EA 5JW4N 4N0CD 4S10A 1QEWA 3ESUF 3GFUA 2EDFA 3MMEA 5IMLA 5ISZD 1A14L 4WFGD 5DJAB 4P46A 3GMRB 4F7EA 4TVPH 4O9HL 5BO1H 1OVZA 3I50L 5ACZA 1U9KA 4JKPL 3CXHJ 5J4MA 5LXGL 2YSSB 4BSWB 3UO1L 5HI4D 3FO9B 1RD6A 1PZ5A 8FABA 2VLRA 4IRSD 1HH9A 4MNQE 3S3SA 1E0OB 2PO6C 5H8DA 1OAZH 5HHME 1PDKA 4J3SA 4RWHA 1BLNA 1I8LC 1WQVT 4KJWD 2P5EA 1XGPA 2Q8AL 5MI0B 4BYHA 5C08A 4UQ3B 3TBWA 3MRDB 1OWWA 3RWIB 3CDCA 3HNSL 3GRWL 1FHGA 4S1RL 4PS4H 1DEDA 1I8LA 3V6BR 3B9KB 2IADB 3OMZA 4K71B 4UOW1 4Z76A 4X4ME 4BH8A 5DQ9B 1U36A 4HZLA 2DQDH 1MHCB 3K4DA 3TC9A 3C5ZB 4M6MH 5EG6C 2Q3ZA 1CDCA 3GJEA 4X0KB 3GRWA 4XGZA 2GTZB 4MJ6A 1K4DA 3MUY1 3IDJA 4WHYG 1JHLL 1EAJA 4ZPVB 1TZGL 4GRWB 7FABL 2PKDA 5HGBA 4I0PD 1WCQA 3ECBA 1FAIH 3QWQB 4D0BB 1AQKH 3BDXA 5KZCD 1YY9D 2XY1A 5ETUB 4YXKL 1MLBA 1QLRA 2MCPL 3BIKA 4EN3B 1XF2B 1T89C 2XQBL 4NNYB 1W8OA 5ANMB 1W0WA 1OT2A 3KS0H 1E4XL 1LO3L 3TESA 1KJMA 5F6IB 1SJXA 3BP7A 3H3BC 4D9QD 3C5JB 1ZT1A 2P24A 4HGMA 3K46A 1U8NB 1IGYA 4P3WA 1LEGB 3BKJL 3MRMA 3GO1H 5F6HI 1H3GA 5C07D 3VCLA 3O6LL 1EHNA 2DYPB 4LIQH 5FAAA 4NQXA 1MFDH 4Q9QL 1ORQB 4NHUA 5D72L 3FB5A 1B9ZA 1BIIA 3D0VA 1FFNB 4PG9B 2IEPA 4ZFZB 4MJIE 1LHZA 2AK4D 5E70A 4WCYL 4UBDC 4AEHL 3O6FA 4P5TB 4X6BB 3ZKNC 4EVNA 3QIBC 1AGFB 1QBLL 1KCRL 5D7IF 2XTJE 2CUMA 1GAFH 2VC2L 3JTTB 3PABB 4OQTA 3C2AL 1F4XH 3AXLA 4HF5H 1HKLH 4NJAH 4QF1B 4YHZH 5DEGB 2XWBB 4FABH 3LN9A 3REVA 3RQ3A 1BVKA 3QIBA 3O6MH 3KYOB 2FLBT 4PJ9A 2FJFB 2AABL 4EQ3A 1F00I 3KGRA 4GSDH 1EK3A 2BNQB 3QAZC 1FE8H 5KVFL 5MENA 4PR5B 3TNMB 5IB3B 1GXEA 1LO4L 4JQXC 3EDKA 1ROWA 3TPUA 2X44D 1QOKA 4NQUA 2VDML 4GKSA 5EBWB 3V95A 5EZLA 2FB4L 5FUCE 1MLCA 3BN9D 4BZ2L 2Q8BL 3HFML 1UJ3C 4JQXA 3QZWA 5HYSG 3O3DA 4KROD 5I19H 3PHOB 4DGIL 1KIQB 2MFNA 4JFEB 4L8SC 3K8MA 1U8JB 3CFIC 2K7QA 1JWSB 3FQUB 1UJ3A 3UP1A 1JGDA 4POUB 2VXVL 4CADA 3RL1A 4DZBA 3D2UB 5GS2D 2A83B 4WU7B 5HYEA 1A6WL 3LOWA 4L8SA 5CHNA 1EJ6A 3GBNL 4K94H 3O4LD 1PG7L 5J6GA 1BFOB 4PJGA 1G7JA 4G7VL 1IQWL 1XF4B 1T7YA 4GO6B 4NKMA 3MYJB 5E2JA 1JZ6A 3TWCH 1VCAA 2VLJA 1EVUA 4E42A 5IVZA 4UINH 4G6AD 1HH6B 3KPMB 1KLUB 2OTWB 5LBSH 2ZG1A 3CU1A 2FH8A 3CMGA 2F54B 3ILQC 4PJIA 4K7PX 4GRWE 2NPLX 4LDEB 2DIAA 3INUL 1B0RB 4PJFA 1IZJA 4WV1C 1N5AA 2FD6H 2YEZA 4NQSB 4PLJC 3DIFB 3E3QC 4K07A 4S2SB 3WNNA 3SDXB 1BD2A 4HHAA 3O8XC 2XZZA 3P0GB 3RIAK 5ANME 3TZVB 5D2NC 3W82A 5F71A 1EMTH 2GITB 1FL6A 3O3UN 2BDNH 3IYLW 4M03A 4WV1A 4BZ1L 5AG8A 4Y0GA 5EN2A 3MNVB 3BH9B 4AL8L 4PJ5D 3VGAB 5JOFB 5D2LA 3DO3A 4CMMA 2BNRD 1JPFA 2HTLC 2I07B 1NCWH 1ONQB 2VSDA 4QHKJ 4V1DD 4DOHB 3WN5B 3EO0A 2ITDA 4OCLC 2R0WL 3CCHA 3MGOA 4HFUH 4WUUA 2GK0B 2AJ3B 1CTNA 1MWAB 1RJLA 3DGGB 5CUSL 5L8KB 4YDKH 3CC5A 4UQ2A 3HC4H 1I9IH 1JRHH 5C0GA 1H15A 4XC3L 1IGFL 3GIZH 1MFBH 3FRUA 3VWJC 2PR4H 1A1OB 5E94A 3FN0L 1T22B 4BH7A 1EO8H 1WTLA 4KTYA 4OLZL 1NAMB 3SBWC 1LEKB 4LASH 5CKAA 5K9JL 4WO4C 4AIXA 2XZQL 2HKHL 1D6EA 4KKBD 4OCSL 3FJTA 1UCTA 4Z77A 2HFFB 3DYPA 3HMXH 4UILH 4OBRA 4XCFH 1KBGH 2BC4A 5DHVB 2LAAA 4OGYH 2MHAA 3VWJA 3H7BA 5SWZD 1OOAA 3SBWA 4XCCL 1HIML 5IVOA 4WO4A 2VABA 4DEPB 4YR6B 4O4YH 2BNQE 2IQ9H 5CS7A 3ROOB 5C6TL 1DBKH 2I9LB 1T83C 1MSPA 2ZSVA 5B3NA 5IVNA 5JPNA 2CR3A 3ZT6A 4K7FB 4Z95L 4JFQB 3CK0L 4EOWL 1FCCA 1D5BA 3TA3D 1WFUA 4U05A 4ESKA 3GJFH 4WWKD 3BGFC 1J9CT 3BQUA 5J57B 5GSVB 1CXLA 1WC7B 3ZE1E 1AXTL 3L6FB 2P7TA 1DVFB 1NAKH 4Y5YB 4NN6B 4JFEE 3UJJL 3VXPA 1I1AD 3FQXA 4NT6A 4U1KA 4QRPB 3B8SA 3U0WH 4JO1H 1J88A 1JGLL 5FO9B 1DUYA 2GSIA 2I5YH 5C9KA 1MCHA 1N0XL 4QWWD 4OBSA 2B8OT 4FQLH 1E4WL 4TQEL 2EIZB 1KNOB 3MLZL 3N0PB 4HUUA 3WUWG 4A6YH 4G9FD 1HHHB 5E8NB 3G9VA 3UYPA 2BXZA 4OZFG 3BOVA 4LSVH 3GKWH 3TVMD 5J3HC 1UVQA 3V9FA 4CN1A 5HGAA 2ZUVA 3AB0C 4QO1A 4YZFE 3LIZL 3KG5A 4K3DL 2Z9TA 4PJGF 3FTGA 2YD7A 4MNQA 3NGBC 2AXGB 2F54E 3QCVL 1DQLL 3TBSA 5GJSL 1J11A 2A6DB 1YN7B 4UAOC 4PJIF 2AGJH 3LV3B 3IFPB 4MS8D 2ZNWA 3SDXE 1CN4A 4PJFF 1KELH 1TQBC 3DRTA 1Y0LB 4N0UA 4ODUA 5DRZA 4QHLA 1GGCL 2VDLH 1OAUL 1EJOH 1F3JB 2Z8VC 4W6WB 2VYRE 2P5WD 4HKJB 1TFHA 4PV9A 3U79A 3BRGC 3PWLA 4X4XA 4Y2DD 5C3TA 5CLTA 4H1LA 1LO5B 5B8CC 3SDCB 5EUKB 3LEXB 4KI5D 5H37H 1KB5B 4DOHE 1IAII 5FA3A 4JVWA 4WJ5A 3BD4A 5D2LF 5E9DA 2ATPB 1A7NH 2AW2A 4XBPA 1CICB 5DK2B 4HH9A 1KB9J 5TF0A 4ZAKB 4D9LL 3RNQB 4WY7H 5B8CA 4NDMA 2J8UB 4P57A 1LVEA 1CWVA 3T0VA 1S7RA 2IGFL 1QNZL 5E8DH 5DD3H 2VXUH 1QSZA 2G9HB 1AHWB 3KYNA 4LHJB 3RWFB 4BSJA 4PLNC 2WV3A 1AGCA 1HXYB 3F7RA 2H3NB 2FSEA 1T0MB 4N8CH 3BKCL 4H0HB 3RDTC 1AGEA 1J12A 3WSQL 4FNLH 5D8JL 3QUXB 5GRJH 3WUWB 3EOBA 4JZOB 2LTQC 3H9SD 3P77A 3OKKB 1ZOXA 4JFPA 3SO3B 5IP4A 4Y19D 2EDJA 3QRGH 4HUVB 2DBLL 3DX8B 2XTJC 4TSBH 1BF2A 3RDTA 1RK0B 4Q97A 2W9LA 1Q0XL 5CIPH 2C1PA 4HS3A 3NVQA 1I3RA 4NM8H 3RVUD 5MEQA 5CD5D 4DK3A 4CVWA 4P2RB 4X9HA 3L3KB 4POYA 1GSMA 3LKRB 5DFWH 4RWYL 4E5XA 1FVCB 4KUCF 4I3SL 5D7KE 4DVBB 5DQDH 3T0BA 4MXQD 4MXWH 3QDJA 5FKPB 4RFNC 2BVYA 1IM3A 4ZS6C 4G6FB 4URTB 2ITCB 4QRPE 1CD0A 1M6OA 4OZHA 1D7FA 3QXWA 4AY0A 2GTWB 3OAUH 2F58H 5FUCC 4PP1D 5E2VH 2B20A 5GS1B 5IIEB 1JUFB 3O3BB 3Q1SL 2XXMB 3PXJA 3DLQR 4QXWA 5A43C 4KDTC 3WS6C 3RTQA 5HYQA 2ZCKL 5HJ3B 3PP3H 5DFVD 4M6OH 4HK3N 3LKSA 1QA9A 1V3LA 1BJ1H 5MI0C 1IGML 3TP4A 1P4IH 5HY9A 3QHZH 3EYUH 3E6FA 3WDHA 5DD6A 3WS6A 2XT1B 2NXZB 5I8OH 1OM3L 1GL4B 1YN6A 1X5ZA 1G7PA 5KOVC 5JO5A 3K74B 3L5WA 4F7MA 2NY6B 5JMRA 4K71C 3CX5K 3U6RA 4F3FA 1GGYA 5TPWH 3WNMA 5CJOH 4KMTH 3GBMH 3PL6A 3HUJA 1GIGL 3C5ZC 1PAMA 2BSSA 1CT8A 5DHYB 4RMSA 2MQ3A 3V6FB 1NMBL 3VXUA 4KKAC 3MLSH 1RZ7L 2E7BA 2CSPA 4YE4H 1WZLA 3L3IA 5JXED 1RMFH 5C71A 1DBAL 2B1HH 4X0KA 25C8H 3H7LA 1QYGH 4N0YL 1MF2H 5TQ0H 4EN3C 1FNLA 4QTIH 1GOGA 3ZTJH 2VLKB 4HWZB 4TUJA 4ZPVA 1NL0L 4XMLH 1I3GH 5BXFA 1UGNA 2BSTB 4QTHB 2ARWA 4DGVL 2D9QB 2J8UE 2A9ML 2GY5A 1RAMA 2MNUA 4APQB 5DJXB 4ETYA 2V7HB 5CBEB 4PTUA 1MI5D 2HVJA 1HQ4A 4LPUA 5LGJA 1FRGL 5GIRB 3UYRL 1I9JH 1MOEA 1QSVA 5E6IA 3BO8A 1L7TH 1FDLH 3UJTL 3A6OA 1YEEH 3C09B 1I9RH 4MJ2A 1U95A 5EIIB 1W72A 4R2GB 4UT6H 1N5YH 4BUGA 2WBJB 1B2WL 2XRAL 1NGWB 2O61A 2JCCA 3SDYH 3SDAB 2Z4QB 5C0ND 3QFJB 2B4CL 2B4CC 1AFVL 2ZUQC 1T3FB 3ARDA 4X6BA 4P2RE 5DD1L 5L8LB 3IU4H 4KDVA 5HHPB 5IK3A 5DJYA 2DLEA 2ZOKA 5JR1H 3JTTA 1QPXA 3KXFB 3QDAA 3NFPB 4QF1A 3WFZA 1I7RA 1Q72H 5C2BH 1F4HA 4Y88A 4LSPH 2UYLB 2HJLA 3FT2B 2DKUA 1P69B 1DQTA 4WI4A 4C59B 2EXWC 4WU5B 1AH1A 1JHKH 1V7NH 1UM5L 4OZHF 4QY8A 5KAQG 2NY4B 1MCOL 3QDGD 3EYSL 3NCEB 4XVTL 3CFCH 5LKNA 4XHJD 4UOW0 1ED3A 1CL7I 2ADIA 5FECB 1RZKH 5GQBA 2VIRB 1JF6A 3MNZA 3QP3A 4MAUL 3HZMB 3MNWA 3WJJA 2VISA 1EX0A 3MRKB 4FZEH 3L3HB 1CE1H 1TETL 2R56H 3DMMB 5GGVL 5DURB 2N56A 3RZCA 2OSLB 2Z93B 4LPVA 1IZKA 3V4UL 4C4KT 2BNUB 1QO3B 4FQJH 1FJ1A 2OQJB 4XPGL 2R2CA 1VGEH 4NRXB 5DR5L 4GXUN 5D1QD 5TDOB 4JAMB 3RY4A 3UC0L 5AD0A 5GGSY 1LO2L 3Q5TA 1XH3A 5EC2B 1CXEA 3L3OA 5CWSB 2ICWB 3D2UA 4NYLA 4E0RA 1VKXA 1F6FB 3V0WL 2IPKB 1YEIL 5GGRB 1PQZB 3WV0A 3N85L 5DJ0A 4WI3A 1U58A 2AKRA 1BFOA 3HUJF 3IU3A 2WZPD 1AC6A 4RA3A 4KTEL 4FXGA 4OF3A 3TFKD 3FN9A 3WD5L 3QA3B 5HDQH 2OJZL 1P2CB 2AAVA 5K33A 5FGBC 2OTWA 1AO7B 4LLDA 2VLKE 5HHVL 5DK0B 4NBYB 2DN7A 3TZVC 3SJVD 4RFEB 5SX4I 1KIUA 5H35A 5IQ9B 4MHHG 2V5YA 3RPKA 1QSEB 3DIFA 1ULVA 1SYSB 3VGAC 5IEKB 1OAXL 1ZGLA 4XPHH 4NQCD 4YGAB 3STZA 1CDJA 2R23B 3WS3A 2X9XA 4Y4HD 3LN5A 2O5YL 3MJ7B 3WN5C 3TZVA 1AIFB 4RIRB 2MSPA 3WFCH 2X41A 3VE0B 4U1IB 1MWAL 4Y2OA 1UWXH 4R4BB 3BH9A 2YUWA 1EHLH 1ZT4B 3BUTA 1P84J 2I07A 3PQYB 2ZCLH 2R8SH 1BQSA 1U3HB 3JVGC 1KYOK 2E9WA 2CJUH 3IJSB 5FO8B 3QRFM 3VRIB 1BEYL 3TBVA 3DGGA 2MTPA 5DJ8B 1BZQK 4I3RH 1F45A 3MLUH 2GFBA 3HZVB 32C2B 3DYMA 3QFJE 3JVGA 4HQQL 4E41B 2WK2A 2YMXH 2JCCF 4OJFL 3BMWA 4PTTA 3BE1L 2BHZA 4D3CH 1G7HB 4IRZL 4BSVA 4Z0BH 5EBLA 4P2YA 3RA7L 4HLZH 4DKDC 3BW9B 3DV6A 2DJ4A 4M5YL 4DEPC 3FT3B 3KXFE 1HYRC 4YIQB 5DSCA 1NBZA 5DHVA 5F7YC 5T3ZL 3HLAB 1REIA 4OLUL 4M6NL 3PWNB 2V17L 3D3VD 3UMTA 1AJ7L 3PP3K 4OGAC 3MFFA 3V8CA 1ZLWH 3D5OF 3RVVD 3OR6B 1HSAB 4O2CB 4ODWB 2ZSWB 5BRZB 4NGHH 3K2MC 2X70B 4NQTA 3F7VA 4HUXB 4K7FA 3U9UA 4EUPA 1DVFC 4Y5YC 1BBJB 2AJXL 4GAYB 4NN6C 1I8KA 1NC4B 2JE8A 4ZG1A 5JZ7D 5GSVA 1BM3L 3BUYB 3MV7A 1IEAB 3EOTL 1UH2A 1TVBB 1IGIL 1OTSC 3QQ4B 1JGUH 3LPWA 5E4IA 3VXOB 1ND0B 3ZE1F 3HE7A 1NKRA 4OIBA 3CFDB 4QRPA 3E8UH 4F2MB 4CU6A 4OLVH 5SWSA 3U4EB 3VGFA 2C9AA 1O7VA 2P45B 4F37F 1CE6B 4FQ1H 3LEYL 4JRXD 4G9DB 1JNNL 1U8LA 3IKCB 5TJWK 4B5EA 5IV2A 5KVEH 3CXDL 1OGAA 1WEJH 2B1AH 1NBYB 3OAZH 1LQSR 2ATKB 3VD5A 4PBXA 3F7QA 3WNOA 4F7TB 4TVSa 4TUKH 3QUYD 3KYMA 5F9OL 2BY3A 2E9JA 5JXAH 3MGTB 1QKZL 4P46D 1INQB 3X13B 5F44A 5HDOA 3S34H 1AO7E 4YZFF 1U93A 3EYFB 3QBTB 4HC1H 4TVPE 1UACL 2JB6B 2VLRD 2ESVD 2ZPKL 3DX6B 4MMXC 1VADB 5DRXB 3VFGH 4B50A 1QSEE 3LV3A 4CAGA 5DUMH 3SDCC 1G9MH 1Y0LA 2NNAB 1KB5L 3DO7A 3TYFA 3HA0A 4F9PC 1A5FL 5CEZH 2CDEB 3MRNA 4AEIH 4FQIL 5MHSD 4OFYA 2PO6D 2XWTB 1OD7A 1CICC 2VRAA 1TTFA 5JMOC 2XA8L 2OX5A 3SDCA 3PQYE 3Q3GA 5BVJB 2GCYA 2VDQH 3QO1B 3QQ3A 4ODVH 4XTRD 1MUJA 1MVFA 1U92A 3FQNB 3W2DH 1A3RH 2I60L 3ETBF 3NZ8A 5L2KA 1RIVH 1OW0A 2FEEI 1T4KA 2EE3A 2VDOH 3TJEL 3W5NA 1WT5C 3FFCA 2J8UA 2W0KA 2CDFB 2H6PA 4E41E 3T2NH 4FQHA 3QUXC 4NQVB 1Z2KA 4JM2B 3U7YL 2D7MA 2F5AL 5T1DH 1N7MH 3HG1D 1P53A 3VFSB 3Q0HA 4K3GA 4L29A 1FBIH 4X6EB 1UH4A 4M4PA 3TYGH 4C56D 4P59H 2EDLA 2Z0BA 4M9PA 4L4VA 2C26A 2DWEB 1E6JL 4YHNB 4U4BA 1QSFA 4LBEA 1MEXL 1H3XA 3TLRA 2XQYK 4ORGB 2BX5A 2BOBB 3FO2B 1G7MB 1JGEA 5BRZE 1G1CA 4HUVA 3SPVA 1ZHNB 5K9QI 3B83A 2X05A 1JI1A 3P4LA 3B9EA 5MERA 2R2EA 3IRZA 4X99A 4LHUB 2EH7L 4LIQE 3RUGA 2NX5D 5GGTA 3AS2A 3FQTA 1MCWM 1NCDH 3PV6B 1B6DA 2OJEB 4JKMA 1MCPL 4DVBA 1UZ8A 3QO0B 1FZKA 2H26B 4PP2B 5GS1C 4LSQL 4ALAL 1FZOB 4JN1H 4KZDH 4OB5L 3AAZA 1K4CA 2FZ3B 4YPGB 4MZ3A 4UBDD 4OCXL 3U7AA 3ZKND 2HA1A 4G7YH 5DLML 3QIBD 4O2FA 5EU6D 1M7XA 4QOKB 3THML 4Q0XL 4TSAL 5FM5O 2GAZB 4NKIL 2DQTH 1IAKA 2WBWB 3O0RH 3R06B 1FFPA 3C60B 1NUDA 1PJ9A 1BFVH 4JFXB 2NXZC 3T08A 3GSXB 4ONFH 2FX7H 4X83A 5E5MB 5IQ7L 1YYLL 4JCLA 4L9LA 4Y8DC 2NY6C 5H37G 4K8RH 3TCLA 2X09A 1ZLSL 3BSZH 4Y1AD 3U2SA 2IBBA 1FO0A 1I8IB 3GJFB 1ZVYA 2W0FB 4M3JA 4UV7H 1UWXK 2HFTA 3PWUB 1FL5B 2ID5A 3S5LA 5KSBA 4UUJA 4WW2A 5TE4L 4WDIB 1MFAL 3GNMH 3EO9L 1X5FA 2IBZX 2YKLL 4JFOB 4JR9L 4KFZC 3OB8A 2BY0A 5IVXB 5DHYA 2CPCA 5A2FA 3WFEH 1IARB 1A7OH 3QG7H 2DAVA 2A9NL 1A1MB 3VDBA 2BMKB 2CUIA 3D69A 4XWOC 3MOBL 1LE9B 1UZ6E 4KGJA 4UNTA 3HR5A 4TNVK 4A6YB 4WEMB 2FGWL 2YC1A 3ARXA 4NC0B 5CGMA 1FN4B 4APQC 1IAOB 4Q6YA 4ODSH 5IT2L 4G8GD 3HI5L 4QGTA 4HWZA 4M7JH 4X6FB 4TOYH 1OWRM 5DI8A 2DI8A 1OCWH 1ZE3C 3PWPB 4QTHA 5HYJD 3O2DH 3BI9X 2BVPA 3C09C 3QXAB 1ZLWK 4ONHA 2YBRB 3GI9L 4GUPB 2V6HA 4X9BA 2J8UF 4Y5XB 1N2RB 1RZFL 2WBJC 3C6SA 4LLUB 2AVGA 1CI5A 3LEVH 5HHNA 2Y1VA 3ILQD 2AJSH 1B0GA 4P9MH 3TT3H 2EH8L 3SDAC 4Z7NF 3LKQA 1ZEAL 2APWA 3L5JA 5CINH 4WFFD 4YHKL 4PLJD 2NZIA 4NKOA 3SKUD 5C7XH 2IANB 4WEUD 3O8XD 3ZE0F 4P4RA 3K2UH 1IM9B 3SDAA 5ESAA 1F3DH 2DI9A 1HI6B 5D96B 1JF1A 2QADB 5KVDL 4R3SA 1A9EB 4IOSD 1URLA 2V9QA 2HTLD 1HHJA 4U1LB 1PZUB 5J06A 2VDPL 5FHBH 1GJIA 5CAYB 3CVHA 1JGVL 1RFDH 5DWUL 3FAWA 2OP4L 3KXFA 1KCUH 3BJLA 1N4XL 3NFPA 3RUGF 3T4AA 2BCKB 2GJ6D 2NY4C 3RPIB 2ENYA 2NXYB 4XPAL 1E4XI 3OAZK 1JHTA 1X4ZA 3JZ7A 5GRYA 3NZHL 5HGHA 3V6ZA 5TF1L 4U1MB 3U1SL 3VWJD 2CKNA 2CIKB 4UOJA 1SY6L 2D7TL 2A6JB 4ZTOH 5C0CD 5C0IA 15C8H 3MCKA 3KJ6H 1T7WA 1SQ2N 5F7KC 1S9WB 3U83A 5FV2A 4QOKE 4PRHD 3TIEA 4JQIL 4R7DA 5ADPH 3DMMC 2XPGB 5E4EB 5IWLA 1SY6A 3HZMA 3C6LA 4JKLA 4KJQC 5CIPB 1RK1B 2BJMH 2F5BH 1CD8A 3DXAB 4KUCD 3P0VH 4W6YB 3AMKA 2NY5H 2GW5A 1TNNA 4OT1H 1S9YB 3MV9D 3BEWA 1AKJB 4U6HB 3HAEA 3I9GL 3AM8A 2OQJA 1C8PA 2J88H 2BRQA 4NRXA 2H32A 4DKFL 5TE6H 4UV4H 3U4AA 3KPOA 3P9MB 4FFZH 1PLGH 3IETB 5C0BA 1A6TB 1RHHA 5INCB 2IPKA 5KSBF 3S3JA 2A38A 4FTVD 1PQZA 4WW2F 5IVXE 1LK2B 4Z0XB 1EEZB 2QR0B 4PREA 4TVPL 5BO1L 1QTYT 4JY5H 4DAGH 1KCVH 3VG0H 5ESVA 1ORSA 1G6RA 5EFIB 4GJTB 2DQEH 1HCFX 5L0QB 3C08H 1P5UA 3ES6B 1IL1B 3QA3A 4WNQB 1OAZL 1BFTA 4RQQA 3WKNA 4Y4KB 1NQBA 3HI1B 3IGAB 5C0AB 3LQZB 4XP5H 2DQCH 4MNQD 2DQHH 3PWPE 5DJZA 3T09A 5HHMD 4WHTB 5DQJA 5J3HD 1MCSA 2DKMA 3H3PH 1U3HC 1TCRB 2EDEA 5EU5A 3ARFB 1TIUA 3ZDYF 1UEMA 4ODBD 4P3DB 1XIWB 3PWJB 4KPHH 5JDJA 3R0NA 4JJ5A 1RUAL 1IAMA 4JY4B 4M6ML 3PQYA 1WUNT 3CGTA 4MD0B 1EVTC 1U3HA 5ITBH 1T20B 2R1YA 5E95B 1D5ZB 1U8HA 1F8TH 2IANE 1VFAA 2B5IB 3VRIA 5IW1A 4ZSOA 3MRJB 2EC8A 1FAIL 1PKQB 4ZS7H 1J87A 4M1CC 1AQKL 3HZVA 4U6YA 4CW1B 5DJDB 2D0GA 1MRDH 3I3EA 5JOPE 4LNRA 5GISL 2J8OA 2K7PA 5I1JH 2X4RB 2PYEA 3P2TA 4X4YB 4YIQA 2VB5A 5F7DA 2ZJSL 3HLAA 7CGTA 3S35H 4CVXB 1P7QA 4R96A 2E8YA 1CG9B 2ICEA 4YHOH 4MWFB 1G0YR 5C0FB 3GO1L 1FVEB 3OR6A 1NANI 4LIQL 1QLEH 3EJZC 5BRZA 1MFDL 1N6VA 4ZYKB 1Z5LA 4IRJA 5AG9A 1FPTH 2H9GA 3LN4B 4GLRI 2GT9B 1I9EA 3V4PH 4DCQB 1XGQA 2WUCH 4JZNA 4M9OA 4MJID 3V5HA 3IDNB 4HCRA 3RRQA 3WXVH 1F4XL 4HF5L 1HKLL 1IEAA 1T1XA 3DXAE 3RIAF 1TVBA 4X80H 1PX3A 4FABL 3R4DA 1WFTA 2XTJD 1ND0A 5DYOA 3O6ML 2DQJH 5FOBB 2L7UA 3ARBB 4GKOA 3HTLX 3F8UB 2I25N 3QB7C 3WNKA 3CX5J 4GSDL 1FE8L 3VD3A 5IB5B 2HLAB 3UAJC 1KT2A 5CFHA 1AQDA 2P43B 2B7DT 3IFNH 4D0DB 3ULUH 1JIBA 4G6KH 5MEPB 4G43A 2QSQA 4RAUB 2V9TA 1NSNH 3NIFE 4PJXB 4QHUA 2V2XB 1PD6A 1DE4B 3C5SB 2QQKH 1JYNA 1UYWH 1H3PH 3MGTA 5I19L 4MJ5B 4ZUVA 4FFYH 4RDQF 2C3HA 1SM3L 2UY6A 2A77H 1FYTB 5C0AE 2VWEE 2XNAA 4AM0A 5I2IB 4K3EH 1VADA 5DRXA 3ZTNH 5C6WH 4YHMH 3JV6A 4CN6A 3MLVH 1KGCE 5HXMA 2NNAA 4HLZG 4UZGA 4XT1C 4K94L 4K94C 4OM0H 4EQ2A 5TQ2H 5ID0B 3WNPA 2VITB 2Z8WC 5ICXB 3FO1B 1HN1A 2B0SH 5AYQA 5E56A 4QHKI 3TWCL 3CFEA 4HUNB 4U6TA 1MFNA 3B9KD 5BVJA 4UINL 4DGYH 3A0OA 2X4QB 3ALPA 3FFDA 3HPJA 1H8OA 3DVIA 3OPZH 5LBSL 4NO0B 3OGCB 3AFLA 5LJYH 4JM2C 1T66C 2AXHA 3WIFB 3C5ZD 1PKQE 1A22B 1BOGB 2FD6L 4QRTA 4KKAD 3WCYA 3ZKXB 2NY7H 4HZAA 4XVJH 3HZKB 5HI3C 5JOEA 2AK1H 5IG7B 4NQVA 4JM2A 1EERB 2VAJA 3LQMA 3PG2A 4HIIB 4N90E 3GSUB 3SKOB 2AJUH 4ZXBB 3VFSA 2BDNL 5HGDB 4EN3D 1PKOA 4Z7WB 5DS8B 1CD1B 3WDIA 5CBAA 1NCWL 2EYRA 2X7LA 2PXYB 1Q9LA 5HPMB 1XZ0B 5FM8A 1EGJH 1C5BH 2HTKD 4HFUL 3P0YH 2BOBA 4PRDA 1G7MA 1EO5A 3IS0X 2MMXA 3HC4L 1I9IL 2X1QA 3VXMB 1JRHL 4C55A 5T5FH 1R3HA 1TZHB 1T04B 3GIZL 5DC0A 1MFBL 2IALB 2LQRA 2PR4L 1C5DA 2DYPD 3G5XA 1KCLA 1EO8L 1XGYH 1I7TA 1YMMA 2Z91A 4LASL 4LHUA 1A7PH 1YNTB 3PV7A 5DVLA 3HMXL 4UILL 5F96H 4XCFL 4P5TD 4F57H 1KBGL 3D1MC 1J1XH 4OGYL 4LKCB 2F53A 4PGCB 1GOHA 2CKBH 2YK1H 3V8OA 4PJ7A 4NO3A 4FMKA 1FZOA 3JV0A 4KY1H 4QHNB 5I0DA 1UB6B 4K3JH 5ERWA 3T04D 1YEFH 3C60C 4KDWA 4O4YL 4DK6A 2IQ9L 4PJ8B 1DBKL 4U7SA 4HV8B 1ADQH 2VKWA 3O3EA 4QOKA 2BNQD 2RHEA 5AWNH 4KHXH 1A2YB 2OMNA 2FWOA 3GZKA 1VSCA 4MA3B 1E4KC 2CMRH 1NEZG 4PJXE 4X98B 5EO9A 5I0ZA 2GQHA 1KUMA 1G7LB 2EXWD 3S88H 5E7BA 1N0LA 4OCWH 3DI2B 1NAKL 3RWJB 4PD4K 3ROLA 1FYTE 2W0FA 3U0WL 1E4KA 4JO1L 2HKFH 1X9QA 2EDXA 2I5YL 4LSSL 3MGAA 43CAA 1M05B 1XT5A 1FL5A 1F42A 4XVSH 4JFED 4A2LA 1ZWIA 4FQLL 1JPGA 2JB5H 4BQ9A 1H5BB 3NIDE 4KAQH 1C7SA 4A6YL 4OM1H 3K4ZA 4WI7A 3IFLH 5M95B 2FYYB 3MRIA 4DUXA 1R24B 3LSOB 4S1DC 4LSVL 3D2UD 3GKWL 4GW4A 2BMKA 1F58H 3F7YB 4X8XA 1U42A 4OD2A 3RWDB 4GW5A 4Y89A 1HE7A 2C1OB 1MJ7H 5GSRB 1Q94B 2WWMC 1JNHA 4JM4H 1F6AA 1KYOJ 4MNGB 1KPUB 3RVXC 1Z9LA 1ES0B 5I30H 3O11B 4Y5XC 4OLXH 2Z92B 3TT1H 1VESA 2A0LC 5C3LD 1CXKA 4YC2B 1DLFH 2AGJL 2F54D 3AS0A 4P2OB 2PTTB 3CUPB 3I84A 5D9SA 4V2CB 1KELL 1T2XA 1ZS8A 2FO4A 1AD0A 3BYTA 3EDFA 1MJJA 3O6KH 4NFDA 5I1KH 2R39A 2VDLL 4XBEL 1EJOL 1RULH 4JG1H 4OV5B 5FYLH 4ZFFA 1IEBA 4KC3B 3UROR 4I2XB 4HD9A 3W81A 1OQOA 4JM2F 4LP4A 4BQCA 3DUUB 4Z7WE 4JLRB 1UWGH 3TZVD 4QGYA 3OF6A 1BBDH 5D96C 4ZOAA 2QADC 2AJVH 1AE6H 3GSOA 1A6AB 1A7NL 2GJZA 3LRGA 4ZOEA 4HKXB 3OJVC 3VXME 4YFEA 1NEZB 2VZUA 3IJHA 3IDYB 1CLYL 1HI6A 4O51B 4C83B 3WUZA 2D4DA 3IDUA 2P4AB 5I76B 3RWEA 2NXYC 1RHFA 2VXUL 3VXSA 2G2RB 1HNFA 3GMMB 1M7IB 2HLFD 4HX1A 1T0NA 1S7QB 2CLVA 1VHPA 5HDBE 2ZUTA 2OR9H 4N8CL 3KYAA 2F9BT 4MAYC 4FNLL 4GQ9H 4X7EC 5CD3B 5B4MD 5GRJL 3SE9H 3T4YB 1IJ9A 2FX9H 3MRCA 3TV3H 5E4EC 5J6HA 4AZ8A 2A6JA 3QRGL 4PJ7F 1M7DB 3QXDA 3MBEB 3MLWH 4TSBL 5FM4A 3EOAB 4MAYA 4YX2H 1J0HA 1XR9B 4NM8L 4OZGB 2QL1A 4NIKB 3VFRA 3WLBA 1JWMA 4Q6IB 3QWOB 2DM4A 2OL3H 4HS8H 3HKFA 4DW2H 5IB4A 1CDUA 3MA7B 2NR6C 3PIQB 3QH3B 1XF5B 4AK1A 3DXAA 4JHWH 1KLFA 4J4PC 3ARSA 4Y16B 5DQDL 3VFOA 3BZEB 2VUOA 4MXWL 1KENH 1V7MH 1AKJA 5D7KD 3F12A 3OAUL 1DVFD 2LV4A 4XNQA 4P2QB 3LAFA 3MJ6A 5E2VL 3P9MA 4QRPD 3RHWK 4HAFA 2NY1B 2CGRH 9CGTA 3AC0A 5L0QC 1HWHB 5I8EA 4BZYA 5E08H 3NIGE 1OTSD 5D1XB 4Y4KC 5E6YA 1SJEB 4M6OL 2IPTH 5CZKA 3WYRA 4NCDA 2VWEC 3GGWA 3X12A 4HWBH 1P4IL 1ZA6B 3QHZL 3EYUL 1CFBA 3QEQB 3I2CH 4WNQA 4MNGE 4KVCH 3OJDB 5BS0B 5I8OL 4Y4KA 3AREB 2LU7A 4PRIB 1DLHA 3TJHC 4TN9A 2ZG2A 4M7KL 1LEIA 4G8IB 5DD5H 5C0AA 5FYJU 1QP1A 4XPTH 5A16A 1X6NA 4PLKC 2J2ZA 1XIWC 5TPWL 2WP3T 4WHTA 5CJOL 1JJUA 1RURH 3GBML 3GSRB 4KMTL 3WFBH 2FR4B 3W11C 2E7LC 1NLDH 4DUWA 4OI7A 4XC1H 2WM0A 5M94B 2NTFA 3GDBA 3S36H 3KDMA 5DJ6B 4RMUA 1ZHKA 2DL9A 4ORZC 4I2XE 1U6AH 3MLSL 4FXLA 2P8LB 4MDIB 2B5IC 4OQ1A 4P3DA 3VXTA 5IJKC 4YE4L 4N0CC 2PW1B 5D5MB 1RMFL 1YY8B 4JN2A 2B1HL 25C8L 2OTUB 3TH2T 5CEZE 2QQNH 1QYGL 4ZTPH 1MF2L 4OZ4B 1T20A 5F1SA 5TQ0L 1YPZB 1KJVB 4QTIL 1D5ZA 3SDCD 1ZLUH 3QJFB 4XMLL 1I3GL 1PKQA 2PCPB 5AAMA 1CFTA 1IC4H 3JXAA 5CEXA 3V6OC 4LCIH 4OUUB 1CICD 1NDMA 4QRQA 1XR8B 4ZAKD 4Y4FB 3DJ9A 3ULVF 4CVZB 3RY6C 3GIVB 4JDTH 4O2EB 4XRCB 4IRSA 5F8QC 1W0VA 3V6OA 1L7TL 1FDLL 4LKXA 1YEEL 5CJ5A 1GOFA 3EFDH 1I9RL 1K6QH 5DMIH 1N5YL 1WV7T 3ME0A 1S7SB 1FVEA 3WLWC 1FC2D 3QUXD 2R15A 1S9KC 1F97A 2AP2A 2YWZA 3CLEH 4OZGE 1HEZB 2A6KA 3FB7B 2AERT 2GT9A 3KR3H 4Z7VA 2EDYA 3T0XA 4DZ8B 3IU4L 5DGRA 4LLVB 4HGKC 5JR1L 4LCUA 1FNGA 4P2RD 3SE4C 4WFHE 1TXKA 1XFPA 1Q72L 5C2BL 4NQDB 2GYSA 4LSPL 3OKLB 1U2HA 4I0PA 5FOBA 4XI5C 4YHLH 3VFWB 5I1AB 4QNPF 5ADOL 4P2QE 1NCAH 1JHKL 1V7NL 4L8DB 2XOTA 4G6FD 1YA5A 3SE4A 5L8JB 1LE5A 3EUUA 1YNLH 1OTTC 5JIPA 3X14B 3CFCL 4U7MA 1NCTA 4MCZB 5EZIH 2CO7B 5TDNB 5HD8C 4MYWB 4OCYH 1RZKL 1RZKC 5F72S 4KUZH 1LD9B 2HJFB 2JF1A 4RAUA 1MHHA 2C4FU 1KJ3H 1NMAH 1MCBA 4FZEL 4PJXA 4D0CB 1CE1L 1SJHB 1MY5A 3SO5A 1DE4A 1KJ2H 1TPXB 2ADGA 1LDSA 1EAPA 3QEQE 3S37H 5C07A 4Q9CA 3NIFF 4CDGC 4N0FB 5BS0E 1C08A 1D5MA 4ZOCA 3G04A 4LLAA 4PRIE 4L1HA 4ZUUB 4Z78A 4F7CA 1OGTB 2FBOJ 4LRNH 1VGEL 2AK4A 3LS4H 2DWDB 3L3GB 4MD4A 2NXZD 1KIRB 4FQ2H 2R4RH 1RSFA 4X9IA 2NY6D 4N1EA 2UZYB 1NFKA 4JY6A 3H6JA 1FFQA 1A02N 3WFHB 3DRQA 4MQ7A 3VRJB 4ONGH 4CNIA 1KTLB 4I77H 4HJGB 2W38A 1ZK9A 2X40A 4U7KA 2BSRA 3ARVA 3DBXA 3KPTA 5D5ME 3QNXB 4M61A 5HDQL 3ZKXC 1QBMH 2XTLA 3T0WA 1I8MA 1YPZE 1JBJA 3UBXG 2JIXB 5DFTA 1N26A 4JDZA 2AV1A 5HI5C 5EBMA 4P5KB 4JFDB 4XHQA 5EIQA 4N9GA 4ZXBC 3T8XA 1S8DA 5DD0L 2VLKD 1QR1B 5JW3H 4XPHL 4XWOD 1RUPL 2GI7A 3HZKA 5E8OB 1ZGLP 1S7XB 1HQRB 2PXYC 1ZA3B 3NA4A 1BFSA 4N8VA 2P1YA 4Z18A 4APQD 1HILB 1LWRA 2X6MA 3O9WB 3WFCL 2VE6B 4ZXBA 4HIHB 1O7SA 4X6DB 1EHLL 1F3RB 2MKWA 4ELMB 1G7QB 2ZCLL 2R8SL 5ABDE 2AQ2A 5KJRH 2NTSP 3VXQB 1XZ0A 2CJUL 5D1QB 4EI5B 1DQMH 4NNXA 5KANG 2A1WH 5L7XH 3P4MB 4I3RL 4R2GD 1LP9A 1TZHA 4FP8H 3MLUL 3GMOB 4HIEB 1UB5A 3O4LA 2BHUA 2WBJD 2IALA 3NFNA 4JVUA 1BZ7B 2EYSA 4M48H 4JRWA 2E6QA 1UEYA 2YMXL 4F9LA 1NGZB 2DB8A 4LLQA 1OP3H 3SDAD 3LRSA 4Z0BL 2NY3B 5IMKB 3QFJD 1YNTA 4FQCH 2YRZA 4LPCA 1DR9A 4Z7VF 1U8OB 1S7UB 2N7AA 4NQDE 1WZ1H 3OKDB 1Q9KB 4PJEB 3JV5A 2CK0H 3NACH 3G6JA 3FT4B 1UB6A 3S7GA 2XWJA 3HRZA 4NGHL 1ZVSA 1C16A 1FIEA 4YLQT 3B2UC 1DQQB 3I6KA 3RVWC 3G5YA 2VQTA 2PYFA 3NH7H 3EYVA 1AP2A 1T5XB 1IBGH 4FZ8H 2NY4D 1WIPA 2G75B 4QT5A 4I18B 4PJ5A 3UBXB 4BKLB 2BNRA 3LMJH 5DMKB 2D7OA 3QUKB 4M43H 5FCUH 3TN0B 4X4ZA 4HKZB 4QYOA 1JGUL 1H5BC 2R2BB 4PJXF 2D3VA 1RZGB 1HZHH 3EOYG 3HPLB 2NW2B 3E8UL 3DMMD 3PUCA 5EIVA 5FK9B 1Y18B 3KPQB 5DURD 4WWID 3I75A 4FXKA 2Z8SA 4FQ1L 2UWEA 2CLRB 1H5BA 2CIIA 2UZIH 4KJQD 1FAKT 2B1AL 1ZLUK 2FYYA 5E0QA 2W59A 3DURA 3BZFB 3SY0B 1R24A 3F6IA 3HZYB 3LSOA 1J1OH 4HJ0C 3LRHA 4KK6D 5INDB 4TUKL 3OKEA 5HPOA 5KSAB 5SWZA 3L3JB 1IGTB 2C1OA 4RISL 5JXAL 1S7VA 3CDFA 3KNBB 3MO1B 4P2OC 3TA3C 4MQTB 2VL5B