4FZ8H

Crystal structure of c11 fab, an adcc mediating anti-hiv-1 antibody.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
233
structure length
222
Chain Sequence
EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGRGLEWVSSISNTSTYIYYADSVEGRFTLSRDNAKNSLYLQMNSLRAEDTAVYYCARANQHFDWLLSLLGGYHYYGMDVWGQGTTVTVSSASTKGPSVFGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB heavy chain of human ANTI-HIV-1 ENV ANTIBODY C11
publication title Crystal structure of C11 Fab, an ADCC mediating anti-HIV-1 antibody.
rcsb
source organism Homo sapiens
total genus 36
structure length 222
sequence length 233
ec nomenclature
pdb deposition date 2012-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fz8H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fz8H01
3GRWA 1MCPH 1MWAA 2UWEA 5L2KB 3TIEA 4LCYA 1KEGH 3MYJA 2VB5A 3IDIB 3MJ6A 3RU8L 2EEAA 5ITFA 2Y07L 3QUYB 2XG5A 2H45A 3EJZD 3H9YA 1S9WA 3CFEB 2NY6D 5I76B 4UAOB 5D7IF 2HT3C 3RNQB 3OKKB 1SQ2N 2PXYA 2OZ4H 5E5RB 4M93C 3FB6A 3D0VA 5CKAA 5L7XL 4RFOL 2WMPA 3KPMA 3T0XA 4FFZH 4K23L 4P2CG 1E4KC 1YYLH 2FJFB 3H0TA 3I84A 3DVIA 5CIPA 3WO4C 3LEXA 5INCA 3GSNB 3IDXH 1HCVA 3EYQC 3ZZ1A 3LD8C 4P99A 1CFBA 2NW2B 2ZCHH 3L3KB 1WWAX 3S36H 4LCCB 3D5OF 2FIKB 4X6CE 1JWMA 3QDJA 4RISL 5DHVA 3WNKA 3GSXB 4KI5E 3CNKA 2BRRL 2VRAA 3RVXC 1DBMH 1JN6A 3H7BB 5EZIH 5I8CA 1VEOA 1WTGT 3QXWA 1MFAL 3N85L 3BAEH 4PJGF 4Y16D 1JHTB 3LV3B 4GSDH 1UH3A 3ULVF 3IAPA 3KPTA 1V7ML 3WE6A 4H5SA 1TZGL 3QXTA 4MVBD 1ZV5A 3EJYD 1I1YA 4LLWB 4L4TE 4LSRL 5IVOA 3HN3A 1RFDH 3GK8L 4XBPB 2A83B 4UB0L 5KS9F 4PRHB 3BDXA 2Y1VA 4TVPD 4AQ1B 2GY5A 3QCTH 5IMLB 2AEPH 3ARTA 3TA3C 5DURD 3V52H 2HG5A 3MLYH 4X8JA 5EZJB 3DETD 4OM0L 3RVWD 5C0AE 5DUML 3UPRB 1J8HB 3CDGB 4L9LA 4XP5L 3BD3A 1RUQL 2XRAL 5HPMA 1ZVYA 4R3SB 2A9NL 2Z8SA 3U6RB 1I1FA 3OXSB 4JFEB 4RSVA 4QF1A 3BZ4B 3LQMA 4OZHF 3DTXB 2D7OA 3OV6A 3QHFL 5CD5D 4JFYA 2I60H 3A6OA 1CGWA 3C9NB 5FEBA 2FGWL 5C0NC 4MB5A 2GJ6E 5IW6B 4ZUSB 4HZAA 4MJID 3OXRB 4YFLF 1IGJA 2EIZA 5I71C 2RAMA 4KVCL 1KB5B 2HJKA 3LKQA 5IT2H 3PWJA 1PG7X 3JXAA 5I8KL 1CDJA 4UV7L 4P23D 4NQDB 2R2BB 3HNTL 1F6AA 4NUGL 1DUZA 5CWSA 5D1QC 1WBYB 5KVEH 1N4XL 5F8RC 4K3DH 5EA0H 4XMKH 5C9JA 1YPZB 3UAJC 5JDSB 3IU4L 4X7SH 4XMLL 3BSZL 4OGXH 2IAMA 3BIAX 3VH8B 3U0TB 3LDBB 4RGNE 5FYLH 5D5MA 1P1ZA 3SY0B 2WWMD 2WBJD 1DEEB 4OT1H 3QIWA 4M6MH 1FL6A 4L8SC 3UYPA 4H8WH 3SKUD 1WWWX 3RVVC 1A9EB 4GG6F 3C60D 3LEVH 1EO8H 4JFXB 3UYRL 4JB9L 2CJUH 1JF1B 4JPIA 3W5NA 1UJTA 1ND0B 1IAKA 3U4BL 2F8OA 3MCLH 5EG6C 5MENA 2Z92A 1RMFH 3RZCB 4DGVL 5KJRH 5ETUB 1GYAA 2GJZA 3CFIC 2EEDA 3VGFA 5D7LA 2NY4B 5INDB 5E56A 2A6JB 2V2XB 3UTTA 1EAJA 1E6JH 3WV0A 1HQ4A 3M45A 3WNMA 1ZSDB 1FLRL 3MNVA 2WP3O 4PRIA 5SWZA 3VXUE 5F96L 2UZXB 1ADQL 1DQDL 4FQJL 3SKMB 3CZFB 1QRNB 4PY8I 1SEQL 3MODL 5DDHB 1H5BC 5CHNB 3RNKA 2AV7B 1NKOA 5CUSL 1T21A 4LLDB 5F1OB 4WFHE 2EC9T 1LGVA 1PG7L 4PTTB 4NP4H 4H0GA 3WS3B 1MFBH 1A3RH 1U3HA 1U9KA 4JY4B 1FE8H 5D2LA 4D0CB 2VLRD 2UY6A 1K8DA 1Z3GH 2AVGA 4N0UB 4PJDE 2Z91A 1C5CH 3UJTL 3DROA 1RK0B 1A5FH 2HFFA 4LHQB 4Q74A 2C4XA 4TPRL 5DJ2A 2PXYC 4XCCL 4MXVE 3CVHL 1WICA 4JKKA 2YPLA 1AY1L 1TJIL 2AQ2A 2G75B 2NY6B 5DD5H 5F72S 5F44A 4M5ZH 2FNBA 1HSAA 1NDMB 3G6AA 1CLOH 1PDKA 3GMMB 1E28A 1U42A 2HRLA 3MXWH 4TTDD 3INUL 2EE3A 3PQYA 2DQIL 3SKOA 2OJZL 15C8H 5C2BH 2V5YA 4YXLH 1W0VB 3SJVD 2Z31A 4EQ2A 4CRPA 3UTPD 2R23A 5KSUB 4KV5E 2WZPD 2CRMA 5D7JA 5E1AA 3Q5OA 1J0YA 2VAAB 4QT5B 2X05A 1FZMA 4L1DA 2VLMD 1E4WL 3R8QA 4GBXC 4RWYH 4BFEA 1YNKH 1KELH 1YNLH 3VRLF 5D1XC 1JUFA 4HUWB 4KK8C 4M8QA 1T0MB 2RIKA 3CPLA 4XPGL 3HPJB 3MBEB 1JZ8A 1XR9B 1A6PA 4EUPA 4OB5H 1MCKA 3LRGA 2BOCB 4MQ7A 2YHGA 2HLFD 2XIDA 4PBWD 3VG0H 1OP9A 2BNRA 5EH1A 3SKNA 3EFDL 3PGCA 2J12B 3E0GA 1W72H 3QHZH 3NA9L 5ESVA 1FBIH 4OD1H 3X3FL 1UXWB 2EKSB 3V4VL 3X14B 2X89A 5HYIA 4WW2C 1H3PH 4QGYA 3CFKA 1T20B 4KJQC 4JM2D 4HS8L 1X5ZA 4WEUD 2HYMA 1HHGA 3B9KD 4Q9RL 4BK4A 5ENWB 1JHKH 3SDAC 1VA9A 4FQQA 4DK6A 1CXKA 3MUZ1 1IAII 2PW2A 3OJDB 2DOCA 1OCWH 2CIIA 3QNZA 1N8ZB 2B1HL 3DIFA 3T0VA 2I26N 5DVNA 1LE9A 1A1OA 2XKUA 4PGJA 1AH1A 5DEGA 4NYLB 3ZHLA 3DVNA 3WUZA 1OAKL 3MLRL 3OQ3B 2XACC 2QKIA 1CK0H 1SBSL 4AY0A 2OK0H 3MV9D 4C4KT 3BPOC 1QR4A 2PNDA 3B2UC 3K4AA 4DEPB 1M6OB 5CFHA 1V3LA 4M8VA 4HV8B 4ZFGH 3KPNA 2XXMB 2VXQL 3NCMA 4G5ZH 2X4PA 2XNAB 3LAFA 4YPJA 4RAVB 1UM5H 4JN2A 1WZLA 2F53B 1TITA 4YGAB 1K3IA 2EYSA 2Y36H 2E7BA 4NDMA 1S9VB 1G7QB 4KKCD 1T1ZA 4PY8J 3HE6D 3O8XA 4P23B 1G7LB 1TLKA 1NAMB 2EDNA 5KVMC 3TZVA 3MA9H 1GGCL 4HZLB 4OAWB 2DM2A 1L0YA 4PLKC 4F7EB 1Q9OA 5L88L 3FTGA 3MROA 4YHIA 2OXHA 4XP4L 2BSSB 4OKVA 5I8OH 2X4NB 3QIWC 3H42L 3OX8B 1LHZA 1CE6A 4F7PA 4Z7OF 5GISH 5TE6L 1N6UA 4NO0B 1J8HE 4PBVC 1I1AD 4P2OB 1GGUA 5AYQA 1SYVB 4KHTL 4JFEE 5EUOF 1QFWH 1L7IL 4PS4H 1JF5A 2AJZA 3PL6D 5FOBB 1HNFA 4LLYB 1EFXD 3I6GA 1G7HA 2GIYA 4FN0A 1SVZA 4UILL 5DQJB 5GZNC 2VIRB 2AQ1A 3OJVC 3IFPA 4QXTB 3L3GB 4ODVH 5H37H 4Z8FL 3SDDC 5CBAB 4LAQH 1I7ZA 1NKRA 5SX5H 3CXHJ 5I1LA 1F97A 1YN7B 4P5KA 1MREL 3D2UD 4JDVB 2J88H 4U6YA 5EU6A 4C55A 3OAUH 4L29B 1J11A 3LOWA 3IT8D 1RZFL 4M6AA 1NFIA 2YD8A 4NQDE 3TO2A 4P48A 4Z76A 1G0YR 4UQ2A 4UNVA 2ZOKB 5KTEH 1P84K 3WIHH 5EU4B 4B5EA 1A6UL 1BZ9B 4B0MM 1QD0A 3NIFE 3FQWA 2D31A 4HAGA 3D9AL 5J13C 1YPZE 4U2YA 4UTAH 4YHNB 2NZIA 5IV2B 3DV4A 4YBQD 3BH9B 4JREC 4X5WA 1CFQA 1A9BA 3WKML 5IBLD 1U3HC 1F90L 4JHWH 3S37H 4QNPE 2WINB 4QRTA 4XI5C 4TOYH 4ETQA 4J3XA 1FORH 1N7MH 4Y8DC 4QLRA 1YN6A 1F4XL 3QO0B 4WI7A 4JFZL 4I2XA 1HINL 1WFNA 5D93B 4F33A 1U8IB 3KPLA 5EU3A 5J1AB 1RVFL 1T89A 3MOAH 2DTMH 4K7PH 5D1ZD 1DE4B 5I30H 2E7LA 3TVMA 4M6OL 9CGTA 4BELD 1CL7I 1LP9F 5ACZB 3QZWB 4KJYA 2AGJL 3DSFL 4NZDA 1RHFA 1BOGB 5DJ0B 3MV11 5FIEA 1Q38A 4YHZH 2VQTA 3S3JA 12E8L 4XCEB 1YJDL 2DDQL 2YN3A 3GSOA 4XC3H 3SKJH 4MNGA 2D7TH 3JTSB 4DKDC 4M9PA 3OGOE 5HHPA 1UWEH 4OGYL 1KG0A 4KXZI 3CSPA 1JYWA 3QH3A 1EX0A 5GGRY 3RFZC 3NABL 4NQCD 3Q6GH 1U8KA 5CEZD 3THML 4S1RH 1QRNE 5HHOB 3WIFA 5D7JC 2A0LD 4UIKH 4WTZA 4IOFD 4NN7C 2V7HB 3CDCA 4M5YH 4Z7QE 2PN5A 4I4WB 1DANU 2H26B 2Q3AA 3SJVB 4Y1AE 4EKXA 3UJIH 5IB5B 1X5IA 4HLZH 1YEIL 4GKNA 2DWEB 3BWUC 3I02B 1UG9A 1BP3B 5AZ2L 2W38A 1ORSA 2X9WA 5D7SH 5T33H 5B38G 1CFTB 4FQHB 2R1XA 2ARJB 4N0UE 3VXSE 1OAZH 3G5VA 1GC1L 4WWKC 4NIKB 5HI5C 5J1TC 4QHKI 4QHLB 4HFWB 4Y7MA 1XGYH 4O2CB 4CJ0A 4H1LB 1JPFB 3QXUA 1KTLB 4DN3H 4L3EB 5IMOB 4HT1L 5DK0A 5B22A 5TH2B 3B9AA 4N9GA 4TUOA 4RA3A 1JRHL 5E2TH 5DMKA 4QHNA 1OAYH 1AC0A 1MQKH 3QUZB 5JXAH 3BKYH 1X5XA 1E4JA 3MBXH 1KPRB 3MACH 1TQBC 2Q8BL 4R7NA 4U7MA 5TDOA 3GSWA 3EYSH 5FF6B 1I3GL 3O2DL 4JM2B 4YHLH 5DMGD 4U3HA 5DJZB 1C7SA 2RFXB 5EN2A 5JORB 1LILA 3L9RB 5A40E 1K2DB 4XB8A 4XHJC 3D87B 4O58H 3ULVD 2A9ML 1Q9WA 4JRYB 4UTBH 1PAMA 5F3HB 2X42A 1INDL 4QTHA 4YNYB 3WCYA 5JHLL 5IGXL 3BISA 1JGVL 1RUAH 1TMCB 1OGTA 3JBG7 3JVGA 4JZJA 2ADGB 4F7TB 1WT5C 1UKQA 3HZVB 3EUUA 1W72A 4LHUD 3MV9B 1KF9B 3TPUB 5E08L 2XA3A 4NZUH 4Z0BH 2DN7A 5IK3B 4ODWA 1IGMH 2DWDB 3GMRB 2D7NA 3TZVC 4P5MB 4NKOA 3AREB 3PWLB 3NFPA 4G42A 5E5MB 4F15C 3HB3D 4MNQA 1F02I 1NMCC 4YEEA 3D48R 4MDJB 1U95B 3WKNA 3BESR 4CDGC 4KPHH 4N8VG 5BRZD 4KTDH 1YMMD 1DBBL 1HXMA 1U8NA 5IOPA 1JHLH 5CBEB 3MLTB 2VQ1A 4Z18A 5T5FH 3BVNA 2A6DB 4N5EC 4PJ5A 2V9TA 4U6XA 4XNZB 4TSAH 2AK4A 2FEEI 2OQJB 3LKSB 1XR8A 2ZG3A 2BNUB 2BJMH 3CC5A 2P5WA 1AD0B 2YA2A 3MUHL 3STLB 5BJTB 2WV3A 2FCBA 2Y4SA 3QG6B 5FM5M 3T4AB 3AY4A 3RKPA 5GGQH 1A6ZA 5F7HA 2V7NA 1NGZB 1UXSA 1KT2B 4DTGH 5E2UH 1QPPA 4KZDL 3E2HC 4OLEA 2OI9B 4WW2F 5D96C 5DGRA 1KEGL 4L8CA 4NNXA 1A1NB 3QUXB 3I2CH 5KW9L 1JVKA 2A6IB 2F53E 4G80B 5CP3H 4KGLA 1ZLWH 3KPSA 1S7UB 4JAMB 4H8WC 4HK0A 3RWEB 4R26H 2R0LH 3MO1B 3X12B 5GPRA 4JPKL 1F3JB 5FO9A 4PGCB 3ALXA 3OF6D 2OZ4L 3V4UL 1E27B 2YR3A 1S78C 2UYLB 3ZTJG 3I9GL 3V6BR 1FFRA 4FFZL 5FA4A 4P2RA 5I1EH 5DK2A 1IRAY 4OFKA 4HQQH 4NKDB 4LPTA 3UYOD 5GSRA 2K7PA 3MGTB 3VGBA 4NKMB 2GEEA 1KIRA 2AEQH 2FX9L 5GGSA 1LDSA 4S0TD 5HTSA 2BDNL 2DBLH 3U9UA 3SE9L 5DZOA 2AQ3A 2YWYA 4QHKJ 5H2BA 4KK5D 3RKDD 4PJ8A 3SCMD 1S7QB 3ZYZA 4RFNB 2G9HA 4DVRL 1A02N 1FYTA 2Q86B 4W6YB 4ZO7A 1JV5B 3PWVB 3SGDH 3K2UL 4ZXBB 1K8IA 2ERJC 4J3WA 3IVKB 1WBZB 4JRXA 4NUJA 3O4LB 2E8ZA 2G2RB 2HJLA 3P73A 3B9EA 5DR5H 1REIA 1T0NA 4HKBA 3FMGL 1QSVA 5DS8B 4Y2DB 1QHPA 4FQXD 1MCHA 2PYFA 4NQCB 2IGFH 4M03A 1U58B 3GMLB 4ENEC 2CXGA 2VDOH 3PXJA 1BD2A 4U31A 4BK5A 1DDHB 1CFNA 1V3KA 3PABA 4QRRD 4HKZA 2C3GA 4M7JH 2XN9D 1WIPA 3IS1X 1OARL 1HOCB 3PWNA 3C5SB 1TVDA 3S8WA 1FDLL 5D7IB 4OZ4B 3B3IA 4WCYL 5DFWH 4WUUD 4R7DA 2J1KA 4X0KB 3BPCA 4MQTB 1WVZA 1HWHB 1G7IB 5EU7E 4NNPH 1OGAD 2GAZB 4PTUA 2JELH 2I60L 5EPMB 4TRPH 4EXKA 3FT2A 2ZWLT 1I9IH 5E9DA 1KTDB 5DZNA 4S1QH 5T3XL 5EC1B 4HX1A 1FHGA 2EEBA 1T7YA 4ZQKA 3CSGA 3ZE0F 1AP2B 3DUSA 5C0CB 3B4NA 1HDMB 2UY7A 1D5XA 4OFYA 3B5TA 3LPFA 4LGRB 1P2CB 5DT1H 5KAQG 4G8IA 1HN1A 5HHOE 4JHAL 1TVHA 2B20A 2WUCL 3DSNA 3BUTA 3FO0H 4Z78A 4K3DL 2P8PA 3SJVE 2R0ZL 4GS7C 3KDMA 4X7SL 1DVFC 1TPXC 4DZ8B 1NFDF 4NCC1 5GQBA 5GS3A 2W0PA 4I9WD 1T4KA 1T03L 2FBJH 3MV8D 3KYOA 4LSQH 4BFIA 3VH8G 1RIHL 2Z35B 5FYLL 1VACA 1R3LB 3LSOA 1RJZB 4LVOB 4M6ML 3VFUB 2YS4A 4H8WL 5F7DA 4HXBH 4YHYB 1WUNT 2CDGA 3QNYA 3SOBH 4HHAA 4K9EH 4KWUA 2N56A 5KS9B 3M17A 5HJ3B 5F1SA 2H8PB 1FSKC 2X7LA 4NHCH 3P9MA 4GOSA 1ZXQA 1M4KA 4KK9C 4AEIL 4WW1A 3KXFD 2KL6A 3V0VA 4Y89A 2AS5M 4L3EE 1SY6A 1QKZH 4RMUA 5LG1A 2F15A 2L7JA 5KJRL 1I8KB 2F19H 4PV9A 4NBYB 3VFGL 3F12B 3I75A 2IALA 4RWHA 2DQTH 3H9HA 1TTGA 2KZWA 4YO0A 3MLWL 4H0HB 4YPGA 3W0WD 4ELMA 1GZQA 5JW4N 5T1DH 5I74B 4OZHB 3V6FA 4WU7B 2HT3D 4GRLA 3RDTA 1NC2B 2CDFB 4XVTL 2EECA 2OR9L 5LQBL 1VGKA 4G9FA 4F3FA 3TJHD 3EYUH 4WU5A 4G6ML 1VHPA 2UVFA 5F3BB 3O41B 4JRYE 5KVGL 3AY4C 4FTVB 1NGWB 4EI6A 1DQML 5CCKH 1WV7T 4NP4L 1JYXA 5TFSH 2VQUA 3O6KL 3DX7B 2HVJA 1FE8L 5D8JH 1KENH 3BUYA 3MREA 1LEGA 1MFCH 1VADB 1I9JL 5GRJH 2CDEA 1C5CL 3MOQA 2HKHL 2N4IA 4KGJA 3I3DA 3MRPA 1D3CA 1IFHH 1IKNA 1YY8A 3EOBB 4MQXC 3KPQB 1D5MA 5T1KD 1UJ3A 1IC4H 1LK2B 3RGVA 4ODSH 4GQPH 1G7PB 2XKNB 1BFTA 2MPAL 3LN5B 2NX5D 4DVBB 1KJ2A 2XTJD 1JWSB 3PIQA 1RZ7H 2Q7YA 3O2WL 2JCCF 4I0PC 4GG6B 4W4OA 5DD5L 3FFCA 2IF7A 5FAAA 3FQUB 3L95A 2GTZA 4M5ZL 4XPTH 5JW4R 2X4SA 4WO4B 1CLOL 3FJTA 1P9MA 1KGCD 1M7DA 2HLAA 4Z7NE 3CLEH 5DVLA 4LDOB 1FO0L 5F97E 1KPUA 4AEHL 2ZSVB 5IB3B 1IGYA 2VWEE 3DUHA 3HC3L 2XFXA 3CSBA 1IEBB 1P4BL 4OZFB 5DA4A 3OAYH 5H35B 3BDBA 4PJ8C 1LNUA 3GSRB 3PHOB 2J8UA 3O3EB 4FG6C 5DC9B 3QQ4B 3WHXB 4LK4A 5C0IA 3L3JA 1C7TA 3BZDA 3CX2A 1YNLL 1UVQB 3O6FD 2V6HA 1T7VA 2XI9A 4PRPD 3W11C 5ACLA 5B3NA 3NZ8B 3FAWA 4OTXH 2R4RH 4R2GD 4OI7A 1NCWH 1HHKA 3QUMH 4F57L 5C0ND 3P9LA 3WDHA 4CVXA 4YWGH 2ZCLL 2VH5L 4OQTA 3SQOH 1FBIL 1XCTA 4G7VH 2ZUYA 4OD1L 4IHOA 4GRWH 1Q0XH 4FQXB 4QTIL 4YDLC 1H3PL 4HCRL 4UZGA 2DQCH 4BSWB 2NXZC 4M1GL 3RWCB 1EVUA 3SGJA 5CD3A 2DIAA 3VD7A 1YMHB 2AI0H 3MRRA 3TFKC 2AJXL 4J3TA 3W9EB 4JPVH 4I0CC 2X4UA 1J05A 4DFHA 1AJ7H 2C3HA 3V5KB 4GRMA 5E8OB 2IEPA 1MHHA 4UIMB 4Y4HD 1OCWL 3GKWH 5C6WH 3V6ZA 5AAWA 7CGTA 1CTOA 5BZDB 3OKOB 1WFTA 3A6CH 2E9JA 1ONQA 3DX8A 4UI2A 2GSGA 1U2CA 2FJHA 4J3UA 4APQB 1VB9A 1XMWA 2RCSL 1CK0L 2OK0L 3IETA 4ISVA 2M1KA 3KNBB 1OGAB 1KFAH 3DYOA 5DJ6B 3MUGA 5F1NB 2MNUA 1LO3L 2XQYK 3S3SA 4ZFGL 2HKFH 2VZ1A 5HGBB 1B3JA 4G5ZL 4JY6A 4KH2A 5TJWK 4AEEA 1UH4A 3O4LE 4KROC 1L6ZA 3CZJA 3KYMB 3NIDE 3JV4A 2F74A 3QEHA 3DRQA 3IRPX 3QI9A 3QXVA 5I19L 5IWLC 4IRJA 3W9DB 2Y36L 1IM3B 5DRWA 3FOMB 4MJ4A 2IANB 4UDUB 1WFUA 3ARDA 3CFBA 4PJ9D 4L4VE 4MD4B 2AXHA 3MA9L 5HHQA 1OAQH 4ZPVB 4XNYL 3ARBC 1FIEA 1A7OH 5DD1H 3REWB 1R5VB 3VMPA 5MERA 4FFWC 3P4NA 4HEPG 1AR1C 5I8OL 2QSQA 4N0CC 4Y19A 1I8MA 1A6WH 4ZFFA 4EDWH 3D3VB 43CAB 4P3DB 5GISL 3LMJH 5D7IE 5C3LD 1SM3H 2BSRB 4HJJL 3QNXB 5D72H 1MHEA 3ZE2E 1BVKA 1MVUA 4P9HH 2E6QA 4YFLI 5LAXB 5L9DH 1QFWL 5IMKA 2EDXA 4Y5XA 1IM9A 5J6HB 3BOVA 3TO4C 1ZHLA 2K1MA 5L6YL 1B6UA 4L3CA 4NN5B 2OLDA 3BI9X 4OFDA 1NEZA 3KXFB 4XPBH 1YECH 4ODVL 5E94A 4LPVA 1YNTA 2X4OA 4LAQL 2BMKA 3EZJB 4NSKB 4UT9L 5C0CE 3VFTA 5LGJA 2J88L 3TT3L 4GW1B 3OAUL 3DX6B 1BMGA 4MNHA 5CEYB 1ETZB 3R1GL 4X99A 3CH1A 4WHTA 4PRAB 5JQ6H 2NQCA 2X40A 2ZUUA 5KTEL 4LCWE 3PDGA 1GRWA 1MRFH 3T0BA 1BPVA 4I18A 3KG5A 4HMEA 3OPZL 2V2TA 4KKBD 4M93B 3FQNB 4UTAL 2PTTA 3M07A 1INQB 4KHXL 1AGDB 4MJ6B 3EDDA 3S37L 4JHWL 3IGAB 4TOYL 1M05A 2YD7A 2NR6C 3LS5H 1QO3A 5HYQB 5F93C 1BQHG 2J3SA 3WO4B 1IE5A 2Z4QA 1IL1A 3ULUL 3LD8B 1KTRL 5CZKA 2PR4H 1IKNC 4NNYB 2VE6A 2Z8RA 3MOAL 1JZ2A 1C16A 1UJ3C 3G9AB 1R24B 4KUZH 4MJ5B 5B38A 4GBXD 1DUYB 1NMAH 4JLRB 5KG9B 4RIRA 5ISZB 3QZWG 3QFJB 1L4IA 4W4OC 1MCRA 4JGJA 3WO3B 1TNMA 5T1KB 3OKLB 4GKSB 2QHRH 4YHZL 3S88H 3MNZA 5E0QA 4W6XB 1KJ3L 3UP1A 4I48A 5F9OH 3SKJL 5DFVC 3STZA 4ALAH 4DN4L 1MNUH 5DHYA 5EUOB 5L8LB 4UDTA 4MLSA 1UWEL 5DJAA 5JW4Q 4OZHE 4ZUVB 3U82B 4XX1G 1CLCA 5FYKE 1F45A 1NQBA 2ZUWA 5EWIH 5E6IA 2BVPA 3Q6GL 3WLBA 3GMQA 5FA3B 4JFFB 5DQ9B 5C0DB 1CGSL 1F2QA 4AH2B 4UIKL 3TCLA 3N1PC 4F58H 5HI3C 3B43A 4MMZC 3RIAK 5IF0B 4FTVE 3GNML 3V7MA 4NO3A 5GSVB 2B5IC 4IIQA 3TA3B 3WYRA 3Q6FB 3WFBH 4CAGA 4NFDA 5I17A 1H3XA 2E3VA 3ILQD 4XVSH 3TESA 2XXCB 5T33L 3C08L 5B39B 2JE8A 5EZLA 1D6VH 2YXFA 4PJHA 2Q7NA 4GLRI 1OAZL 1UFUA 4KQ4L 3BIKB 1UEMA 3NAAH 4V1DD 5A2FA 2OSLB 3BIBX 5JPNA 4NQTA 2ORBH 2MQCA 2VLJA 3B2UD 3NN8A 2CUHA 4DN3L 2W59A 3UPCA 4PJDA 5I16A 1AGCA 1QFOA 1RJYA 3H7LA 4GG6E 3ROOB 1OAYL 3MRLA 2FD6L 5E2WH 4ELKB 5JXAL 3BKYL 2FWOB 3LKRA 2N7AA 2HWZH 1JZ5A 3T0AA 2APVA 5I71B 4UQ3B 5SWSD 5F9AC 5E4IA 3F7VA 1LP9B 1QLFB 1JP5A 2P8LB 4N8VA 5JLZA 2C3VB 3WFDH 4UNUA 3QWRA 2DF3A 4O58L 4HUUA 2GT9A 4JY5H 4UTBL 4YHPA 4QOKE 4HDIB 3VFNA 3BP6A 1A22B 4CU7A 3EOTH 1P84J 5BOZG 1RUAL 3LZFH 4Q2ZA 3WNPA 5BVJB 5HSFA 1IARB 5DUPH 3DHJA 2EZ0D 4LL9A 4L8SB 3ZTNH 1TJGL 2P8MB 1KPVB 4JKPL 5DRZA 2CO6B 4Z0BL 5KSAA 4IRJC 1QR1B 3F7PC 5IEKA 1IGML 1MJUH 3G6JA 1B2WH 4XBGB 3ALPA 4O51B 2LAGB 3ARDC 3GBMH 3HC0A 1S7WB 4JQVA 4C4KO 3KR3H 5L2KA 5KOMC 3IS0X 4KFZC 4LPWA 5M94B 25C8H 3SDDD 1CVSC 3LB6C 4MHHI 1JF6A 1NUGA 3GBNH 5HVFB 3QUYA 1I7RB 4WFFE 3OAZH 3CFEA 2VOTA 4KPHL 5I76A 3RNQA 3GJEB 3OKKA 4GMSL 1J1XH 4KTDL 1EV2E 1OTTD 4EVNB 1JHLL 4PG9B 4HEME 4LVHC 1DZBA 4TSAL 5I1AB 4Y5XC 2GSIB 3IKKA 2Y6SC 2VDRH 2BJML 2FJFA 2H41A 3T2NH 4C54A 1Q0YL 3L5IA 3MLUL 3CMOH 1NGYA 2NTSP 2WW8A 1K9TA 3GSNA 1D9KC 2DLGA 3DUUA 5GGQL 3T08A 4OCYH 2DB8A 2NW2A 3CU7A 3L3KA 3QIUD 2Q8AH 1X5JA 4DTGL 5E2UL 3TIEB 2FIKA 2VZSA 3MYJB 4TQEH 2BNQA 2P4AB 3GSXA 3UC0H 4NZJA 4UT6L 3CUPB 1WEJL 1AGFB 5GS1A 5AAMA 4ZS7H 1AE6L 4HWBA 1KXTB 2BOBA 4YAQA 3WBDA 2IANE 4WY7H 3MRQA 1JHTA 3L3DB 3QT2A 4R26L 2QSTA 3O11B 1ZLSH 3D0VB 3QA3B 4K9EC 5ALCL 4NFCA 1PX3A 4Y5YA 2YZ8A 2CO7B 1AO7D 1JGLH 1KBGH 1SMOA 3DWTA 3H0TB 4LLWA 5K93A 4X5XB 5I1EL 3D3VE 5FKPA 1MF2H 4PJBA 3QXAB 4PRHA 1HIMH 3TN0D 4Q6IA 5DSCB 2AEQL 1P69B 5DHVB 4OQ1A 4IRSC 5ICZB 2ZPKH 1AKJA 2DBLL 1CE1H 4U33A 1J8HA 3CDGA 3SDXF 3F7YA 1SMAA 1WAAE 2IQAA 2NY0D 4GBXB 4NWUH 4XPAL 2EXWC 3OXSA 3RHWF 5FYJE 3BZ4A 5D1XB 3DTXA 3G5XA 4WWKD 1KIUA 3VXPB 5E6IC 2E7CA 2DM7A 4TYUA 3C9NA 1I1YB 3HZMB 4HC1A 4R4FL 4GXUM 5HHME 4DUWA 1PG7W 2CGRH 3WLWC 1O5DT 4ZUSA 1MWAL 1SJXA 2ICEB 2QBWA 3UXFA 5IQ7L 5D71L 3MRMB 4L5FH 2IGFL 1VENA 4Z5RB 4J3VA 4CU6A 1JGDA 4WW2B 4AG4H 4G6AC 2AK1H 4MXQC 1OHQA 3ROLA 4NQDA 2R2BA 2B0SH 5JUEL 1VPOH 4Q9QL 4M7JL 1T2JA 4U1HB 5E03A 3MRJA 1WBYA 2EDHA 3MA7B 3ZYOA 4JO4H 4U49A 1NLDH 5I1JH 5D7KE 3SDAB 3N1GC 3DVGB 1I1FB 2AKRA 4UUJB 3D69A 4QF1B 3PGFL 3VH8A 1ZVSA 1MCWM 1YEGH 4RMRA 5E8NB 2EYTA 3SY0A 3DBXB 3OHXA 2V9RA 3LKPA 4NNPL 3WFEL 5MEOA 1JPSL 1A9EA 3QFJE 4KDWA 3TBVB 3RVUD 2WBKA 4X4XB 5ISZE 4TRPL 5B4MC 4JFXA 1I9IL 4WHYH 4LVNC 3BPOB 2MMXA 1JF1A 1ITCA 4AJ0A 4HUMB 1ND0A 3N0PB 4P46C 3QFDA 4N9OB 2HJKB 5EUOE 3BE1H 3DGGA 3TLRA 3RZCA 3HI1B 4GFTB 4KJPD 5ETUA 1XIWA 1F6AB 1DUZB 1CU4H 5INDA 4FNLL 5DT1L 4JFFE 1U8QB 4ZPTB 5SWSB 1LO0H 3NVQA 1BQUA 1XGUB 2CKBH 1FFOB 3WDJA 1ZSDA 1X6NA 5FXCH 2OTUB 2Z93B 2H2SD 3U36A 3MMEB 5A16B 3C5JB 3SKMA 1S9XB 3D18A 1PLGL 4ODHH 3CZFA 1QRNA 1P1ZB 3QEGH 5DDHA 1OTSD 4HPOL 4LSQL 2AV7A 5T3XD 4JFOB 4MWFA 4LLDA 1CLYL 3FO1B 2DLEA 4HXBL 5JXEA 2R1WB 3SOBL 4ODUB 2GFBA 3JSSA 3WS3A 5FCSH 2ZSWB 1MCEA 3SHSA 3WS6A 1BQSA 1T7WA 4WI2A 3MPCA 2O5YH 3O6MH 5ADPH 4JY4A 4WJ5B 1QBLL 3HMXH 3RWJA 4D0CA 3T0ED 5EU5B 1GAFH 4MX7B 1QKZL 4N0UA 3AS0A 2F19L 5F7UA 4MS8C 3QRGH 4PD4K 3UTTB 1FG2B 1RK0A 5E2VH 1HQ4B 1KXQE 3U9PH 3SDDB 5A3IC 5ANMB 1MPAL 3P4MA 4NJAH 4D94A 2FO1A 2G75A 3F8UB 1I7TA 5TQ0L 3MV7E 1Y6MR 1QRKA 1TJHL 1T21B 1S78D 1WJ3A 3BPNC 3EYUL 3O6LH 1IBGL 2ATKA 4YHMH 5J13B 2DYPB 2NY2C 4P57B 2ZJSH 4Y5VC 1OWWA 5E4EC 4X9IA 4JREB 2UUDH 1OAUH 3OG6B 2DQJL 1U3HB 3P11H 2EYRA 5I1HL 4HPYH 3D6GA 5KSUA 1FZKB 3EOAA 3MUJA 5D8JL 4QT5A 5HHNB 3G5ZB 4L4JA 3E6HB 5GS1C 1NLBL 3VGGA 3LEYH 2VR4A 1U8LB 4JO1H 2DLHA 2APFA 5TE4H 4X4ZA 3GI9H 3TBWB 2JJUA 1NFDB 1AC6A 1IFHL 4LIQE 1JFQH 4HUWA 1T0MA 1IC4L 2YPLB 4PJ7F 3HPJA 1H3TA 4XHQA 4ODSL 3RWGB 4Y5YC 4K3EH 4FABH 1OQXA 5IHUH 4Z77A 2VC2H 4Y16A 1HSAB 2MQ0A 2NCMA 4U6VH 5E70A 3PWPE 3FRPG 4XPTL 5EOQL 3S6CA 1NCAH 1VFAB 4LSVL 2QV2A 3SDCD 4GKOA 2JLLA 3CLEL 1UXWA 1ORQB 5C0GB 3X14A 4Q6IC 1H9VA 1KYOK 3HC4H 4R4BB 4QXGL 1T20A 1WLHA 2HFEA 3HR5B 4NN7B 2W07A 4OZFG 4Y4FC 5GHWH 2OYPA 1FZMB 3T77A 4NM4H 4DFIA 5ENWA 3B9DA 2X9YA 3OJDA 3U30C 1Q1JH 1CXIA 1NCCH 2Y23A 1JUFB 1ZWIB 3CPLB 4CBPA 1FNFA 1AQKL 1X5KA 1MRCH 1CD1A 4GO6B 2J2ZA 4NYLA 3JV5A 2YBRB 4OJFH 5K9QI 1P7KA 4WFEE 4QRUB 1WITA 3L3OA 4OTXL 3BP5B 5DTFB 4WWKB 5IIEB 3E8UH 1M6OA 3QUML 2QLVB 4HV8A 4YWGL 3SQOL 2NY1C 5TF0A 2XNAA 4MJIA 4RAVA 1Q0XL 3S36X 1KEMH 1BBJB 2F53A 3UJJL 1B0RB 4XNQA 2AV1B 2DQCL 1S9VA 2D7PA 1QLRB 3I3EA 4JQIH 1EERB 1TQBB 2ADJB 4P23A 3NCYP 1NAMA 4JPVL 3ZSSA 3QNZB 1MIEL 4OAWA 4OCRH 1T0PB 4F7EA 3BQUD 3KHQA 1EDQA 5GS0L 5HGDA 5IMMB 5T3ZE 2X4NA 4NRXB 2JCCB 1MI5B 3BKMH 3QDJE 1ZA3B 3OX8A 4JZNB 4NFBA 1M1SA 5I15H 2D7MA 3VFSA 4LEOA 4NO0A 1BGXH 1NCBH 1KN4L 2DQUL 4FZEH 4P2OA 5KSVB 1EFQA 2RBLA 5DRXA 1N3NA 1EH9A 2WBJA 1SYVA 3VGHA 4DGIH 1QFHA 1JYVA 1JRHI 2DI7A 2YA1A 4PRNB 2OR8A 3RZCC 3HPLB 4LLYA 5FOBA 3CFCL 1XIWC 3RHWK 1J87A 2B39A 5C07D 2EYSB 5DQJA 2VIRA 5JMRA 2VXTL 4NDMB 2UZIH 4QXTA 4P4KC 1YDPB 3K8MA 2XKSA 1T22B 4MA3B 5GGTA 3QUKB 5CBAA 1PJ9A 2EO9A 4ZAKC 2ADFH 4HIXH 1YN7A 4JDVA 3VFOB 3FTGB 4F15B 3MROB 5IHZA 3DYMA 4L29A 3O9WD 4LLQB 1NMCB 1A7OL 4OF0A 4TSBH 1P4IL 3VA2C 4Y4KC 4DCQB 4CUCA 4PJCF 4F7PB 5EU4A 1R3KB 4A6YH 2R2CA 4JVUA 3V5DA 3D39D 3G6DH 3JWDH 4ZFOB 4TULH 5T1MB 4BYHA 4YHNA 3WS6C 2YUZA 3BH9A 3VDBA 1JNLH 2JJSC 1B88A 5DD0L 2WINA 4P9HL 3EO1B 4WTWA 1KOAA 4XAKD 5FM8A 3PV7A 4Q7DA 3QO0A 3V7AG 3V2AR 5JW4M 3FO9B 5F21B 1V7NH 1U8IA 5J1AA 5F7YC 4LSTH 3PDDA 1BZQK 1DE4A 3O45B 3BYYA 3T0EB 4PR5B 2X2YA 2ENSA 3E2HB 3UDWA 2IH1B 3EJZC 4U6YB 5D96B 3G04B 5H94A 4NHUB 4DKEL 4Z76B 1BOGA 5DJ0A 1BFVH 4UQ2B 1KCUH 2IBBA 1J5OL 1LEKB 4O02L 4XH2B 5JQ6L 3JTSA 5KZCD 4I0PD 4X6DF 5DQDL 4D9LH 2C4FU 3L5XH 3BGMB 1NJ9B 3O2VL 1A9BB 1UM4H 1Y18B 1Q9KA 4ETQB 1KNOB 1S9KC 3FRUA 5HHOA 1P6FA 1QBBA 1YN6B 3ESUF 4XVJH 3QPXH 1GHFL 3OKEB 3ARWA 3CH8A 3LS5L 4FQ1H 1R0AH 4I4WA 2H26A 1DCLA 3KPLB 3SJVA 1U8MB 4LARL 2PO6D 5IB5A 2ADIA 2XG4A 4FG6D 2C1PB 2DWEA 2PR4L 3I02A 1IEHA 5MENE 3VGAC 1T6WA 2F9BT 1CFTA 4FQHA 3GSUB 2ARJA 4D0BB 4Y16C 4G43B 4NZTH 4P5TC 4L8DB 2X1QA 1A7RH 4MNGB 5HD8D 4G7YH 3DXAD 3UTTE 3TCXA 4QHLA 4MVBC 3EJYC 2NYYC 1J12A 4O2CA 4OF8A 2ERJB 2BY3A 4H1LA 1JPFA 1U8KB 1KTLA 5IMOA 3HUJA 4L3EA 1L9MA 2I5YH 3ULUD 2R0KL 4F37F 3WIFB 3V0WH 1ZLWK 5J11C 3UMTA 2QQLL 4GRWF 3LHPL 1KPRA 2HRPH 2YD9A 4JPWL 4F58L 4U1KB 4JM2A 1VFMA 2EDOA 5F6HI 1EHLL 3DETC 3RVWC 5DJZA 2E9BA 2RFXA 4LPCA 3QHTC 3ZE0E 5JORA 2QQKL 3L9RA 4KI1A 4NCDA 1JPGA 1IGTB 4AL8L 5ID1B 3Q1SH 3Q5YA 1K2DA 3WFBL 2R1XB 3KGRA 3D1MC 4QRQB 1ZLVH 4JRYA 5F3HA 3CVIH 2BVOB 3QISA 4OLVH 1IEAB 5EC2B 4YNYA 4NM8H 5IFAH 5CD5C 1A6AA 1BVLB 1NFDE 5I66B 2ADGA 4F7TA 5F9DC 4M3JA 3HZVA 2YPLE 5DK0B 5IBTL 3MV9A 3TPUA 3DYPA 5HI4D 5DJCB 5DMKB 1ROWA 2W0LA 5IK3A 4LOUD 1Y6KR 5HYJD 2DQGH 2JF1A 3GMRA 2C26A 5E2WL 1MHCB 4KROD 4OUOA 4QRPD 4P5MA 5CS7A 4J23A 4YDKL 1EGJA 3PWLA 5E5MA 4Z9KB 3R0NA 2QR0B 5C09D 1T1WB 4XAWH 3IAGC 1MH5A 2APBA 3E3QC 1DBKH 4JVWA 1UM6H 3ARBD 5FYKU 3WFDL 5L8JB 1Q9WB 2KQNA 5I0DA 4F8QA 1A64A 3RIFF 4WFGD 3KHOA 2D4DA 3DURB 5CKGA 4GS7B 2WWMC 5CBEA 2WBJC 1DVFB 1TPXB 2VXUH 3NFNA 3EOTL 2OQJA 3C60C 4OF5A 1W72B 1BBDH 3K2MC 2XPGB 4RGOH 2BNUA 4Y8AA 5IFHL 1AD0A 3STLA 5BJTA 4ODWB 5EBLA 5DEFB 1EHXA 1FAIL 3WJJC 1JMZA 1FQ9C 4OI9A 2NLJB 4ZNCD 1FSKB 1B2WL 1NGZA 3GBML 1AXIB 4NO5B 3NFPB 5C07B 3KR3L 4NRYB 3UTSD 4MNQB 2WLYA 3OB0H 4XZUB 1A1NA 25C8L 2QADD 1PW3A 2A6IA 1FL5B 4WGWB 5BV7H 3TBSB 3LQAL 1S7UA 4JAMA 3D2UA 1NGQL 2R9HD 3RWEA 1Z9MA 1A4KB 3MO1A 3X12A 3OKYA 1F3JA 4BFGA 1J1XL 5MHSE 4PGCA 3BP7B 5L7XH 4RFOH 1E27A 2AK4B 1YEKL 4TNWK 1MCDA 3ZMRA 5BQ7B 2UYLA 3CC5B 1B0WA 3D39B 2JCCE 1MI5E 1KC5L 1WWBX 4JHBA 4G8GD 1XEDA 4B7LA 4E5XB 2NR6D 5C71A 3KLAB 2V7NB 4HF5L 4NKMA 3S97C 4OCYL 2Q8AL 4Z95H 5TQ2L 4AZ8A 1XFPA 2BRRH 2YXMA 4F9PA 4L8CB 4YXHL 3X13B 3W39B 5EIIA 1CQKA 1XGRA 4HIIB 1DANT 1EUUA 5D1ZA 4ZUUB 4NC2B 5C7XH 1MFAH 3KPSB 2Q86A 4PBXA 1LQSR 5FO9B 1A1MB 4WY7L 1JV5A 3PWVA 3S4SB 3MQIA 5DFVD 2M8XA 3IVKA 1ZLSL 4C56D 1CXFA 2YKLL 4TTDC 4I0PB 5F6HJ 3UZEA 3O81A 3J7HA 4LSRH 5FA4B 4Y2DA 1WFOA 3GK8H 4NT6B 3HE7D 4NQCA 1G1YA 1Q72H 5M95B 3T2QA 1U58A 4GUPB 2DBJA 3C2SA 1TDQA 1TIUA 3PGDB 1DDHA 3ZKMD 3LH2L 4J1UB 1MLCB 1HOCA 2Q6WA 3FONA 2DIJA 2ZPKL 1PZUB 3C5SA 3IDNB 4PJ8B 1QNZH 2XRAH 1KJMA 5D7IA 3WEXB 2A9NH 2DQHH 4OZ4A 4LNRB 3ZTJH 3U4EB 2P24B 1GPOL 5DYOB 3C6LD 4X0KA 4X4YB 1EUTA 4WDIB 2HLFC 3T04D 1G7IA 3SE4C 1HILB 4XCFL 2GAZA 2FGWH 5EPMA 1G7MA 3EDFA 3QJHB 1SJVA 5HDQL 5FYLE 3QDMB 1KTDA 5EC1A 5K33A 4JM2C 2I27N 1AP2A 1H3VA 5I8KH 4UV7H 5F9JA 1HDMA 4JHZA 3HNTH 3B9KC 1MRDL 1VESA 4K7PX 4POZD 4AG4L 5IR1A 3U0WH 3MXVH 1VPOL 1E4XH 2NXZB 2WIIB 3P77A 5ID0B 5C08D 3M8OL 4GJTB 4JO4L 4JFDB 1X44A 1ZE3C 3BSZH 4PJGA 1XCQB 1NLDL 3ARGD 1GZPA 3H3BC 4DZ8A 3VFMB 3BPCB 4Z7WF 1CLZH 1QFUL 2Z35A 3MJ9H 3OAYK 3HFML 3CX5J 1R3LA 3AM8A 1GGYA 3FT2B 1RJZA 3VFUA 1P7QB 1SJHB 3R06A 3UYRH 4HUKB 2GI7A 2HA1A 1X4ZA 2X09A 2X41A 3MZTA 3U4BH 4MNGE 5KS9A 4LHUA 5HJ3A 2H8PA 1V3MA 2APTA 4JR9L 3B6SA 4DGVH 4HWUA 2NW3B 3DUSB 1UB5B 3BE1L 1HH6B 3BPLC 2NXYD 1INEH 1FP5A 1BAFL 2OJEB 4KKCC 4KROB 2EH8L 3HE6C 4BQBA 3F12A 4QRPB 1CU4L 2NTFB 3LB6D 5DJDB 4ERSH 2P43B 1FLRH 5IVXF 5E99L 1NANI 2AJYH 3GJFH 4K55A 4F37K 3MRIB 5F96H 3RRQA 3SE3C 3KDMB 2XY1A 2E6JA 4OZHA 4FQJH 4WU7A 5CGMA 1NC2A 4BH7B 3ARBB 4BFIB 1J1OL 1ZKAA 2BVUA 1I1AC 1VACB 5CUSH 2IPUG 1KB5H 1FV1B 3O41A 5F3BA 2BX5A 1PG7H 3QULB 2CLRB 2W0FB 4FTVA 3EKCA 2VDML 3GFUA 3PL6C 1I3RB 4XXCA 1PSKL 2X7LB 3IFLH 5EOCH 1KTKE 3MLVL 3VI4F 4PJFF 3HG1B 5JHDD 2HTKD 3DX7A 3TO4B 2O5YL 3O6ML 5DD6A 3K8KA 1NBQA 3HMXL 5IJVB 1SEBB 3KS0H 3UJTH 3QCUL 1UWXH 5J12C 1DLHB 3QAZC 4RMWA 4YO0B 3S98A 4TPRH 4XCCH 5E2VL 3RBSA 3EOBA 2QADB 1LK2A 2K7QA 4OIIL 1TJIH 1G7PA 2XKNA 3LN5A 4DVBA 1FPTH 1D5IL 4NJAL 4FXLA 1BFOA 1JWSA 4GG6A 4X80H 2YPKA 4MCZA 3FQUA 2AAVA 3INUH 3OF6A 4YBQC 1H3WM 1CICC 2DQIH 5IBLC 4NQED 1QFWI 1RZKL 2ZJSL 2NNAB 3DECA 3KLSA 4ESKA 3RIFK 2IG2L 5IB3A 2FEDD 3IXTB 1CDIA 3FCTB 4JJ5A 4F9PC 3P11L 1M7IB 3W2DH 4OZFA 5BS0B 1IILE 1LEGB 4YUEH 4Z7UF 5I1IH 3MJ7B 5D1ZC 3GSRA 4FFVC 4M4PA 2XZCL 4QYOA 3QQ4A 8CGTA 2RR3A 2EIEA 4JO1L 4U1IB 3WHXA 5TE4L 4LAJH 1LVEA 5HDBF 1UJ3B 3GI9L 4XPGH 5J9PB 3JWDC 3SCMA 4JO2H 1UVQA 3QJFA 2CSPA 3EJJX 4MNQE 2Q7YB 3OTTA 3MR9B 4K3EL 5J56B 2BSED 4RQQB 4FABL 3FFCB 4EZMA 3NZ8A 2W0KA 5IHUL 4QWWD 5JIPA 2X4SB 4U6VL 2VDLH 3EFDH 4D3CH 3NA9H 5GS2D 3CAFA 1NCAL 1SY6L 3AU1B 3V4VH 3HAEH 3B9VA 1FJ1B 4IOFC 4PJ5E 2AK4E 1FFNB 1IGYB 4FQ2H 4FQXA 5I1DA 4M1CD 1OD7A 2YUXA 3HE7B 1F4HA 1I9RL 2P5WE 3D39E 4BSWA 4Q9RH 3DRTB 4G6FB 3RWCA 4MXQD 3RA7H 3P9WB 2KPNA 3W9EA 3NIGF 4QRRA 2HMID 1ZT7B 3MRFB 2B1HH 3C5ZC 3V5KA 3L3JB 4UIMA 2IPTL 5D70L 1U92B 4MD0B 2EDDA 2B5IB 2BHYA 5LKNA 5BZDA 3OKOA 4B7IA 1ZGLM 1OAKH 5C0BB 1F2XK 3MLRH 1A7PL 1N5YL 3GM8A 1QA9B 4WI3A 1OF2A 3V6OA 4EUPG 1SBSH 1UACL 2COQA 3QPQD 2X1OA 2CR6A 4APQA 1LO5A 3JWNC 3KAAA 2WBWB 5D7LD 3KPSE 3BDYH 4BQCA 4MYWB 3E8UL 4FMFA 1OGAA 4CVXB 2VXQH 5DJ6A 1XGTB 5F1NA 1RJLA 2HH0L 1RIUL 4PRID 1T3FB 4P46D 2DTSA 1KACB 1M7XA 3OZ9H 3QDAA 1A4JA 3KYMA 1KEML 1MHPH 3TM6A 4P2RE 5DMGC 3W9DA 3MRRB 2Q87A 3FOMA 3FQXB 2IANA 4J4PD 1KJ2L 5KBNC 4MD4A 5L88H 4ZOBA 1GCFA 3ULVC 2J5LC 4PJ7B 4XP4H 4ZPVA 3C8KB 4OCRL 4PD4J 1G6RH 4PLOB 5C08B 1R5VA 3REWA 3CFDB 1Z6JT 3AM8C 3BKML 5TE6H 3IFNL 1QSFD 1QVOB 5FB8B 2FJHB 43CAA 1BZ7A 2ESVB 4P3DA 4HBCL 1BGXL 2OBGA 2BSRA 1NCBL 3QNXA 3IETB 4KHTH 4ISVB 5DVOA 1L7IH 4KKAD 2CK2A 3PWUB 2VLLB 3S5LA 1Z9OA 5LAXA 2IWGA 3KJ6L 8FABB 2IQ9H 4DW2H 4F7MB 3C8DA 4QXUH 4JY6B 2BHZA 3RX5A 1CIUA 3QEHB 2V17H 5CZXD 2P5ED 4M7LL 2LE9A 4IRJB 1HSBA 5GS0D 1QUNA 2EDEA 3KXFA 2UZIL 4Z8FH 3QDME 4N90D 5J0BA 3HB3C 4JANA 1MREH 4KMLB 2ADFL 3PQYD 4JDTH 1H8OA 4HIXL 2BXZA 4NSKA 5E24E 4GH7B 2FL5B 4GW1A 5JIIA 2ED9A 2J8HA 1C08B 1FIGL 3OJ2C 5CEYA 3P4NB 2Y06L 4PJAF 2Z31D 3W0WA 1A6UH 4I8DA 4RNRA 3OWEA 2FH6A 1JBJA 4Z7VF 3WJLC 5HY9B 4JFDE 5IM7B 4R6UA 1JIBA 2VZTA 4A6YL 5JW3H 4Q97A 1NMBH 4J6RL 3JWDL 1MHEB 1HYSD 4XXCC 3FQNA 1F90H 1FG9C 4LVHB 5AEAA 2O93L 1U8HB 1INQA 2X4QB 1AGDA 4MJ6A 5IMKB 4Y5XB 3IGAA 1OT2A 3L3HB 4JFZH 4X4MA 5HYQA 2RGSA 3NFSL 1KYOJ 5JO5A 1D9KB 5IW3A 1V7NL 5E94B 2A38A 1YNTB 5DA0B 2W1NA 1A14L 2BNRD 1TCMA 1R24A 4LU5H 1IGFL 2Z0BA 4MJ5A 4PGZA 2MQ3A 2BMKB 5LGJB 1DUYA 4YHOH 4JLRA 1ADQA 5ISZA 3QFJA 3UBXI 3KPRB 3CH1B 2VDQH 1YJDH 4WHTB 2DDQH 3ZT5A 1BFVL 5T1KA 2P47B 3OKLA 4GKSA 4WNQB 4IOIB 3D85D 1Q9LB 2ZZUT 2NX5A 5F7FA 32C2B 5EUOA 3O3BB 4D9LL 3MRNB 4J2XA 5IW1B 4XVUD 3L5XL 2VLKB 1MFDH 1J0JA 2P46B 1RZGB 3FQTB 1JE6A 1UM4L 4WI9A 1M05B 3OAZK 5FA3A 5DQ9A 1JTOA 4D8PB 4BZ1H 5T1LD 4UT7H 2MJWA 3QPXL 4IRZL 2Z4QB 4FQ1L 2F54D 5IB2B 4R90L 5KSBF 4EIZC 5IROC 2CRIA 1FVCB 3WD5L 4P4RB 2VE6B 4LBEA 1P53A 4R0LC 5GSVA 3TV3H 2WQRA 1NUFA 4KK5C 3HG1E 3RKDC 3L5JA 3SCMC 3Q6FA 4CVWA 3CVHA 4IRSB 2CUIA 4RIRB 5F88B 3BGAA 4PJCB 3V8OA 5B39A 5E95B 4E9LA 5I1KL 4K2UL 4NZTL 1YQ2A 3JTTA 5ICXA 5FK9A 1QQDB 3BIKA 1A7RL 3NCCB 4G7YL 2YD4A 2V2WB 3MJ8A 4LASH 4HT1H 2BERA 3ARQA 5TF1H 5E6IB 2BVPB 5KN5B 1JRHH 3K4ZA 3WLBB 3VXOB 3QEUB 4XXDB 1VGEL 4KDTC 4G9FE 3ROOA 3OR7A 3V0WL 1S7XB 4ELKA 2Q8BH 1RUKH 4WTZG 4OI8A 2FWOA 5J3HC 5K9KA 1Z9SA 4OCSH 4UQ3A 2A74B 1MIMH 1LP9A 3TWCH 3AMLA 5HXMA 2J6EL 2XZZA 4LFHD 7FABL 1FN4B 5CGTA 3F6LA 2AJ3B 5BS0E 3AS1A 3BFOA 5FUCE 1INDH 3RVTD 1IQDB 4JDZB 2E9IA 2P49B 4JGUA 4X6DB 4HDIA 3RWFB 4F8TA 1JGVH 3VI3E 5IP4A 4OLVL 3SGDI 5IFAL 2C5DC 4M62H 4NM8L 1MY7A 3PDOB 4FZ8H 3U7AA 2VLJB 2OL3L 3UCRA 4H88H 5BVJA 5E08H 1BM3H 5I1CL 3OKMA 2BVYA 3CFJA 3U7WH 3HAEA 4L8SA 5EU6D 1KPVA 2O5XL 4KQ3L 1CF8H 3FFCE 1A2YB 4O4YH 4LVNB 4KRNA 2DQGL 5EFIB 2ICES 4O51A 4P46B 2ITDB 3ZYJA 5MI0C 5C0RL 1MAJA 1QBML 1V5JA 4ZAKD 1F11B 3PNWA 1UZ6E 1J18A 4M3KB 3PP3H 1UQSB 1DBKL 4GAYA 1JTPA 1VFUA 1C5DB 4P2YA 5E6ZA 3GJEA 1UCTA 4Y4KD 4I13B 4FHBD 5CSZB 3VFNB 3HRPA 2ARWA 4U1JB 5ECJE 3QUMB 4OZIF 2VXUL 1L6XA 3QEQD 5I1AA 5LVEA 3TVMD 2X4TB 3I6KB 5C0BE 2GSIA 2FX7H 3ARYA 1RD6A 3VMOA 4GRWB 4NN5C 5EBMA 5JOPD 5CAYB 3G6JB 3HC0B 1EEQA 4KZDH 1VFOA 2H6PA 1B0GB 2P5EB 5TDPB 1R3JB 1T5WB 3IYLW 5KW9H 4LMQI 2EDTA 3WN5A 1IGCH 3CUPA 4AT6B 3P4OB 1BQLL 1AGFA 1DBAH 3RUGF 5BV7L 4X6EA 3W82A 4HH9B 4JPKH 2GTWA 3L3DA 3V4UH 1UA6H 3O11A 4LSSL 3TJHC 1YEJL 2AW2A 2WLZA 3QA3A 5A1AA 5SWQB 3I9GH 5C08E 2H9GA 3NGBC 1XH3B 1OP3H 3J8F7 5E00A 3BPNB 4BZYA 4X5XA 4RMSA 1NGYB 5C6PB 2ESVE 4S1SL 4KK6C 3BKJH 1FL3B 3DUUB 2KBGA 2NY2B 3QXAA 4Y5VB 5E4EB 2MSPA 2FX9H 3C8HA 4JQXC 1N0LA 2BDNH 5DSCA 3SE9H 2D0HA 3VE0B 2BNQB 4Z95L 1FFQA 5ICZA 2FX8L 1DBJH 2EDRA 4DVRH 5GS1B 4U1LB 3T4YB 4EDXA 1RJCA 5C7XL 1FC1A 2BOBB 4GBXA 4YAQB 1NGPH 2XTJC 2W92A 3MNWB 3MRQB 4MLIA 5I18L 4P5TD 3K2UH 5D1XA 1BIIB 1AGBB 1CCZA 3VXPA 3BW9A 4Y5YB 4N1EA 5E1HB 3FMGH 2NYYD 4EBQH 3HZMA 1U93A 2EIBA 4Y19E 1MLBB 2ICEA 5FKPB 5C0EB 1WCQA 4HIHA 1N26A 4PJBB 1GIGL 1Q72L 3MRMA 1F6FB 3FT3B 5AYUL 4Z5RA 4Q6IB 3IJHB 4WW2A 3JV0A 1OARH 4E41B 4M7KL 5DWUL 1AKJB 4U1HA 1FDLH 4AIZB 3MA7A 4Y4FB 3RWHB 3F7YB 4X8XA 4WCYH 1QNZL 2IQAB 5F71A 3SDAA 2DQHL 3DVGA 4LVEA 4UUJA 3U30B 2UUDK 1PZ5B 5IQ9B 3O6FC 5CJXC 1S7TB 4MA1C 6FABH 4ZODA 5DJXB 5TE7L 2FYYB 3G5XB 5E8NA 5E8EB 4HJGA 3IRZA 1CVRA 3DBXA 1ZLUH 3IAQA 4R2GC 4S1DD 2EXYD 3NPSC 3TBVA 3KPRE 4GAFB 4X4XA 4NZRL 1SHMA 1WTLA 5T3XH 2F58H 3DNKA 3U2SA 4M48L 2BVTA 1TQCC 3F58H 4HK3N 1SJEB 1QSED 1XGQB 3GIZL 2VN7A 3FB8B 4XP1L 5F7KC 5GRUL 1JGDB 4P2QB 3HI1A 1CZ8H 2NY1B 2VLKE 3ROLB 5K59E 4JHAH 5DJYB 1DFBH 2R56L 1PEWA 2X9XA 4XC1H 2WUCH 3X17A 3MRJB 3U0WL 3MXVL 1U8QA 1E4XL 4ZPTA 5SWSA 4Y4HC 2BC4A 4PUBH 2QL1A 4PJXF 1XGUA 3WUWB 1FFOA 2R0ZH 2AKRB 3D69B 1NC4D 2OTUA 2Z93A 2EE6A 1HEZB 3I6LD 1T03H 1ZVSB 3MMEA 3MCG1 3C5JA 4OCWH 5A16A 1RIHH 1S9XA 1PGRB 2I07B 2EYTB 1BJ1H 1CLZL 3OHXB 5FUOH 1FVEB 3LKPB 4PGEA 1QYGL 5M7QA 3MJ9L 4JFOA 5MEOB 3MFGB 2X1XR 1AIFB 2VZ3A 3FO1A 4JCLA 1IMHC 4FXKB 2R1WA 1HHIA 4ODUA 2ZSWA 3UZQA 3B83A 4AEIH 3QFDB 2O5ZL 3DGGB 4U6HB 5F70A 3O2DA 4PIRF 4WJ5A 4PV8B 1FZOB 4QY8A 5B8CA 1XIWB 5EU5A 3VFGH 1INEL 4MX7A 5I75C 4G9DB 4PJ9C 3MLWH 4P4KB 1FG2A 2FO4B 4B50A 4ERSL 2E9WA 3SDDA 4NQVB 3D0LB 4ZAKB 2AJYL 5ANMA 1VFBB 4XVTH 3U36B 2OR9H 4HC1L 1OAXH 3D18B 5LQBH 1S7RB 5ESQA 3BRGC 2APXA 4Y4KB 4G6MH 2ZUXA 4BH8B 4MWFB 2PETA 5KVGH 1KB5L 4AENA 4PJHE 1ZT4B 4R8WL 1DQMH 4X6DE 2GFBB 2DYPA 4D9QD 4P57A 2WK2A 1LD9B 1HCFX 3BD5A 3O6KH 5EOCL 4LHJB 3IFLL 1FYTD 1IAIL 2NY5H 5IB1A 1OW0C 2VLJE 1DLFL 5HYSB 3NCJH 3PF2A 3RWJB 4NQUA 1DR9A 2RB8A 1FZKA 2YSSB 3WN5C 1Z0MA 2B8OT 1I9JH 5HHNA 3G5ZA 4JRXD 3E6HA 2HKHH 1DEDA 1U8LA 1L7TL 3NH7H 2HFGH 5JIKA 3TBWA 1NCTA 5E7BA 3S35X 1NFDA 2MPAH 2FATH 4Z7WB 1A6TB 3P4MB 1FGVH 3CMGA 4JFHD 3O2WH 3RWGA 2PYED 4KV5F 1F3DJ 1FPTL 1I7TB 1G9NH 3KLHC 4HWEH 1W8OA 3VXRD 4X80L 4KKBC 4URTB 4FMKA 2ATKB 1I4FB 1HKLL 1GJIA 1VFAA 1FZJB 1FO0H 1AO7A 1ES0B 4U3CA 4AEHH 3SBWC 5KANI 2H1PL 2FB4H 5C0GA 1ORQA 3RX8A 1DN2A 2HJFB 3TBYB 4R4BA 2EYRB 3HC3H 2C3XA 1HWGB 1P4BH 4ZOEA 1BEYL 1JTTA 4PLJC 5CEXB 4KZEL 2GCYB 3W2DL 3EOAB 1DTUA 3TP4A 5C0JB 3HR5A 3H6JA 4YUEL 5I1IL 4GRWE 3T8XB 3ARRA 5IVXB 3L6FB 3G6JE 3JV6B 1IAOA 5E9DD 1XF2B 1JGEB 3QQNA 5FECA 1EVTC 1ZWIA 5L2KE 3VGAB 1WGOA 5JZ7D 4JO2L 2OZ4A 2YBRA 4YR6B 2GJJA 1BF8A 4Z77B 4Y16B 4OFYD 3EBAA 1ZEAH 5GJTL 4P5TB 4QRUA 4F57H 3GHEL 3BP5A 5DTFA 2CRYA 4WWKA 1IJ9A 5IIEA 2VDLL 1N2RB 2ZCLH 2VH5H 4D3CL 5DVMA 4PJFB 4CADB 1RI8A 1JZ7A 1YEDB 4QTIH 1I85C 4HS6B 4HCRH 4FQ2L 1BBJA 4M1GH 2HFEB 5J11B 1B0RA 2ZOLB 3UTQA 3JZ7A 3QSKB 2AV1A 4MJ2A 2AJXH 4WEBH 3T77B 1QLRA 1LO4L 3RA7L 2ADJA 4Q9CA 2R8SH 1YJDC 5DURB 2Q20A 3ILQC 1D5BA 2KKQA 1NANH 3UEZA 2X70B 5IMMA 1CD1B 4NRXA 2BNQE 1MI5A 2JCCA 1ZA3A 4CVUA 1FAKT 4JZNA 3LPWA 1P7KB 2KH2B 2RCSH 4ORGB 3L3OB 3QDHA 2ZCKH 1E6OL 3F7RA 1FNSH 2B4CH 1GGIH 2FSEA 2OR7A 5KSVA 3TGXA 3BDYL 1YEEH 1LO3H 3ZHKA 5AD0B 3BMWA 1WT5A 4PRNA 3LQZB 3HPLA 2VKWA 4WENB 5GGUB 2P1YA 4MJIB 4GRLD 5FKAA 4Z7UB 5I19H 3OZ9L 3QWOA 5I6XC 3X11B 5CJBA 4XNQB 1QSEB 4P3WA 1I8LC 1MHPL 1YDPA 1T22A 4MA3A 1WZ1L 3QUKA 1ED3B 5EULV 4PJBE 3WFCL 1GC1C 1CD9B 4OLYH 4PRHE 4XNYH 3VFOA 2I25N 5HGDB 1S3KH 3EO9L 4LLQA 4WVRA 1G6RL 1HH9B 4D9RE 4E41E 4DCQA 2R2EB 1DQLL 2FHBA 3MRKB 3VFSB 4LEOB 2YK1L 1NC4B 4HJJH 1R3KA 1CN4A 4EI5D 4ZFOA 5T1MA 5DRXB 1N3NB 2EZ0C 2WBJB 1M71B 1GVIA 5TPWH 3BEVA 4I77L 5L2JB 5KAQF 3WSQL 3C60B 1DSFH 3TNNB 3ULSB 3EO1A 3RGVD 2JJVA 5B8CC 1FNAA 2GUOB 2IQ9L 4DW2L 5L6YH 1ZLVK 2B1AH 5GRWA 3VXMD 4QHMB 4QXUL 1UGNA 2YZ1A 3MUY1 2D03L 2V17L 3FO9A 2LQRA 1YPZF 2NY3D 4CMHB 5FO7A 4PP2B 4DWHA 3O45A 3T0EA 4PR5A 2JKXA 4UT9H 4ZFZA 3T3PF 1U6AL 3TT3H 4HG4K 2IH1A 4JDTL 5IHZB 4P2QE 1QEWB 3G04A 5DJ8A 2QTEA 3R1GH 4PB9L 2MTPA 4NHUA 1CTNA 3CK0H 4I1NB 3QQ9D 3ME0A 3U46B 1MOEA 1LEKA 4ZD3H 1OTTC 4XH2A 5JA8B 4G8EB 3N1MC 3V5DB 4JGMA 3OPZH 4GW5A 1QOKA 5JW3L 1YQVH 1NMBL 4KHXH 3BGMA 1CICD 1NJ9A 3HI5H 2EDJA 1KCVH 1Y18A 2Q1EA 1KNOA 4PY7B 4XRCB 3T09A 3ALWA 4W68A 4HH8A 2A77H 4XBEH 1NAML 3GSVA 3OKEA 3ULUH 3QIUC 3VFRB 3ARPA 2H32H 3BN9D 1U8MA 1NEZG 1UKSA 2VLRB 2JTDA 4FFVD 2FHCA 2C1PA 2CKBB 4LU5L 2BY0A 3B8SA 1GXEA 1G9MH 5H94B 2EC8A 1BWWA 3FT4A 3BKCL 4YHOL 3GSUA 5DC4B 3S9DB 4D0BA 4G43A 1ZT1B 3O3UN 2VDQL 1KJ3H 1GOHA 4L8DA 4DN4H 1BREA 2ICWI 5IG7B 4ODBD 4M4RA 4XWGL 5DI8B 3DI2B 4PB0L 3OB0K 3VFWB 3VXRB 3GMPB 1Q9KB 3FB7B 1YYML 2Y5TA 3FRUB 1MFDL 5DO2D 1CGSH 5FYJH 5AUMA 1U0QA 5GRZA 4BZ1L 3TN0C 5L0QC 4UT7L 3GNMH 4GXUN 4U1KA 4RRPG 2ADIB 2GKIA 3VD5A 1FH5L 1B4RA 4FQLL 4CJ1A 1U41A 1X4YA 1IGTA 3WHE0 3TV3L 3C5ZD 5ID1A 4S2SB 3C08H 2NY0C 4CNIA 4PJAB 1KLFA 5BXFB 1SYSA 3TBTA 4KI5D 4MA7H 4QRQA 1J86A 5JOEA 3VJ6A 1AQDB 1LEIB 2BVOA 4KQ4H 4Z7VB 4HXAL 1IEAA 5EC2A 3RL2A 3QI9D 2GY7B 1UKTA 1BVLA 5DFTA 2VDNH 5I66A 5I2IA 4Z7WE 3KYAA 4LASL 3HUJB 5TF1L 5DGQA 3ARFD 4KAQH 5DJCA 2FD6H 4L3AA 1U36A 3HCVB 5HVWA 2VSCA 4RMVA 5GGSY 4L4TD 1MHCA 1OP5H 3P0YH 1RUKL 1AI1H 35C8H 4OCSL 2BFVL 3BX7C 1MIML 1FGNL 4NPYB 1BLNB 1K4CA 1JPGB 3B9KB 3MSPA 1H3UA 1L0XA 3TWCL 2QR0A 4LCUA 1T1WA 5EIVA 3MRCA 4DOHB 1II4E 3BGFC 5C0AD 1LDPL 3EYOB 3BQUA 1I1RA 3PP4L 3VW3H 2YWZA 3QWQB 3DURA 1A6AB 3EHBD 1DVFA 3VDAA 4M62L 3RTQD 2PCPB 1MFEH 3RVUC 4FZ8L 3F62A 3ZO0A 5CINH 1PYWB 1TJGH 4H88L 4OF3A 2XPGA 5EBWB 5C6TL 3KWWB 2PW1B 1BM3L 4JKPH 4CN6A 1X5YA 4O9HH 1HHHB 3U7WL 5DEFA 2P44B 1CF8L 4NOFA 3B5GA 5KSBB 2XZAH 4O4YL 2NLJA 4K7PY 2GJ6D 4M02A 1S5IL 2ITCB 4KJPC 1HHJB 4NO5A 1IAIM 4PJFE 5C07A 4DKAA 1ITBB 4NRYA 5CZVL 3BPLB 4EQ3A 4XZUA 3MGOB 4PRBB 3GSQB 4MAYC 1MH5B 3QIBD 4M61B 1XF4B 2AABH 3HE6B 1X9QA 1FL5A 3Q2CA 3TBSA 4GMSH 2H2SC 4TVPE 3BRFA 1A4KA 4TUKL 4K3GA 1OTSC 3BP7A 5JDJA 3NFNB 4OSUH 5BQ7A 4GAGL 4M9OA 2G60H 1S9YB 4RGND 1I1AB 3D39A 2GITB 4GG8B 4LRIA 1Q0YH 2FX7L 3MLUH 4HAFA 1VKXA 5EBLB 3OKNB 3E6FB 2KZ1B 1AHWA 4E5XA 2C4FT 3PL6B 1J0IA 2Z8VC 1EFXB 1FNEA 3KLAA 3U7YH 5I8EB 43C9B 3T0EC 4IMKC 3VXMB 4WRLA 3RI5F 4OZGF 4UT6H 4GMTH 1WEJH 4MJIE 3X13A 5C3TA 3W39A 4HIIA 4ZUUA 5EZOL 1AE6H 1IGCL 2XQBH 5J12B 3QAZB 1DBAL 3D2UB 1JNNL 3LN4B 1A1MA 2DI9A 4OM1L 3ZDZF 5IEHB 5ALCH 3S4SA 1UA6L 4I3GA 5EORH 5HHVL 3VXUD 4BSJA 3IJYB 4M1DL 4I0PA 1KB9J 3E3QE 2C9AA 4CVZB 1KJVB 3CIQA 1CICB 3GI8L 3GJFK 1EGJL 4LSDA 5LGHH 4NT6A 3VWKC 4IDJH 4WFHD 4LSPH 2YMXH 4YZFE 4YIQB 1HQRB 3BKJL 4GUPA 1K5NA 4GQ9L 3S34H 3PGDA 2VR9A 2PKDA 4KRMB 5L8KB 4OLWL 1N6VA 3TH4T 5CILL 4J1UA 3RJDA 1MLCA 4AK1A 5EIIB 1XGRB 2PO6A 3IDNA 4NO2B 5D1ZB 1DBJL 3G08B 4WWID 3WEXA 4LNRA 2VDPH 3U4EA 4ODXB 1OTUD 2QSCH 5LWYL 4XPAH 2P45B 4XCNB 2P24A 3NIGE 5DYOA 3V9FA 3WIHA 1MCFA 1NGPL 2BK8A 4X9FA 4A6YB 4OZIB 4X4YA 4WDIA 4LCIL 5AWNL 3VD3A 3BH8B 3I50L 1A7BA 1G0XA 3P2TA 5F8QC 1NUNB 2ILLA 4IS6B 1HILA 4R4FH 3ZSTA 5HVGB 1UWXK 4MB4A 2NY5C 3GRWH 3QJHA 4EBQL 3SDCC 1MWAH 4JO3H 2IJ0C 3QDMA 3W81A 5IQ7H 5D71H 4U1MB 1GGBH 1I3VA 3WIIL 5JUEH 3V4PL 5J3HD 4Q9QH 1BECA 4NC1C 2VKXA 3MGAA 3ZT6A 4BJLA 4ONGH 4LKCB 2Q6WB 2WIIA 2FGZA 3FONB 3L7EA 1OLZA 1A47A 3GKZA 4U0RC 5SV4A 3RUGB 4CW1B 1EO7A 1F13A 3HKFA 1KJMB 5ID0A 3B5HA 4JFDA 1XCQA 3PGFH 3C5ZB 5KSAD 1ZA6B 5JA9A 2VLRE 3VFMA 4O5LL 6FABL 2XOTA 5CIPH 3WFEH 2G5BB 3FFDB 1CDHA 1JPSH 3KYNB 5BVPH 3HZYB 1NCNA 1TZHA 1G7MB 2OMBA 5IBUB 2VTFA 3WXVH 1P7QA 1SJHA 2UV3A 5H8DA 5T3ZH 3QUYD 3V95A 4CMMB 1QPXA 2F58L 4MZ2A 1T83C 4LNVA 3F58L 4HJ0D 4LSUH 4M43H 1A0QH 5JOFB 2NW3A 5F9JB 4GW4B 1UB5A 1HH6A 3TEUA 3BO8A 1RZJL 1CZ8L 2OJEA 4FNLH 4L4TB 4YBLC 5IR1B 2EH7H 3P77B 5J6GB 1DFBL 4XC1L 3SDXA 5IWLA 1U91B 4QRPA 5FUZH 2NTFA 4W4NA 5DJDA 3IJSB 3BQUC 5D2NC 4PJGB 4PUBL 2D7QA 2L4OA 3MRIA 3WUWG 3UTPE 2NPLX 1GZPB 2J5LB 4DKFL 1PLGH 4BH7A 3ARBA 1B9ZA 4HPOH 4OCWL 5C0AB 4UOW0 5F7WC 3EYVB 2VLME 5FUOL 4PJAE 2I9TA 2MOVA 1P5VA 1CLYH 1H15B 3R06B 3QDGD 1FV1A 4N1CA 1F4AA 3QULA 4HMCA 2CLRA 4Z7VE 2W0FA 3A67L 5D9SB 4LHUB 1I3RA 1F5WA 3B6SB 3HG1A 3VA6A 1QBLH 4HW6A 3TO4A 2IBZX 3HUJE 3UTOA 5IJVA 1SEBA 2LTQC 2GJ6B 5LGKA 2JK5B 3N50A 1K4DB 1DLHA 3O3DB 3RPKA 3B2VH 5GRVL 3O9WC 5F89B 1MPAH 2B4CC 4MSWB 3BEWB 3SPVA 5BRZB 1OAXL 5TQ0H 1EJ6A 4DAGL 1YMMB 3RIAF 1IC7L 1TJHH 4LRIC 1IBGH 1EEYB 5IB4B 4DOHE 1NAKH 5J06A 2AXGB 3EGSB 1AHWC 1PVHA 1U2HA 3RY5A 1YC7A 3ZDXF 1HE7A 1J8HD 1PEZA 2A73A 1KCKA 2DQJH 2XTLA 2NNAA 2W60B 5I1HH 4KK6D 4JFED 1JJUA 5GS2H 2BVEA 3IXTA 2AJUH 2NY5L 3FCTA 1M7IA 5DD6B 1VERA 1MELA 3MV9E 1T66D 3NCJL 4OUUB 1MCCA 4QCIB 5BS0A 4HIEA 3K0WA 1NLBH 3MJ7A 3CCHB 4XTRD 4OGZA 4PJXB 3GHBL 3ARUA 4Z7NF 2J7LA 3K46A 3LKNB 4U1IA 3NH7L 3UBXA 4FFYL 3ZT7A 4IBLT 2HFGL 4OCXL 4UOJA 4Z6AT 4BUHA 5DUBA 5J9PA 4LQFH 1DN0B 2YEZA 2FATL 3IU3B 1BFOB 3N1FC 1FGVL 3EFFB 3MR9A 4RQQA 2YPKB 4MCZB 1G9NL 1WSST 4NQDD 4HWEL 2VABB 5EOQH 4F9LC 4LSVH 2VDKH 3VXUB 4XCYA 1RPQA 4WI6A 4M6NH 4P3CH 1OOAA 3AU1A 4YGVB 4QXGH 1FJ1A 4ZOCA 1NGXB 2FB4L 4JCMA 1FFNA 3O4OC 4JJ5B 3DOSA 3HNVH 3HE7A 1ACYH 3GMNB 3RY6C 4EIGB 4V2BA 2PO6C 3DRTA 4LLMB 2HFTA 1ZHNB 5FYKL 2X6MA 4QYOB 5J4MA 1CT8A 5BV7B 1ZT7A 3FN9A 3MRFA 5CP3A 1K6QH 5F1KC 4R0LB 1RUML 1U92A 4MD0A 1AQKH 3SCMB 5CJOL 3QJFB 5C0BA 3Q5TA 2IPKB 5HHXL 4X6BB 3L1OL 1TCRB 1QA9A 5HD8C 3HLAB 1KV3A 3A6BH 3RI5K 1ZEAL 5CJ5A 4ZUWB 1G6VK 3ULUC 4KVNH 1XGTA 2V5TA 5E8PB 2Y9RT 1T3FA 5I1DB 2LV4A 5CGYD 3UJJH 2MWCA 2HAZA 1HZHL 4YK4C 1QRND 2E27H 2CLZB 1G9MC 3ZKSD 1A3LL 4J8RA 4WEBL 3GUTB 3FQXA 3TIDB 4RZCB 4OV5B 1MIEH 4QRRB 2XN9B 4RDQG 2R8SL 3MLPA 4Y1AD 5GS0H 5IVNA 2DAVA 5JXED 4PJ7A 5HDLA 3C8KA 5C08A 1QBAA 5K9OA 3CFDA 5HGAB 3IDMB 3NIDF 3AROA 1OF2B 1P4LA 1QVOA 5FB8A 4KMQA 4WUUB 1KN4H 1LO5B 5I0ZA 2DQUH 2ESVA 4MQSB 2ZCKL 3VXSD 4XMPL 1XT5A 1FNSL 2B4CL 1GGIL 1MCQA 3RWIA 4FQPA 3PWUA 2VLLA 1YEEL 5HI4C 1RJLB 3CFCH 4OZIE 3BT2H 4OCNC 4LOUC 8FABA 1HYRC 4F7MA 1A4JB 2VXTH 2WAHA 3RAJL 4IMLB 5CP7A 4EUPH 5IKCB 1UEYA 4NQCE 3ZE2F 5CEZE 3ETBF 2QEJA 5MI0B 4UU9A 4BUGA 1MJ8L 4OLYL 1I7UB 1S7SB 4XPHH 3ZYIA 1P4IH 1YEHH 2FL5A 1S3KL 2R69L 1S5HB 1C08A 1KN2L 1IQWL 3G5YB 4CU8A 1CDUA 3RUGE 1BZ7B 2A2QT 1ZANL 2AJSH 5HY9A 5IM7A 3MV8B 4QXWA 1YUHB 2BSTA 3RZWA 4X7TB 1SVCP 5DD0H 3S5LB 3HRZB 1U8HA 1ZTXH 2X4QA 5TPWL 3QDGB 3C6SA 1DSFL 3L3HA 3FZUD 1CD8A 4S0SD 3MBED 3KVQA 2EO1A 5BMFH 2B1AL 1MCIA 5DLMH 1HSBB 3DV6B 5JHDA 4X9GA 1FRGH 4OD2B 4Z0XB 1D9KA 3Q0HA 4JANB 2EDLA 1BIHA 2QADC 1IGIH 2CMRL 1KLGB 1PD6A 4DKEH 5JPMB 1J5OH 3KPRA 2R9HC 4KJWD 4O02H 2Y25A 3CK0L 3W0WB 2ATPB 2AXFA 5CSBA 1FC2D 4WNQA 4IOIA 3TYFB 1Q9LA 4RNRB 4ZD3L 2F5BL 5GZOC 3KLHD 5DQDH 4PJGE 1UH2A 3L7FB 32C2A 3O2VH 1L0QA 3O3BA 3MRNA 1YQVL 3ULVE 3FKUS 5IW1A 2VLKA 3T1FA 3HI5L 1KCVL 1WC7B 1RZGA 4ZYKB 4WHYG 3FQTA 3PP3K 3NGBB 4PGDB 4NQEA 1GHFH 2BCKB 1T7XA 4D8PA 4RFEB 5E2JA 4PG2C 2A77L 4JVPA 4XBEL 4UV4H 5JO5B 4PLJD 4CN4A 4RRPA 4NJ9L 1QZ1A 1JCKA 2XWBB 3LIZH 4LARH 5IB2A 1FVCA 2X4RB 4P4RA 1Q94B 3VWJD 5KS9E 1AR2A 4RCAA 3TPKA 4BQ6A 1ZS8B 2DKUA 3QB7C 2AEIT 3GJFB 4WHDA 2VITA 4IRSA 3WL9B 2LVCA 2CK0L 5F88A 1G9ML 4PJCA 3ELAT 1CGTA 1T2QL 1FNGB 2F53D 1U8OA 3BXNB 2ICCA 1QQDA 2NX5B 2XTJB 3I3BA 2V2WA 5FM4A 2R0KH 5EO9B 5KN5A 5BRZE 1FYHB 3HE7C 1XF3B 3VXOA 2QQLH 1YMME 3QEUA 3ECBB 4XXDA 3LHPH 5FYJL 1S7XA 3EDEA 4JPWH 2GW5A 1KCSL 4UMGA 4M7ZC 3ZKMC 4J7RA 4NO0D 1EHLH 1TETL 2A74A 4LBEB 2QQKH 2FIRT 4P2OD 4AL8H 1FN4A 3CVHB 3K80A 2J4WL 1OP3K 2XZQH 2AJ3A 3C6LC 4MA7L 1IQDA 3JTTB 4JDZA 5ICXB 2R0WL 4KDVA 4PJXE 4X6DA 5ESAA 4AYFA 5FK9B 3RWFA 4ZTOL 2DM4A 3IFOB 4FOMA 1PBYA 3O6FB 1G7JB 1LO2L 3OGCA 4MA1B 3PDOA 1D6EB 5BZWB 3MJ8B 1NDGB 2F5AL 4PRPB 2VDNL 5IBTH 3SE8H 1RK1B 4PJIF 4R2GB 4X98A 4H1LG 5MP6L 3NPSB 4KMTH 1CBVL 3BD4A 4KAQL 1H0DB 3UTZA 1W0WA 3OR7B 1TNNA 1A2YA 2A6KA 5EFIA 1TQCB 4GKZB 4P9MH 5MEQA 2DI8A 5K9KB 4P46A 2ITDA 3P0YL 4H0IA 4POZC 4YDKH 1F4YH 3CGTA 1AI1L 5D6DC 35C8L 1WCBB 1F11A 3V79C 1RZ8A 4HMDA 2W65B 3OBAA 3ARZA 4J4PA 3ARGC 4ZOAA 1UQSA 4HG4J 1EEUA 4Y1AB 2YD5A 4Y4HB 1C5DA 1U8PA 2FBOJ 5F6IC 5CSZA 4C59B 2J8OA 3VW3L 4U1JA 3HI6H 3QUMA 1QSFA 3R0MA 5CSGA 3OKMB 1MFEL 4PJEF 5IFHH 2X4TA 1EXUB 2CXKA 3I6KA 4KKNA 3CFJB 5CINL 3HAEB 3VXSB 4FA8A 1FAIH 4O9HL 3CJJA 3FN0L 3QYCA 2DICA 1YZZA 2JIXD 2XZAL 2NXYC 1XAUA 4RX4D 1I8IB 1OPGL 1ZLUK 1B0GA 3O3AB 2P5EA 5TDPA 1EEZA 1R3JA 1E4XI 1T5WA 4G6JH 4HS3B 5I75B 3PNWB 3AVEA 4AT6A 3P4OA 4PJ9B 4GAYB 3TNMB 2AABL 3LQAH 1NGQH 5HHOD 2QQNH 4HH9A 2W91A 4MMXC 4QRRE 2XN9E 1YEKH 4L8BB 4YXKL 3K74B 3IDJB 3WNOA 5SWQA 2SEBB 1Z5LB 4HULB 4OSUL 1KC5H 3LY6A 4WV1B 5CLWA 5AZEH 2G60L 1XH3A 5BCAA 3V6OE 4PYGA 2ZUQC 4MA8L 3U83A 1PX4A 1ZHKB 4WUKL 5EBMB 4WUUE 5D6CB 1L9NA 2D0GA 4HGKC 5KVDL 4L1HA 2HTKC 2AJVH 1FL3A 4HF5H 4Y5VA 3DVFA 5DXWA 2E6PA 3ULUF 3U7YL 1OGAE 5TQ2H 3BZEB 1B90A 2H6PB 5JR1H 3VE0A 3T65B 4YXHH 5BO1L 3MRBA 3F5WB 4GMTL 3WN5B 4L3ED 1G6RB 4U1LA 3T4YA 4X6EB 2XQBL 4IOSD 4LGSB 3QUZD 4JFPB 4NQSA 3L3IA 3MNWA 2GTWB 4OGAD 2DLFL 3VRLE 1BIIA 4DK3A 1AGBA 2YKLH 3NACH 5EORL 3D85A 3F6IA 1A3QA 4K94H 2H9GB 3LKOA 1LK3H 4KRPC 4L9LC 5E00B 1WAAF 5GRVK 3QO1A 4LIQL 2ZUVA 1MLBA 3H2WA 4GAJH 4N0YL 5C0EA 5J7CC 5LGHL 2FEDC 4I9WE 4JRYD 3MV8E 4IDJL 4YC2C 4LSPL 1U8JA 2YMXL 2XWJB 3FT3A 5F9WC 2ED7A 2IADB 2Y5EA 3IJHA 5T1LA 3LH2H 1UC6A 5HGGS 2ZKHL 2WQ8A 3QDGE 2WNGA 3S34L 4E41A 2F54A 2OMNA 3IDYC 4AIZA 4Q9BA 3VWJB 4Y4FA 3RWHA 4HKXA 4EDXB 1GPOH 4LF3A 2VDPL 3KXFE 2QSCL 1PZ5A 1CDGA 5IQ9A 3ZKND 2VXVH 5A2JH 1S7TA 1CG9B 5TDNA 5DJXA 5FO8B 2FYYA 5E8EA 4XCFH 3CDYA 4QWWC 3BW9B 3RWDA 1CXHA 3ARED 1U93B 1VCAA 5HDQH 1XGPB 1R3HA 3H9SD 3W0WE 1C12B 3GRWL 5EOTB 3MLXL 4JO3L 4HIHB 4ZTPH 2IAMC 1SJEA 3SO3C 4M1CC 1XGQA 3FB8A 3VD9A 1MRDH 1MCLA 1GGBL 4P2QA 4OZGB 4NKIL 2VXSH 3WDIA 5DJYA 5FV1L 1N5AA 3VRJA 2HMIC 3M8OH 4ONGL 4X4ME 3SGKA 4RGMC 5JNYB 5EDXA 4XNMB 3WUWA 3F65A 3KYKH 1A21A 1HEZA 1QFUH 5BW7A 3QPQC 3HFMH 2I07A 4HJGB 1Y6NR 3EYFB 3K7UA 3V5HA 1FVEA 3PHSA 3OR6B 5BVPL 2VMFA