4FZBA

Structure of thymidylate synthase thyx complexed to a new inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
191
Chain Sequence
b'TGSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQINNKTASGLLKYCIRHKHWSIFETAFMTLELKTSRGIAAQVLRHRSFHFQEFSQRYASVEDDQTWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFPSIAKALDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thymidylate synthase
publication title Mechanistic and structural basis for inhibition of thymidylate synthase ThyX.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase/transferase inhibitor
total genus 62
structure length 191
sequence length 216
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4fzbA01
1O29A 1O28A 4GTDA 4GTLA 3N3YA 2CFAB 5CHPA 4GTFA 4GTCA 4KATA 3G4AA 4GTEA 1O2AA 4GT9A 1KQ4A 4FZBA 5IOQA 5IOTA 1O27A 2CFAA 4GTAA 4GTBA 5IORA 1O2BA 1O26A 1O24A 5JFEA 3N0CA 4KARA 3G4CA 4P5AA 3N0BA 4P5BA 4KASA 1O25A 5IOSA 3AH5A
chains in the Genus database with same CATH superfamily
2GSUA 1R9TK 4BBSK 4A3DK 4YFKA 1C0AA 1GE9A 1EK8A 4BLAA 3I4MK 3FKIA 1TWHA 4BXXK 2A6HA 4GTBA 4WJ4A 1O2BA 3GTKC 3HOUC 1UV7A 3AD9C 4C3JK 3LAJA 1IW7A 4KMHA 2JA7K 4G0WA 2R7ZA 5IYDK 4BY1C 2R92A 2WAQD 4QJVA 4A3BK 2PA8D 3A8KA 3HOZC 3AH5A 3TFHA 3S2HK 3BP8C 1Y1WK 3GTLA 4GTFA 4LOWA 3HOWC 2GAHC 2E2JK 3HOYK 4A93C 4BY7C 2ZUFA 4XSXA 3PO3K 1I3QA 3TFJA 2JH3A 3GEHA 4GTAA 3GTPC 2GSOA 5M3FK 3FKIK 2PMZL 1TWHK 3N0BA 2XCRB 4KMAA 2KWAA 1PJ5A 2NVQC 1I50C 1YNNA 4LK0A 3HOXK 4C3IK 3M3YK 3S14C 2R92K 3AQPA 1O28A 1TWFC 4Y52C 1WCMA 1L0WA 4NOIA 5EGHA 2JA8C 2NVYA 2YU9C 3T02A 3GTOA 5IYCC 1J6XA 3CQZC 2R93C 2VUMA 1ZBSA 3GTJC 3GTLK 1BDFA 3Q3QA 1AB4A 4ILDA 2O5IA 1TWCA 1WIHA 1ZYRA 3S2DC 4O2DA 4KARA 2ZUEA 3G4CA 4OIPA 4A3JK 5M5XK 4BBRC 4A3MC 1PJ7A 3M4OK 5C4XK 2JA6A 3T01A 2Y3PA 3S15C 3SZYA 5C3EK 4JK1A 2PMZD 1DCOA 4GTLA 4XCHA 3S1MK 3GTMA 3GTQK 1XPPA 4QIWL 3K7AK 5IP7C 5L46A 1WCMK 5IOQA 3RZDK 3S1QK 4A3CC 4A3FC 3GTOK 2VUMK 1DCHA 1J98A 3BUEA 1WSVA 3AQOA 1YCLA 1J6WA 2NVXC 4A3IC 1WSRA 2ZFZA 1B4AA 1USMA 4A3EC 2A6EA 3PO2K 4A3GK 1I6VA 1I6HK 2EBBA 4BKWA 4Y7NK 4GFQA 4X6AK 4LR2A 2RH6A 1WQFA 1K83C 1XZQA 3T00A 4C2MK 4C45A 1VJEA 3LPXA 4LK1A 1SFOA 5C4JK 3GTMK 2WAQL 3HOUK 2PA8L 4KDDA 1EFWA 2FQTA 4LLGA 1JVIA 3HOZK 3H3VD 1F7VA 3LAPA 2R93A 4WJ3M 3GTJA 4J3NA 3BP3A 4Q5SA 2JA5C 3HOWK 3ADAC 1YX2A 3RZOC 4C3HC 3JSTA 4A93K 4BY7K 1ISEA 4XLPA 3S1NC 4WILA 1IL2A 2NVQK 1XZPA 4MQ9A 1I50K 1SFOK 2XCQA 2V6SA 2RGRA 4M1XA 4LQYA 2R93K 2YU9K 3S16C 3CQZK 5FJ8K 1F93A 3DXJA 2B63C 3GTJK 4A3KC 1ZQ1C 5IYBC 2E2IC 3GTGC 5FLMK 3S2DK 3HXAA 5IP9K 1O26A 5D4DA 2BE5A 4KM8A 4BBRK 4A3MK 1WQHA 3I4NC 4YFNA 1TWGC 2E2HC 1F7UA 3S15K 4YFXA 5C44C 3GTQA 2WB1D 1Y1VC 1R9TC 5IP7K 5CHPA 1BGWA 1WOPA 1BS2A 4KATA 4A3CK 4A3FK 1ZXOA 2W7VA 3WODA 1TWAA 5IORA 1HQMA 4BXXC 1O24A 1JQWA 3FHZA 5TMFA 3NUHA 4C3JC 5IYDC 2FQOA 2JA7C 2CFAB 2GSNA 1BJTA 2PHCB 2V6UA 5EGEA 4ZH4A 1Y1WC 3GDZA 1VLOA 3GTKA 4G7HA 5M3MK 3G4AA 3H3VL 2A68A 3HOYC 1KQ4A 4FZBA 3S17K 3AD8C 4A3LK 1O27A 5E68A 3S1RC 4DDQA 1F9NA 1TWAK 3FKIC 1O25A 5JVOA 1XXAA 4OIRA 4KMDA 1V5VA 3HOVC 1JOEA 3HOXC 4C3IC 2D6FC 2R7ZC 3N3YA 3OREA 4G0VA 2R92C 3GTPA 4QJVB 1G51A 1IS1A 4GTEA 1TWGA 1WOSA 1I50A 4GZYA 2CW0A 3GTKK 4KN4A 2PPBA 1INNA 4BY1K 4KASA 1TWFA 1I3QC 2XCOA 2YU9A 3CQZA 3FOEA 2B63K 4PAAA 3M4OC 1XXBA 4GTDA 5IYBK 1VH2A 3QX3A 3S1MC 5TJ3A 3H0GC 3V4GA 3K7AC 3GTPK 3RZDC 3I4NK 3S1QC 2NVYC 2WB1L 1TWGK 3N0CA 2E2HK 2VUMC 3GTOC 4OIOA 1J6VA 1TWCC 5C44K 3FOFA 5HL8A 3GIRA 4XSZA 4AYBD 3PO2C 4A3GC 3GEEA 2NVTC 3S14K 3OPFA 1TWFK 4Y52K 1HI9A 3VA7A 1I6HC 2Y0SL 3CAGA 4Y7NC 2JA8K 4BLBA 4X6AC 5IYCK 3S0XA 2JA6C 2NVXA 4C2MC 1YNJA 1O2AA 1WQGA 5C4JC 3GTMC 4P5AA 4MEXA 3L4KA 1SMYA 1K83A 5M5YK 2P8TA 1ZVUA 4KMUA 3MMLB 1O29A 3TTGA 3TFIA 1DCPA 4BBSC 4A3DC 2P5MA 3S1RK 3EQLA 3I4MC 2Y0SD 2NVXK 4A3IK 1EI6A 1XZQB 4P9SA 1B4BA 2JA5A 4A3EK 1SFOC 4G0UA 3HOVK 5IOSA 4KC6A 3H0GA 2R7ZK 1VGXA 4A3BC 5CJ9A 1XXCA 4RMFA 1K83K 4OINA 3S2HC 3L4JA 1IQ0A 4KB2A 4FM9A 2E2JC 3HKZL 3IPJA 5FLMC 4KM9A 3PO3C 5IP9C 1I3QK 4P5BA 4XLNA 2B63A 2V6TA 1TWHC 2JA5K 1XZPB 3RZOK 2E2IA 4C3HK 3GTGA 4PABA 3H0GK 3M3YC 5M5WK 4G7OA 4GTCA 3S1NK 3AD7C 5TMCA 1O2FB 2E2HA 2NVYK 3A8JA 4AYBL 3GTLC 4G7ZA 4KAWX 1TWCK 1Y1VA 1RU0A 1R9TA 1DD5A 2NVTK 1IE0A 1EQRA 1PJ6A 2GAGC 4KB4A 3HKZD 4A3JC 4KN7A 3S16K 2O5JA 1IBAA 4A3KK 3GSIA 1VRQC 5C4XC 1WOOA 2JA6K 3OEPA 3GEIA 2A69A 5C3EC 4LJZA 2E2IK 3GTGK 4AH6A 3GTQC 4GT9A 2JA7A 5IOTA 2CFAA 3S17C 4A3LC 1WCMC 1USOA 4QIWD 5JFEA 3A8IA 3ERED 1EH1A 1X31C 3SZZA 4YG2A 1Y1WA 4Q4ZA 1WORA 1TWAC 4OIQA 4MEYA 1Y1VK
chains in the Genus database with same CATH topology
2GSUA 2GSNA 1BJTA 1ZVUA 2PHCB 3MMLB 4BKWA 1O29A 5EGEA 4GFQA 4LR2A 2RH6A 1WQFA 1GE9A 1EK8A 3GTKA 3LPXA 2P5MA 3G4AA 4BLAA 3FKIA 1SFOA 1KQ4A 1TWHA 4FZBA 1O27A 4KDDA 4GTBA 4DDQA 1F9NA 1O2BA 1B4BA 2JA5A 3LAJA 4KMHA 2R7ZA 4G0WA 1O25A 5JVOA 4G0UA 3LAPA 1XXAA 2R92A 2R93A 5IOSA 4KC6A 4KMDA 3H0GA 3AH5A 3GTJA 4J3NA 5CJ9A 4C3IC 1XXCA 3GTLA 3N3YA 3OREA 4C3HC 4G0VA 3GTPA 1ISEA 4GTFA 3L4JA 1IS1A 4GTEA 4KB2A 4FM9A 1TWGA 1I50A 1I3QA 2JH3A 4GTAA 2GSOA 4KM9A 3N0BA 4P5BA 2XCQA 4KASA 2XCRB 4KMAA 2KWAA 1TWFA 2B63A 2XCOA 2RGRA 2YU9A 3CQZA 3FOEA 2E2IA 4M1XA 3GTGA 4LQYA 3AQPA 1O28A 1XXBA 4GTDA 1WCMA 3QX3A 5EGHA 2NVYA 5TJ3A 3GTOA 4GTCA 2VUMA 3V4GA 1ZBSA 3Q3QA 1AB4A 4ILDA 1TWCA 2E2HA 1WIHA 1O26A 4KAWX 3N0CA 4KARA 1Y1VA 3G4CA 4KM8A 1R9TA 1WQHA 1DD5A 3FOFA 4KB4A 2JA6A 3GTQA 3OPFA 2Y3PA 3VA7A 3CAGA 4GTLA 4BLBA 3OEPA 5CHPA 3GTMA 3S0XA 1BGWA 4KATA 2NVXA 4C2MC 1O2AA 1ZXOA 4GT9A 5IOQA 2JA7A 5IOTA 1TWAA 2CFAA 1WQGA 5IORA 1O24A 3BUEA 3ERED 5JFEA 3AQOA 3FHZA 4P5AA 1EH1A 3L4KA 3NUHA 2ZFZA 1B4AA 4C3JC 1Y1WA 1K83A 2CFAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O29 A;  1O28 A;  4GTD A;  4GTL A;  3N3Y A;  2CFA B;  5CHP A;  4GTF A;  4GTC A;  4KAT A;  3G4A A;  4GTE A;  1O2A A;  4GT9 A;  1KQ4 A;  4FZB A;  5IOQ A;  5IOT A;  1O27 A;  2CFA A;  4GTA A;  4GTB A;  5IOR A;  1O2B A;  1O26 A;  1O24 A;  5JFE A;  3N0C A;  4KAR A;  3G4C A;  4P5A A;  3N0B A;  4P5B A;  4KAS A;  1O25 A;  5IOS A;  3AH5 A; 
#chains in the Genus database with same CATH topology
 2GSU A;  1R9T K;  4BBS K;  4A3D K;  4YFK A;  1C0A A;  1GE9 A;  1EK8 A;  4BLA A;  3I4M K;  3FKI A;  1TWH A;  4BXX K;  2A6H A;  4GTB A;  4WJ4 A;  1O2B A;  3GTK C;  3HOU C;  1UV7 A;  3AD9 C;  4C3J K;  3LAJ A;  1IW7 A;  4KMH A;  2JA7 K;  4G0W A;  2R7Z A;  5IYD K;  4BY1 C;  2R92 A;  2WAQ D;  4QJV A;  4A3B K;  2PA8 D;  3A8K A;  3HOZ C;  3AH5 A;  3TFH A;  3S2H K;  3BP8 C;  1Y1W K;  3GTL A;  4GTF A;  4LOW A;  3HOW C;  2GAH C;  2E2J K;  3HOY K;  4A93 C;  4BY7 C;  2ZUF A;  4XSX A;  3PO3 K;  1I3Q A;  3TFJ A;  2JH3 A;  3GEH A;  4GTA A;  3GTP C;  2GSO A;  5M3F K;  3FKI K;  2PMZ L;  1TWH K;  3N0B A;  2XCR B;  4KMA A;  2KWA A;  1PJ5 A;  2NVQ C;  1I50 C;  1YNN A;  4LK0 A;  3HOX K;  4C3I K;  3M3Y K;  3S14 C;  2R92 K;  3AQP A;  1O28 A;  1TWF C;  4Y52 C;  1WCM A;  1L0W A;  4NOI A;  5EGH A;  2JA8 C;  2NVY A;  2YU9 C;  3T02 A;  3GTO A;  5IYC C;  1J6X A;  3CQZ C;  2R93 C;  2VUM A;  1ZBS A;  3GTJ C;  3GTL K;  1BDF A;  3Q3Q A;  1AB4 A;  4ILD A;  2O5I A;  1TWC A;  1WIH A;  1ZYR A;  3S2D C;  4O2D A;  4KAR A;  2ZUE A;  3G4C A;  4OIP A;  4A3J K;  5M5X K;  4BBR C;  4A3M C;  1PJ7 A;  3M4O K;  5C4X K;  2JA6 A;  3T01 A;  2Y3P A;  3S15 C;  3SZY A;  5C3E K;  4JK1 A;  2PMZ D;  1DCO A;  4GTL A;  4XCH A;  3S1M K;  3GTM A;  3GTQ K;  1XPP A;  4QIW L;  3K7A K;  5IP7 C;  5L46 A;  1WCM K;  5IOQ A;  3RZD K;  3S1Q K;  4A3C C;  4A3F C;  3GTO K;  2VUM K;  1DCH A;  1J98 A;  3BUE A;  1WSV A;  3AQO A;  1YCL A;  1J6W A;  2NVX C;  4A3I C;  1WSR A;  2ZFZ A;  1B4A A;  1USM A;  4A3E C;  2A6E A;  3PO2 K;  4A3G K;  1I6V A;  1I6H K;  2EBB A;  4BKW A;  4Y7N K;  4GFQ A;  4X6A K;  4LR2 A;  2RH6 A;  1WQF A;  1K83 C;  1XZQ A;  3T00 A;  4C2M K;  4C45 A;  1VJE A;  3LPX A;  4LK1 A;  1SFO A;  5C4J K;  3GTM K;  2WAQ L;  3HOU K;  2PA8 L;  4KDD A;  1EFW A;  2FQT A;  4LLG A;  1JVI A;  3HOZ K;  3H3V D;  1F7V A;  3LAP A;  2R93 A;  4WJ3 M;  3GTJ A;  4J3N A;  3BP3 A;  4Q5S A;  2JA5 C;  3HOW K;  3ADA C;  1YX2 A;  3RZO C;  4C3H C;  3JST A;  4A93 K;  4BY7 K;  1ISE A;  4XLP A;  3S1N C;  4WIL A;  1IL2 A;  2NVQ K;  1XZP A;  4MQ9 A;  1I50 K;  1SFO K;  2XCQ A;  2V6S A;  2RGR A;  4M1X A;  4LQY A;  2R93 K;  2YU9 K;  3S16 C;  3CQZ K;  5FJ8 K;  1F93 A;  3DXJ A;  2B63 C;  3GTJ K;  4A3K C;  1ZQ1 C;  5IYB C;  2E2I C;  3GTG C;  5FLM K;  3S2D K;  3HXA A;  5IP9 K;  1O26 A;  5D4D A;  2BE5 A;  4KM8 A;  4BBR K;  4A3M K;  1WQH A;  3I4N C;  4YFN A;  1TWG C;  2E2H C;  1F7U A;  3S15 K;  4YFX A;  5C44 C;  3GTQ A;  2WB1 D;  1Y1V C;  1R9T C;  5IP7 K;  5CHP A;  1BGW A;  1WOP A;  1BS2 A;  4KAT A;  4A3C K;  4A3F K;  1ZXO A;  2W7V A;  3WOD A;  1TWA A;  5IOR A;  1HQM A;  4BXX C;  1O24 A;  1JQW A;  3FHZ A;  5TMF A;  3NUH A;  4C3J C;  5IYD C;  2FQO A;  2JA7 C;  2CFA B;  2GSN A;  1BJT A;  2PHC B;  2V6U A;  5EGE A;  4ZH4 A;  1Y1W C;  3GDZ A;  1VLO A;  3GTK A;  4G7H A;  5M3M K;  3G4A A;  3H3V L;  2A68 A;  3HOY C;  1KQ4 A;  4FZB A;  3S17 K;  3AD8 C;  4A3L K;  1O27 A;  5E68 A;  3S1R C;  4DDQ A;  1F9N A;  1TWA K;  3FKI C;  1O25 A;  5JVO A;  1XXA A;  4OIR A;  4KMD A;  1V5V A;  3HOV C;  1JOE A;  3HOX C;  4C3I C;  2D6F C;  2R7Z C;  3N3Y A;  3ORE A;  4G0V A;  2R92 C;  3GTP A;  4QJV B;  1G51 A;  1IS1 A;  4GTE A;  1TWG A;  1WOS A;  1I50 A;  4GZY A;  2CW0 A;  3GTK K;  4KN4 A;  2PPB A;  1INN A;  4BY1 K;  4KAS A;  1TWF A;  1I3Q C;  2XCO A;  2YU9 A;  3CQZ A;  3FOE A;  2B63 K;  4PAA A;  3M4O C;  1XXB A;  4GTD A;  5IYB K;  1VH2 A;  3QX3 A;  3S1M C;  5TJ3 A;  3H0G C;  3V4G A;  3K7A C;  3GTP K;  3RZD C;  3I4N K;  3S1Q C;  2NVY C;  2WB1 L;  1TWG K;  3N0C A;  2E2H K;  2VUM C;  3GTO C;  4OIO A;  1J6V A;  1TWC C;  5C44 K;  3FOF A;  5HL8 A;  3GIR A;  4XSZ A;  4AYB D;  3PO2 C;  4A3G C;  3GEE A;  2NVT C;  3S14 K;  3OPF A;  1TWF K;  4Y52 K;  1HI9 A;  3VA7 A;  1I6H C;  2Y0S L;  3CAG A;  4Y7N C;  2JA8 K;  4BLB A;  4X6A C;  5IYC K;  3S0X A;  2JA6 C;  2NVX A;  4C2M C;  1YNJ A;  1O2A A;  1WQG A;  5C4J C;  3GTM C;  4P5A A;  4MEX A;  3L4K A;  1SMY A;  1K83 A;  5M5Y K;  2P8T A;  1ZVU A;  4KMU A;  3MML B;  1O29 A;  3TTG A;  3TFI A;  1DCP A;  4BBS C;  4A3D C;  2P5M A;  3S1R K;  3EQL A;  3I4M C;  2Y0S D;  2NVX K;  4A3I K;  1EI6 A;  1XZQ B;  4P9S A;  1B4B A;  2JA5 A;  4A3E K;  1SFO C;  4G0U A;  3HOV K;  5IOS A;  4KC6 A;  3H0G A;  2R7Z K;  1VGX A;  4A3B C;  5CJ9 A;  1XXC A;  4RMF A;  1K83 K;  4OIN A;  3S2H C;  3L4J A;  1IQ0 A;  4KB2 A;  4FM9 A;  2E2J C;  3HKZ L;  3IPJ A;  5FLM C;  4KM9 A;  3PO3 C;  5IP9 C;  1I3Q K;  4P5B A;  4XLN A;  2B63 A;  2V6T A;  1TWH C;  2JA5 K;  1XZP B;  3RZO K;  2E2I A;  4C3H K;  3GTG A;  4PAB A;  3H0G K;  3M3Y C;  5M5W K;  4G7O A;  4GTC A;  3S1N K;  3AD7 C;  5TMC A;  1O2F B;  2E2H A;  2NVY K;  3A8J A;  4AYB L;  3GTL C;  4G7Z A;  4KAW X;  1TWC K;  1Y1V A;  1RU0 A;  1R9T A;  1DD5 A;  2NVT K;  1IE0 A;  1EQR A;  1PJ6 A;  2GAG C;  4KB4 A;  3HKZ D;  4A3J C;  4KN7 A;  3S16 K;  2O5J A;  1IBA A;  4A3K K;  3GSI A;  1VRQ C;  5C4X C;  1WOO A;  2JA6 K;  3OEP A;  3GEI A;  2A69 A;  5C3E C;  4LJZ A;  2E2I K;  3GTG K;  4AH6 A;  3GTQ C;  4GT9 A;  2JA7 A;  5IOT A;  2CFA A;  3S17 C;  4A3L C;  1WCM C;  1USO A;  4QIW D;  5JFE A;  3A8I A;  3ERE D;  1EH1 A;  1X31 C;  3SZZ A;  4YG2 A;  1Y1W A;  4Q4Z A;  1WOR A;  1TWA C;  4OIQ A;  4MEY A;  1Y1V K; 
#chains in the Genus database with same CATH homology
 2GSU A;  2GSN A;  1BJT A;  1ZVU A;  2PHC B;  3MML B;  4BKW A;  1O29 A;  5EGE A;  4GFQ A;  4LR2 A;  2RH6 A;  1WQF A;  1GE9 A;  1EK8 A;  3GTK A;  3LPX A;  2P5M A;  3G4A A;  4BLA A;  3FKI A;  1SFO A;  1KQ4 A;  1TWH A;  4FZB A;  1O27 A;  4KDD A;  4GTB A;  4DDQ A;  1F9N A;  1O2B A;  1B4B A;  2JA5 A;  3LAJ A;  4KMH A;  2R7Z A;  4G0W A;  1O25 A;  5JVO A;  4G0U A;  3LAP A;  1XXA A;  2R92 A;  2R93 A;  5IOS A;  4KC6 A;  4KMD A;  3H0G A;  3AH5 A;  3GTJ A;  4J3N A;  5CJ9 A;  4C3I C;  1XXC A;  3GTL A;  3N3Y A;  3ORE A;  4C3H C;  4G0V A;  3GTP A;  1ISE A;  4GTF A;  3L4J A;  1IS1 A;  4GTE A;  4KB2 A;  4FM9 A;  1TWG A;  1I50 A;  1I3Q A;  2JH3 A;  4GTA A;  2GSO A;  4KM9 A;  3N0B A;  4P5B A;  2XCQ A;  4KAS A;  2XCR B;  4KMA A;  2KWA A;  1TWF A;  2B63 A;  2XCO A;  2RGR A;  2YU9 A;  3CQZ A;  3FOE A;  2E2I A;  4M1X A;  3GTG A;  4LQY A;  3AQP A;  1O28 A;  1XXB A;  4GTD A;  1WCM A;  3QX3 A;  5EGH A;  2NVY A;  5TJ3 A;  3GTO A;  4GTC A;  2VUM A;  3V4G A;  1ZBS A;  3Q3Q A;  1AB4 A;  4ILD A;  1TWC A;  2E2H A;  1WIH A;  1O26 A;  4KAW X;  3N0C A;  4KAR A;  1Y1V A;  3G4C A;  4KM8 A;  1R9T A;  1WQH A;  1DD5 A;  3FOF A;  4KB4 A;  2JA6 A;  3GTQ A;  3OPF A;  2Y3P A;  3VA7 A;  3CAG A;  4GTL A;  4BLB A;  3OEP A;  5CHP A;  3GTM A;  3S0X A;  1BGW A;  4KAT A;  2NVX A;  4C2M C;  1O2A A;  1ZXO A;  4GT9 A;  5IOQ A;  2JA7 A;  5IOT A;  1TWA A;  2CFA A;  1WQG A;  5IOR A;  1O24 A;  3BUE A;  3ERE D;  5JFE A;  3AQO A;  3FHZ A;  4P5A A;  1EH1 A;  3L4K A;  3NUH A;  2ZFZ A;  1B4A A;  4C3J C;  1Y1W A;  1K83 A;  2CFA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...