4FZBA

Structure of thymidylate synthase thyx complexed to a new inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
191
Chain Sequence
b'TGSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQINNKTASGLLKYCIRHKHWSIFETAFMTLELKTSRGIAAQVLRHRSFHFQEFSQRYASVEDDQTWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFPSIAKALDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic and structural basis for inhibition of thymidylate synthase ThyX.
pubmed doi rcsb
molecule keywords Probable thymidylate synthase
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase/transferase inhibitor
total genus 62
structure length 191
sequence length 216
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4fzbA01
1O27A 4FZBA 5IORA 3N0BA 4P5AA 4GTFA 4GTBA 5IOTA 4P5BA 4GT9A 4GTDA 4KASA 1O28A 3N3YA 1O2AA 1O26A 5JFEA 5IOQA 4KATA 1KQ4A 3G4AA 1O24A 2CFAB 2CFAA 3N0CA 1O25A 4KARA 1O2BA 3G4CA 4GTAA 5IOSA 4GTLA 1O29A 4GTEA 3AH5A 5CHPA 4GTCA
chains in the Genus database with same CATH superfamily
3S2HC 4OIPA 4OIRA 2VUMK 4P5AA 4WJ4A 3GTOC 1K83C 3H3VL 5M3MK 3IPJA 3HOWK 1WOPA 4A3KC 3HOXC 4X6AK 5JFEA 2E2IA 3GTJK 1KQ4A 1O25A 4LJZA 4A3CC 3GTPK 4AYBD 4KC6A 4O2DA 2Y3PA 2CW0A 4KDDA 2P8TA 2YU9A 3GTLC 4BLBA 2R93A 5IORA 2JH3A 4G0VA 1BGWA 4GFQA 4BBSK 4GTBA 1DCOA 1IBAA 4XLNA 1C0AA 4A3LK 3GTKK 2KWAA 1DCPA 3HKZL 5C44C 3TFJA 5HL8A 1PJ5A 1WIHA 1RU0A 4XSXA 4BBRC 2NVXC 5IP7K 2JA7A 1ISEA 2GSNA 1V5VA 3GTMK 2E2JK 3AD9C 2NVYK 1TWHK 5FLMK 1I50K 3T00A 1J98A 2GAHC 1Y1VC 1TWAC 3MMLB 1I6HK 1XXAA 4A93C 4C3JC 2JA6C 4A3IC 4BXXC 1WSVA 1J6WA 4A3FC 3AD7C 2RGRA 2A6EA 2E2HA 1WQHA 4C3HC 3HOUK 4KM8A 1SFOC 3S17C 4Y7NK 1TWCC 3HOYC 2V6TA 3FKIA 5M3FK 1I3QC 3WODA 4KN7A 3DXJA 3GTQC 3JSTA 5M5WK 2R93K 3S15K 1HI9A 1TWGC 3S1NK 3S14K 4MQ9A 3CQZC 3I4MK 1WCMA 4MEYA 3ERED 3I4NC 1R9TC 4AYBL 1JOEA 1O2FB 2R7ZA 3AH5A 1JVIA 1ZYRA 2A68A 4C2MC 3S1RC 1XXCA 5C4XC 2ZUFA 3GTOA 1K83A 1Y1WC 1ZVUA 4QIWL 1DCHA 3A8JA 1IW7A 2RH6A 5IYDK 3T02A 4QJVB 4YFNA 5C3EK 3GTGA 4Y52C 4A3MK 1AB4A 2JA8C 1YCLA 2B63A 3A8KA 4BY7C 1O29A 2XCOA 2E2HK 4FZBA 3HOWC 5IYBC 1USOA 4KMAA 4X6AC 2A6HA 4NOIA 1WSRA 2P5MA 3AD8C 3PO2K 3GTPC 4A3DK 5EGEA 1XZPB 4RMFA 3RZOK 3PO3K 3S1MC 2NVXA 3VA7A 1EQRA 4MEXA 3TFIA 5C4JC 2PA8L 4OINA 2JA5C 1PJ7A 3TFHA 4A3LC 3GTKC 1XZQA 3LPXA 1INNA 3S2HK 5IP9C 1Y1VA 1VH2A 3V4GA 1IE0A 3HOZK 1K83K 2R92C 4G0UA 2JA6A 4A3JC 4FM9A 3GTGK 3S0XA 3GTMC 3SZZA 2B63K 2BE5A 2E2JC 2NVYC 1UV7A 5JVOA 1TWCA 2WAQD 3GDZA 4GZYA 3H0GC 1JQWA 4BY1K 3HOVK 1I6HC 1TWGA 2NVQK 4QJVA 2NVTK 1J6XA 1BJTA 1R9TA 3BP3A 3HOUC 4Y7NC 1HQMA 1YNNA 2WB1L 2E2IK 4OIQA 3LAPA 5M5YK 2Y0SD 4KMHA 2R93C 3SZYA 4YFXA 1Y1WA 3S15C 4KN4A 3S1NC 1F9NA 1VRQC 3N0BA 3S1QK 3S14C 3H3VD 1BS2A 3I4MC 5IYCC 4P9SA 2YU9K 5D4DA 2O5IA 3A8IA 4Q5SA 2D6FC 3K7AC 1YNJA 4JK1A 1Y1VK 1I6VA 4A3BC 4A93K 3FHZA 3M4OK 1IQ0A 4KARA 4A3IK 1O2BA 4LK1A 4LK0A 4BXXK 4J3NA 4G7OA 4DDQA 1ZBSA 5CJ9A 5CHPA 4C3HK 5IYDC 5C3EC 4G7HA 3GSIA 4AH6A 3RZDK 1TWCK 1EFWA 2JA7K 4A3MC 4A3EK 2FQOA 4GTDA 1F7UA 3GTPA 1TWFC 1L0WA 3T01A 1O2AA 4PAAA 2CFAB 3N0CA 4XLPA 3S16K 3I4NK 1R9TK 3L4KA 2E2HC 1EK8A 3FOEA 3GEHA 5TJ3A 2VUMC 3GTLA 1B4AA 3AQPA 3OPFA 2PHCB 1PJ6A 3M3YK 2JA5A 1BDFA 3PO2C 4BKWA 4WJ3M 4A3DC 1Y1WK 2R92A 3FKIK 3GTJC 4WILA 1WORA 1F7VA 1O28A 1XXBA 2W7VA 3RZOC 4OIOA 3PO3C 1WOOA 4Y52K 2O5JA 5L46A 4XSZA 4BLAA 1WCMK 4LQYA 2NVYA 2ZUEA 4GTEA 4KB2A 2Y0SL 2ZFZA 4BY7K 4KB4A 3EQLA 4BBSC 4A3GK 3H0GA 2PMZD 2V6SA 1ZXOA 3HOZC 1VGXA 2R7ZK 3S2DK 4ZH4A 1EI6A 4C3IK 1IL2A 4GT9A 5IYBK 3GTGC 2PPBA 1WQFA 1TWAA 2GAGC 3GTOK 4ILDA 2V6UA 1O26A 2B63C 3G4AA 4A3KK 3HOXK 5IP7C 4G7ZA 3TTGA 4GTLA 4BY1C 4A3CK 1SFOA 3HOVC 3S1MK 1TWHC 5FLMC 3OEPA 2FQTA 3FOFA 1I50C 2NVQC 1I3QA 5EGHA 2NVTC 5C4JK 3GTLK 4QIWD 3GTQA 1DD5A 4P5BA 2JA5K 2A69A 1IS1A 5FJ8K 3CQZA 5IP9K 4LOWA 1XPPA 4YG2A 5IOQA 2R92K 2EBBA 4KATA 2E2IC 4A3JK 2CFAA 3GEEA 5C44K 3NUHA 3S1QC 3BUEA 3ADAC 4KMDA 1GE9A 1WOSA 4BBRK 2YU9C 2NVXK 1O27A 1VJEA 1B4BA 4C45A 1J6VA 5IOTA 3H0GK 1VLOA 4G0WA 1TWFA 4KASA 3M4OC 3N3YA 4KAWX 1ZQ1C 1TWAK 1XZPA 5TMFA 4C3JK 3HXAA 2JA6K 3AQOA 4M1XA 1X31C 3Q3QA 2VUMA 2JA7C 3RZDC 4LLGA 4A3FK 2PMZL 4GTCA 4A3EC 2PA8D 4Q4ZA 1XZQB 1SFOK 3S17K 3HOYK 1USMA 3GTJA 1I3QK 5TMCA 5IYCK 2XCRB 3GTQK 3S16C 4XCHA 3HKZD 3GEIA 1SMYA 1TWGK 3K7AK 3CQZK 5E68A 4A3BK 2XCQA 3BP8C 4KMUA 3M3YC 1G51A 1EH1A 3L4JA 2WAQL 3FKIC 4GTFA 1F93A 3GTKA 2GSUA 3CAGA 4C2MK 3S1RK 5C4XK 4PABA 1YX2A 1WQGA 3QX3A 1WCMC 1O24A 1TWFK 4KM9A 4YFKA 5M5XK 3GTMA 2JA8K 4A3GC 3G4CA 2WB1D 4GTAA 5IOSA 2GSOA 3OREA 4LR2A 1TWHA 3LAJA 2R7ZC 3S2DC 3GIRA 4C3IC 1I50A
chains in the Genus database with same CATH topology
1XXCA 3OEPA 3FOFA 1Y1WA 1I3QA 3GTOA 1F9NA 3N0BA 4P5AA 5EGHA 1K83A 1ZVUA 3GTQA 1DD5A 2RH6A 4P5BA 1IS1A 3GTGA 3CQZA 1AB4A 5JFEA 2E2IA 5IOQA 2B63A 4KATA 1KQ4A 2CFAA 3FHZA 1O25A 4KARA 1O2BA 4J3NA 4KC6A 4DDQA 2Y3PA 3NUHA 4KDDA 1O29A 1ZBSA 3BUEA 4KMDA 5CJ9A 1GE9A 2YU9A 5CHPA 4BLBA 2XCOA 2R93A 1O27A 2JH3A 4FZBA 5IORA 4G0VA 1BGWA 1B4BA 4GFQA 4KMAA 4GTBA 5IOTA 4G0WA 4GTDA 1TWFA 3GTPA 4KASA 2KWAA 2P5MA 3N3YA 1O2AA 5EGEA 2CFAB 4KAWX 3N0CA 1WIHA 3L4KA 2NVXA 1EK8A 3AQOA 4M1XA 3FOEA 3VA7A 3Q3QA 1ISEA 2VUMA 2JA7A 5TJ3A 2GSNA 3GTLA 3OPFA 3AQPA 1B4AA 2PHCB 4GTCA 2JA5A 3LPXA 4BKWA 1Y1VA 3V4GA 3GTJA 2R92A 4G0UA 1O28A 1XXBA 3MMLB 2JA6A 1XXAA 2XCRB 4C3JC 4FM9A 3S0XA 2XCQA 2RGRA 4BLAA 4LQYA 1WQHA 2E2HA 3L4JA 1EH1A 2NVYA 4C3HC 4GTEA 4KB2A 4KM8A 5JVOA 2ZFZA 1TWCA 4KB4A 3H0GA 3FKIA 1ZXOA 4GTFA 3GTKA 2GSUA 3CAGA 1TWGA 4GT9A 1WQFA 1TWAA 1WQGA 1BJTA 3QX3A 1WCMA 4ILDA 1R9TA 1O26A 3ERED 3G4AA 1O24A 4KM9A 3GTMA 3G4CA 4GTAA 3LAPA 5IOSA 4GTLA 2R7ZA 2GSOA 3OREA 4LR2A 1TWHA 3AH5A 3LAJA 1SFOA 4KMHA 4C3IC 1I50A 4C2MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O27 A;  4FZB A;  5IOR A;  3N0B A;  4P5A A;  4GTF A;  4GTB A;  5IOT A;  4P5B A;  4GT9 A;  4GTD A;  4KAS A;  1O28 A;  3N3Y A;  1O2A A;  1O26 A;  5JFE A;  5IOQ A;  4KAT A;  1KQ4 A;  3G4A A;  1O24 A;  2CFA B;  2CFA A;  3N0C A;  1O25 A;  4KAR A;  1O2B A;  3G4C A;  4GTA A;  5IOS A;  4GTL A;  1O29 A;  4GTE A;  3AH5 A;  5CHP A;  4GTC A; 
#chains in the Genus database with same CATH topology
 3S2H C;  4OIP A;  4OIR A;  2VUM K;  4P5A A;  4WJ4 A;  3GTO C;  1K83 C;  3H3V L;  5M3M K;  3IPJ A;  3HOW K;  1WOP A;  4A3K C;  3HOX C;  4X6A K;  5JFE A;  2E2I A;  3GTJ K;  1KQ4 A;  1O25 A;  4LJZ A;  4A3C C;  3GTP K;  4AYB D;  4KC6 A;  4O2D A;  2Y3P A;  2CW0 A;  4KDD A;  2P8T A;  2YU9 A;  3GTL C;  4BLB A;  2R93 A;  5IOR A;  2JH3 A;  4G0V A;  1BGW A;  4GFQ A;  4BBS K;  4GTB A;  1DCO A;  1IBA A;  4XLN A;  1C0A A;  4A3L K;  3GTK K;  2KWA A;  1DCP A;  3HKZ L;  5C44 C;  3TFJ A;  5HL8 A;  1PJ5 A;  1WIH A;  1RU0 A;  4XSX A;  4BBR C;  2NVX C;  5IP7 K;  2JA7 A;  1ISE A;  2GSN A;  1V5V A;  3GTM K;  2E2J K;  3AD9 C;  2NVY K;  1TWH K;  5FLM K;  1I50 K;  3T00 A;  1J98 A;  2GAH C;  1Y1V C;  1TWA C;  3MML B;  1I6H K;  1XXA A;  4A93 C;  4C3J C;  2JA6 C;  4A3I C;  4BXX C;  1WSV A;  1J6W A;  4A3F C;  3AD7 C;  2RGR A;  2A6E A;  2E2H A;  1WQH A;  4C3H C;  3HOU K;  4KM8 A;  1SFO C;  3S17 C;  4Y7N K;  1TWC C;  3HOY C;  2V6T A;  3FKI A;  5M3F K;  1I3Q C;  3WOD A;  4KN7 A;  3DXJ A;  3GTQ C;  3JST A;  5M5W K;  2R93 K;  3S15 K;  1HI9 A;  1TWG C;  3S1N K;  3S14 K;  4MQ9 A;  3CQZ C;  3I4M K;  1WCM A;  4MEY A;  3ERE D;  3I4N C;  1R9T C;  4AYB L;  1JOE A;  1O2F B;  2R7Z A;  3AH5 A;  1JVI A;  1ZYR A;  2A68 A;  4C2M C;  3S1R C;  1XXC A;  5C4X C;  2ZUF A;  3GTO A;  1K83 A;  1Y1W C;  1ZVU A;  4QIW L;  1DCH A;  3A8J A;  1IW7 A;  2RH6 A;  5IYD K;  3T02 A;  4QJV B;  4YFN A;  5C3E K;  3GTG A;  4Y52 C;  4A3M K;  1AB4 A;  2JA8 C;  1YCL A;  2B63 A;  3A8K A;  4BY7 C;  1O29 A;  2XCO A;  2E2H K;  4FZB A;  3HOW C;  5IYB C;  1USO A;  4KMA A;  4X6A C;  2A6H A;  4NOI A;  1WSR A;  2P5M A;  3AD8 C;  3PO2 K;  3GTP C;  4A3D K;  5EGE A;  1XZP B;  4RMF A;  3RZO K;  3PO3 K;  3S1M C;  2NVX A;  3VA7 A;  1EQR A;  4MEX A;  3TFI A;  5C4J C;  2PA8 L;  4OIN A;  2JA5 C;  1PJ7 A;  3TFH A;  4A3L C;  3GTK C;  1XZQ A;  3LPX A;  1INN A;  3S2H K;  5IP9 C;  1Y1V A;  1VH2 A;  3V4G A;  1IE0 A;  3HOZ K;  1K83 K;  2R92 C;  4G0U A;  2JA6 A;  4A3J C;  4FM9 A;  3GTG K;  3S0X A;  3GTM C;  3SZZ A;  2B63 K;  2BE5 A;  2E2J C;  2NVY C;  1UV7 A;  5JVO A;  1TWC A;  2WAQ D;  3GDZ A;  4GZY A;  3H0G C;  1JQW A;  4BY1 K;  3HOV K;  1I6H C;  1TWG A;  2NVQ K;  4QJV A;  2NVT K;  1J6X A;  1BJT A;  1R9T A;  3BP3 A;  3HOU C;  4Y7N C;  1HQM A;  1YNN A;  2WB1 L;  2E2I K;  4OIQ A;  3LAP A;  5M5Y K;  2Y0S D;  4KMH A;  2R93 C;  3SZY A;  4YFX A;  1Y1W A;  3S15 C;  4KN4 A;  3S1N C;  1F9N A;  1VRQ C;  3N0B A;  3S1Q K;  3S14 C;  3H3V D;  1BS2 A;  3I4M C;  5IYC C;  4P9S A;  2YU9 K;  5D4D A;  2O5I A;  3A8I A;  4Q5S A;  2D6F C;  3K7A C;  1YNJ A;  4JK1 A;  1Y1V K;  1I6V A;  4A3B C;  4A93 K;  3FHZ A;  3M4O K;  1IQ0 A;  4KAR A;  4A3I K;  1O2B A;  4LK1 A;  4LK0 A;  4BXX K;  4J3N A;  4G7O A;  4DDQ A;  1ZBS A;  5CJ9 A;  5CHP A;  4C3H K;  5IYD C;  5C3E C;  4G7H A;  3GSI A;  4AH6 A;  3RZD K;  1TWC K;  1EFW A;  2JA7 K;  4A3M C;  4A3E K;  2FQO A;  4GTD A;  1F7U A;  3GTP A;  1TWF C;  1L0W A;  3T01 A;  1O2A A;  4PAA A;  2CFA B;  3N0C A;  4XLP A;  3S16 K;  3I4N K;  1R9T K;  3L4K A;  2E2H C;  1EK8 A;  3FOE A;  3GEH A;  5TJ3 A;  2VUM C;  3GTL A;  1B4A A;  3AQP A;  3OPF A;  2PHC B;  1PJ6 A;  3M3Y K;  2JA5 A;  1BDF A;  3PO2 C;  4BKW A;  4WJ3 M;  4A3D C;  1Y1W K;  2R92 A;  3FKI K;  3GTJ C;  4WIL A;  1WOR A;  1F7V A;  1O28 A;  1XXB A;  2W7V A;  3RZO C;  4OIO A;  3PO3 C;  1WOO A;  4Y52 K;  2O5J A;  5L46 A;  4XSZ A;  4BLA A;  1WCM K;  4LQY A;  2NVY A;  2ZUE A;  4GTE A;  4KB2 A;  2Y0S L;  2ZFZ A;  4BY7 K;  4KB4 A;  3EQL A;  4BBS C;  4A3G K;  3H0G A;  2PMZ D;  2V6S A;  1ZXO A;  3HOZ C;  1VGX A;  2R7Z K;  3S2D K;  4ZH4 A;  1EI6 A;  4C3I K;  1IL2 A;  4GT9 A;  5IYB K;  3GTG C;  2PPB A;  1WQF A;  1TWA A;  2GAG C;  3GTO K;  4ILD A;  2V6U A;  1O26 A;  2B63 C;  3G4A A;  4A3K K;  3HOX K;  5IP7 C;  4G7Z A;  3TTG A;  4GTL A;  4BY1 C;  4A3C K;  1SFO A;  3HOV C;  3S1M K;  1TWH C;  5FLM C;  3OEP A;  2FQT A;  3FOF A;  1I50 C;  2NVQ C;  1I3Q A;  5EGH A;  2NVT C;  5C4J K;  3GTL K;  4QIW D;  3GTQ A;  1DD5 A;  4P5B A;  2JA5 K;  2A69 A;  1IS1 A;  5FJ8 K;  3CQZ A;  5IP9 K;  4LOW A;  1XPP A;  4YG2 A;  5IOQ A;  2R92 K;  2EBB A;  4KAT A;  2E2I C;  4A3J K;  2CFA A;  3GEE A;  5C44 K;  3NUH A;  3S1Q C;  3BUE A;  3ADA C;  4KMD A;  1GE9 A;  1WOS A;  4BBR K;  2YU9 C;  2NVX K;  1O27 A;  1VJE A;  1B4B A;  4C45 A;  1J6V A;  5IOT A;  3H0G K;  1VLO A;  4G0W A;  1TWF A;  4KAS A;  3M4O C;  3N3Y A;  4KAW X;  1ZQ1 C;  1TWA K;  1XZP A;  5TMF A;  4C3J K;  3HXA A;  2JA6 K;  3AQO A;  4M1X A;  1X31 C;  3Q3Q A;  2VUM A;  2JA7 C;  3RZD C;  4LLG A;  4A3F K;  2PMZ L;  4GTC A;  4A3E C;  2PA8 D;  4Q4Z A;  1XZQ B;  1SFO K;  3S17 K;  3HOY K;  1USM A;  3GTJ A;  1I3Q K;  5TMC A;  5IYC K;  2XCR B;  3GTQ K;  3S16 C;  4XCH A;  3HKZ D;  3GEI A;  1SMY A;  1TWG K;  3K7A K;  3CQZ K;  5E68 A;  4A3B K;  2XCQ A;  3BP8 C;  4KMU A;  3M3Y C;  1G51 A;  1EH1 A;  3L4J A;  2WAQ L;  3FKI C;  4GTF A;  1F93 A;  3GTK A;  2GSU A;  3CAG A;  4C2M K;  3S1R K;  5C4X K;  4PAB A;  1YX2 A;  1WQG A;  3QX3 A;  1WCM C;  1O24 A;  1TWF K;  4KM9 A;  4YFK A;  5M5X K;  3GTM A;  2JA8 K;  4A3G C;  3G4C A;  2WB1 D;  4GTA A;  5IOS A;  2GSO A;  3ORE A;  4LR2 A;  1TWH A;  3LAJ A;  2R7Z C;  3S2D C;  3GIR A;  4C3I C;  1I50 A; 
#chains in the Genus database with same CATH homology
 1XXC A;  3OEP A;  3FOF A;  1Y1W A;  1I3Q A;  3GTO A;  1F9N A;  3N0B A;  4P5A A;  5EGH A;  1K83 A;  1ZVU A;  3GTQ A;  1DD5 A;  2RH6 A;  4P5B A;  1IS1 A;  3GTG A;  3CQZ A;  1AB4 A;  5JFE A;  2E2I A;  5IOQ A;  2B63 A;  4KAT A;  1KQ4 A;  2CFA A;  3FHZ A;  1O25 A;  4KAR A;  1O2B A;  4J3N A;  4KC6 A;  4DDQ A;  2Y3P A;  3NUH A;  4KDD A;  1O29 A;  1ZBS A;  3BUE A;  4KMD A;  5CJ9 A;  1GE9 A;  2YU9 A;  5CHP A;  4BLB A;  2XCO A;  2R93 A;  1O27 A;  2JH3 A;  4FZB A;  5IOR A;  4G0V A;  1BGW A;  1B4B A;  4GFQ A;  4KMA A;  4GTB A;  5IOT A;  4G0W A;  4GTD A;  1TWF A;  3GTP A;  4KAS A;  2KWA A;  2P5M A;  3N3Y A;  1O2A A;  5EGE A;  2CFA B;  4KAW X;  3N0C A;  1WIH A;  3L4K A;  2NVX A;  1EK8 A;  3AQO A;  4M1X A;  3FOE A;  3VA7 A;  3Q3Q A;  1ISE A;  2VUM A;  2JA7 A;  5TJ3 A;  2GSN A;  3GTL A;  3OPF A;  3AQP A;  1B4A A;  2PHC B;  4GTC A;  2JA5 A;  3LPX A;  4BKW A;  1Y1V A;  3V4G A;  3GTJ A;  2R92 A;  4G0U A;  1O28 A;  1XXB A;  3MML B;  2JA6 A;  1XXA A;  2XCR B;  4C3J C;  4FM9 A;  3S0X A;  2XCQ A;  2RGR A;  4BLA A;  4LQY A;  1WQH A;  2E2H A;  3L4J A;  1EH1 A;  2NVY A;  4C3H C;  4GTE A;  4KB2 A;  4KM8 A;  5JVO A;  2ZFZ A;  1TWC A;  4KB4 A;  3H0G A;  3FKI A;  1ZXO A;  4GTF A;  3GTK A;  2GSU A;  3CAG A;  1TWG A;  4GT9 A;  1WQF A;  1TWA A;  1WQG A;  1BJT A;  3QX3 A;  1WCM A;  4ILD A;  1R9T A;  1O26 A;  3ERE D;  3G4A A;  1O24 A;  4KM9 A;  3GTM A;  3G4C A;  4GTA A;  3LAP A;  5IOS A;  4GTL A;  2R7Z A;  2GSO A;  3ORE A;  4LR2 A;  1TWH A;  3AH5 A;  3LAJ A;  1SFO A;  4KMH A;  4C3I C;  1I50 A;  4C2M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...