4FZBA

Structure of thymidylate synthase thyx complexed to a new inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
216
structure length
191
Chain Sequence
TGSAKLISVTKPVVEGVNTAEELIAYAARVSNPENQINNKTASGLLKYCIRHKHWSIFETAFMTLELKTSRGIAAQVLRHRSFHFQEFSQRYASVEDDQTWWATEQEKLYAQSMELYNKALEKGIAKECARFILPLSTPTTIYMSGTIRDWIHYIELRTSNGTQREHIDLANACKEIFIKEFPSIAKALDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thymidylate synthase
publication title Mechanistic and structural basis for inhibition of thymidylate synthase ThyX.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus 1
molecule tags Transferase/transferase inhibitor
total genus 62
structure length 191
sequence length 216
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4fzbA01
4GTLA 3N0BA 4GT9A 4P5AA 5CHPA 1KQ4A 1O24A 4KATA 3N3YA 4GTDA 5JFEA 4GTAA 1O27A 4KARA 1O2BA 3G4AA 4GTEA 5IOSA 5IOQA 2CFAB 1O2AA 1O29A 3AH5A 1O28A 4P5BA 4FZBA 5IOTA 3G4CA 1O25A 4GTCA 4KASA 4GTBA 1O26A 5IORA 3N0CA 2CFAA 4GTFA
chains in the Genus database with same CATH superfamily
4GTLA 2PHCB 4GZYA 3PO2K 4GTDA 4GTAA 3GIRA 4WILA 1INNA 3GTQA 4RMFA 4GFQA 2R7ZK 3PO3K 1I6HC 4A93C 4Q5SA 1G51A 3FKIC 4Y7NC 3HOZC 1O29A 4A3CK 1Y1WC 3TTGA 2Y3PA 3SZYA 3GTKA 5TMFA 4G7ZA 2PA8D 5C4JK 2P8TA 3AD8C 5C3EC 3GTOC 4KATA 1K83C 1USMA 3ERED 1O27A 1I50C 1PJ7A 1VH2A 1WQHA 4BKWA 4JK1A 5IYDC 2ZUEA 4X6AC 4BLBA 4MQ9A 1XPPA 3IPJA 2E2IA 4YG2A 5M5WK 3A8IA 4ZH4A 4P5BA 3OREA 3FHZA 4FZBA 3HOYC 5M5YK 3N0CA 5IYCK 4O2DA 3N0BA 4P5AA 1R9TA 1L0WA 3GTQC 4XLNA 3HKZL 4KC6A 4A3JK 1XZQA 1USOA 1TWCA 4KB2A 5M5XK 3I4MK 3T02A 5IOQA 4A3BC 4ILDA 1IE0A 3T01A 1F7VA 2PPBA 4YFXA 1TWFC 1AB4A 3GTQK 2A6EA 4LLGA 1F7UA 3HOXK 1ZVUA 5FJ8K 2EBBA 4KASA 1YNNA 2V6TA 1O2FB 3H3VL 3HOWK 1ISEA 3S2HK 2JA6C 3K7AC 5IP9C 4GT9A 3LAPA 5C44K 3GTKK 3QX3A 1O2BA 5C4XK 1SFOC 3G4AA 4BY1C 2KWAA 4BXXC 3S17K 4BBSC 4KMUA 1WOOA 3S0XA 1HQMA 3LAJA 2WAQL 3GTMK 3GEIA 3S16K 2GAHC 5EGHA 2GAGC 3TFHA 3FKIA 2NVTK 1JOEA 1I3QC 2A69A 1Y1WA 1O25A 4QIWL 4BLAA 1O26A 4AH6A 1O2AA 2E2IK 5IP7C 2XCRB 2O5JA 3LPXA 3S1RK 2GSOA 2JH3A 2NVXC 4C3JK 3HOUK 5M3MK 3GTOA 1K83A 1ZXOA 1WCMK 1I50A 1R9TK 3ADAC 4LK1A 4KMAA 4G7HA 1B4AA 2R92C 1TWCK 1J6WA 1DCHA 4YFKA 5HL8A 1TWAC 3HOVK 1I6VA 1EQRA 2NVYA 1GE9A 4C2MC 2Y0SL 2V6UA 3FOFA 4KAWX 5IYBC 4A3KK 3RZOC 4A3MC 1XZPA 4XSXA 3AD7C 3GSIA 1O28A 3S14C 1WORA 1ZBSA 3S1MK 3S15C 1B4BA 5IYBK 4C3IC 1TWFA 4AYBL 3S1NC 1I6HK 1VLOA 5M3FK 1BJTA 4A93K 3GTJA 2PMZD 3FKIK 1WOPA 3CQZC 3WODA 4Y7NK 3HOZK 1PJ5A 1Y1WK 2JA6A 2E2HC 4C3HC 1BGWA 3L4JA 2WB1D 2JA5C 3BP3A 1SFOA 3S2DC 4XSZA 2YU9C 3GTGC 2GSNA 3AD9C 2O5IA 2NVYC 5L46A 5C3EK 3GTOK 4A3EC 1K83K 2ZFZA 2B63C 1I50K 4KM8A 1J6VA 2RGRA 4X6AK 5IYDK 1WOSA 1I3QA 4Y52C 1Y1VC 4A3IC 3GDZA 1J98A 1TWHC 3A8KA 3HOYK 1F9NA 2NVXA 4J3NA 4YFNA 1IL2A 3GEHA 4Q4ZA 3FOEA 4LJZA 3S1QC 3I4NC 1WQGA 1XZPB 4A3IK 4OINA 2R92A 2CFAA 3GTJC 1EK8A 1XXCA 4PAAA 1TWAA 3SZZA 4A3BK 2VUMC 3DXJA 1TWGC 2ZUFA 1XXAA 1DCOA 1ZQ1C 5JVOA 1TWFK 4A3GC 1JVIA 1IBAA 2XCQA 1C0AA 3GTPC 2JA6K 1EH1A 3K7AK 5IP9K 4A3LC 1IW7A 3CAGA 1PJ6A 3G4CA 4GTCA 4A3FC 2E2JC 2R7ZA 1YCLA 1WSRA 5IORA 2JA7C 1SFOK 4BBRC 5CHPA 4BY1K 1IQ0A 4OIRA 4BXXK 4BBSK 1WIHA 2CW0A 1VRQC 1WSVA 1YNJA 4G7OA 4QJVA 3M3YC 3GTLC 4KN7A 4KMHA 3CQZA 4OIOA 1I3QK 2JA8C 2E2HA 4KB4A 2XCOA 2JA5A 2FQTA 1XZQB 4OIQA 3M4OC 2YU9A 3GTGA 5IP7K 2W7VA 1X31C 1SMYA 1RU0A 5FLMC 4KMDA 3S1MC 3H0GC 2NVXK 4BY7C 1KQ4A 1O24A 4QIWD 3MMLB 2B63A 4KARA 1BDFA 2CFAB 2R92K 3PO2C 3OEPA 1Y1VA 1TWAK 3AH5A 5TMCA 5FLMK 1TWHA 2R7ZC 3PO3C 4C2MK 2PA8L 4XCHA 4A3CC 1F93A 2PMZL 3T00A 2RH6A 3RZDC 5TJ3A 5E68A 2WB1L 4A3MK 3RZOK 4LK0A 3TFIA 2BE5A 4LOWA 1WQFA 1BS2A 2Y0SD 5C4JC 4NOIA 3S14K 3JSTA 3GEEA 2VUMA 4WJ4A 1TWGA 3S15K 4C3IK 2FQOA 3RZDK 3S1NK 4QJVB 4LQYA 3GTPA 3CQZK 4LR2A 5EGEA 4C3HK 2E2HK 2JA5K 3GTMA 2JA7A 3S2DK 5IYCC 2A68A 4AYBD 2YU9K 3GTGK 4GTEA 3BUEA 3Q3QA 2NVYK 4A3JC 3AQOA 4P9SA 4KN4A 1XXBA 1VGXA 4A3EK 2B63K 3I4MC 3GTLA 4KDDA 5CJ9A 4XLPA 5IOTA 3OPFA 1WCMA 4Y52K 1Y1VK 5JFEA 4G0UA 2R93A 3EQLA 1TWHK 3HOXC 3N3YA 3H0GA 3S2HC 3HOWC 4OIPA 5IOSA 5C44C 3HKZD 3GTKC 3S1QK 5D4DA 1UV7A 5C4XC 3I4NK 4A3DC 3S17C 3GTJK 1HI9A 2VUMK 4GTBA 3GTMC 3TFJA 1TWGK 3S16C 1J6XA 2NVTC 2GSUA 4WJ3M 3VA7A 4G0VA 3H3VD 4A3GK 4A3DK 2E2IC 4KM9A 3GTPK 1V5VA 1DCPA 4A3LK 2NVQC 1VJEA 2D6FC 3S1RC 1ZYRA 4A3FK 2E2JK 4C3JC 3HOUC 4MEXA 2JA7K 4BBRK 1WCMC 1R9TC 2R93C 4DDQA 1JQWA 4C45A 2V6SA 2WAQD 4MEYA 1TWCC 4PABA 3M3YK 3AQPA 2NVQK 3GTLK 3HOVC 1EFWA 2JA8K 4M1XA 4G0WA 3HXAA 3L4KA 3BP8C 2R93K 1YX2A 3M4OK 4A3KC 2P5MA 3H0GK 4BY7K 4FM9A 3NUHA 2A6HA 3V4GA 1DD5A 1IS1A 1EI6A 3A8JA 4GTFA
chains in the Genus database with same CATH topology
4GTLA 4LR2A 1EK8A 2PHCB 5EGEA 1XXCA 1TWAA 3GTMA 4GTDA 2XCRB 4GTAA 2JA7A 3LPXA 2GSOA 2JH3A 3GTQA 4GTEA 3BUEA 4GFQA 3GTOA 1XXAA 1K83A 5JVOA 1ZXOA 3Q3QA 1O2AA 1I50A 3AQOA 4KMAA 1O29A 1XXBA 2XCQA 2Y3PA 3GTLA 1B4AA 3GTKA 1EH1A 4KDDA 5CJ9A 5IOTA 3CAGA 3G4CA 4GTCA 2R7ZA 3OPFA 1WCMA 2NVYA 5IORA 5JFEA 4G0UA 4C2MC 2R93A 1GE9A 5CHPA 3FOFA 4KATA 3N3YA 1WIHA 4KAWX 3ERED 1O27A 3H0GA 1WQHA 4BKWA 5IOSA 4BLBA 4KMHA 3CQZA 2E2IA 2E2HA 4KB4A 1O28A 2XCOA 4P5BA 2JA5A 3OREA 1ZBSA 3FHZA 4FZBA 2YU9A 1B4BA 3GTGA 4GTBA 3N0CA 4KMDA 4C3IC 1TWFA 3N0BA 4P5AA 1R9TA 1KQ4A 1O24A 2GSUA 3MMLB 4KC6A 1BJTA 3GTJA 2B63A 4KARA 3VA7A 4G0VA 2JA6A 1TWCA 4KB2A 4C3HC 1BGWA 4KM9A 5IOQA 3L4JA 2CFAB 3OEPA 1Y1VA 4ILDA 1SFOA 4C3JC 3AH5A 2GSNA 1TWHA 1AB4A 4DDQA 1ZVUA 4KASA 2ZFZA 4KM8A 1ISEA 2RGRA 3LAPA 4GT9A 2RH6A 1I3QA 5TJ3A 3AQPA 3QX3A 1O2BA 3G4AA 1WQFA 4M1XA 2KWAA 4G0WA 3L4KA 2VUMA 3S0XA 1F9NA 1TWGA 2NVXA 4J3NA 3LAJA 2P5MA 5EGHA 3FKIA 3FOEA 4FM9A 1Y1WA 3NUHA 1O25A 4BLAA 1WQGA 3V4GA 4LQYA 1DD5A 3GTPA 1O26A 1IS1A 2R92A 2CFAA 4GTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTL A;  3N0B A;  4GT9 A;  4P5A A;  5CHP A;  1KQ4 A;  1O24 A;  4KAT A;  3N3Y A;  4GTD A;  5JFE A;  4GTA A;  1O27 A;  4KAR A;  1O2B A;  3G4A A;  4GTE A;  5IOS A;  5IOQ A;  2CFA B;  1O2A A;  1O29 A;  3AH5 A;  1O28 A;  4P5B A;  4FZB A;  5IOT A;  3G4C A;  1O25 A;  4GTC A;  4KAS A;  4GTB A;  1O26 A;  5IOR A;  3N0C A;  2CFA A;  4GTF A; 
#chains in the Genus database with same CATH topology
 4GTL A;  2PHC B;  4GZY A;  3PO2 K;  4GTD A;  4GTA A;  3GIR A;  4WIL A;  1INN A;  3GTQ A;  4RMF A;  4GFQ A;  2R7Z K;  3PO3 K;  1I6H C;  4A93 C;  4Q5S A;  1G51 A;  3FKI C;  4Y7N C;  3HOZ C;  1O29 A;  4A3C K;  1Y1W C;  3TTG A;  2Y3P A;  3SZY A;  3GTK A;  5TMF A;  4G7Z A;  2PA8 D;  5C4J K;  2P8T A;  3AD8 C;  5C3E C;  3GTO C;  4KAT A;  1K83 C;  1USM A;  3ERE D;  1O27 A;  1I50 C;  1PJ7 A;  1VH2 A;  1WQH A;  4BKW A;  4JK1 A;  5IYD C;  2ZUE A;  4X6A C;  4BLB A;  4MQ9 A;  1XPP A;  3IPJ A;  2E2I A;  4YG2 A;  5M5W K;  3A8I A;  4ZH4 A;  4P5B A;  3ORE A;  3FHZ A;  4FZB A;  3HOY C;  5M5Y K;  3N0C A;  5IYC K;  4O2D A;  3N0B A;  4P5A A;  1R9T A;  1L0W A;  3GTQ C;  4XLN A;  3HKZ L;  4KC6 A;  4A3J K;  1XZQ A;  1USO A;  1TWC A;  4KB2 A;  5M5X K;  3I4M K;  3T02 A;  5IOQ A;  4A3B C;  4ILD A;  1IE0 A;  3T01 A;  1F7V A;  2PPB A;  4YFX A;  1TWF C;  1AB4 A;  3GTQ K;  2A6E A;  4LLG A;  1F7U A;  3HOX K;  1ZVU A;  5FJ8 K;  2EBB A;  4KAS A;  1YNN A;  2V6T A;  1O2F B;  3H3V L;  3HOW K;  1ISE A;  3S2H K;  2JA6 C;  3K7A C;  5IP9 C;  4GT9 A;  3LAP A;  5C44 K;  3GTK K;  3QX3 A;  1O2B A;  5C4X K;  1SFO C;  3G4A A;  4BY1 C;  2KWA A;  4BXX C;  3S17 K;  4BBS C;  4KMU A;  1WOO A;  3S0X A;  1HQM A;  3LAJ A;  2WAQ L;  3GTM K;  3GEI A;  3S16 K;  2GAH C;  5EGH A;  2GAG C;  3TFH A;  3FKI A;  2NVT K;  1JOE A;  1I3Q C;  2A69 A;  1Y1W A;  1O25 A;  4QIW L;  4BLA A;  1O26 A;  4AH6 A;  1O2A A;  2E2I K;  5IP7 C;  2XCR B;  2O5J A;  3LPX A;  3S1R K;  2GSO A;  2JH3 A;  2NVX C;  4C3J K;  3HOU K;  5M3M K;  3GTO A;  1K83 A;  1ZXO A;  1WCM K;  1I50 A;  1R9T K;  3ADA C;  4LK1 A;  4KMA A;  4G7H A;  1B4A A;  2R92 C;  1TWC K;  1J6W A;  1DCH A;  4YFK A;  5HL8 A;  1TWA C;  3HOV K;  1I6V A;  1EQR A;  2NVY A;  1GE9 A;  4C2M C;  2Y0S L;  2V6U A;  3FOF A;  4KAW X;  5IYB C;  4A3K K;  3RZO C;  4A3M C;  1XZP A;  4XSX A;  3AD7 C;  3GSI A;  1O28 A;  3S14 C;  1WOR A;  1ZBS A;  3S1M K;  3S15 C;  1B4B A;  5IYB K;  4C3I C;  1TWF A;  4AYB L;  3S1N C;  1I6H K;  1VLO A;  5M3F K;  1BJT A;  4A93 K;  3GTJ A;  2PMZ D;  3FKI K;  1WOP A;  3CQZ C;  3WOD A;  4Y7N K;  3HOZ K;  1PJ5 A;  1Y1W K;  2JA6 A;  2E2H C;  4C3H C;  1BGW A;  3L4J A;  2WB1 D;  2JA5 C;  3BP3 A;  1SFO A;  3S2D C;  4XSZ A;  2YU9 C;  3GTG C;  2GSN A;  3AD9 C;  2O5I A;  2NVY C;  5L46 A;  5C3E K;  3GTO K;  4A3E C;  1K83 K;  2ZFZ A;  2B63 C;  1I50 K;  4KM8 A;  1J6V A;  2RGR A;  4X6A K;  5IYD K;  1WOS A;  1I3Q A;  4Y52 C;  1Y1V C;  4A3I C;  3GDZ A;  1J98 A;  1TWH C;  3A8K A;  3HOY K;  1F9N A;  2NVX A;  4J3N A;  4YFN A;  1IL2 A;  3GEH A;  4Q4Z A;  3FOE A;  4LJZ A;  3S1Q C;  3I4N C;  1WQG A;  1XZP B;  4A3I K;  4OIN A;  2R92 A;  2CFA A;  3GTJ C;  1EK8 A;  1XXC A;  4PAA A;  1TWA A;  3SZZ A;  4A3B K;  2VUM C;  3DXJ A;  1TWG C;  2ZUF A;  1XXA A;  1DCO A;  1ZQ1 C;  5JVO A;  1TWF K;  4A3G C;  1JVI A;  1IBA A;  2XCQ A;  1C0A A;  3GTP C;  2JA6 K;  1EH1 A;  3K7A K;  5IP9 K;  4A3L C;  1IW7 A;  3CAG A;  1PJ6 A;  3G4C A;  4GTC A;  4A3F C;  2E2J C;  2R7Z A;  1YCL A;  1WSR A;  5IOR A;  2JA7 C;  1SFO K;  4BBR C;  5CHP A;  4BY1 K;  1IQ0 A;  4OIR A;  4BXX K;  4BBS K;  1WIH A;  2CW0 A;  1VRQ C;  1WSV A;  1YNJ A;  4G7O A;  4QJV A;  3M3Y C;  3GTL C;  4KN7 A;  4KMH A;  3CQZ A;  4OIO A;  1I3Q K;  2JA8 C;  2E2H A;  4KB4 A;  2XCO A;  2JA5 A;  2FQT A;  1XZQ B;  4OIQ A;  3M4O C;  2YU9 A;  3GTG A;  5IP7 K;  2W7V A;  1X31 C;  1SMY A;  1RU0 A;  5FLM C;  4KMD A;  3S1M C;  3H0G C;  2NVX K;  4BY7 C;  1KQ4 A;  1O24 A;  4QIW D;  3MML B;  2B63 A;  4KAR A;  1BDF A;  2CFA B;  2R92 K;  3PO2 C;  3OEP A;  1Y1V A;  1TWA K;  3AH5 A;  5TMC A;  5FLM K;  1TWH A;  2R7Z C;  3PO3 C;  4C2M K;  2PA8 L;  4XCH A;  4A3C C;  1F93 A;  2PMZ L;  3T00 A;  2RH6 A;  3RZD C;  5TJ3 A;  5E68 A;  2WB1 L;  4A3M K;  3RZO K;  4LK0 A;  3TFI A;  2BE5 A;  4LOW A;  1WQF A;  1BS2 A;  2Y0S D;  5C4J C;  4NOI A;  3S14 K;  3JST A;  3GEE A;  2VUM A;  4WJ4 A;  1TWG A;  3S15 K;  4C3I K;  2FQO A;  3RZD K;  3S1N K;  4QJV B;  4LQY A;  3GTP A;  3CQZ K;  4LR2 A;  5EGE A;  4C3H K;  2E2H K;  2JA5 K;  3GTM A;  2JA7 A;  3S2D K;  5IYC C;  2A68 A;  4AYB D;  2YU9 K;  3GTG K;  4GTE A;  3BUE A;  3Q3Q A;  2NVY K;  4A3J C;  3AQO A;  4P9S A;  4KN4 A;  1XXB A;  1VGX A;  4A3E K;  2B63 K;  3I4M C;  3GTL A;  4KDD A;  5CJ9 A;  4XLP A;  5IOT A;  3OPF A;  1WCM A;  4Y52 K;  1Y1V K;  5JFE A;  4G0U A;  2R93 A;  3EQL A;  1TWH K;  3HOX C;  3N3Y A;  3H0G A;  3S2H C;  3HOW C;  4OIP A;  5IOS A;  5C44 C;  3HKZ D;  3GTK C;  3S1Q K;  5D4D A;  1UV7 A;  5C4X C;  3I4N K;  4A3D C;  3S17 C;  3GTJ K;  1HI9 A;  2VUM K;  4GTB A;  3GTM C;  3TFJ A;  1TWG K;  3S16 C;  1J6X A;  2NVT C;  2GSU A;  4WJ3 M;  3VA7 A;  4G0V A;  3H3V D;  4A3G K;  4A3D K;  2E2I C;  4KM9 A;  3GTP K;  1V5V A;  1DCP A;  4A3L K;  2NVQ C;  1VJE A;  2D6F C;  3S1R C;  1ZYR A;  4A3F K;  2E2J K;  4C3J C;  3HOU C;  4MEX A;  2JA7 K;  4BBR K;  1WCM C;  1R9T C;  2R93 C;  4DDQ A;  1JQW A;  4C45 A;  2V6S A;  2WAQ D;  4MEY A;  1TWC C;  4PAB A;  3M3Y K;  3AQP A;  2NVQ K;  3GTL K;  3HOV C;  1EFW A;  2JA8 K;  4M1X A;  4G0W A;  3HXA A;  3L4K A;  3BP8 C;  2R93 K;  1YX2 A;  3M4O K;  4A3K C;  2P5M A;  3H0G K;  4BY7 K;  4FM9 A;  3NUH A;  2A6H A;  3V4G A;  1DD5 A;  1IS1 A;  1EI6 A;  3A8J A;  4GTF A; 
#chains in the Genus database with same CATH homology
 4GTL A;  4LR2 A;  1EK8 A;  2PHC B;  5EGE A;  1XXC A;  1TWA A;  3GTM A;  4GTD A;  2XCR B;  4GTA A;  2JA7 A;  3LPX A;  2GSO A;  2JH3 A;  3GTQ A;  4GTE A;  3BUE A;  4GFQ A;  3GTO A;  1XXA A;  1K83 A;  5JVO A;  1ZXO A;  3Q3Q A;  1O2A A;  1I50 A;  3AQO A;  4KMA A;  1O29 A;  1XXB A;  2XCQ A;  2Y3P A;  3GTL A;  1B4A A;  3GTK A;  1EH1 A;  4KDD A;  5CJ9 A;  5IOT A;  3CAG A;  3G4C A;  4GTC A;  2R7Z A;  3OPF A;  1WCM A;  2NVY A;  5IOR A;  5JFE A;  4G0U A;  4C2M C;  2R93 A;  1GE9 A;  5CHP A;  3FOF A;  4KAT A;  3N3Y A;  1WIH A;  4KAW X;  3ERE D;  1O27 A;  3H0G A;  1WQH A;  4BKW A;  5IOS A;  4BLB A;  4KMH A;  3CQZ A;  2E2I A;  2E2H A;  4KB4 A;  1O28 A;  2XCO A;  4P5B A;  2JA5 A;  3ORE A;  1ZBS A;  3FHZ A;  4FZB A;  2YU9 A;  1B4B A;  3GTG A;  4GTB A;  3N0C A;  4KMD A;  4C3I C;  1TWF A;  3N0B A;  4P5A A;  1R9T A;  1KQ4 A;  1O24 A;  2GSU A;  3MML B;  4KC6 A;  1BJT A;  3GTJ A;  2B63 A;  4KAR A;  3VA7 A;  4G0V A;  2JA6 A;  1TWC A;  4KB2 A;  4C3H C;  1BGW A;  4KM9 A;  5IOQ A;  3L4J A;  2CFA B;  3OEP A;  1Y1V A;  4ILD A;  1SFO A;  4C3J C;  3AH5 A;  2GSN A;  1TWH A;  1AB4 A;  4DDQ A;  1ZVU A;  4KAS A;  2ZFZ A;  4KM8 A;  1ISE A;  2RGR A;  3LAP A;  4GT9 A;  2RH6 A;  1I3Q A;  5TJ3 A;  3AQP A;  3QX3 A;  1O2B A;  3G4A A;  1WQF A;  4M1X A;  2KWA A;  4G0W A;  3L4K A;  2VUM A;  3S0X A;  1F9N A;  1TWG A;  2NVX A;  4J3N A;  3LAJ A;  2P5M A;  5EGH A;  3FKI A;  3FOE A;  4FM9 A;  1Y1W A;  3NUH A;  1O25 A;  4BLA A;  1WQG A;  3V4G A;  4LQY A;  1DD5 A;  3GTP A;  1O26 A;  1IS1 A;  2R92 A;  2CFA A;  4GTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...