The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
145
|
sequence length |
437
|
structure length |
427
|
Chain Sequence |
b'VTTLRQTDPDFEQKFAAFLSGDVDRAVREIVDRVRREGDSALLDYSRRFDRIDLEKTGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSRWTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAGVSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVLIVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTETASASWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAHAQSVAIRLNLLEHHHHHH'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis for the rational design of new anti-Brucella agents: The crystal structure of the C366S mutant of l-histidinol dehydrogenase from Brucella suis.
pubmed doi rcsb |
molecule keywords |
Histidinol dehydrogenase
|
source organism |
Brucella suis 1330
|
molecule tags |
Oxidoreductase
|
total genus |
145
|
structure length |
427
|
sequence length |
437
|
ec nomenclature |
ec
1.1.1.23: Histidinol dehydrogenase. |
pdb deposition date | 2012-07-09 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00815 | Histidinol_dh | Histidinol dehydrogenase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Nitrogenase molybdenum iron protein domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Nitrogenase molybdenum iron protein domain |