4G07A

The crystal structure of the c366s mutant of hdh from brucella suis
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
437
structure length
427
Chain Sequence
VTTLRQTDPDFEQKFAAFLSGDVDRAVREIVDRVRREGDSALLDYSRRFDRIDLEKTGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSRWTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAGVSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVLIVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTETASASWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAHAQSVAIRLNLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidinol dehydrogenase
publication title Structural basis for the rational design of new anti-Brucella agents: The crystal structure of the C366S mutant of l-histidinol dehydrogenase from Brucella suis.
pubmed doi rcsb
source organism Brucella suis 1330
molecule tags Oxidoreductase
total genus 145
structure length 427
sequence length 437
ec nomenclature ec 1.1.1.23: Histidinol dehydrogenase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00815 Histidinol_dh Histidinol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4g07A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4g07A02
3AEKB 1KARA 2AFHB 1KAEA 4NNOA 3ZK8A 2XDQA 3GI1A 4MLZA 2XY4A 5GGYA 4TKVA 3AEUA 2R79A 4MX8A 3UJPA 5KOJA 1K75A 5CX1A 2PS0A 2MINB 4M7OA 3AERA 1QH8A 1L5HB 2XUZA 3AEQB 4WNAB 3AESA 2ETVA 4HN9A 3AETA 2YNMD 2RG7A 3PDIB 1TOAA 3PSHA 3U7QB 3ZKAA 4WESA 4WN9B 2M6LA 2XQVA 1QH1B 2OSVA 2AFIA 4GICA 5KHLB 5HDQA 3BE6A 3MINA 2Q8QA 3CX3A 4FILA 1G20A 4TKVB 4H0FA 4DBLE 5I4KA 5BVHA 1FP4B 5KOJB 2YNMC 3EIWA 5CX1B 3TEFA 5M29A 2QI9F 4INOA 3AERB 1N2CB 1ESZA 3ZK9A 4LS3A 1M1NA 3PSAA 5M2QA 4UDOA 1G21B 3AETB 1MIOB 1EFDN 3R5TA 2X4LA 4WZAA 1QGUA 4K3VA 4OXQA 1H1LA 3R5SA 5M34A 2WHYA 5FLYA 4IRMA 2R7AA 3MINB 1N4AA 1XVLA 4FKMA 4G07A 2XDQB 1K2VN 3AEKA 2AFHA 4UDNA 2PRSA 2XH8A 3K1AA 3AEUB 3BE5A 4OVKA 3NU1A 3TLKA 1M1NB 1M1YA 4ND8A 1N4DA 2PS3A 1QH8B 4WZBA 2MINA 3TNYA 4BBPA 3MWFA 4UTPA 1QGUB 3AESB 2OGWA 2XV1A 1PQ4A 5AFSA 1K0FA 5JOQA 4CL2A 2WI8A 5KOHA 3ZTTA 4WESB 4MO9A 3U7QA 4XPIA 5CR9A 2Q8PA 4B8YA 2AFIB 5M3BA 4N01A 1QH1A 3HXPA 4LJSA 1M34A 3HJTA 5B58T 5JPDA 4PM4A 1G20B 2M6KA 4TKUA 3HH8A 3K1AB 1N2ZA 1KAHA 5BVGA 5BVHB 4OXRA 5GGXA 1FP4A 1M1YB 4NNPA 4ND8B 4WZBB 2OV1A 4PAGA 1N2CA 1K7SN 4H59A 4HMQA 4MDYA 2PS9A 1G21A 4UTOA 4WZAB 2PHZA 1L5HA 1MIOA 3MFQA 4HMPA 5KOHB 3MD9A 3AEQA 4WNAA 2OV3A 4XPIB 1H1LB 5HX7A 5JJ5A 3LHSA 3ZK7A 2O1EA 4G09A 3MWGA 4HMOA 3PDIA 4FI3F 3EIXA 1M34B 1PSZA 4WN9A 3LI2A 4FNAA 4TKUB 4INPA 5BVGB 3G9QA 5JG7A
chains in the Genus database with same CATH superfamily
2Z4TA 1HDZA 1VHLA 1YL7A 3L0PA 4S0XA 4Z3DA 5C4GB 5JMOA 1XXHA 4MS1A 2XNKA 5JYBA 1QP7A 3DG9A 2QGZA 4B31A 2P67A 3L1KA 5KNDH 1ARZA 1TZBA 3PUIA 4CKYA 3TBKA 5GJWC 5JNRA 1V96A 4OB8A 1IRIA 1S6YA 1BVHA 5BV0A 3NHAA 3AH8A 5FBWB 3AY7A 1N78A 2FKNA 5IT9A 4ZYZA 4TTVA 1C7IA 1R4MB 3AJRA 4TS4A 1L2TA 2VH2A 2H0AA 2XBMA 3ZKAA 3L04A 2Z2KA 4Y9DA 3BWEA 3EY4A 3K35A 4AB1A 1T5SA 3GFTA 1JR3D 2JBHA 3ECAA 4YLYA 1LV7A 1J2JA 3VR6D 3OKPA 4FOOA 4AECA 2MIIA 3DAHA 1ZLYA 4LBWA 3VR1A 2CLLB 4ZT3A 1NUAA 4P3PA 3R9XB 3HS3A 3R9KA 5LMCA 4CEHB 2B8NA 4TTRA 5FBVB 3I5MA 5DH9A 3EBLA 3I9V1 2VNAA 3T3HA 3D5EA 3FY4A 3MAJA 3VTZA 1EWVA 1V1MA 4IWNA 5MFPA 3ZK9A 2XDYA 4DYHA 5FT9A 3WV5A 1YMQA 2IUEA 1YA4A 3OPMA 4HPXB 4J8PA 3KJIA 1G6Q1 4GL2A 2DF8A 2VRCA 1PR1A 1J56A 4E51A 3BOSA 3IEPA 1R3DA 3NKVA 1GKYA 2O52A 4DUYB 1I2MA 3NHWA 2VJBA 1Z6YA 3FBWA 5EG5A 1F14A 2FF5A 2PE5A 4P2GA 3RGGA 1NWCA 2QD1A 4X24A 3G0HA 3QZUA 4HF7A 3RVNA 4F4HA 2LUOA 2ON6A 1PR2A 3RIMA 2DAPA 5IG2A 4ALMA 1Z7YA 4AN1A 3VNAA 3MT7A 3V5NA 3ABOB 5T57A 4A5OA 3GEHA 4EW3A 2ZXUA 1KJ9A 2C59A 3EF1A 3ORSA 1NP3A 3A06A 4JB2A 3T9CA 4GRDA 3E0QA 4J2OA 4JKIA 1QANA 2V7GA 2QW1A 5DMXA 3PFWO 4YR7A 5CG2A 4KNYA 1XB2A 4PQRA 5EKUA 1N4DA 2QTLA 4CIDA 2REOA 4RPJA 2J9XB 1TEZA 4NZ9A 3BH6A 5KU7A 2XYRA 5EINA 2X7XA 2VHUA 4J1TC 4JK3A 4DUZB 3HN7A 5TS2A 4EL0A 1SXJD 3CLSC 1CLUA 2H8KA 3DZHA 4HG2A 5F73A 1G291 2FZLA 4YMHA 2XUIA 3WGKA 3IBCA 2J41A 4YJHB 2AZDA 2VSNA 3KOZA 3KEMA 3AY6A 5A7FA 2AS0A 3A1TA 2WVJA 3D6TB 2XGGA 4JLWA 5INTA 2Z30A 1H2AS 2JBWA 1UH5A 1S7GA 1U0GA 1ZGGA 2ADOA 7ABPA 2ID4A 4JT8A 4OV6B 4A91A 3MCUA 1DAMA 1KK3A 4GLBA 4WZBB 5FA5A 2JKYA 5GZ6A 1QP4A 1QG4A 3IUPA 4DCNA 3Q9UA 1N2CA 2FDXA 5BQPA 4HYTA 4XJSA 1G41A 1ABEA 1ZIYA 3ET5A 2QX7A 5D3ZA 4FS8A 1L5HA 1JILA 4CDGA 1YVEI 4RGVA 4NEQA 2EERA 3GEEA 2ZYVX 1NVWQ 2ANCA 3L6OO 5LYJA 4X6YA 1BGVA 1O77A 3EULA 3MW8A 4OUDA 4BP9A 4B4OA 2QXUA 3LI2A 1SKYB 3AXTA 2EHDA 4EUHA 4LDAA 4EHJA 4OL9A 4GG1A 4MA5A 4BQEA 3GGJA 4YREA 4RMGA 3F7NA 4I14A 3WWYA 4E6PA 1SCJA 1W93A 2P9ZA 3CUSA 2JK0A 1DAHA 3TRKA 4IGEA 2D06A 3A4MA 4JC5A 1SHZA 3QFHA 4R0NA 1AN9A 1AUOA 5A6VA 1BDJA 3R6WA 2AMVA 2BM9A 3KZVA 4RDCA 2XPCA 1BX3A 3BCSA 2QSUA 3I09A 4V2IA 3DBHA 5DX8A 3EZ7A 1YZLA 4QUIA 1PJAA 1FDVA 2VAXA 3B5EA 4H7JA 1XJWA 3WKDA 2XKKA 3EXIA 4BECA 5JJBA 3MRSA 3N7AA 2XQVA 4KG7A 3VZSA 2JCYA 5DEIA 3V4FA 2ZULA 1V8FA 3V2HA 1CZKA 4LI3X 4CM9A 4WBXC 4F3KA 1D4OA 4C20A 2WUWE 3BAZA 1KBZA 1DCFA 5FUQA 4KFCA 3GA5A 2PKXA 3PQ4A 5E9JA 2W70A 4DA0A 5I7RA 3I8XA 1J4AA 3CURA 3M8KA 5KOJB 3UCXA 2GCPA 4QU5A 4MQFA 3HJFA 3FNRA 5EHNA 3FTCA 2P2SA 4S24A 3UMRA 1P1FA 1E6LA 3MS7A 3DEYX 1VA5A 3QVXA 1UFVA 2P2NA 4U7TB 5AHWA 5EXDA 4DAOA 1PBTA 3GLGB 4R9NA 4LJ6A 5CGQB 3TR0A 4NE9A 1ZLXA 2P9BA 3A31A 3EA4A 1UOQA 1RWBA 3H2HA 3EEYA 1Z75A 2RE8A 4WKNA 4EYSA 2DM6A 2ZJBA 3TQOA 3MTBA 3Q98A 2Z2YA 3DEZA 5L6LB 1LPBB 2ZUCA 3U9SA 1JSZA 2GSDA 2GWHA 4LQDA 1QYVA 3VVMA 5H4HA 4RYDA 4BO4A 1LRLA 4CG1A 4E4YA 4P0QB 3H8WA 3OQOA 2R751 2P9FA 1FRZA 3OM9A 3SEAA 3FYDA 1DWPA 2CXXA 4JC4A 3RR2A 4M6WA 4ISBA 1PJ2A 3F9IA 5AP9A 2GK6A 5E6RB 1F8GA 3O93A 4INJA 4RABA 1NUPA 4CEIB 1L4LA 3HB4X 1Q74A 2YMMA 4AFNA 2WZQA 1ZM7A 3QVTA 1IHUA 3T3EA 4ZI7F 3AVTA 1KYYA 2HN9A 1AKTA 3M5CA 2HI0A 2XJ9A 3KUXA 4KMMA 4CMGA 1KEEA 1WWKA 2GTHA 3LP8A 5AXDA 5DI9A 3GCDA 4MP8A 5CD1A 3SEZA 1IEQA 1T8RA 3KT3A 1SCDA 1OFTA 1QV9A 3IAAA 2IEYA 5LQCA 1U9JA 2B0CA 1MB3A 3BMNB 1UXGA 3EYAA 4OX9B 3OECA 3TL6A 2JH3A 3OETA 5K0BA 3M2TA 3JQDA 4YS6A 3R3ZA 3OWXA 5DI3B 1G20B 1TM7E 4H77A 3LPMA 3WVNA 2XYQA 3SKXA 4DA6A 3LAWA 4KXFB 2D5LA 1EH5A 3DQQA 2H18A 3NUZA 4UHBA 4TYWA 3WNZA 3EQ8A 1FMCA 3N5CA 3PP8A 2WRZA 3GFGA 4L4YA 1MOPA 1EDZA 3AG5A 4YJ3A 4IOKA 3UATA 2JS7A 3LCJA 2YC2C 3MJRA 5BSMA 3NMUF 3V42A 5JALA 4BVGA 1ECFA 1LF5A 2YWCA 3TGLA 5J40A 1JNYA 4II3A 4LXIA 4ATNA 1VXOA 2WV7A 4RSRA 1B8PA 4YMSA 3ROXA 5KTOA 1S3FA 2QN9A 3GBSA 4H3SA 4QO7A 1P45A 3H3JA 4LOAA 2JEOA 4OQZA 3IS3A 3K70B 4CCSA 2ARKA 1ZH0A 3K0BA 1FMTA 1XV5A 3WGTA 1KBQA 4UUBA 4LF5B 2H7XA 3F96A 5KWSA 1Z62A 3ZZNA 1TRHA 2OY0A 1K75A 4FMBB 1HETA 5JH7F 4F12A 1EFLA 1Q7EA 1XR3A 1OGIA 2UYQA 4HWKA 1TFRA 4ZDIA 3DTVA 4NS1A 5EVJA 2FK7A 4DUPA 2OHHA 2RB4A 2G8LA 3IE0A 5K01A 1RADA 2GJ4A 3GNSA 4M1ZA 3H16A 3LC2O 1B6GA 1T5IA 2NSLA 1LNZA 2GK3A 3BIJA 1IBRA 1KPGA 2NT4A 3KVYA 2B2XA 3QFCA 1G1AA 4W1PA 4I8XA 3FB1A 4F56A 3IHKA 4N3NA 5J58A 4UHJA 5AJWA 4BNFA 4QQKA 3MWKA 5D3QA 1CF2O 3PCTA 3TJRA 4CKCB 2Q4RA 3TD9A 3O3MB 4H0NA 4TOIA 4TKVB 5JAZA 4G4GA 1JQDA 3A2LA 3KU1A 1PHRA 4F5YA 1CZUA 4LFBB 4K88A 1R8YA 3GRZA 3UWKA 3SIXA 5HS4A 3HSSA 5FOUA 4WLUA 1ZH8A 2ROQA 2YXNA 3L93A 4JS0A 4XR4A 3HCFA 2B7LA 4C4TA 1ZK3A 4Z7QB 2FZ4A 5HKOA 3V34A 5FP0A 2FZGA 4JUFA 1WKCA 4FSHA 3C8MA 1M76A 1BDMA 1CVIA 3I3OA 2HJWA 1NUHA 1OZHA 3T12A 4EOGA 2R60A 2R6CA 1JQJC 3MWDA 4G85A 2QZSA 4JENA 2RGBA 3AJ8A 4L9RA 4LJKA 2ZSUA 4MV3A 4ZZ0A 1Y5NA 3AVXA 4BNLA 3L4JA 4EKYA 3NDJA 3DBRB 2QM8A 2Q7XA 3HQ4O 4X7RA 4JBNA 1NXWA 2SCUB 5DLDA 3HY3A 1CVLA 2J48A 3AEUB 2WOJA 3H86A 1T2NA 1JTVA 1SVIA 3IAM1 3B78A 3Q7PA 3UG7A 4MIKA 5K0JA 4DYDA 3GJXC 2Q3LA 5AI9A 2J31A 1Q44A 2FQ1A 3ZLTA 2UZAA 3Q87B 1LKZA 4XZ3A 1V3UA 4KXQA 5SZHB 3W5JA 4UU1A 3RYCB 5JMPA 5BNFA 1IZ8A 1F7VA 1WMDA 3RJZA 3N9IA 1ZP6A 2ZB7A 1BS2A 2YWGA 3LVBA 5CTAA 4YAGA 4FJ1A 3KALA 3WLOA 3I5AA 5JEEA 2VP6A 3HH8A 3GCWA 1HL7A 1Q2UA 1T5BA 4XVCA 4FU0A 3QE9Y 1R6DA 4BFVA 4WGGA 2A7QA 1U02A 1PR9A 4AY4A 3WA7A 1KP9A 2AKEA 1JBEA 4UFOA 1NC1A 4OHVA 3MBKA 3ETNA 1EA5A 3D6FA 2CXHA 1RMYA 2JGMA 1ESCA 2HMTA 2YY7A 2Q9CA 3IUJA 2J07A 1GGEA 3HRHA 5F78A 4BVAA 2H29A 2BCGY 2IHBA 4GPAA 4MQLA 1Z6AA 4TVKA 1DSSG 4QSMA 4RACA 1D1TA 3B7WA 2QUZA 2ZI3A 2G09A 3JX9A 1XNJA 4DIEA 1Z9BA 2PUWA 4KN8A 2CFIA 2ZBRA 1NXTA 2YDXA 1NSYA 5AVVA 5CDHA 4NV0A 4QYIB 3MXTA 1ZM4A 3SN6A 3DBLB 3UGTA 1A7KA 3MA0A 3MQ4A 3I5UA 4L7QA 2HF9A 2IEGA 3O8OA 3NH9A 4XUCA 5HYVA 1JX6A 1I0IA 3GGGA 1J24A 3Q3IA 1T9DA 1XMPA 3RU2A 2K7FA 2O8CA 4UM8B 2WTAA 1U3FA 3FRIA 3PHIA 2I66A 2VHZA 4M0UA 2F1HA 2QENA 2JI8A 3JQAA 1QYDA 4J4HA 4M21A 1OMOA 4BTVA 4PNPA 2BMFA 2GLXA 5AO9A 4C2UA 3I01A 2CK3A 2JFHA 3PUJA 1NQAO 1C2TA 3O4GA 5T41A 2QXTA 4KAXA 4O1IA 4F8JA 1FVXA 1ZM2A 4DMHA 1ISSA 1GZ4A 4PSAA 1QGDA 1M2KA 5KHLB 1KP2A 4JVOA 3UBMA 5LXTA 1XVVA 1UXIA 1OFGA 1W4CA 1ZITA 2XCUA 3K4HA 1LJLA 2NU9A 4A8JC 4IJVA 1SXPA 1LRJA 2YRWA 3T5DA 1KOGA 2HAEA 4TV9A 4OBXA 3V8QA 2O2GA 3MZ0A 5FTNA 3VDXA 1XMJA 2WAOA 5FOXA 4PAOA 1BW9B 1XCGB 2AV6A 1Q7CA 3S2EA 3Q6NA 4I50B 4D45A 4NFLA 3H4MA 1CEEA 1G60A 3RVKA 4II7A 4KQXA 5IC4A 3IP8A 3ND7A 3HC7A 5EZ5A 2MSLA 4DAEA 3IMFA 1N25A 1NLZA 3HU3A 2WUDA 1SRRA 5JQWA 2H06A 4BFLA 2EW8A 2WWWA 4JLJA 221PA 3ZV5A 1J70A 1H4SA 1AHIA 4PEVA 1GKLA 4II2A 2VHTA 4MVJM 4P4TA 4IUDS 4QYMA 5A5EA 2R0QC 5AJTA 5H5JA 3OEHA 1Q1EA 5FPYA 1D5CA 1G6OA 1UMDA 2ZSBA 3HXMA 1HLDA 3PV0A 3TQHA 3DZKA 2FP4B 2R8PA 1ICEA 3C3YA 3TB6A 1Z39A 3WGOA 3M4YA 4P22A 3PLNA 3DP7A 1H6CA 4FI3C 1TX4B 2WKRA 3AF0A 4MB0A 1R7RA 3COWA 1YASA 3PKZA 3V7NA 2NPOA 3ROGA 1FFCA 4YCNA 4H1WA 3PD7A 3QEJA 1JPVA 5KHAA 3DE7X 1NW5A 4TMVA 1JUDA 1RYDA 4ZTBA 1YHYA 1DBVO 3COVA 1A5SB 2IXTA 1HA3A 3OEEA 1NTRA 3RD5A 2D7DA 3FUWA 4FONA 5I7OA 4YUZA 3TRJA 1QIFA 3VHXA 1E2GA 4EUNA 4TT3A 3E7FA 3RYHB 3OAAA 1SK9A 5CFMA 4X7BA 1VLLA 3WGGA 2BI7A 1E0JA 4H59A 3F97A 2WVAA 2C61A 3TSWA 4JJGA 3JZFA 4KNWA 1FFAA 1CRZA 2BE7A 2H1SA 2ZI7A 4MINA 3DZCA 3JAMA 2Z9CA 2ONZA 4YP7A 4AJHA 2OXEA 3KJGA 3DBIA 4CU2A 4DV7B 1EDOA 2IYUA 1ODSA 3U31A 1TU0A 4G0YA 1NXSA 2QOEA 1VCMA 4J0JA 5LUAA 2DECA 3DF9A 4ETMA 1PQWA 3U4QA 4CETA 4FGKA 5A4KA 2V7QD 2COEA 4JUDX 1AQLA 2NTJA 2AG0A 3S40A 3S2UA 2VG8A 2IYWA 3ZW7A 5JVDF 4TX1A 1W0KD 2DJIA 3SKYA 3SE0A 3FAKA 4PGMA 4HAIA 3OHPA 1KQPA 4L16A 4O08A 4J4TA 1E6CA 4LYJA 4RTSA 4RL6A 4HLDA 3SG0A 2ETVA 4P9NA 4JJAA 4MA0A 3O84A 1BXRB 3GK3A 1SC9A 4JYPA 2JZCA 4OJKA 2A84A 3HYNA 1C3LA 2XZLA 1WLSA 3IKVA 4Y2TA 2RBGA 3RYFA 2AFIA 3GJ4A 1O5TA 1KJ8A 1JJBA 1Q1GA 4X3CA 2JVKA 1W96A 3TD2A 1Z2EA 2ZT5A 3IYLW 4FILA 3PT5A 1QCZA 3DHVA 4WXYB 4ZT6A 3BCRA 4V38A 4BWFB 2PSSA 2HF7A 1L8OA 5A71A 3C3JA 3QPUA 1YE3A 3F3MA 3IVMA 3B1ZA 3E3AA 4HGOA 3F1KA 1M6HA 4YAUA 2DLDA 3OI7A 4M1EA 5JY1A 1SHKA 3EXG2 9GPBA 3MB5A 1RKVA 4PG4A 5CD9A 1P1JA 2GESA 2J09A 3UWDA 3A1VA 4ND1A 1PR3A 2NU6B 5BMVB 1EM8A 3HM9A 3IELA 2PA0A 2F62A 3CF2A 3JCZA 3MNFA 3PE6A 3L5OA 4CIYA 2ZZNA 1RYFA 2ZTUA 3FGOA 4RTMA 4XX0A 1A5TA 3K9GA 1EUZA 3I1FA 3VPHA 2IUSA 3EW7A 4TYQA 1GU0A 1E9FA 3GAFA 3VZCA 2YRXA 2C92A 3M9WA 3N07A 2P3SA 3FF4A 1G3UA 1AXRA 3D4PA 3GMSA 4HY3A 4N5DA 3NS7A 1B43A 3D0RA 4QULA 2DHCA 2BKUA 3BKXA 1EBUA 2ZSFA 4R8LA 3B3FA 5FNVF 5H9VA 3SXJA 2NP7A 3EGWA 1LTQA 1JDZA 5JWOA 3EMDA 5IAEA 2NVBA 2A35A 2HCRA 3HVKA 4C6SA 4HDCA 4NFSA 1KK1A 3WBFA 2AOTB 3SFTA 1U0FA 4UBKA 4MVJA 4DZZA 4B9AA 1RZVA 2SBTA 4QBFA 1D04A 1EM6A 4BVFA 4YAEA 521PA 1V11A 4M1KA 1WNTA 3N0TA 1XU4A 2WTXA 5CIWA 2OFOA 1XROA 3EIQA 5CM8B 5FUVA 5EWMA 4J91A 4G65A 3ELBA 4B45A 3GLUA 4ZAXA 4PNEA 1NSFA 4DR6B 3I64A 5B55A 5JSUA 3RTCA 2JLRA 3OY2A 3G2HA 3K72B 4JITA 4OPMA 4WXEA 3TQIA 1SG9A 3UAXA 4BV8A 3STXA 2ZJYA 4JOBA 1HDOA 3AL0C 4JYAB 4YRFA 3THYB 2P65A 2VJQA 3NTLA 3W6PA 3IJPA 3C6KA 3P9CA 3KQHA 2ZJAA 1PE0A 1N8NA 1R4ZA 2E4XA 4M8NE 5KU1A 1XC7A 4WFIA 3KEFA 3W9BA 1LVHA 5H3CA 5CBPA 1P4SA 3EXG1 5B6JA 2G25A 4MRAA 3T9FA 3LK7A 3WLQA 4P5EA 4PHFA 1SU6A 1FZTA 2JAPA 2O14A 1WZEA 3TEMA 2JJYA 2PGNA 1VKOA 1QF7A 2YIJA 3WZ2A 4TXJA 1B3RA 2OPHA 1RXEA 4E08A 4I5FA 1NYRA 4G5FA 4OHBA 4WPGA 5I7SA 2QZ4A 5AI5A 2AOUA 3LQ1A 3MCZA 3P2EA 1FP6A 4TMXA 2B99A 1JAXA 1XT6A 2X4GA 2NLOA 2XE4A 2ZK7A 2R25B 1TIBA 2EFYA 3W7BA 3NXSA 2GJKA 3VKUA 4B5LA 2PU5A 4M9UA 4D6XA 2HV9A 3HRIA 1UAYA 2IW3A 1ZN8A 4BFXA 5AW0A 2XMQA 1TQHA 3S1AA 2PX0A 3D2CA 3H19A 3CKKA 1UKEA 4C0AC 4JKOA 3VI3B 2V4UA 5D3KA 3PIDA 4BZWA 3MT8A 4DC0A 2YJ4A 5IABA 1KO8A 1WW8A 3X1JA 1Q2XA 1W4AA 3AG6A 4XLTA 2WMOB 4BFYA 3T3NA 3M6LA 2IWRA 1Z7BA 4MR9B 4X1IA 3ZCSA 5ESDA 4BNMA 1XXHB 3EOBI 4MS1B 5L7TA 1PNRA 3J7AC 3EQ7A 1P3DA 1SRQA 3DDHA 2BFPA 1FP4B 2JDID 3A6DA 3FI9A 4OFZA 5D3MB 3V8MA 4DPKA 4I8IA 3P0HA 3TEFA 2VQDA 5K8CA 1CHDA 3ZD8A 4RFLA 1XQXA 2REBA 4B6RA 4U7FA 1V37A 1VJ5A 3NWPA 1TC1A 5LR6A 3SC2B 4GECA 1XELA 3HCNA 1R88A 1TK9A 1PQYA 4C4ZA 2OR3A 2EAUA 2XRZA 5DYIA 5DEOA 2ZVJA 2ZGVA 1PYOA 2W7TA 2C96A 3K5WA 5I5GA 3VHQA 1DBRA 1PAUA 3C7KA 4D80A 1N0UA 3IERA 2HV8A 4KYIB 1X70A 3I8SA 3SLRA 1FTWA 4E2ZA 1V1MB 4NZZA 5CCXA 4EB6A 3TIGA 5IBCA 1M2NA 1L5QA 4A2PA 3VKVA 4NH4A 5JPCA 3DXZA 1JG6A 4OHFA 5DNUA 5ADWA 2VK1A 4OKNA 1UOEA 4OJQA 3FHLA 5DGTA 1MGOA 5JO9A 1WKBA 3SY8A 4YV2A 3ME5A 3EQ9A 5F98A 1YMUA 3AUKA 4DV4B 3SZ3A 1FDTA 2ZIEA 1VHDA 1G6KA 3DUFB 3L4SO 4M0EA 1U4SA 4CF5A 2VH5R 3HFSA 4F21A 4WBSA 1OH5A 4UCFA 5DISB 2QTHA 5H3HA 3H3XA 4YUXA 4QFBA 4KKVA 1F0PA 1WOYA 2P79A 1QYRA 1XCPA 2Y1FA 4TKMA 5HQJA 4BX3A 3CZPA 1AK1A 2KB0A 1E6UA 3FTDA 3AU8A 3VKFA 4G0VA 5FL3A 2IP4A 1AA6A 1EWQA 1WCWA 3JAWA 3KSMA 1R4NB 5T8KA 3S1SA 1TAUA 1P0QA 4D0RA 1BE8A 5DGHA 2BR3A 3DEFA 5DM0A 4W5JA 3OE1A 1RDFA 3LHSA 4OY3A 3TFQA 5IANA 3GWZA 4HMOA 1JG7A 3QV2A 5L3VA 1UM8A 4QTTB 2CWWA 2G63A 4GXQA 3CNQS 3DEIA 2W83A 1E69A 5JS8A 2ODBA 2PXHA 1AXEA 1RPJA 3B6ZA 1JLHA 1QHYA 2J6IA 1ZQ9A 3MGBA 4MYHA 4CR8A 1YS1X 1MAWA 3DMPA 3L40A 4UNQA 1NM5C 1C4KA 4R1OA 1XK7A 1HLPA 2HIMA 2QV0A 2QRPA 2J6CA 1KSFX 3KKNA 4L28A 1GU1A 3S2GA 3VC3A 1X74A 1N5OX 2QV7A 4KHZA 2MTBA 5ARDA 3I05A 1D9XA 3H5LA 3MRVA 1U1CA 1T6BY 3DPSA 4O4HA 1PW7A 5EE9A 3VR3D 4D74A 3Q12A 4AZSA 1GZ3A 2JZOA 3AERA 5SZIA 1QH8A 1L5HB 3MCTA 1EXNA 2EKBA 3DE6X 1E7SA 1AB5A 2QMQA 2VQ6A 4YONB 2C2MA 4GOLD 4HAUA 4EMTA 2DPGA 5C35A 4DCVA 2WYOA 2QM7A 3UT6A 4B35A 3NC1C 1S1MA 5G53C 3THRA 4OUDB 4PZCA 1E9EA 4AS1A 3L41A 1SC4A 3AFIA 2D0OB 4A1FA 1P0CA 1QP0A 4A16A 2EG5A 4ADSG 1V41E 3Q0IA 5EL0A 5FUWA 2L2QA 3D1JA 4FEYA 4BVKA 5C9ZA 1JYFA 3U80A 4EHNA 2B6NA 4Y9TA 2DFDA 3UOGA 2AE1A 4QYSA 2XVXA 1NDUA 3Q3EA 4G0MA 3D7LA 3OCXA 2FEOA 5DCWA 3QGMA 2X5KO 3WYEA 1MW8X 1WMAA 1MG0A 1H8ED 4HDOB 4IIDA 4GGOA 1TCVA 2AKAB 2DUNA 3I4CA 3WB9A 1E99A 2REQB 4Z4IA 3UMFA 4AYXA 4E46A 2GAFA 4F1KA 1PUXA 1U0NA 4PYKA 3GXBA 3LUGA 4GQBA 5KAMA 3SIRA 3W77A 4EFKA 3E82A 1H0KA 3EXIB 3KFXA 2YQ4A 4LZWA 4N5LA 1LLQA 1U5BA 1NFRA 3HB1A 1O58A 1L5VA 4PTYA 3ZBQA 1P75A 4O2RA 2FJUA 4OLHA 1OZAA 3MT0A 3MJTA 2WYUA 1O9HA 4BIIA 3DL7A 4BU0A 1JXOA 3WIOA 5AVQA 1MVOA 3T94A 5LD2C 2C7BA 2PZFA 1UANA 4QYXA 2JF0A 4MUHA 1DJLA 2EEZA 3HY6A 1H42A 4NABA 4D9KA 3G13A 5IDWA 1ZA1A 1QPGA 3VR6H 4ZI2A 2GYWA 2ORVA 3L18A 3OZUA 4D5EA 1RXCA 2HXYA 4Q6BA 2VYFA 4Q3CA 4Z0NA 3PVSA 5L45A 4Q7EA 2CDCA 1BWQA 1I4WA 3PICA 4J6EA 1Y1QA 4JD5A 4RCVA 5AFSA 4KLCA 4UNPA 4XQ9A 2F3QA 1NPYA 4PLZA 4YALA 2W00A 3BMCB 1LSUA 2I4RA 3GGCA 4XSVA 1VJ0A 3IQDB 4Y6QA 2I3DA 3TIFA 5BNWA 5C2JB 2JLWA 1GAWA 2ES4A 3ER9A 1PK7A 3EXHC 2NO9A 2D1SA 4QPDA 4XPZA 5CT6A 3HVJA 1P33A 3AF6A 1GUDA 2WU3A 1NF8A 3C5HA 4J49A 1UFOA 4Q1EA 1XG5A 4M6WB 4X20A 2X3YA 4UATA 1HZZC 1QX3A 1Z0AA 3E6AA 5EZ6B 4BC0A 5BVHB 3ZVKA 4NCAA 3HZZA 2UVQA 3G8AA 1I5OA 1AGRA 1KMHA 3FPSA 1UBSB 4AICA 4NMHA 4WCDA 2WUEA 1E7WA 1V4BA 4QGSA 1GYRA 1X1EA 5A62A 2X77A 1R18A 1Z5ZA 4KH1A 1PTJA 2Q28A 2OQRA 2PX6A 4G24A 4LC9A 2B4QA 4RCZA 2FW0A 1RJFA 1T4CA 2IZ7A 2CLMB 1QQAA 4Z1MA 2Z6QA 3TVTA 4B82A 1H5UA 1U6JA 1MUUA 2IYNA 1HXHA 3K2IA 1GFZA 4Q05A 2CE7A 1G4AE 2OKGA 2WWFA 3ETEA 4L0MA 4P4SA 4WN9A 1YONA 5J3JA 1FMFA 1DDGA 2PBRA 2E3JA 1CHNA 5L3QB 3WO0A 4L4UA 3FI0A 5K8VA 1L7RA 3FHJA 3QVVA 4M9CA 4XDZA 4YECA 1VJCA 1CJKC 1BHQ1 5FULA 3L1IA 4KYVA 3ZEIA 4FGWA 1JAHA 1HDEA 1T2CA 4ARCA 1LUAA 2JJ2A 5ALTA 4YCDA 5EQDA 4TLLB 4YJ3B 5BSHA 5JRZA 1JQBA 1BVYF 5AOBA 1HURA 2QQ0A 4QU9A 2ADMA 1HE4A 1W8IA 1Z0FA 5A3JA 2XUAA 4YJFA 5F35A 2EQ5A 5JYDA 4MDFA 5KMGA 3CRQA 2H52A 4YCCA 3BTSA 1ULSA 1VSQA 4P81A 4V0SA 2AA3A 2KBEA 1NJSA 3UPUA 2IEZA 3VNQA 4G5XA 1PJQA 1TAQA 1TKBA 1G9XA 1NDHA 3ND8A 1WDTA 4KR2A 3HUTA 3AWDA 4HO1X 4YN3A 4P53A 4Q1CA 4W6QA 2XCOA 1CJTC 2WHXA 4JLUA 3D5TA 3ZDXB 1M8PA 1JYEA 4DWWA 1SD1A 4PONA 1FXUA 1LI4A 1CP2A 1UBHS 1YZYA 3EASA 2GBLC 4OK5A 1FFBA 1L6RA 3DD1A 1Y4SA 4B85A 4HLNA 2I33A 4XOIA 1SUDA 5C1IA 3WKAA 5CB4A 1DWUA 3D3KA 2C9CA 3DTVB 2NZUG 3OIWA 4MYRA 4RZ2A 1GNVA 3ROPA 3VH4A 1N2BA 4NNJA 1CB7A 1PGPA 3P0RA 3N8HA 4R9SA 2DBRA 2OHFA 2V6JA 3CH4B 3MQ2A 5FAKA 1H94A 1S3GA 3N2KA 4M0CA 1WSAA 4UUQA 3SJBA 3WYCA 4ENTA 4QEZA 3EH2A 2FN8A 2JJQA 5IK2D 3GHYA 1D6JA 1A9XA 1P2VA 1FU7A 5CVCA 2C4NA 2GZAA 2R65A 2G9NA 1RHJA 2Y66A 2P7IA 1IZ7A 6YASA 4LJRA 5K3FA 2LBPA 2AXPA 4IDAA 1GDTA 3UH1A 1YRHA 3DYVA 4HYQA 4RVHA 3ZHBA 2CFOA 4Y1FA 4ZVNA 3PFCA 1X8XA 2FFJA 3RSCA 4COKA 3Q3JB 3GFRA 2VJAA 1V8DA 1NJ8A 4UUMA 3ID6C 4ZEOA 1FNSA 4CT5A 2FOXA 4J3JA 1XJQA 1IBSA 2X14A 2DTXA 3BGVA 4OSEA 4GPZA 4R40A 5AI4A 4LYEA 5D1HA 4BZZA 3IJEB 4PNHA 2NO6A 1ZM3A 2VPTA 3K5IA 1YB4A 4TXMA 1QX4A 2AZMA 1YB6A 3OX4A 1QG6A 3T7AA 1JDBB 3PDUA 1GQSA 4QWMA 1CDDA 4E7PA 4LZOA 5E4TA 1CUIA 2WA1A 1UBNA 3GZTB 4XLLA 1PEYA 2A0YA 5JR3A 2B61A 3WJ2A 3OFSA 3ZNPA 3A9WA 4MITA 3KK0A 3GEMA 3HJBA 3C7TA 3FYCA 1T9KA 2AEEA 1HTWA 3B1FA 2C3YA 1XWIA 3BSYA 2FRVA 4TLEA 1NR5A 2ZUDA 2PRYA 4AZ0A 3K0AB 1PZGA 3UT0A 3WE7A 2Q5JA 3HB5X 4Y2JA 1N6RA 2ZI5A 3U7RA 5BV8A 3KVNA 3NASA 1YZ3A 4O29A 3P9YA 3P0FA 1EUDA 4L75A 5JNLA 1CR1A 4G09A 4CDNA 3PHCA 1YB7A 3QG5A 1T8PA 3T9BA 4Z4CA 6LDHA 3MUFA 4LIPD 5TMBA 2GHIA 3AEZA 1L9KA 2IKQA 3BVPA 3H1BA 3WKCA 1JZQA 2CDBA 4BO5A 5K9ZA 1AS2A 2TMKA 2WAAA 4WLOA 3STWA 2I03A 5BR7A 3HM2A 1GTVA 2H4WA 2Q0HA 2W2LA 4Q1FA 1GUYA 1U7HA 3A9VA 4R01A 4DG9A 4TYNA 4X85A 5CM2Z 3E18A 4BMCA 1AMUA 3BHNA 4BNDB 3INGA 2O8VA 3C6MA 3FE2A 4G4SO 1ZMBA 1HFEL 4GE3A 4QHYA 4DXHA 1KU6A 1VRVA 1MN6A 2B3TA 4HSEA 1RKQA 2LZ0A 2PIAA 4LV6A 4Q9DA 5J4LA 2JI6A 3FIJA 3PYXA 1XD9A 4X6UA 2V03A 1BH6A 3GGPA 1NQ5A 2RHWA 5JSYA 3EIHA 1IOZA 1OLXA 1TOAA 4ARUA 3N53A 4U0KA 1KF0A 2OZLB 3CNHA 5HF5A 3U44A 1ZK2A 4A6DA 5LOVB 3F5QA 1E5VA 4FFSA 4BAUA 3VMMA 2H6EA 2YJTD 5B7GA 3WMGA 3H18A 3NHBA 4ZAVA 3TTUA 4R1TA 3AVUA 1WD7A 3O8OB 2BTEA 5IJAA 4YDRA 3GAAA 2O8CB 1Q1ZA 1U65A 4H08A 1GLVA 1BEEA 3QITA 3TLJA 3O03A 3JQAB 1V8ZA 4UC0A 4LDRA 4OGGA 5K20A 3UAVA 4RZXA 4DBZA 5HTKA 1JPUA 2B4RO 1VECA 2XUKA 4P4GA 3GVXA 1M6VA 3H1GA 3EZ2A 3GEPA 5EWJB 2W6JA 5BP7A 3AZQA 4RETA 1GV0A 5AMXA 1WS6A 3M1YA 4PTLA 3V2GA 2V0GA 3TMKA 1C3OB 1HEUA 1JFVA 3RVDA 1L1EA 1Y6ZA 4F60A 3SC4A 1PZEA 4OK3A 1QHXA 1EWYA 2VDJA 3ZGNA 5CT8A 5BN3A 3MSXA 1IN7A 3TNDA 2I4NA 4WGFA 5KYWA 4DHWA 4L9SA 2QSJA 3FNFA 3QOXA 2QORA 4AWAA 4E5PA 5K3AA 5DM70 4PAMA 1XYVA 3IAM6 1FLDA 5JCJA 4HQKA 3TNYA 1RPZA 4ZVRA 1U28C 4KJZA 4UTPA 4IJUA 4MMXB 5LFAA 1KK2A 1NG9A 3ELDA 2FEAA 3E8MA 1AIPA 1EGHA 3UB2A 2ZRJA 3L77A 4Q7JB 2HLDA 4BFWA 4QBTA 4BVEA 3M5WA 2PUVA 2AHOA 3GJYA 3PR2B 2K5UA 5K05A 3PQ2A 4AY5A 2PH1A 4YRTA 2PZKA 3RVSA 2Z4SA 3EFOA 2OC9A 2B82A 1HYQA 1L7BA 3G89A 3M4NA 4YH1A 5DT2A 1IOVA 2J4CA 4NP6A 1NVVR 2NU8B 2JJMA 1L5LA 5KSYA 3S2IA 2ZLBA 3X1KA 4N8EA 1UMDB 4EPXA 4AG6A 4URZR 1NMYA 5F33A 1FSFA 3ZDFA 4JLDA 3NWOA 4GYYA 3HKEA 2PCJA 3SDZA 5CYGA 5EUQB 5H8WA 3PF8A 2I62A 1BD3A 1G5QA 4YV0A 5ILOA 3FCOA 3EWIA 3LBIA 1DAKA 5EJ8A 1D4FA 1X92A 3D7RA 2BEUA 3I6ZA 1CULC 4YJGA 3ONWA 4P3NA 2AJLI 4AJEA 2VC2B 2HF8A 1E1LA 1E2FA 1Y98A 4LWPA 2NTVA 4OFXA 4HJXA 1ZL0A 1G8SA 2EKZA 4AURA 5TEWA 4GNRA 4BNWA 1I5RA 1YDWA 1M5TA 5ESXA 3VHXB 4I81A 3DLIA 2ORIA 3C45A 3KTAA 1DT5A 2ISQA 3DPIA 3M49A 4I1OA 1W1WA 4MAFA 1PP4A 1DO2A 2R79A 1IXZA 1EB9A 1EHIA 4UQPA 4A0RA 2IBTA 4G8BA 3W2IA 4BASA 1BQ4A 1ZOIA 2CY0A 2FWBA 4NY1A 3DJYA 1YBHA 3IQGX 3RNOA 3MOSA 1SU4A 1JDPA 3O0TA 4D5GA 1WXGA 2X0IA 3P9KA 2HMVA 2BFWA 1AGYA 3HR4A 2PSFA 3ONVA 5BPHA 4GDMA 4IV5A 3K1TA 5DM4A 1GYQA 1DAOA 1GJRA 3SBEA 1YA8A 2QQGA 4KUEA 3CPJB 5A7GA 1HQCA 4POOA 1Z8DA 3WNVA 2WOOA 3B1XA 2VZEA 1RYBA 3WSWA 4YMVA 3BMOB 1Q0TA 2E37A 3LX8A 2I7TA 4FN4A 4AXBA 2Q1XA 3DXFA 1YMVA 4Q4JA 1YQEA 2HL6A 2YNMC 4QQFA 3Q10A 1HEYA 4DARA 3ZC3A 1K63A 3B53X 4Q48A 1NY6A 2QVGA 3BSFA 3HNPA 4WWHA 4GSLA 4ZQIA 3CC8A 5JZVA 4JEMA 1QE5A 1I33A 2GCEA 4W1RA 4X3OA 3VU1A 3W2TA 2I4MA 1CFJA 4BLPA 2GEJA 3ZS9A 5DSXA 4K1XA 1QAOA 1U6KA 4S12A 5JXIA 1IBCA 1NW8A 4PC3A 4MS4A 1Y34E 2PSJA 3CZQA 3F7OA 3K09C 3RYFB 3BXGA 4CQLA 2C2WA 4HAVA 4B2YA 4JYBA 2OM6A 2X8LA 3HZRA 4S1PA 2RD2A 3K53A 4FT4A 4O2BF 3VZBA 2OB1A 5EE0A 2QHXA 5BUSA 4H17A 3TMAA 4JUBA 5U9CA 1Y7PA 2OV6A 1Q17A 3AXSA 2XSZA 1KMNA 3LJKA 2JFYA 2HMWA 1Z5OA 4ZEWA 1IB0A 3ZDEA 4W5TA 1ZD2P 1Q3HA 1ETHA 2RH8A 5ERXA 1M9NA 2W4QA 1U7DA 1PGOA 1N8SA 1T8TA 2VHXA 1TZKA 2YJ6A 1OYWA 3KQQA 3TW6A 1M2HA 4IXMA 3FMGA 1B0AA 3CRVA 3DZ8A 4L8YA 2B1IA 1Z2OX 3PNKA 4K87A 3JZIA 4JJ6A 1EFRD 1I4LD 1T1EA 1Z5WA 4YACA 4YRLA 3WL3A 3B5JA 1KJNA 5C80A 1RWKA 2B5VA 1DO8A 1FFWA 2RAUA 4IY1A 3RJ5A 4F45A 1I6WA 1T3LA 2ZR7A 5BXYA 3IV7A 4LHVA 4UOQA 4XX0B 3IVGA 4ND7A 5AVJA 3FKSD 5CMLA 4M0KA 4PANA 3VYRB 4MS3B 1KFJB 1MCZA 5LBTA 2JFPA 3V1UA 1DFHA 3G1TA 2PY6A 1ILWA 2JH9A 1KR2A 3RBVA 5KNCA 9LDBA 2ORWA 1N36B 1BROA 4K3UA 4I2NA 3L7AA 5EJ4A 2FMXA 2Q2OA 3WLEA 5AW6A 4OEHA 4ZV9A 3PRKE 5BN1A 1XRMA 3UK0A 3EDMA 4GRAA 3OHMA 2HRCA 3D3EA 4OFBA 4UE6A 3HCOA 4Y9RA 4HRVA 3OZDA 4LXHA 2I8CA 4TN5A 5E7JA 3RQIA 2OCIA 3W06A 3CTMA 1OXBB 5KOYA 4W5OA 4XTCS 4UOZA 3FWZA 1RPNA 1QVZA 2GBCA 1V11B 3GT4A 4FR5A 2I91A 3W9SA 1CUYA 4IDHA 2KPOA 1N6PA 1XEXB 2W6OA 2ZU6A 1OHHD 3BZWA 3EBPA 2BR5A 4IGAA 4N40A 1J9GA 3M6FA 4Y2RA 4CNBA 4JBYA 4RE5A 1ZYUA 5SY6A 3ESBA 4Q3AA 1OGYA 2FW7A 1PQPA 4Q34A 3QVGA 2D2EA 2VP2A 4U6QA 1EK6A 1ZINA 2PJZA 3BORA 4J0KA 4G4SP 2ZJFA 5KQLA 3CSUA 3K8QA 3I9MA 2QAGC 4YRRA 2F64A 1NATA 3Q15C 4D99A 4GI2A 3PUKA 2K2QB 3ZI7A 1N33B 3M82A 4GOMD 5CCDA 5CBPB 3IESA 2O0KA 2G06A 5CB0A 1T0HB 4EGCB 5IU6A 4I1SA 2VPWA 4Y8VA 5T67A 5BUZA 3C41J 3F90A 2FH5B 4NCJA 5H1YA 3W6ZA 3DCIA 4D9NA 5KQPA 4JMLA 2CV2A 5E2IA 1RM4A 5E6UB 5AJYA 2FZKA 2ID7A 3BBLA 2AOUB 2V7EA 4GE0A 2VDRB 4AJJA 1W6UA 2Q6TA 1BDIA 1QOQB 3EODA 3A37A 1LDEA 1HRDA 3JU3A 2GERA 4JJKA 1CZHA 1HFKA 5LDGA 1NR1A 4QNNA 3KZNA 3WTCA 1L5ZA 2ZYUX 4OQXA 2EFHB 4PCUA 3HHEA 1BXGA 3ELUA 3M6VA 1I51A 2H2DA 3KWLA 3FDZA 3M3PA 2BZSA 1CW2B 4RHUA 1MX9A 4UJ3A 2A33A 2BLNA 3UQZA 5IYZA 4LCEA 5BQXA 4HNRA 2P9JA 4DYVA 1B74A 5IKPA 4QZVA 1DKMA 2O5CA 1MH9A 1JG3A 4FX2A 2AE2A 3HCDA 3MMZA 5KHOC 1RJEA 5ECWA 3QVLA 1QV6A 4UEQA 1XDWA 4X1IB 3TNLA 4JI6B 3DZFA 2DCUA 3OCJA 2JGIA 2IYFA 4R2LA 4RYLA 5LQJA 5LB4A 2HDWA 1VLQA 3P96A 1B26A 2HADA 4CLHA 4BOYA 3AP2A 4QVIA 1EGAA 1TPYA 2PT9A 4FYYA 4MJ3A 1Q0QA 4UDXX 4N48A 5AVXA 2AK2A 2CFTA 3QHAA 4ZMBA 1S01A 2XA9A 4WJZA 1G9SA 2XOEA 5IBQA 4UEOA 2BGWA 5F9FA 3KAJA 5B2EA 3BZUA 5CTJA 1DARA 3HKDA 3ZTTA 5DW3A 3S4YA 1XTBA 4LKOA 1O94A 1X1QA 4CF4A 5HK9A 3L7CA 1SCIA 3DO8A 3MTQA 1T9BA 3UFXB 3PNSA 3FUUA 4BQFA 2Q27A 4RV5A 1M2FA 3O47A 4Z99A 4Q3EA 2ERXA 1C3XA 4RZUA 1DRWA 2DFTA 4JJ8A 4Y0AA 5BR1A 5L3ZA 4EB6B 3D8UA 1A4UA 5C4MA 4C0KA 5CIQA 4N3AA 4BB0A 5IJ0A 3AFOA 4GX5A 1IL0A 3I42A 4K9LA 3CX7A 5JAPA 3H6HA 4OYRA 1ZGCA 1MQ8B 4LY6A 2VS1A 2OXIA 4N12A 1O6ZA 3AEQA 3PDHA 3C6QA 4RVSA 1C9EA 1E3SA 1A77A 2H7VA 3VTFA 3C70A 4GS5A 3I52A 1G38A 2QN1A 4WVLA 5FKJA 1Z0ZA 2RAPA 2WP8J 5T3UA 2HWWA 4WD3A 3BB3A 3R8CA 3AW8A 4OREX 5KTYA 5KS2A 2F48A 4BRUA 5AHOA 3SMQA 2IBSA 5KTTA 3GLFA 1ZMTA 1ORIA 1FS5A 3Q1KA 1U9YA 1LWNA 4WKCA 3JWIA 3BKWA 4B3DA 3JAWB 1RIIA 2VJMA 3E8SA 1RLJA 1SZDA 5A7HA 3RRMA 1PT5A 1SVLA 1VL5A 2J3EA 3TW8B 4RC9A 1TC2A 4G1FA 3E7XA 5JMTA 2NUTA 2OZVA 3A32A 1G8HA 3CISA 4N6OA 4MJ7A 4H35A 3INRA 1EE9A 1TYBE 4HN9A 2CHGA 2PWYA 2VP5A 5AUQA 5A4MS 4KPUA 1X1SA 2I76A 3R74A 2Q3CA 2QTCA 2B69A 4KB5A 4LBYA 1OWOA 4L72A 3OZXA 3SWWA 4IWXA 2GFIA 3RC3A 1KQ3A 3HK2A 5F12A 2CNKA 5A6SB 5GAJA 2IBMA 4PHCA 5HDQA 5CM9C 2YW2A 4EJ6A 5JDIC 4G1UC 3MRTA 1MVLA 4LJ5A 2QYHA 1NU6A 2RGDA 2OBNA 2XEDA 4D6PA 5AM2A 2GJ8A 4ZHQF 4NG5A 1HO3A 4Y9UA 1F7UA 3JSAA 1Y37A 4O4HB 3UA3A 3KEGA 3FUXA 4FT2A 4RIEA 3B1VA 1K8XB 1X2BA 1WZUA 3AERB 3PUVA 1ESZA 4RK1A 5NLLA 2WLSA 4G0UA 4P6VF 3VKHA 3H8VA 4RGYA 1WB6A 4QPPA 2ZJOA 1ZQ1A 3RBZA 4IFEA 4NHOA 2PUCA 4PZZA 1QGUA 3EVEA 4XH9B 3SKVA 4LSMA 5C5EA 2AC2A 1D2EA 2F1JA 1XPUA 4IIXA 4LTNA 4O4JF 4DA7A 3RFCA 1RPAA 3BFPA 5M34A 1A4IA 2XECA 4KWIA 4UBMA 3KVVA 3MIZA 5ILGA 4LJLA 3LY8A 4BB6A 4BJ3A 1CUDA 3QE3A 4L5BA 4BKOA 4I5EA 3OIVA 2BHRA 1DPGA 1GG8A 5TDHA 1GAJA 3K05A 3OX2A 5EHZA 2OCKA 2PRJA 1X7YA 2JFVA 2Z43A 2ZP1A 3HUFA 5LA6B 3GFBA 4ENUA 4GLOA 5KWJA 5I7EA 1J5EB 2DB3A 4TKLA 2ERYA 3N59A 3ZDRA 2XNCA 4YLGA 1TQ4A 2Q7OE 4F06A 1DBIA 1KYZA 2B35A 4BMOB 3A6HA 5CJ2A 1BHJA 1MAHA 4PZDA 3CSSA 3EFEA 2XQFA 3LCUA 1RKXA 4GH5A 5JCOC 2H59A 4QXRA 1N34B 2BHTA 4UPDA 2B5OA 2A5DA 3D6JA 1YHNA 2GZ3A 2A6PA 4REQA 5FL7D 5CP8A 4OBBA 1T2DA 3S7TA 3T0IA 3ZCUA 3DHYA 2EEPA 1M73E 4YRGA 3GT0A 4D98A 1PT9A 4FFWA 1R9MA 1UWLA 4LY0A 2XB6A 4M87A 4F2GA 3HXKA 2VSOA 4C21A 4HDMA 2J67A 3TJZA 3IP9A 1FZQA 3WWEA 1Q0SA 4Z8XA 2CEKA 4JJ7A 2NN3C 3N0RA 4XGNA 2I6UA 2NZXA 3R5FA 3P9XA 4M7PA 3BCHA 4TGLA 1LK7A 2REXB 1U2SA 3LDHA 1DIAA 3TI7A 3P9ZA 4MV5A 1DC7A 1SUBA 3KS9A 5EERA 4BKMA 4NENA 1SUFA 4NG4A 1ZSNA 1I01A 1CG6A 2EFEB 5HF9A 5IAJA 4F4UA 2E89A 2JFZA 2ZAOA 4LVUA 3QXCA 1EG2A 3NDRA 5CB8A 1A9QA 2G9UA 4CG2A 3BMQA 4H4DA 3FMVA 3HV2A 3TAUA 3ZWYA 3JD2A 3THXA 2QLFA 4WY2A 4Y2UA 1IOWA 2O2CA 1JDUA 5E4YA 1TQ2A 1Y8AA 3T4XA 3ICOA 1JT2A 1KDOA 4F96A 3LA6A 1K4KA 1O6GA 2FRDA 4DQLA 4F5DA 4YT2A 1GPAA 2AMFA 1BOOA 1ZSVA 1KMHB 2HB6A 4KOEC 4D4KA 5C37A 5JAHA 1IPEA 1KHHA 4L6AA 3NHLA 4Q9IA 5GADl 1UMKA 1NY5A 4JWTA 3HPRA 3CKLA 2ATVA 2W6CX 4Y6RA 2JGRA 3TLYA 5C7IO 3T1YB 1SU8A 3CVXA 1LZKA 1ONBA 4LRTB 2FVYA 2ZOSA 5EFZA 2I6TA 4HRAA 3U7QB 2XLCA 3DNPA 3T3OA 2O0HA 4P4SB 3AL2A 4WN9B 5F1PA 2FFBA 2FR8A 1SK8A 3UKDA 4YV7A 5BYAA 3IH5A 1U80A 1B7GO 3U09A 2EYUA 3R3YA 2UYHA 4K0KB 3KTFA 2E6KA 4YT4A 3H7IA 3R7NA 1UZUA 1W9MA 2BAGA 1DRUA 3A3YA 1U1IA 1C41A 3Q2IA 4B4UA 1Q1BA 1JAYA 1XI2A 2XCLA 3CGGA 1G21E 3LUKA 3CFYA 1LX7A 2WJIA 2G07A 2A88A 2I2BA 4JUCA 4TTQA 3PJFA 4ZOAA 4XCXA 3WZMA 1Z8FA 4Q7KA 4YJFB 2XUHA 1ZXLA 2A5LA 3QTTA 4DIFA 3SQMA 3SDSA 1V8PA 4WINA 3BB1A 4TMFA 5EUBA 1L0BA 5TNXA 3MF4A 5LJLA 2CD7A 2CJYA 1QGYA 2FQXA 1XMIA 3GJ3A 3ZH9B 2OZKA 3SJAA 4AN4A 3LS2A 4B3RB 4NOJA 4ABYA 1GZSA 3OTHA 1WZ2A 2PRKA 1A8QA 2BUCA 2DY1A 3HDTA 1U9ZA 4GX1A 1LRKA 1QMGA 1V9LA 5LCXA 4B6PA 4C4PA 5CA0F 2BFEA 4MLPA 4UU8A 3K8ZA 4PQGA 4BN4A 2NU7B 2H1WA 4E09A 1QQ5A 1NM5A 2WJ4A 4EHLA 3EX7C 4P32A 4KX5A 2JIZD 4R2JA 3JQGA 2Q5OA 4UNIA 5CB4B 3UBTA 4KITB 2P78A 1M54A 2I4TA 3SR0A 3UZUA 4BNJA 2FPWA 1BTOA 5HIMA 5ICFA 2LKDA 4MUKA 5FXMA 3U13A 4EW6A 3ABSB 2B6HA 4QGBA 5HZHA 1SC1A 2Z3WA 4FCCA 3AIIA 4ZRMA 4J43A 3UOWA 2H85A 4L5JA 1A9XB 1MDBA 4PYNA 2JLUA 4LECA 1FRQA 3W79A 3PFBA 1EDEA 2GLUA 3PGMA 1XEFA 4ZOLA 3V80A 3H2KA 4KAJA 1NUQA 4IKEA 1ZZEA 2Y1GA 1Z36A 3STUA 3TM4A 1HQDA 4UNSA 3G02A 4IAOA 3C3CA 3UANA 5KSOA 3F67A 3JYLA 1L5KA 5LKAA 1FNMA 1SZJG 4MPJA 2ZYWX 4I1RA 2G5PA 4X8LA 1N2JA 2BGUA 5HGJA 5BWCA 2Q3HA 2GFHA 1IUKA 1V25A 4BY9E 3HTXA 4QARA 4CLDA 1C1XA 3AL3A 1I2DA 3NCHA 4NJEB 3UN1A 3RHSA 3N8KA 2PIDA 4I19A 4LZPA 5IT0A 3TS1A 4EG6A 1V3TA 5TVGA 3P4UA 2PWBA 3ZCRA 4WSOA 3ITEA 4ZDJA 3T9AA 3P9QA 5KNBA 3QW4B 4H4EA 3GCZA 3PHGA 1LPAB 4DVJA 5FOQA 4AKEA 5K4GA 4CF3A 4X90A 4YR9A 4CL0A 3IJRA 4QTXA 2C2YA 1A71A 4WI1A 3TG2A 2JI7A 1CR6A 4J9VA 2AYXA 5AUNB 1WF6A 3BX1A 2X7HA 4GM0A 3WHLA 1JMKC 1IHDA 2R86A 4RELA 4B6QA 4AZ0B 5CEEA 4EJ0A 3AM4A 2H57A 1HR0B 3TRDA 2XAUA 3L46A 1PQUA 2DOKA 4YMLA 2H3EA 2XUZA 3C3PA 4D97A 1PLLA 1JDTA 1EUDB 2IWHA 2EX4A 4CN9A 2NUPA 2VEDA 5C1PA 3KQLA 1KKLA 1SAYA 3A11A 2OYSA 1Z0DA 5A4FS 1R12A 5CLGA 4A2CA 4XD2A 5EAIA 4AU1A 3OTOB 2NYRA 3HGQA 1J39A 1K97A 3CZAA 1S9DA 4D3FA 5CURA 4ZDWA 5KSWB 3UW1A 3U3XA 1HKHA 1IOLA 1C1HA 421PA 4ZVQA 3HKCA 3QNWA 3HCRA 2VO1A 4UQLA 5MF6A 1Z17A 3AK4A 2A1TS 3KBBA 3C43A 2IPLA 3KPJA 2YASA 3ZZMA 4FB5A 2OGTA 3HP4A 1IQ0A 4XWTA 4PE5B 5DBGA 1OBVA 3GBPA 4ZV7A 3ZLVA 3U19A 1GSIA 3BRQA 2R6AA 1DT3A 1UBOS 1L1QA 4PSCA 4RUKA 4WZAA 5C31A 5IKOA 4IW3B 3SR4A 1ELOA 2WSSD 3E5MA 4JBHA 4C7JA 5DNYB 1QQ6A 2V7PA 5EXEA 2ZRNA 1AV7A 4BLTA 4DSAA 1QTIA 1ZN9A 1Q21A 1T10A 3A3KA 1QO0D 4MQ5A 1NVUQ 1WBJB 4FE7A 5F7JA 4RHTA 3WL5A 4ND5A 4UHCA 3VR2A 2VP9A 5AI0A 5F23A 5I8PA 1F12A 1BJRE 1IDN1 4GPD1 4HB2A 5TR9A 3SHOA 3Q4GA 1VP3A 3CF0A 4FHFA 4G26A 1NF3A 3V9PA 2A3RA 3WSVA 4U2EA 1M6VB 1KJZA 5HKLA 4Z0HO 1QQ7A 5TPZD 1TM1E 4I9GA 1K0FA 3EZXA 5K3CA 1Z5UA 2FHSA 3MJDA 3TFWA 2BPOA 1YL5A 4RE6A 3PRYA 2G4LA 3ANSA 2RKBA 1OVMA 1XTQA 4RPLA 4KKXB 4BUCA 4NYJR 5K0CA 2UZ0A 3ZE1B 1AUPA 3K32A 3ZE9A 2F1OA 4LGCA 4X1KA 1QJ4A 1Y7IA 2RCNA 5KYWB 3R6GA 2VKQA 3F3KA 3KYDA 3GP5A 4QLAA 2QZ9A 1T9HA 2DWUA 3VBCA 2BGTA 1VI2A 2WFAA 2CMFA 3M5DA 3Q11A 3DYIA 1B2LA 3IE2A 4X94A 5F21A 2GBLA 3V4OA 4E07A 3NDIA 3OTIA 5HIAA 2VAWA 4CKWB 4L5IA 2IYYA 3HPQA 4MIEA 1D0IA 6NULA 2PAAA 3O7MA 1QQTA 1SVOA 4KUHA 1V4VA 2O1WA 3FWPA 1PL6A 3KSDO 2IHKA 5EESA 2VBCA 5AKXA 3EVZA 3G88A 5E2AA 1J0AA 4CMIB 4FEAA 1ZCZA 3DQZA 2O7NA 2JAXA 5LQNA 1DG9A 4LHYA 2X8BA 3WR5A 2ECKA 1JVSA 1MQSA 2E7ZA 3CIOA 1L4NA 3V8EA 1VE7A 2XNDA 3CRMA 1MX5A 1NBAA 3EOAI 4MI6A 4K6KA 5JE8A 3QX8A 1RXVA 1IM5A 1KI7A 4Q3DA 5BNZA 1S9HA 5A3SA 3UAYA 3I9JA 2X6TA 4HPWA 3AYZB 4PS1A 3W1WA 3EYWA 4EDFA 1GEGA 2BEUB 4B3MB 3O9MA 5I3ZA 2KYRA 4B74A 4Q9AA 2BHNA 1M1ZA 4PSUA 1CIPA 4ESEA 3QA3E 5KREA 2V8OA 4RM2A 2PZJA 3A3PA 4TWZA 5IDXA 4FIZA 1VFNA 2MOKA 3OA0A 1KFCB 3PC3A 4R9RA 4F7WA 4RDXA 2BJWA 1J49A 3ITKA 2VYCA 4J0IA 3T0FA 4DBVO 1EXDA 2GZHA 3UGQA 1XPRA 1M2WA 3KDAA 3RWOA 4DLVA 3PC8A 2XRFA 1K7CA 3R40A 2G1AA 3IHWA 3B52X 3JTEA 4NYMR 1L7PA 2XKBA 1IY1A 3RH0A 1GPYA 1VRCA 2M9MA 2YH2A 1FX0A 3DAGA 4D9GA 3JASA 4KYUA 4YP1A 2ASEA 5FQOA 4IIUA 4JJIA 2R8XA 3G6KA 4LHZA 4ZJZA 3PSAA 1UP6A 1WXDA 3L8ZA 3ZTYA 1D0SA 3GVCA 1G19A 4CMBA 2CF5A 4IXTA 1VRWA 2VEOA 4MH0R 2BKVA 3PI6A 3NYWA 4N49A 3GMIA 4KLNA 2H4ZA 4NU5A 4QKQA 4Q16A 1QK3A 4LRUA 2G67A 1T9CA 4R69A 3D3WB 4REOA 1GZ5A 3U7EB 5JZMA 5BQFA 1E6EA 1KY3A 3TD6A 1RI5A 2L17A 3CW8X 3KIPA 4HNSA 4E33A 4KLAA 1LPPA 2W37A 1CYDA 1BQEA 3QNMA 2RGAA 3MT9A 1SELA 3TOCA 2FE4A 1UPFA 4G0OA 4ALKA 2XH8A 3W2FA 3PI7A 3C8ZA 3RCBA 4X45A 3JWGA 3VVLA 1FNNA 4C76A 4CCWA 5IVPA 4GKBA 3DCYA 2J3IA 5IFKA 1KYXA 3BTOA 1L7OA 6AT1A 1VOTA 1DG3A 3IB6A 4KZPA 3BEDA 3GZJA 4OOFA 4RPIA 5B57C 1GTJ1 4XM1A 3IOCA 1HK7A 3ZWNA 1PZFA 4CL8A 4MS4B 4CKBB 5MN5A 2V7WA 4Q0MA 1P9NA 4PCLA 3KOWA 3RGWS 2WYIA 4CQLB 1F38A 4BBZA 5B3JC 2GVNA 4P5DA 5HFJA 1KY4A 2PGJA 4KDEA 5D84A 4YAKA 4R98A 1KZGB 3OM0A 2PSDA 3CSDA 1J90A 2HJRA 4RS4A 2AXNA 3AP3A 4WERA 3TTXA 1WABA 4PLCA 1KNXA 4N9QA 3EFBA 4M3NA 3HVUA 4IXWA 4KC0A 2J9YB 3LPAA 4HQ6A 5C1DA 3CLUD 4XOUA 4DV6B 4NMXB 3LHKA 2XZPA 5CA0A 3FR8A 3Q7RA 2BFNA 3DB2A 4HYEA 1PGNA 2Q3MA 3BJIC 4WDQA 4GYWA 5K99A 4UTOA 1ISHA 4PXYA 1CCWA 4IXNA 3HBFA 2L0XA 1QWOA 4P4NA 3L01A 1J25A 4EFMA 4LGYA 2VHQA 2GEUA 4FIDA 2XZDA 4QYWA 5KX5F 1TTQB 2DWCA 3N39C 4H6XA 3QEBZ 3EXEA 4QC2A 4JI3B 2GPTA 2WG2A 3RREA 4JC0A 1C3VA 1KI8A 2G71A 5L9AA 1YIAA 1Z83A 4DCMA 4E94A 4QVGA 3VDRA 1AQUA 2KW5A 4EVRA 1X7WA 5IZCC 1U8FO 4FOSA 4NBWA 2AX3A 2G8NA 3IR7A 1H2YA 2EP7A 2J9FA 3PENA 4UMFA 4BFCA 2BTQB 2CNWA 3PNVA 5TQ2B 2V6BA 1LEHA 2NYUA 4OXYA 1BC5A 3OQHA 3L7OA 4RPKA 3EXFA 4MMZB 1P8JA 3HUDA 3TINA 5ADHA 5JZOA 3NRCA 4QDXA 1U28A 2WSIA 3AHFA 1G7SA 2HQSA 3GLHA 3AC0A 4TS1A 3PXXA 1LU9A 3ACDA 3FVQA 4ZVTA 3KQUA 1PJLA 4YCBA 5KB3A 2JJ1D 3Q72A 2BI8A 2GK7A 2XYPA 3L8MA 4KO3S 2J9RA 1ZAKA 3STVA 1RCTE 4PF1A 2X8WA 3CNBA 2HDOA 4TTTS 3QVGB 4I4TA 2I6XA 1IHYA 2OCAA 3GDOA 3IBSA 4RPHA 3C5VA 3VHRA 2X1VA 2ZATA 1D6SA 1MRNA 1RJGA 1W4BA 2WJPA 2DFKB 4MTCA 2HU8A 3B7GA 1SA0A 2AN3A 2B5WA 2FMHA 2VDWB 3GFSA 3KCNA 3NIDB 3SI7A 5HZMA 4JP8A 3IDQA 4GZ3A 4JDUA 4NPHA 1ADJA 4PLTA 4RXTA 3K71B 4UHKA 4OXQA 1FW8A 1X9HA 3T4UA 2I6QA 2X9VA 3DOFA 1FBNA 1NHWA 1A1SA 4X6XA 1DUIA 1GPH1 1URPA 5BN5A 3OWHA 5KTRA 1QVVA 3GPBA 2WF8A 1W73A 3OKFA 4GD3Q 1LW6E 1JKFA 2J32A 5EJ2A 2J08A 4BB9A 1LDMA 3UHPA 2V74B 3U3OA 1QO7A 1DOZA 1QG0A 1TJYA 3LGXA 4MVYA 2GOYA 3BE5A 1W581 4OKIA 4OVKA 4XIFA 1Y5MA 3KUDA 1CUVA 4KK3A 1BXGB 3BL6A 4PAWA 1ISRA 2C5EA 5IJ9A 5AK4A 1ZAYA 5CCBA 4B47A 2WTBA 4YQYA 3P5SA 5J5VA 4EO7A 3KKKA 5FI1B 4ENVA 5IYZB 1D2AA 3PNOA 3T34A 5KYUB 1T8SA 2CKMA 2OGWA 3C3WA 1W29A 2P4EA 2WMYA 3USES 2BGGA 1MT3A 4AIIA 3HSKA 3WA6A 3RE1A 3N75A 5CHYA 2RGYA 4I1PA 3A05A 5ALZA 1J09A 2I5PO 1F3LA 1LBHA 4B7ZA 2W90A 3V97A 5EIXA 1OW3B 4JLKA 1GRVA 1E1MA 1VCNA 2O8FA 1QGED 5KQGA 3I76A 4M7RA 2IH2A 1KJIA 4MLCA 2Q41A 1B93A 1FS6A 4IUBS 5DM60 1IM2A 1XZAA 1ZJJA 4H7EA 3VPDA 3WTBA 1J8MF 4Q9KA 4C04A 5LZ4A 1JIXA 3RK1A 1HSOA 2BBTA 2YNMA 2HZ7A 1GV1A 4TRRA 1OA1A 4RVFA 5FWXA 5G0TA 3VSDA 3WL8A 3X1WA 2A0XA 2ZM5A 4H1TA 3HKDB 2G36A 1C7JA 4RVUA 2J5RA 1YI1A 2HU7A 3R3JA 4C4OA 5JFGA 4JOCA 5DRTA 4C88A 1T34A 4RANA 4IQFA 1P6QA 4CTOA 5ARBA 1S8FA 3IOYA 4K7JA 1OAAA 2GEVA 3CEHA 3EJ6A 5A04A 1AF7A 3ZW8A 1K98A 4IX1A 4AO6A 4HYYA 2PWZA 2OSBA 2ZB3A 3FTPA 4ZVOA 2OO5C 1M5RA 3WHKA 1VBNA 1J07A 4PYLA 1B0UA 3IAEA 1MHPA 1MO2A 2XOKA 2ZYGA 4ZVVA 4MQ4A 2Y8EA 3S2ZA 4OLFA 1WHSB 5J43A 4HDRA 3C1OA 1K08A 1SOAA 2WT8A 3L1UA 3N6XA 5JECA 2PFKA 2QJWA 3OZWA 4LOKA 3I32A 4AP9A 5KZMB 2EZTA 2PX5A 3AEQB 1WUIS 5JZ9A 1QDUA 1UC4B 4BMXA 4BMSA 3IRVA 4IQ0A 4DB4A 3S8MA 3ZNNA 4LTMA 1FLNA 5ALRA 5BN4A 4MV0A 4AJIA 1GU7A 3DHNA 3KXKA 4GGMX 1CP3A 4DNPA 2H9AA 4NATA 3KR9A 2BRUC 2FN4A 2QTRA 3NBZC 1ZIPA 3FPHA 3FNQA 1E5DA 2IY8A 4R2HA 4NBLA 3FSGA 3R24A 4A6EA 3C6XA 4H0FA 4FWTA 1K6XA 1SD2A 3PTLA 3SFZA 4EKNB 1T1RA 4U9HS 4X1YA 2QI9F 3E7PA 1PUJA 1HH4A 3CONA 1GR1A 2GASA 2NUTB 3IT1A 4WTOA 2ATIA 4ES6A 5ICSA 1MC8A 1OX4B 1NLYA 1VJRA 5BQOA 1OFVA 3QBEA 1X6VA 3FUVA 5I7FA 1VL6A 2XCIA 2C4WA 3FHOA 4X97A 1XF1A 2JG3A 2BVNA 1RXYA 1U0SY 4JB8A 1A8PA 1NIJA 4OQFA 2WHYA 4DR5B 1ZH2A 2ZCVA 5J2TA 4TPKA 1P4RA 2VWHA 3FJOA 1BMFD 1XLWA 1N1MA 3EZ6A 3O94A 3RFUA 3ZWCA 2A9OA 4BGUA 4EEKA 2H5EA 4ZU1X 8LDHA 1TVKA 1WF3A 2P2GA 3E9NA 4CV1A 2PRSA 3AV0B 2G0NA 3OMXA 4B17A 3WJ7A 1J21A 1J8FA 3JQEA 2R4QA 3K31A 3QEKA 3ABZA 4Z0TA 1OF1A 1FL9A 4BMVA 5CCEA 3U16A 2ZUTA 4JV5B 1PX2A 1GGMA 3UWPA 4ZMSA 2ST1A 2XF2A 1U1DA 5F76A 4ZEMA 4J0GA 1JH8A 1M2OB 3WFIA 1EUYA 1RE0A 1TMGE 1QGUB 1HWYA 3JZAA 2F1RA 2MYNA 2ZWPA 1PWYE 2X2PA 2Z1NA 1IE3A 4AMYA 5BY2A 1GYPA 4OA8A 1C81A 4WDRA 3RHFA 4JT9A 1ORTA 1OI4A 4FMDF 3MGCA 4G8JA 1RI1A 1KR5A 1QXSA 1AGPA 3KXLA 3C7AA 1QH1A 3OZ7A 1PJ4A 4L6IA 5JHGB 3G0IA 4XQCA 1X7YB 1GQQA 3PLRA 4UVIA 2QTAA 3GRVA 1FTQA 3R0QA 1NLMA 1KDRA 3H1PA 4PPFA 1P74A 1ULBA 2FX5A 3H2YA 2P4HX 3GT7A 2YOFA 1X1CA 4GX0A 1NBHA 2E6UX 2VF7A 1OKKA 1Z4IA 2I3AA 3MK31 1NWHA 4Q4AA 4R7TA 1NW9B 4BAGA 5FI5A 3VOBA 3U7FB 2WJHA 3OY7A 5D1NA 3UCFA 3E3OA 2RCYA 1ZESA 4GMDA 1I1OA 4HGPA 5FBKA 3UT5A 1VDZA 4Z5XA 1DKOA 1QK4A 2YUTA 2YS7A 3FZNA 3KT0A 3M1AA 1H1LB 4DJJA 4DSOA 1NMSA 3W3AA 2VRNA 1IG3A 1Y3HA 1X8LA 4W5HA 3NAGA 5CEFA 4EHFA 5E4FA 4NDZA 3LYLA 2A57A 1N3LA 2JFQA 3EHDA 5ITZA 1N8TA 1V2HE 2M6RA 3U1VA 2HGSA 4HWSA 1JKIA 2ZVPX 1ODTC 3GO4A 1UAAA 2VQSA 2ZDQA 3H97A 3F5SA 1DCKA 3PGLA 5CHEA 3RUHA 5KTSA 1UM9A 4PY2A 1Q92A 1MEJA 1AXGA 1C2YA 1FK8A 2AYYA 4NENB 4D81A 3ETHA 4URXR 1DKUA 2WTNA 1L5GB 1UODA 3M6XA 2FEKA 2WTEA 4FC7A 3QE2A 4TLCA 4A82A 1MA3A 5AKLA 4UM9D 1UK9A 2J3DA 1NJ5A 3NWBA 3S1LA 3THXB 5A0TA 2D7CA 3D3QA 2PJDA 2VUHB 1OV6A 3T5MA 2UZ1A 3A1DA 3DEKA 4NBKA 2AJTA 2FU5C 3X1XA 3SX2A 1CUXA 2HU5A 1WXEA 1TT5A 2WT4A 3GJ7A 3OQJA 3QKIA 5BR4A 1EDDA 4RTOA 1EK1A 2VYVA 2HHCA 1KO5A 3CX3A 3WGQA 4ZYYA 1QIJA 2GCOB 3KJNA 1C9DB 2FVXA 5F1YA 2AEMA 4DLBA 1YK1A 1N9GA 2ZSJA 3CW9A 3DP9A 3EWSA 3H84A 1XDSA 1X87A 3B12A 4FMCF 1EJBA 4E2YA 3U60B 2H92A 5H81A 1QPBA 3TECE 1XTUA 3KKZA 1XDUA 2EJBA 2NO4A 4NARA 2B30A 5FB3A 4GYKA 2H54A 2V4ZA 1LA2A 3QM1A 1R9JA 2BF7A 4FD2A 4D79A 7YASA 2OWDA 3B85A 1BX1A 3SSOA 3UJ8A 3KAKA 4LX0A 1N5LA 1NFFA 1JF8A 2XCQA 3OQBA 2NUBA 4QDUA 1NASA 1VE9A 2QRUA 3T5AA 1IMOA 1FQWA 1F17A 1KJWA 1RBZA 2IYQA 4YC7A 2Q3DA 4N0DA 5AIBA 4LDPA 1WEHA 2MSNA 1Z37A 3QP9A 4HAXA 3R7LA 2JLYA 1ZRMA 4EO4A 1QM5A 4X0EA 4F7DA 1VGRA 1TTPB 1NHGA 3CVWA 2QJOA 4UOEA 1US8B 4R1QA 4MIOA 5KBYA 1TNDA 2HJHA 3N05A 3NVMB 3R0ZA 1NKTA 5EIOA 1QRTA 1SUWA 2X86A 3DKRA 3KOYA 3MOIA 4LOJA 3WP0A 2B83A 2YINC 2IUUA 4XWAA 3W2HA 1ESNA 2DGDA 1N5DA 1R5BA 2QIPA 3SQOA 1PL0A 3FWYA 1CJMA 5LLDA 5T6MA 1RQRA 1JECA 2MYUA 1RWQA 2H11A 2XMDA 3H9GA 3LT0A 4UVDA 5BV2P 1OWPA 1SC6A 4U63A 1DS6A 4XPIA 3RS5A 2Q8PA 3OCCA 4LFCB 5CEJA 2Z08A 1PW5A 4M1WA 1X9GA 5IC5A 4MTLA 4BFUA 2YMLA 4BYMA 1GXSA 4P34A 4ZZ1A 3DDNA 1GR0A 1JFFB 3KLNA 2BM8A 3PXBA 5JDIA 3M70A 5DTQA 5KYGA 2WQ7A 4QXPA 4KRFA 3I58A 3JQGB 2ZJ1A 5G0SA 3D8SA 1XA3A 3E35A 3OSZA 3I4LA 4CIAA 1SXIA 1ZVJA 3HXLA 3PE4A 4OAQA 5HNKA 5L7YA 3TZEA 3VOAA 5M5BA 1U0RA 2GO7A 4U7DA 1AF4A 1XRQA 1G16A 3WNBA 1XDBA 4NLLA 1N9ZA 1UAGA 2IU4A 3GUUA 3ODGA 3W4JA 4DGSA 2JK1A 4I2VA 4NOMA 3ZY4A 3D4LA 3ZYZA 2QRZA 5LBIA 2YV1A 4RVCA 4EHHA 1L5YA 4ZOLB 2Y0DA 4YWHA 4CMAA 4E1VA 4IF6A 2DU8A 4S2EA 3OCYA 3F78A 3DFMA 4GC9A 3BYZA 2VNHA 2D5IA 4N9WA 1COWA 3CUVA 4ETWA 4S35A 2MDTA 3GZNA 2A0WA 2WM8A 1G18A 4G8DA 4X5OA 4ZREA 1E1RA 4PGHA 2IJGX 3ZU4A 3LDGA 2HT1A 2BL4A 2GTIA 4N54A 4QQNA 1Q0LA 5EYPB 4MSUA 1U6IA 4MLDA 2VUSA 4DMCA 5JCOA 5A03A 3INYA 4HEJA 3S5UA 1R16A 3R9WA 3SR3A 2FLKA 2DBQA 3KHKA 4WJLA 4DQVA 5JIBA 1LCIA 1OXUA 1CUAA 2DERA 1P29A 1W47A 3M0EA 3P20A 4HQNA 4LWOA 4O2BB 4BP8A 3NHYA 2FJ0A 1NULA 1U90A 1UPTA 3EGOA 1EI9A 1AH2A 4L7VA 3ZWKA 4DJAA 3H2SA 3DMTC 1B1AA 3RVRA 1EFVA 3OO0A 3T1TA 3GLIE 5LD2B 1QTRA 3RAFC 2Y0CA 2LIVA 4C5CA 5MN6A 4H3VA 3L07A 1R2QA 1HUQA 2H5JA 3CWZA 4BO1A 5AW2A 5L3SA 5HGXA 1LX6A 1UF9A 4EHIA 1GTMA 4L15A 4YGXB 1OZ0A 5EUCA 2XTJA 2CJWA 1LQUA 1CY6A 3P9SA 2HFJA 2FMKA 2FWRA 4PSKA 2JEYA 4MB2A 4DR1B 1YOVA 2P6MA 3CUUA 1ZUD1 3T3IA 1TYDE 1J7JA 1WTCA 2QY9A 1FXWF 3GDHA 3QUCA 1UWVA 5LNK6 2DRIA 5KYTA 2FQQA 4GX2A 4M8LA 3EXHB 3L79A 4IOLA 3RIYA 4M1TA 1SG6A 1XNGA 2GZRA 4TUYB 3R7BA 4X64B 2FQYA 1W5SA 1GGFA 3BFKA 2XGJA 4ZCSA 3WGVA 4GKJB 1ZXBA 1NN0A 2F1KA 1KE2A 1UFKA 3Q7EA 2IIQA 1FLVA 3FOFC 4OB7A 1KEVA 1RHKA 1N5JA 3WLTA 4R1NA 2Y1LA 3BAFA 5ALHA 2WD8A 3RHZA 4DBLC 4M46A 5JI3E 1HDRA 2O0LA 3TTWA 4TVOA 3L8GA 1MO4A 1CK4A 2ZFUA 1GPDG 1C4OA 1Z18A 1WXXA 1ZCFA 4HGZA 5IRCD 4GO1A 4URHA 1UKZA 2ENWA 4GI7A 1HE2A 1XKXA 4PZ0A 1N7JA 3PX3A 1EVYA 3I6YA 4O25A 2HIHA 4W63A 1ABFA 3QXHA 3C8UA 4Q3BA 1B00A 2ET6A 1LH0A 5FPTA 2FMTA 1DDIA 2C3PA 2IODA 3C4VA 4J1QA 1D9ZA 5BUCA 5DIZA 1KAMA 5AVSA 1PFUA 1ZHHA 1P80A 1X1AA 5AICA 4BNTA 3D8BA 4DY4A 1TQ8A 4JJFA 2IE8A 3RANA 5CXQA 2BFDA 4DR4B 1Y8RA 4GW3A 1RXIA 5ICCA 3I1YA 1U1FA 3S28A 1SBIA 3I12A 3MYRA 4RJLA 2WVGA 3DSRA 1HNWB 1FFYA 2AN4A 4LY3A 4FB4A 1U7TA 5K8TA 2PUGA 1FFEA 2NO5A 5LZ7A 4JWKA 4AJKA 3TGPA 4G81A 3C3AA 3IB3A 5HKAA 2D8AA 3KYJB 3LDUA 4R1UA 1Y9DA 2Z9DA 4BMYA 4HNGA 2XQIA 1XMQB 3KYDB 1KARA 5HG0A 4TQGA 4G41A 2WFLA 5DYWA 4DV1B 2ETXA 2VJPA 4IJQA 2PX8A 3HJAA 2NPFA 4EABA 3FYUC 3NRBA 3QMWA 1TVMA 3VU9A 3ZVLA 3PLAE 1JLKA 1QFXA 3UY4A 4CKZA 4RTLA 4CE6A 1EINA 3L7DA 3L06A 2XWPA 1YDHA 4EF5A 1FYDA 2R1ZA 2Z5LA 3CCFA 1TM3E 3IP3A 1O97C 2NOAA 2E4AA 2FY8A 2JCSA 3IQIX 4TWRA 5CPBA 4BYGA 3AETA 5J2UF 2CCGA 3ESYA 2QRNA 4EA8A 5JCZA 3ZD7A 2R6ZA 5AD1A 2PUHA 1JR4A 2M6SA 4GLFA 4F92B 1PZMA 1K6EA 1TK3A 3K16A 2IOFK 3PITA 4QUEA 4OU4A 5KTKA 4PBTA 4NZNA 1VKNA 5LIPA 1G1MA 2CFRA 3JQFC 4B40A 5GOZA 5TJ9A 3AR5A 4BFTA 3TCKA 5P8WA 3E9MA 4LC1A 2XDWA 2G0AA 1B8OA 3GUYA 5JQGA 2PR7A 5TGTA 3ABIA 3ZCVA 3DOIA 3F4LA 3ZHCA 5I01A 2IE0A 4V3BA 5EWLB 1I1NA 5FORA 4YP6A 2GUGA 1PU2A 2Q0SA 5EQFA 2ZRAA 2H08A 4MGZR 1W0JD 2I2AA 4OFWA 3RJTA 4DC9A 4RIHA 1SB9A 2J9ZB 3KQPA 4R8MA 4D8UA 2QL9A 5FLYA 1GIAA 1YZUA 5CH5A 5TF4A 2LCQA 1G0NA 3NETA 1GZ7A 3BC1A 2C99A 3FLBA 3KKEA 3GFQA 2IU3A 3QEAZ 3KPUA 4S0ZA 2IOHA 1JHAA 1DKLA 1KRWA 1A7JA 1LPSA 5TARA 2HA7A 3U1TA 3I9OA 2O59A 2RKOA 4NFHA 1XZ8A 1G98A 1DMRA 3V8BA 1CUHA 4WCFC 3G82C 4GVLA 5EIHA 4FFRA 4JB0A 3M7IA 1VHWA 1DJPA 1L4HA 2WHQA 2XQGA 3OTWA 3TLZA 3SGLA 4WLEA 5L7WA 1VE1A 5D01A 1KC3A 3QKRB 1ST3A 1EZZA 1YS9A 5LP6C 2J1LA 1KIFA 4A1OA 2C7RA 3HB9A 2VVTA 1EWKA 2R8ZA 2FOLA 4HI0E 5B64A 3OF3A 4F8YA 1GADO 4ENSA 3C3MA 5I7UA 4RVGA 1TPZA 3G0GA 2WIAA 5BRAA 4F6LA 1Y6JA 2Z5VA 3AHJA 5A5VA 1E4EA 3ZU3A 3N0WA 3O8QA 3H99A 3D8HA 1HEIA 3GJTA 3DLTA 1IH8A 1ZL2A 2WM3A 1NQUA 2YXEA 3MMNA 4KGZA 4AJNA 3PF9A 4L9WA 1V95A 3B3AA 4UTXA 1MMFB 1U8AA 1A69A 5DYTA 5ERGB 5B4VA 1H6BA 2H00A 3G0CA 3HBNA 3NX4A 2OD2A 5BR8B 4KN6A 2PM8A 1KHTA 2YWBA 4LNUA 3H9JA 1CEXA 1QIEA 1J1IA 1RBMA 2O8BA 3DOEA 1ISMA 1TE2A 3ETCA 3F0TA 4MHOA 4OUKX 4WUTA 3UMMA 4RWZA 1MJ5A 1GNTA 1FJHA 5E0KB 3GGDA 3EC7A 1JN0A 3EIXA 2HMSA 2WQ6A 1TEXA 5FOTA 4G36A 5I45A 2NUAA 1NX6A 4FNAA 3RG8A 4DR7B 4G25A 3JRWA 4EZBA 4ZHQB 2IGBA 4F11A 2X76A 3OD5A 1M8JA 3WMEA 3IUMA 3EVFA 3F47A 2CE2X 1KO7A 1A50B 1UBUS 2CBGA 3EVBA 4JROA 4ONEA 3EH1A 4J6FA 2H4HA 3PRJA 1I9CA 1XJCA 3X1YA 5CA0B 3IQEA 4N0EA 3PJRA 2P5SA 2YCLA 4O02B 4A0SA 5DNDA 1WY7A 1ETUA 2Q4EA 4LOIA 16PKA 1LVUA 1W9HA 3JSXA 3EC1A 3V3TA 1HG0A 2VHWA 4V1CI 1I6KA 2R1VA 1BA2A 2PUAA 8MHTA 2EGGA 2RH4A 3QWFA 1YC2A 3MVEA 2XUGA 1P1HA 3NBAA 4O4JB 4EY5A 5K0SA 2X0RA 3CVUA 3QE0A 2RJNA 1UT8A 4WESA 3CVOA 4N03A 4ZT4A 3SF8A 1U2EA 1BG6A 5DX1A 5C8YF 4QD3A 1J00A 4ZPJA 1ATZA 2GKGA 2W6QA 4J75A 1B0ZA 1U0HC 2A67A 3D2BA 3E15A 4WEOA 2H2FA 4MCJA 2IZZA 2B4TO 4PZEA 1EVLA 1X7WB 4KUGA 3WNDA 4HADA 4NCXA 2CT8A 4DBLE 1E2UA 5LZ9A 2H63A 3C6ZA 3LRTA 3BXZA 5K0GA 2J0UA 2EZ8A 5J1SB 2W2OA 1G3IA 3JYQA 3ZGXA 1E94E 3FMOB 1E8NA 1WULS 3Q85A 2ZTHA 1VBMA 3EXFB 1RZRD 2ZWIA 1EG7A 4RAOA 3SX0A 1L1FA 1Y7TA 4M22A 4W8GA 3QHPA 2AR7A 2XD4A 3UYKA 2YX1A 2V6MA 4B75A 5CA1F 5AVUA 2YN0A 2SECE 3NHRA 4KIFA 3U4IA 3A7EA 1L7EA 2IV7A 3TE7A 1CVRA 1DEAA 3TZLA 4IHJA 4EO9A 3PRHA 2VSFA 4IM7A 3S2FA 2Q4DA 4JXJA 1FQJA 1U94A 4DLZA 3BK1A 1UDX