4G07A

The crystal structure of the c366s mutant of hdh from brucella suis
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
437
structure length
427
Chain Sequence
VTTLRQTDPDFEQKFAAFLSGDVDRAVREIVDRVRREGDSALLDYSRRFDRIDLEKTGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSRWTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAGVSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVLIVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTETASASWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAHAQSVAIRLNLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the rational design of new anti-Brucella agents: The crystal structure of the C366S mutant of l-histidinol dehydrogenase from Brucella suis.
pubmed doi rcsb
source organism Brucella suis 1330
molecule tags Oxidoreductase
molecule keywords Histidinol dehydrogenase
total genus 145
structure length 427
sequence length 437
ec nomenclature ec 1.1.1.23: Histidinol dehydrogenase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00815 Histidinol_dh Histidinol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4g07A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4g07A02
3ZTTA 3HXPA 3ZK7A 4FKMA 3AEUA 4WN9A 2XY4A 4FI3F 1M1NA 4FNAA 4G09A 4TKUB 3MFQA 2XUZA 4WESA 5HDQA 3BE5A 2OSVA 1N4DA 3AETB 3R5SA 2XH8A 4INPA 3AEUB 1KAEA 4DBLE 2ETVA 3R5TA 4WESB 3K1AB 4H59A 4UTOA 5BVHA 5HX7A 1QH8B 4XPIA 4BBPA 1K0FA 1N4AA 2PS9A 2R7AA 3U7QA 4UTPA 5JJ5A 3AEKB 1PSZA 1MIOA 4H0FA 3AERA 4ND8A 5BVHB 2MINA 2Q8QA 1QGUB 4OVKA 3TEFA 3NU1A 4TKVA 1G21B 4WZAA 3ZK8A 1EFDN 3MWFA 2PRSA 3PDIA 2M6LA 5JOQA 5M3BA 3LI2A 5KOHB 3MD9A 5GGYA 4MDYA 1G20A 4IRMA 5AFSA 1K2VN 2AFHA 2AFIB 3BE6A 4G07A 1L5HB 2YNMD 1M1YB 1PQ4A 3LHSA 2O1EA 2XV1A 4UDNA 4GICA 2X4LA 3EIXA 1FP4A 3CX3A 5JPDA 5M29A 4XPIB 4MO9A 5CX1A 1KAHA 3EIWA 4LS3A 4OXRA 3AESA 5CR9A 3PSHA 5KHLB 4LJSA 4WZBB 5GGXA 2MINB 3MWGA 2OV1A 3PDIB 5M2QA 2QI9F 3AESB 2OGWA 4PAGA 4HMQA 1H1LB 4PM4A 4CL2A 2WI8A 3AEQB 2YNMC 4WZBA 4WNAA 1N2ZA 4INOA 5FLYA 1N2CA 5KOJA 2R79A 2XDQA 1M1NB 1XVLA 4OXQA 5JG7A 4WNAB 1QH1A 2WHYA 4NNOA 1L5HA 1N2CB 3AEQA 4NNPA 5I4KA 3ZK9A 1M1YA 5BVGA 2AFIA 2AFHB 4B8YA 1FP4B 5KOJB 1QH8A 4MLZA 5CX1B 3G9QA 3K1AA 1M34B 4HMPA 5BVGB 2RG7A 4ND8B 1K7SN 1G21A 4WZAB 1H1LA 3GI1A 3MINB 4K3VA 3AEKA 5B58T 3AETA 3MINA 4HN9A 1KARA 2XDQB 1G20B 2Q8PA 3AERB 5KOHA 1ESZA 3HJTA 1TOAA 2XQVA 4N01A 3TNYA 2PHZA 2OV3A 3PSAA 1M34A 4MX8A 1QH1B 4UDOA 4WN9B 3HH8A 2M6KA 3UJPA 4TKUA 1K75A 2PS0A 4M7OA 3ZKAA 3U7QB 1QGUA 4HMOA 2PS3A 3TLKA 5M34A 4TKVB 1MIOB 4FILA
chains in the Genus database with same CATH superfamily
4ARSA 3B1WA 3LX4A 1WHTA 1S8OA 2CXRA 2ZB2A 3T7CA 4BNDB 4BYGA 1SNYA 3EGIA 3ETGA 4H1VA 1KI6A 2MR5A 3CX7A 1W0KA 3RH0A 2VWHA 4GVLA 4KRXA 3U9TA 1AQNA 2GJAA 1AUQA 4II7A 4TYQA 4ZCRA 4I1IA 3WWPA 2X0FA 1I0LA 1ZFNA 2RG1A 5BT9A 3V1LA 5C7YA 3GFTA 2OXEA 3PQ7A 4N48A 3OP4A 3Q15C 2QPLA 4R1UA 1Z5GA 5LJIA 3K8QA 4XVUA 3E9EA 4X6XA 4URVR 1Z13A 3IELA 4L08A 3ZCUA 1RSZA 5FEMA 1KI6B 1Q92A 4IKOA 3P94A 1NVWQ 1QQ7A 5I3CA 1KXZA 2K2WA 4FHFA 1NASA 4RMJA 4FEAA 4IP0A 2W00A 3SFVA 4PYIA 1E1LA 2ZJYA 4DSNA 1SCJA 2PRZA 3DKKA 2D2IA 4P3OA 4DDVA 2RGEA 5CJPA 3O3MB 5DVZA 3S28A 3LV8A 4XJXA 4DR4B 1XBTA 3LFTA 4NOMA 5C9ZA 3G6WA 4BEBA 2H4JA 3PUYA 2H92A 4FGUA 1G3IA 2WAMA 2ZYIA 3L06A 5IU6A 3IBFA 4GLBA 3PJFA 2QEQA 1FZQA 1WZNA 1C0LA 3OD5A 2C9MA 3QXHA 4RD1A 3NM5A 4WEQA 3R76A 4KE7A 4EHKA 2JVIA 5AVSA 3ED5A 2DWUA 3TI9A 2J9ZB 4JVSB 4LZAA 2UUCB 1IPHA 4QEKA 2XUOA 4M7WA 4C7KA 3C0KA 5C32A 4K1LA 5FYQA 3REOA 5J47A 4O02B 4C78A 1LNQA 3CEJA 4G0OA 4D96A 4PAOA 1K89A 4XSGA 4RLSA 4E3WA 3OESA 2DULA 2JL1A 3UMRA 1XCMA 3M5WA 3IDFA 4MR8B 1QQ6A 4KPEC 1J39A 5JDIC 3KTAB 1DIGA 2CV0A 1N8NA 1XZKA 2ST1A 1EUDA 1LF0A 2PUDA 3MJSA 3MAJA 4OKNA 2NVUA 2WHYA 3TZHA 1DXHA 4HZGA 1WXDA 3P26A 2AJDA 4HVLA 1G8KA 4O0MA 4P83A 2XOKA 4M9RA 4UVDA 3G5AA 1MAHA 1K9VF 3TVYA 5MN4A 5AM0A 1NC1A 4DIBA 3T0IA 3SPXA 2EC5A 3O0DA 4YV0A 4A8TA 3I9OA 1WCIB 3DLHA 1Q1EA 2BIFA 3H2SA 4OTZA 1P29A 1RHRA 3HBNA 4RU1A 4B84A 4UCXA 5BN1A 3KR9A 1KXJA 2E37A 1R8XA 2QZ9A 2CDNA 2RGAA 2W83A 4IBOA 5IZ4A 4MINA 1D2AA 3CH5A 3FFBA 1ZH0A 4U2FA 3BH7A 4HNRA 4HXYA 3ZY3A 1D3AA 5KUTA 4JN6B 4KXVA 3IE2A 1NR1A 2PD3A 2Q41A 1AURA 1VTKA 3PQ6A 4XIGS 2GAAA 2NT4A 2HRRA 2VQ6A 1H85A 1SCBA 2BI7A 2IJGX 2GUGA 2R7LA 2QUZA 4HN9A 2W6ID 3L18A 3DZGA 3UKDA 4HEJA 2JLUA 3LUFA 1E0DA 3HRIA 4G0QA 2ZG6A 3V9AA 3UJAA 3W2FA 3HUDA 4E0BA 4G84A 3FNFA 4AZ0B 5BOVA 2B8WA 5IZCC 2VF4X 4UVGA 1G55A 2QRNA 3F3MA 1IHOA 4KE6A 4V0RA 3CZPA 1PFQA 3CHYA 1YI1A 1CHDA 2OO7A 3KXLA 5JFTA 3D31A 4MB2A 1HUQA 4Q7MB 1P4RA 1P44A 5DLEA 2I65A 2YJZA 1DS6A 4LI3X 4NOKA 2RJNA 4PPQA 2LCQA 4OEHA 3V4LA 3DE7X 4ZVNA 1H6BA 4FT4A 4P7FA 1ZIOA 2QL6A 2C9CA 2LXNA 3KR2A 2QIOA 3SSAA 4RZHA 4GHWA 3DZJA 4AJ1A 2QHXA 4PC3A 3LTEA 4C29A 2A35A 3UAWA 3TD6A 4J2OA 3E0QA 3KPYA 4XAQA 5FORA 5L3SA 1U0OC 2AJBA 2D2VA 3PK0A 1M54A 1Z15A 4JLDA 2CHFA 3ZW9A 4PN7A 1QLJA 3CUYA 3RM3A 2AL7A 1BG6A 2JFFA 2OAGA 3TZBA 2ID8A 3KV1A 2ABWA 1AQYA 4NESA 5H83A 3TD9A 1Z88A 5ESXA 3V4SA 2C7RA 1WSDA 1E1MA 3VKVA 1FZTA 1P81A 2L69A 4KR2A 4XYBA 5E3JA 5ITZB 4EO7A 1JMKC 4Z4EA 5K9ZA 1U94A 2OYRA 1XL0A 2V4ZA 1J4AA 4K3UA 3FKQA 4LYEA 4COOA 3A0RB 3AU8A 1F0PA 4GL4A 2BEVB 2IHVA 3TNDA 4N4AA 2IU3A 3FWYA 1U02A 4GQIA 3KJHA 4HNUA 1TM4E 3J80A 4G07A 1K5DA 1SURA 1M34E 1U2QA 2XB4A 3M6LA 1ZJ6A 3F7MA 3PQ5A 3T9BA 1WTCA 2EWWA 2ZJBA 3A4YA 4QVKA 4YQZA 3TKLA 3QPUA 2C3UA 3EMVA 3MUNA 5IJ9A 1Z0JA 2C1EA 1F4VA 2CL0X 1J06A 2BEVA 1ZMTA 3GZNA 4FFDA 3TTSA 4EPXA 3ZBPA 1CUSA 3I6QA 3HL4A 1JSLA 1Z8DA 2Z43A 4HGRA 5E9WA 4IJ5A 1NURA 1Z68A 2RBGA 5KHLB 3PV0A 3AI1A 2DT5A 2GBPA 2JKVA 1F8YA 2O4CA 2XB8A 2GPTA 3FTQA 4KI0A 4OXNA 5CP8A 2C96A 1JPNA 4U00A 3AEQB 2YNMC 3B38A 1KYVA 4V03A 4Q16A 5L4SA 3B9PA 3EAGA 1KJNA 3OLVA 4YP0A 1UBOS 3O8QA 3KSAC 3R8FA 1WWKA 2R00A 1Q7TA 4WFIA 2FMKA 2JJ2A 5CH8A 4TLCA 2MR6A 2D54A 3DUFA 1G42A 3LCMA 1QH1A 3T7DA 2AUMA 1OKKD 1JDUA 3ZK9A 2VAMA 3PPIA 5CK4A 2PLRA 4TL9A 4F8EA 4Y9RA 521PA 4BLWA 1R9JA 4C89A 4GYYA 4FHDA 1SXJA 1QRAA 3EMKA 2FR8A 3NFYA 3RG2A 5CDTA 1I14A 3IAUA 4HDKA 1RAHA 5TNXA 3NO4A 1HPLA 1XQ9A 2Z83A 3I2JA 5IC4A 5LNK6 3X2SA 3QF4B 4EECA 2GZHA 5IC6A 1J8QA 2LGJA 3NKFA 4DQUA 5C53B 3W6OA 3ED1A 4MMYB 1RZRD 1WCWA 1VGVA 2PKYX 1LBHA 2G82A 2H4HA 3OOYA 4AZ0A 1NATA 2H4WA 2O20A 2B1RA 3UUWA 1DNPA 3F5MA 3DS8A 2WICA 4DMGA 1E1QA 3A27A 3H65A 3ZE8A 1AF7A 1O4WA 5DM70 1Z12A 3ZXIA 1VE1A 5L8VA 2E21A 2XF8A 3H0CA 3STWA 4ENVA 1FFXB 2XDAA 1UKEA 1T3SA 1FB5A 4KLNA 4Q4HB 5JZVA 2D1QA 1D04A 1Y8RA 1GZ7A 4M37A 5AT1A 4CTJA 3EXIB 4JUFA 4EFDA 1W49A 5EXDA 1X2BA 2VXOA 4Y9TA 3ZNOA 3ZY5A 4F96A 4O4JF 2EJWA 3LAWA 1SA0A 4JD5A 4DMRA 4BQEA 1GCUA 5GVRA 4PBTA 3T61A 1X7ZA 5BSRA 1H8HA 4DLNA 4DXHA 4CKCB 1G5RA 4TL6A 5CCDA 2HBRA 4L5BA 1ZGGA 5BXYA 2LD4A 2RH8A 5KCZA 3N9IA 3KKLA 2W2LD 2CNOA 4L2IA 4YT5A 5G3ZA 3TAXA 2P7HA 4BKQA 1NSFA 3IBGA 1NVVR 1XDZA 2FW7A 2PZEA 5H0IA 4L9SA 1S89A 1LW7A 5KDLA 3VUFA 3IL2A 4M0UA 3G9UA 4DWVA 1XJWA 3EEQA 1GZ4A 1HYHA 1XC7A 3C41J 2P5YA 1EVIA 3JW8A 4MCJA 4ND8A 3U39A 4AIIA 3ZWOA 2AN4A 5HQ3A 3IP8A 1PVVA 4LNAA 1P9LA 5EE3A 3HBLA 3RD5A 2PIDA 1CHNA 3OI7A 1K7CA 5BV2P 1U1EA 3PXBA 1FX0A 1K06A 2R4TA 3RAFC 4MOWA 1GPH1 4RGVA 2J48A 1G2QA 1ZP6A 4I4TB 4I55F 2SHKA 2DFTA 1GYPA 4JI8B 1XVVA 2CLKB 2JKZA 3KOYA 4IUCS 2V9PA 4C6TB 3OETA 4N3CA 3CLTC 3D3NA 1OFUA 2AFHA 1VIYA 2B5OA 3DCYA 3EN0A 4NPAA 2O8BA 3U7RA 4B7CA 3B78A 1YJ5A 3BXFA 1DI0A 3LT5A 3IQHX 1E7WA 4UDNA 3PZRA 3M6XA 3NYWA 3OPNA 3BEOA 3PNVA 2IOQA 3AVQA 2C5EA 5FPHA 4OJTA 1TFRA 1JHZA 5AKYA 3QX9A 5IKEA 1UC5B 3DTTA 5F23A 3NIGB 2UZIR 4Q7JB 5FKJA 3WADA 3W04A 1E4EA 5KTPA 2ZRFA 2FJUA 3RU7A 3SQOA 5I7FA 3RS9A 5A62A 1OH7A 5BWCA 1PDOA 4Q47A 2XGGA 3PC7A 4GGMX 2WWWA 2QTHA 3Q7PA 5B1YA 2Q2WA 4WNAA 4YJGB 5REQA 1EXDA 1N6LA 3OECA 4OYHA 1YS9A 2X4GA 3I92A 2PAAA 2DBRA 2VT3A 4D3FA 1Q84A 3GLFB 2JIBA 1I51A 1GY8A 3AIKA 4CU2A 5BVGA 2XTNA 1E79D 4MR7A 4KGZA 1PZHA 5IAEA 1ZN9A 3AP2A 3VNQA 3AKCA 3DVAB 1X87A 4MAFA 5ESRA 1AGYA 3WGOA 3K1AA 1SU6A 3CEPB 3NW9A 4Q82A 4TUYF 2Z9CA 4BV3A 2WZQA 4QUJA 4J03A 3U7GA 2M2IA 1FQOA 3RRFA 1YQXA 4PC2A 4WFKA 1LDGA 4HJRA 1PI3A 3EWSA 1PK9A 4URWR 2UVQA 2ZVPX 3AR4A 1T8WA 2W9XA 3B70A 4OL0A 4NF2A 4L6IA 5DOZA 4DSUA 2AMJA 2JI8A 1DOZA 2GAOA 2YZGA 4KXNA 4WCFC 4UMVA 5K8LA 5HJ2A 2PL5A 5KTRA 1GCIA 3I72A 4KQFA 3JYOA 3A58B 1H23A 1RLIA 5DHPA 5JNTA 2O4UX 3ECAA 4HEQA 1MEEA 3NP7A 2OL4A 4DNQA 3IMKA 3PC2A 1QRRA 3FTCA 4L4ZA 2I67A 2R97A 4LI0A 1MB9A 1UDAA 1VBMA 4ND7A 3RASA 2FR0A 2JLSA 4MZDA 1PJ4A 2AH5A 2P1DA 3IHKA 2G83A 3HH8A 4BIMA 5DYWA 2XBMA 3SCZA 4KVAA 4PYQA 5F7JA 1I3KA 2C1XA 3MIZA 3QEJA 4HP8A 4Q4HA 5TQVA 3REGA 4EEXA 2IUSA 4TKVB 4LNUB 1PP4A 1PNQA 3PLAE 1O6GA 1YVRA 2YV1A 1W36B 2WIAA 3TBHA 4DLSA 1U6JA 4PLWA 3ND6A 3ZXUB 3O95A 3C4QA 3WX0A 4D42A 3BORA 4Q34A 3ZV4A 3G17A 3K05A 2ZW9A 4L5CA 1Q3HA 1M5TA 1SQ0A 2P9YA 2WFLB 2JNWA 4IDQA 3F7TA 1EUQA 3OIFA 4FINA 3Q0IA 4GMFA 3TGWA 5HUHA 3HO1A 1K5HA 3DEIA 1PV4A 3CJTA 4X0EA 4F85A 1F8FA 1PL8A 3AKDA 4I9NA 4IOKA 4Q12A 1NUHA 4Z3DA 2AC7A 3AIMA 1HL3A 4QTYA 4NARA 1QS0B 1S2IA 1GKKA 5C8YF 1P9WA 3C16C 4E5KA 2XRFA 5JXIA 2GF0A 4HQRA 3R6TA 4Q3LA 4EKGA 4J1TC 3CZ5A 1R0XA 2VFAA 2WYUA 1KDZA 2C78A 3PDUA 3R9XA 1QH9A 2OZLB 4FMPA 3ADBA 1CY1A 3H16A 4TSRA 4MQBA 3LSYA 4CXMA 4NQRA 2GKGA 3L7CA 4X54A 1XMJA 4R2IA 3FXAA 1L8QA 4F9GA 3HB5X 3NC0C 1FUIA 2YNMD 1FTGA 1F0KA 1Q7GA 4B87A 3EPKA 2VHTA 3GA0A 1V6CA 1W19A 1Z2OX 3SZOA 3HU5A 1CRPA 5IFKA 3LC1O 4QQFA 1I3NA 3MIIA 3KQPA 3IALA 2W6MA 4TWIA 5EQJB 4ZZ0A 4MR8A 4MUIA 1YR6A 2IYUA 4KR0A 3JRXA 4DOMA 4Q1VA 1B6TA 3GG2A 4ND4A 3WDKA 1ZBQA 3GZNB 5LD2B 4XZ3A 5A3QA 4LDZA 3RFUA 1N2XA 3SZ3A 1QMPA 3P0JA 5KSZA 1BHSA 3I39X 3L1KA 5BRJA 4C20A 2QL7A 4MCIA 1OW3B 3EGOA 5IJXA 3VHXB 3PGXA 1X70A 2NU7A 2R6AA 2UZ0A 3C5WP 5LQUA 1GJRA 2P9EA 2RGCA 1E18A 4XW2A 1ONSA 2GLTA 1G5PA 3L7IA 4NNOA 4ER5A 1JMVA 3UC9A 5L4LA 4LY6A 1YK0A 4GQBA 1ECPA 4HAUA 1T3LA 2BMWA 5C34B 3VZCA 2NU7B 1USWA 2KPOA 5I9NA 3G3EA 4NENB 3MB8A 3RYIA 3IUNA 2AN3A 2V97A 3AL0C 2XUPA 4Y2YA 4AWBA 1P6QA 1Z0DA 1KK1A 5COBA 2ZRAA 1PLKA 1G20E 4MSUA 4P86A 3T7SA 2VO1A 1NLFA 3OT1A 4XYEA 4KOEC 1M2OA 1O89A 4KFTA 3MJRA 5CFRA 1QIMA 2E2WA 4K9LA 4QQKA 2OZKA 2P0YA 1SULA 1W4ZA 2QM8A 1EWTA 3C45A 3E5RA 2ZBPA 4PWYA 3FSEA 2AE1A 4BO0A 3F3KA 4OJQA 2WSLA 2O8NA 2ZPTX 4XRRA 1MO5A 1U8XX 1AMOA 3DWIA 5JAIA 1BU8A 3R77A 3QUTA 1GRRA 1Y3AA 4IDGA 4R2WA 1R5BA 2WU8A 4GI1A 5F9MA 5HIJA 3DNMA 2OCKA 4DL9A 5HM6A 5KJFA 4GOMD 1RRCA 1JIVA 4CG3A 1N6RA 4YQYA 4E12A 1Z28A 3L82B 4C87A 1UH5A 3EGDA 2A92A 4UU0A 5H02A 1H3FA 3EOBI 1OPXA 1RRPA 3C7AA 3QLEA 5DB4A 5ILGA 1E9SA 3BILA 4FI3F 4FNAA 5HDQA 3C6XA 5DGCA 5IAKA 5CEFA 2V65A 1R6XA 4WN3A 1MVNA 4PO3X 3OMLA 4FD3A 1PVOA 4IRXA 3L05A 3PGVA 5CA0B 2EKLA 1JHMA 1Z5NA 2H8KA 2HMVA 4Q7KA 1CB7A 2PTHA 4RGYA 1JECA 1KMQA 4JLWA 2M32A 3DE0X 1P0IA 4HBZA 4ZOEA 1FNSA 4Y3UA 2WFLA 2APJA 1Y4DE 1U2GC 2XLCA 1XZIA 1Z3CA 4WCFA 2VTEA 4ZT5A 4XYLA 2NUPB 4ZKEA 2CD9A 1HNZB 3VHLB 3MT7A 5WRFA 3CZ9A 5G0VA 4DM4A 3DEYX 1UP4A 1WOMA 1U8UA 4TLEA 3O47A 4UM8B 1R9NA 4NV0A 4HDRA 4IXTA 3PFWO 1I2DA 4JQYA 2COKA 1JQEA 3TRIA 1SXQA 1WBBA 1C3LA 1UINA 3CURA 5L9AA 4HAWA 2YZ2A 4CCSA 4EB6A 4M36A 4UVIA 1SBQA 2PX0A 3JR7A 4ZEOA 3WMEA 4PZZA 2PU5A 2VPTA 3BE6A 2WQZA 4LQ4A 2J3EA 2WC1A 5FA5A 4ZYXA 4U8HA 4DRXA 3LUAA 3FGNA 4R71A 1JPJA 1Z6QA 4S2UA 3KUKA 4L0DA 3C5EA 1H2YA 1N5LA 1S9DA 3G6KA 3MTIA 1XXLA 2UDPA 3FTFA 2QJRA 2ZETA 1TO2E 3D3WB 4YK7A 5DBEX 2W5UA 5FA8A 1OZ0A 3U3RA 1E0SA 4CLXA 1Q74A 1Y37A 2NV2B 1I5OA 1G9XA 2ZBQA 3AJDA 4WLNA 1SC9A 4TMKA 2NZ8A 5ER9A 3MA0A 3VNUA 1CKEA 4NIMA 4MKFA 5DSTA 2QLBA 3PHCA 3M4JA 5EIOA 2HMAA 2RAFA 3JQ8A 1CUVA 1W5BA 1NQVA 3SP1A 3UK7A 9ATCA 1ZJZA 5AW0A 4OHYA 1P2UA 2V59A 4QUEA 3ZCQA 4OMCA 4HHEA 4NVRA 1DC5A 4RNDB 3LK6A 1EZ4A 4E4RA 2MYNA 1MUUA 3FSRA 4AS2A 3BXZA 1CQZA 1NOIA 2YHAA 4X9XA 3B6MA 3JTEA 4YP6A 3TSZA 3V55A 1WUKS 1I7SB 4UJ5A 1N2GA 3Q1LA 1LWOA 1UK9A 5ELXA 1YL7A 1UXGA 3FMIA 1KO5A 5GIOE 3KELA 1PWXA 1Z6ZA 1E20A 4EP1A 1Q16A 3FF1A 5BT8A 1FTSA 3U09A 4ZAFA 4NCIA 3UVEA 1T2FA 2E4YA 2QR3A 1DAMA 1LTHR 2JFOA 2QPTA 4GGOA 4HSEA 4LHYA 5TMEA 4EW3A 2L19A 1FRQA 2BFWA 5F77A 1EESA 1FS4A 4OQLA 1WS6A 1S0UA 3OM8A 4M99A 1E79A 1DEAA 3C8UA 3DBHA 1UT6A 4TMTA 3VVMA 1CYDA 2VJQA 3P2JA 1VHWA 5B58T 5I7VA 5J43A 3N8GA 4ZXFA 1PT9A 3I0NA 1RRMA 1OLXB 1OZFA 4DWOA 2OXFA 4FUQA 4I8XA 1H42A 3EDYA 5C35A 2MTBA 3L0YA 5KOHA 2CDCA 3R9IA 3UTDA 1RBYA 1TK2A 1T24A 4IXDA 4FGSA 2BMAA 5E4FA 4AMZA 3E3MA 8LDHA 3QEAZ 1KMHB 2VSXA 3D8TA 3RVKA 4V39A 4FFRA 2HU8A 2WJAA 3CKKA 4EB0A 1GDHA 2B4YA 4C2BA 4XQGA 4AX8A 5C18A 1PR0A 3ASYA 3M4ZA 4TKUB 1NW5A 5DI9A 5KNDA 1ZNXA 2RGNC 1MTOA 1GCGA 3IT1A 5ALLA 3GVCA 2OCAA 4JVNA 5D5PA 1GUDA 4ZEMA 1XNGA 5EFZA 1V7ZA 1KJQA 3GUVA 3MN1A 2AW3A 1K0FA 4FMCB 5JCPA 1P3DA 4FNGA 1RZVA 4PPGA 5IHPA 2RK4A 2WUFA 1RPAA 4KKVA 4M9QA 3W3AH 4DUPA 5D3ZA 3U1VA 2I2WA 4Z49A 4O3MA 2VNIA 5F9FA 4OB8A 2D0PB 5AVQA 4HB2A 3GJ3A 4MW5A 3SLRA 5K8VA 1BVUA 1JJFA 2QLTA 1E3MA 4URZR 3X1ZA 4B3GA 4UNIA 4ZREA 1XOIA 2DEUA 1O95D 3CW9A 4Y2UA 1PRYA 5AVJA 1C4XA 5LP6C 5AVXA 1C3OA 4HH4A 4XX0A 1D7AA 1VLZA 5IM4A 3EYWA 3HUUA 2PNFA 2ZZKA 1J1UA 4MWSA 4MYUA 4ZQIA 2G77B 1QU3A 1PO7A 3G7UA 1DBIA 1PTJC 3ADOA 1B15A 1M7BA 1GRQA 2XEDA 2J33A 3EVDA 3U4IA 4MQ6A 5K01A 4PLHA 5HF9A 2FWPA 3T1OA 2FA9A 2VJOA 3EZ2A 5H3HA 2WSSA 2P6RA 4DSZA 3GVIA 2XAAA 4HRVA 2YINC 5FP0A 3AJ9A 2CE2X 2JIQA 4D3DA 3M6FA 2J6HA 2XMRA 4G0NA 4PIPA 1HDXA 3UMFA 2BP7B 3BRCA 4RESA 1GA1A 2NXJA 3K4PA 4Q3KA 4RQAA 3SN6A 2CVPA 5IC5A 1EKXA 1O57A 4CIXA 4DDHA 3IKTA 5EEGA 3H9EO 3QA9A 4G5SA 1WNTA 4YUAA 4N7BA 1QKJA 2J3DA 2BTEA 1JIUA 2GOYA 3M82A 3FIJA 1Z9BA 3NYIA 1F38A 1S2NA 3PLRA 4M88A 3E84A 5FBVB 1R8YA 1JG4A 5IM5A 2X76A 4FX5A 3GEHA 4XVRA 1T9KA 1V8ZA 2NZVG 2JZNA 2P65A 1F9EA 3J7TA 5I4CA 3LFUA 3TIGA 3T3DA 5CJJA 3GMDA 2Z6AA 2AQ8A 3G8AA 4RM3A 2G9RA 2YY5A 3T3MB 1P1BA 3FTPA 5FOXA 1ZNYA 4RDIA 3FOEC 4XEHA 1EGHA 4ME6A 4EF5A 4M1KA 1JHAA 1ZQ9A 4M55A 4ZJZA 4KK4A 4OGGA 2EFYA 2Z5LA 3WGJA 4P6VF 2FRXA 3NAQA 4DTCA 1CUIA 1U98A 2QMZA 3E2MA 1LD3A 1HC7A 2AXPA 5ALFA 3ESCA 4XLZA 2BEKA 3LUDA 1ISPA 4QNMA 4KRYA 1X6VA 2X77A 2QX4A 4RHXA 1EXVA 3BRWD 4YPFA 3O26A 3RFCA 3OJFA 1I36A 2WABA 4FOPA 3WLHA 4CMHA 2BFOA 1TCBA 3WYBA 3FPJA 1Z2EA 1ZBDA 5KJEA 3JQQA 4PEVA 1R12A 4WASA 1XTTA 4W5WA 4QXOA 4PRYA 1WMFA 3KJZA 3GUZA 3UJCA 3ZHRA 5KSOA 2DPMA 2O54A 1VYUA 4N3AA 1U0JA 3ADKA 3GDGA 1N6PA 3GCWA 2IUFA 3G2KA 3JPYA 4JOSA 2PA3A 4MQLA 4GSKA 13PKA 1H1DA 5FUXA 1DBQA 1T36A 3IIIA 1KI4A 3DDSA 4JHXA 5BQFA 1DC4A 4WWHA 1P0CA 3AOEC 5CB8A 4WN9A 4KR3A 1GOTA 3WHLA 2Q2VA 5EL0A 2AMVA 1Q1GA 3ADPA 4WY5A 4D9BA 3VR2A 1WZEA 3GNQA 2OBNA 3BWXA 3R0QA 3DTYA 4B40A 3VO8A 3L7AA 2YRXA 1A1VA 4S1OA 4JB8A 2BW0A 5F2OA 2FF7A 3L93A 4J8PA 4UTRA 2A6PA 2XD9A 4GWKA 3BFXA 1YDGA 3UFBA 3U62A 2C2XA 1VL6A 2PWPA 2HMSA 2PT6A 2DQZA 3DONA 2JA2A 2WU3A 3D5QA 1K6MA 3OG9A 2HO4A 5JI3E 2VSFA 1C1YA 4G01B 5KBYA 3WGLA 2E4XA 1PJSA 1GFWA 3OQJA 1A9YA 4QPDA 3KLPX 2H1VA 1TEXA 2DCUA 3G5UA 1Y3IA 3MOIA 4G25A 3E05A 4FFSA 4QUIA 4RVFA 5L3RA 3TAHA 5EGNA 4O4LA 4KBFA 1VL2A 3D4NA 3BB4A 3FWHA 4U7FA 2AZMA 4DBVO 2YY7A 3QFTA 3WGYA 3VMFA 4KXMA 4MPJA 3IR7A 1G2IA 2WSIA 1FSFA 4P1ZA 5ARBA 4YAUA 1OGIA 1PWYE 2Q1YA 3DBOB 3JPWA 2MYPA 4X7BA 5EP3A 4FWBA 1BCSA 2DJIA 3KHKA 2YXNA 3AJEA 2B4TO 3LXUX 3ZE1B 1BTOA 2HA5A 1ZJ5A 2Z4RA 4IIDA 2IWHA 5JH7B 1L8XA 1OWMA 1H8ED 1MRZA 2WJ4A 5BSEA 2XA1A 1XFAA 1C0KA 4Y9SA 3GRRA 5J58A 3O91A 3W6NA 1YQEA 1KU0A 2OHXA 1TYCA 4MQEB 4I5DA 3BQNB 4O08A 1LPBB 2G3YA 2O0MA 1P2GA 1JTVA 3LXMA 4DADA 3UPUA 1OXBB 3VC2A 3W6UA 1ENPA 3CTMA 3TL6A 4YRDA 2CFOA 1FFBA 5C8DA 1A69A 1VSTA 4IZHA 1ZVKA 1NYQA 4J3FA 3GMIA 1JWAB 2NPFA 3CMCO 5A5EA 2ORIA 4UFNA 1YR2A 3A3OA 2E6UX 1EAYA 3HCWA 2QVZX 5GAJA 5AOVA 1IZ8A 1YRLA 3MJHA 3PRHA 3SFTA 1C7RA 2OHJA 4BFVA 3MXTA 1RYDA 2QAGB 1S9HA 3ME5A 3WV4A 1Q95A 2HRDA 2UYCA 4EYKA 3SE0A 2R25B 5TPZD 2PUEA 3LF1A 3IHTA 3AH8A 1MABB 2B2XA 2BFAA 1QANA 4IEFB 3E1GA 1YFKA 3PFHA 4IVRA 4PYNA 1S4MA 1UM9A 2NU9B 2VG8A 2JHPA 2HQOA 3G89A 4KPUB 4MRAA 3KC2A 4NYIQ 1G6HA 1E3DA 2BI4A 4WV3A 1MTZA 4JI3B 2H2GA 3S1LA 5ITWA 1UEJA 2YWBA 3L43A 4QO7A 1K92A 2YWHA 3EVTA 3UMMA 4C7OB 4NDNE 2OOKA 4FMDF 4J6FA 3U37A 2X8JB 2IOHA 3LVBA 5IVIA 3GFFA 1T2VA 2FE1A 2R6DA 1QZUA 4MDHA 4TTVA 3U13A 2FK7A 2PGJA 1C2YA 1NX6A 2WMDA 3OU2A 4X1OA 5EWLA 2XTAA 1M0SA 1VKZA 2R85A 2BFDA 3V5NA 3D5TA 3L8ZA 2O3UA 4WY8A 3V4RA 4L7QA 1YNOA 4F5YA 4A26A 1E1KA 5HJ7A 4XQEA 3T94A 2HQRA 2QTAA 4B9AA 1FK8A 1TYZA 3IA2A 3LQFA 3PWSA 3RHTA 3GLQA 3TRDA 3JQ9C 4NFYA 5CW2A 4WESB 4B33A 5BMVF 5ARCA 1XKTA 1D1QA 3Q5EA 3HCBA 4G41A 4Y6PA 2GPNA 2ZKIA 1PL7A 4PG7A 2QE7D 3FFAA 2C2BA 2VDKB 3MLBA 2G80A 3MTQA 3PTLA 3WYGA 4AECA 4CMEC 4D79A 4V1CI 2OZVA 3A6PC 1NUAA 1ZD2P 3W5JA 4MIOA 3IURA 4XTRA 3UT5A 4X1YB 1RHJA 3JRNA 4CDMA 1E0AA 2D0IA 4X94A 1LSSA 2GNOA 3LL4A 4E2FA 4HFNA 1DEHA 3LTNC 3BMOB 3G5LA 5IJZA 4XASA 1EVLA 5DLYA 1PWHA 1X38A 4JU8A 3D54D 4MVXA 4PQGA 4UE3S 3FCSB 3W7AA 2BKXA 3LX5A 2Q3DA 3K30A 3NLLA 3TQCA 1JJIA 1TW3A 1VKOA 2C3OA 3ENKA 3KSDO 4LV8B 3A9VA 4PSDA 5FBLB 3TE7A 4ZCTA 5KYKA 2VQSA 2ZSFA 3D7KA 3K4HA 2NZWA 3ID6C 4ZAWA 3C70A 2DR3A 1XZLA 4TVBA 3LBNA 2OPBA 5DYGA 3BA1A 3U81A 5K3OA 1UFQA 1VYHA 2OCIA 2VH1A 3LE8A 1JFFB 1XEWX 2W93A 3O94A 4LY0A 2F62A 3B8EA 5E2AA 3KHTA 4GYWA 3V1MA 2W2KB 1PKEA 2D7DA 1Z4OA 4NS1A 4FWTA 1LPSA 5BSFA 1B0ZA 1CCWA 2Q6OA 4UPEA 2JGDA 1XQYA 3GFOA 2DB3A 3T4XA 2NZ2A 1MW8X 5DO9A 3I52A 1V1RB 2XWBF 4ZDWA 1W76A 1R18A 4G5XA 3VU9B 3OKPA 4EI9A 2CMDA 1W0JA 1R6UA 1Y1TA 4KQIA 1O87A 1XU4A 3HBFA 2WNSA 1TVKB 1UK8A 1RU3A 3R4CA 2WSBA 3CT4A 1QRDA 1YCGA 2BFMA 4ARAA 2RHDA 3MEQA 1DC8A 5GP1A 4QFCA 2HD4A 2FUG6 5K0NA 4NCJA 1YVDA 4R4JA 4FD2A 1ZN8A 3K9HA 3A1FA 2PRYA 3GLVA 1ADGA 1LJLA 1DTWB 2I2XB 4QJ5A 3K8YA 3O8CA 3UBTA 4RD3A 2H2FA 2VYVD 4XGKA 1Y1RA 5JO9A 1V6SA 5C3MA 1LGYA 2OT3B 2Q4DA 2VQ3A 5TS3A 3S99A 3W0LB 1QCZA 2BTQB 3QWHA 1BFUA 4QIHA 2AJ8A 2P9FA 5C1IA 5ED4A 4AP5A 2ERCA 2VBCA 3I9MA 4IKPA 4PTLA 3HN6A 1HFEL 4R1SA 3RVSA 2BCJQ 2X5JO 4IVNA 1V8DA 4DHEA 1I7DA 1BDJA 3DBIA 3SYNA 2V9CA 2XMBA 4GW3A 2HJ9A 4LYHA 3ZJ5A 1UBLS 4EL0A 5JS6A 1LB1B 2YW9A 1G8HA 1T1EA 5EJIA 3TZLA 4EFNA 5BW6B 3ZVKA 3VTZA 4CKXA 1Q6ZA 5IEBA 4BE9A 6CHYA 1T0UA 2GZ2A 1V16A 5LKRA 1UMCA 4PQYA 3WTCA 4NHEA 3DV0B 1KOGA 1JI0A 3FD8A 4NXMB 1CJVC 1CQIA 1GG5A 1RC0A 4EDHA 3KLOA 2GCNA 1AKRA 1FDTA 1YRBA 1DJPA 2F43B 3NV7A 3D7RA 3PDCA 1E2BA 3V2UA 4MEAA 4ALLA 4DEVA 4YCBA 2I55A 5THXA 2ZUEA 3PF9A 5K4AA 2HTEA 1C30A 3LHKA 4U7TB 3ZDCA 4TTPA 1ZW1A 2C2GA 1MQ9A 3DCJA 4KDEA 4TZKA 5G4KA 1LW6E 3KD2A 4YRTA 3WRXA 2GDJA 2YCBA 2XOXA 1T2EA 2JCXA 3FUXA 4YFYA 2XCLA 3A6GA 5JT1A 1L7VC 1JDVA 1RAIA 2ZYSA 3HU1A 1A9QA 3K1ZA 4YRPA 3UN1A 5TPWB 2JAXA 3ZTYA 1W96A 1X3SA 3BMOA 1H4SA 1T1JA 1VC2A 1KVUA 3MWDA 4Q9HA 1G4HA 4MROA 1ISRA 2QTWB 1GNQA 3ILHA 3OTQA 4UARA 1AS2A 3P2YA 4KOAA 4V0ME 3WNBA 4B17A 3THYB 4NR0A 3CQ9A 5TMDA 3WK9A 1I3LA 5DXJA 4ASUA 1KTIA 3T3NA 1N34B 3WWEA 3FCCA 2Z08A 4C6HA 4ZQCB 1QTQA 3KWMA 3DV0A 3O2NA 1NA5A 5LA6F 2B1JA 4CQMB 4C0WA 3HJCA 1Y8ZA 2ACVA 3W34A 1HOTA 1PJLA 4L4SA 2EFHB 3QEKA 1A4RA 5FQOA 2P5TB 3DLIA 3S1SA 3ULKA 1ZY2A 1JT9A 4CU5A 4H3KB 3K72B 5AVZA 1E6EA 3ROKA 1OXKB 1ZHHA 1JLLB 2LNDA 1E2FA 2NG1A 3GYBA 2KLHA 4IFIA 1F4PA 4ACBA 4GXNA 4RTJA 1XF1A 2G1PA 5HM8A 4RK6A 1F7UA 1G7SA 2H31A 5JFGA 2FPIA 2BZ1A 4YP1A 1OKKA 4JGBA 3F6YA 4EY3A 4JLAA 1TJ5A 1ESDA 3PD1A 4X3OA 1E77A 4MYCA 1WX1A 2Q1UA 2QPAA 3AGPA 3CR7A 4LG1A 1AZSC 3GD7A 2MINB 3K96A 1S8AA 4ZOLB 3U60B 4RTLA 2ADOA 1ACJA 3WFZA 3C1AA 1FXWA 1RJ9B 4CMKA 2J9YB 5E6SA 1E3LA 3SBXA 1UXIA 3K9QO 3QSGA 3IVXA 4AYWA 1PQUA 3T1QA 1A9OA 1KP2A 2XVZA 3ENWA 1KQOA 3HKBA 1CUFA 1YRWA 4BQIA 2W6IA 3GAMA 1HX7A 1UC9A 3K1JA 5HFJA 1WZCA 1YZYA 3BQ9A 2BFEA 2H11A 3H7IA 3KDSE 4D9EA 4JNCA 5AK0A 1NRIA 3ENNA 3OTHA 4C7XA 2ZRLA 4P32A 3KPUA 1EDEA 1NMZA 4MVJE 3DCIA 1JR3D 3QKRB 2PLAA 4P7JA 3HU2A 4GP6A 1QUFA 2O5VA 4KR9A 5L7YA 2CZGA 5BSTA 3TMYA 2HX1A 4Z9XA 4CCYA 1RJEA 4K0KB 3Q2KA 3MJEA 5GZ3A 2D2EA 4QYSA 5JSZB 1M1UA 1VMAA 1UZUA 2OCPA 4LHVA 1NKVA 4IO0A 3DHNA 4RF5A 1N2SA 1NUUA 3E7WA 3JQFC 1L5KA 3WLOA 5CG2A 3QOYA 1H0KA 2IEDA 4NRDA 1D2HA 4D44A 5EWMA 1ZRNA 2QG6A 4H1UA 2O19A 3L6CA 1P0PA 3MCUA 2DG2A 2HDNB 5EINA 2XT9A 2L17A 2ZTVA 2QT0A 4N8SA 4KPFC 1SWWA 5A2GA 2ODEA 5TQ0B 2O5EA 1YJ8A 5A6SA 2Z04A 1USKA 3PF8A 4IVQA 4WXRA 1F3LA 4M7OA 4YMWA 1CR1A 2BSXA 5AI6A 4COKA 4ETNA 4TRJA 1N2CE 5KWEA 3AJRA 4F0JA 5AJXA 2KHZA 3M6AA 3JQGA 4E5DA 4RHFA 1O7JA 4S1NA 5BMVB 2J87A 2Z95A 3TW6A 1TDJA 1N9GA 2RGWA 3IPXA 2G08A 3K32A 4K03A 3EEYA 2VRCD 2Z3ZA 1MX9A 4I3FA 2DT8A 4KNVA 4ZO6A 3T5MA 3WKBA 1AX9A 3CX6A 3PJEA 2X4IA 2Z2YA 4LZPA 3BFVA 3WO0A 4DEXA 5BY2A 4GYKA 1XZEA 4Q0MA 2ONKA 4UNQA 3O4RA 4HVAA 4R2KA 3GN1A 4NYJQ 1A8PA 5FDFA 1KAOA 4IMIB 4N6OA 4ZOBA 3CCCA 3QI2A 4P2GA 4UBNA 1F51E 2PGIA 1MIOA 1QHXA 1F1BA 2RHRA 4B3RB 3CONA 1KEPA 1IZ0A 1MXHA 3AG5A 5ERGB 4C9BA 2BONA 1BXZA 1OX5A 4FFWA 4L72A 2YWFA 3IO5A 1NBEA 3RF7A 1FDUA 1TTQB 4JLPA 2DHQA 4RLHA 1R4NB 5JBIA 1RPTA 5EJ9A 1QS0A 1GTJ1 4ZVOA 1C3EA 2OCXA 2QZPA 4N0PA 2I7TA 3IUJA 4RETA 5H59A 1L1EA 4FC7A 4INAA 4NYMQ 1TMGE 5DX8A 4EW1A 5I5GA 4H3HB 1M8GA 2DH6A 2GRUA 3ZN2A 4D2IA 1H2WA 4TROA 2P5UA 3HZOA 4WOPA 4DKXA 2Z6QA 3GCDA 1A82A 2PQMA 5JE8A 5EKUA 1WXXA 1LDMA 3DTVB 5F33A 3G1TA 3OJEA 2E55A 4JC5A 3ZWCA 1OTYA 3OUTA 5AHKA 4WW0A 4P8RA 3TUIC 1BIFA 1TU0A 5AJWA 4C7BA 2IVFA 1ZCBA 1CP2A 4WBXC 2IPXA 2I4OA 2GRAA 1GGNA 4GOOD 4EBBA 1CR6A 2QRKA 4NAUA 2G28A 2RKBA 1BZYA 3AF3A 4HRXA 4TMWA 1L2TA 4EB6B 1G5HA 4HDAA 3GFGA 4NU6A 1RZRA 3DA8A 1TJPB 2J4FA 2CWDA 2C20A 1XX6A 4R8RA 4J6EA 5BQPA 3UANA 4B4OA 5CFZA 1Z0ZA 3MWEA 3G9ZA 1E7MA 4RL4A 4XUDA 2JH3A 3H0KA 3FDZA 3MS7A 2EIXA 4EG1A 2P62A 2X0JA 4ICIA 5LMUB 4HQKA 3DFFA 1QJCA 2ERYA 4NNPA 3L5OA 4BECA 4ZAGA 2X23A 4B0OA 3GUYA 4GKVA 1D03A 4V24A 5K0LA 3C24A 2O9JA 3DP9A 4RV5A 3SSMA 1NJFA 3PT5A 4QE3A 4RK7A 3UAOA 1P45A 2QL9A 3V4PB 3W1EA 3AFMA 3TOVA 5CX1B 2V7PA 3WG9A 2XCRB 4DLWA 4M9CA 3QPVA 1PV2A 1ACLA 2WJZB 4Q9NA 1AQJA 2D5CA 1U6KA 3T3GA 1M6WA 1B0PA 1SHTX 4TT3D 3U7HB 5JSUA 2RAUA 4CW7A 4BV8A 2ZJ3A 4RADA 5ICSA 3Q7RA 9GPBA 1KZGB 2V5VA 3PA8A 4HDKB 4LSZA 1F2TB 1P77A 1ZC4A 2QU8A 2JG3A 2OCYC 1EU1A 1F2VA 2EZUA 1XQXA 1JEJA 2C2ZA 4QASA 1YCHA 2XKAA 3OBBA 2AWNA 4DDWA 4B82A 1Q0QA 3BD6A 1R0LA 1MXFA 5HMMA 1V7PC 3PSAA 2GA9A 4EPYA 1I1OA 1QH1B 1N3BA 2A9QA 1N6HA 1PHRA 1XRNA 4REOA 1EP3B 2EJBA 4M9ZA 1FLNA 4HVCA 3C3DA 4P53A 4X66B 3LKZA 3HCEA 3U61B 3R75A 1XTRA 4R1PA 1XPJA 3RS3A 1LRLA 2HU5A 2DTEA 2Q9AA 4LRSB 3ZE7A 3S81A 1J22A 4JI4B 3D4OA 5JALA 5T5QA 1V8PA 4CMGA 1VJ5A 1TL7C 2PYZA 3UM9A 4QUHA 4B7UA 2QAJA 2IHKA 3VOBA 4GX2A 1US8A 3GLHE 4MGYR 3FMPB 4FHZA 1XLUA 4JY7A 3HYLA 3OQVA 3R23A 4IFBA 1NVMB 2BSAA 4DCJA 1DWOA 3EAQA 4UOEA 3WRWA 1D8TA 1J21A 1UOQA 1SZPA 4TL8A 1G66A 3FUTA 1PSDA 4RK0A 3ZEIA 1DOAA 1KQFA 1B3RA 5KJ1A 2VTBB 5ITSA 4IGKA 4P4TA 3IX7A 3OOWA 3WHIA 3O6VA 1TTTA 4TTAA 2GD6A 1RIFA 1GZVA 3EEIA 2YWJA 4GWLA 3AB8A 3DEZA 3QX8A 4CCAA 4B2LA 5HQ3B 1XDWA 1RQ7A 4L0CA 5LA6A 4B2IA 1PF7E 3WAGA 1KPHA 1XU9A 3V1UA 2A1UA 1XIVA 3WB1A 4DQ0A 2R5NA 1NJ2A 1USUA 1QB7A 3JY6A 4Q3NA 1I0ZA 1KI3A 2Q5HA 1U81A 1VDMA 4O8CA 5CT9A 1CUBA 2JIZD 5DPMA 2OXCA 3S2EA 2DPYA 1QDLB 2I4IA 4FJ0A 4JEMA 1C7QA 1Q11A 2C4VA 3WFIA 2V7TA 3CLTD 3JZAA 1BMTA 2ATXA 3BD7A 3NDIA 3P5BA 4Z8YA 1PZMA 4V0KA 1IDN1 5EIEA 2AE2A 4LZJA 3T8YA 1QHNA 4QUKA 4LUCA 3W9BA 1ID1A 3KWLA 2JASA 3PP8A 3RAGA 2O8DB 1NDQA 5AH0A 3O3NB 1CZRA 1T5BA 1T9AA 2YV5A 3CRRA 3QHQA 3WIEA 4XWTA 2JFPA 3CZQA 1T35A 3RJTA 1XE3A 1N8SA 1USVA 3HQ4O 4HCJA 3DMDA 2F3UA 3WYNA 3HYTA 3COPA 4QVIA 1Z6YA 2JAPA 4O2AB 1CUGA 4CL8A 3K70C 4L6AA 1U5BB 1SHJA 3WY9A 4DRZA 1B8UA 3FRHA 3TW8A 4DIOA 4I1UA 1KGDA 3EULA 3ZHSA 1WMEA 4HGOA 4BU0A 2CUKA 3AVVA 4CIDA 1KWKA 2ZSKA 5JAUA 2PV7A 2VQFB 1MBZA 3OFVA 2BDEA 4IS3A 4KNWA 3VOTA 1GAXA 1DTSA 4KI7A 1KRHA 2PSDA 1VKRA 2QTLA 2HLDD 1PS9A 4L9AA 3QU4A 1IBKB 1ESEA 1ZC3A 4FCWA 4Z7JA 4RZXA 4JODA 4ZRMA 5E6UA 4C07A 4GOJA 1DLJA 1U1IA 4IO1A 2HDHA 4ITRC 2R44A 1CF9A 4LV5B 1W0KD 1RQRA 3GLIE 3KT6A 1QUEA 3BT7A 2VDRB 3Q6MA 4TYYA 1HDRA 2WF7A 3CR8A 4A92A 3WYCA 2VHUA 4GBMA 1CNMA 1MC1A 4S1TA 4WLUA 4MS1A 1HMYA 1MKYA 1BD4A 3LUJA 4EJ2A 1RHUA 2HSZA 4TZ6A 4G0WA 1YR1A 4Y6OA 3ZWVA 5FRDA 3DWGA 4TKUA 4U7PB 5M5BA 3PXXA 1LDEA 1GSAA 5KSWB 4L07A 4PZCA 7REQA 1BD3A 2RI1A 4OY3A 5F1KA 4FBMA 3KM0A 4FQ8A 2IVZA 4IDNA 1FVHA 5DHSA 5AW9A 4V0LA 1T5HX 4CE6A 4AB1A 5KSYA 1W36C 4HQNA 3HY6A 2IU0A 2GXAA 3LW8A 1A8HA 1NW6A 3GL9A 5BN4B 3TK1A 4AG6A 4J7AA 2NYAA 4HTAA 2CXQA 4KWHA 1EM6A 4WKGA 2ID9A 4WOBA 4AX4A 3EDRA 3G1UA 3EUAA 3H84A 3HDYA 4Z0HO 2BELA 1CG6A 1Z29A 5D84A 4IHJF 1IM2A 1V26A 1XN1A 1WV0A 3H5AA 3WI7A 4KGXA 2VDMB 2FMIA 3AUUA 1NU6A 3I8OA 4P54A 4UPVA 3UUGA 1RLJA 4KFCA 1M1YE 4OP1A 1QP8A 1HE2A 3MWFA 1QHEA 1IXKA 1J2UA 2KBEA 3KAJA 3M4YA 4KQHA 3ER9A 3V2IA 3KQUA 1NBME 4NYJR 3RSFA 1ZXXA 1XAIA 1Y81A 2IDKA 5C46F 4KR6A 5DXFA 4DVGA 2CNWD 1FTQA 1Z62A 1A4IA 2VPWA 3QVJA 1FDWA 2BGKA 3F71A 4EW2A 1ZN2A 4FDVA 2EBFX 1BGVA 1Q0UA 1VL0A 3Q4GA 3OPMA 2G5TA 2I6FA 4C1BA 1M1ZA 1MG0A 2JGKA 3T9EA 4CFYA 1JG7A 3NGMA 5A3JA 1DKUA 3BSFA 1XMIA 3P9NA 1ZWLA 4BNKA 3IQXA 5FBWB 4R2XA 3P9SA 4OLJA 4PS0A 5MHTA 1BDMA 1GR1A 1BEEA 3KK0A 3PSHA 3KCQA 3MWGA 2J6CA 4HUJA 1T8PA 1XQVA 3GLGB 3DXFA 1XMQB 1XPRA 3PUIA 3C98A 4RIHA 3SNKA 3THRA 4LWZA 2JI7A 3JSXA 1L5GB 3L4EA 2OFFA 3DH0A 1LZKA 4YXWA 5AI9A 3SK0A 4BP1A 1I30A 3IO3A 4GLOA 1R5NA 2VJNA 3K09A 4ZOAA 1BQ4A 4IM7A 4WXHA 1Z82A 1PR4A 3UV3A 3TDKA 2GPAA 2B3TA 3PC8A 1BE1A 4KBYA 4C4ZA 3B5JA 3VU1A 4DJTA 2V6GA 1FP4B 1V37A 1ZZGA 3ADCA 3I61A 2WAOA 3MRSA 5EMNA 5LQRA 3EASA 5F2EA 3V2HA 1Y6RA 4M7RA 2EF1A 2YS7A 3EGXB 5F98A 4XIFA 1LH0A 2HI0A 5KNBH 4RKQA 1S2GA 2VJYA 2XE8A 2PX6A 5J3JA 4A0RA 4MV4A 5FI0B 3QXCA 4BMNA 3V97A 2EHJA 1OH5A 3N6XA 2GT1A 3R7DA 4NXNB 2HEIA 2I0FA 1TFUA 4YFVA 3I1YA 4MWDA 5JISA 1XO1A 2QX8A 3GB9A 3GJZA 1NM5A 4PNPA 1A76A 1X9IA 1MD9A 3ZX4A 3IAS6 5JBQA 5T4BA 1W34A 3AHFA 3KUUA 3QF7A 3SNHA 3VH3A 4BN5A 3S1AB 4PIVA 3ANLA 4JR1A 4BX0A 3KYDB 3WKEA 1GR0A 3RTCA 3RAJA 1AV6A 3VYUB 2QR5A 5C4GB 2GMWA 4G8JA 2CW5A 1ST2A 3TXAA 5EIBD 2IS1A 1JDBC 3FJ1A 3WB0A 4EHJA 2AHOA 3CS3A 2HWXA 2OM6A 4NZYA 1Q2UA 4DWWA 3N2KB 2R1TA 2I9PA 1KJ9A 2FZKA 4YEDA 2GETA 1DQYA 4D82A 3HA5A 1GPMA 1BYUA 1T9ZA 2P67A 3JQ9A 4TZ0A 3Q8WA 3R5SA 5KC9A 1SCKA 1WY5A 2C2YA 2VHYA 4FT2A 1Y9EA 2FOIA 3BZUA 4M1EA 2I22A 4U2CA 2H29A 5F52A 2VHWA 2QAIA 3I6ZA 1FVOA 1KKMA 3AR8A 3D0QA 3P2KA 3PNBA 1L4FA 1YR3A 2WIBA 3G2OA 1W4CA 1A2BA 1XCPA 3LCRA 3MT0A 4Z7QB 3ER6A 2ZOSA 4G9GA 5TGDA 1UFVA 1SVUA 1T5DX 1ZMOA 2XKBA 3LT4A 3EXEA 5C52B 2O1XA 3WO1A 1BDIA 3NPMA 4KL8S 2IE0A 4RCYA 1PS0A 1ZK0A 4LSGA 1BHQ1 3W5VA 4YRMA 5TQ0A 3VAZA 4ZCMA 2I3DA 2PUAA 1CR4A 4R3UC 1MX1A 4RK1A 3LY9A 3O8LA 2IL1A 4XGNA 4ZVQA 4S1WA 5BUCA 2C8KA 4CF7A 3CNBA 4YXWD 2QP9X 5I9TA 3U17A 2PSJA 4V3BA 4FZJA 2YMMA 3PUHA 4FWIB 1JA1A 3EHDA 3SWWA 1IN8A 2FXIA 4RM2A 4M0KA 2DHEA 2FEWB 2LZ0A 1SXJD 4YMSA 4G26A 4QM7A 1KVSA 1WHTB 3ER8A 5CMLA 5EOVA 1F14A 1T2NA 2NMVA 4D46A 4M8KA 1TT5A 2HMUA 3TLCA 3B9QA 2JDID 1JLSA 1ZOIA 3E9MA 1JU3A 2ZIAA 5BNIA 3ORHA 2JIZA 1UCFA 1K27A 1FVFA 1XEFA 3HHPA 4B3FX 1W5TA 2P79A 2IV7A 1RZ3A 2AQHA 4JASB 3TSCA 4INOA 5AQ1A 2QRPA 2ZJ2A 2OO5C 3EVEA 4QYMA 4UCQA 4XIYA 3U40A 5EE0A 2GF9A 1UDWA 3WQRA 1G0OA 1TJYA 1XVUA 3LPDA 4MQ5A 4NE9A 3T0FA 2R2GA 1NN0A 2DWPA 3QXSA 1WB6A 4I3GA 4S24A 3WK7A 1M1XB 4DCCA 1TZMA 4NDAA 3A36A 1DWQA 3BBLA 1QB8A 5TARA 1A2KC 1CJBA 2Q6KA 2WJYA 3K20A 2EATA 3ZYZA 3HA3A 4O4IA 5BV7A 2ZI3A 5GVSA 4F5DA 3FOFC 4POAA 2CXPA 2BD0A 3G9QA 3HBMA 3IAHA 1IVNA 5L3SB 3OZDA 4OLAA 2EQ5A 3LUKA 3H3XA 2XNDA 3EARA 4FSHA 4I4IA 3CF6R 3D59A 4YJFA 5K8JB 3TD2A 4BVEA 4B85A 1N1GA 1QC5A 4FPXA 3GCZA 5BN5A 1VYVA 4PXYA 2JGMA 4HFMA 4V3CA 5JJCA 1SH7A 2PH3A 2VTVA 4IFTA 4XA8A 3ZU2A 1CZLA 3K9CA 4AMYA 4BAUA 5IK2D 1XCOA 4YGXB 5B55A 2PWAA 4FJ1A 2Q5IA 4CWAA 3QLJA 4EPVA 5EHZA 1E1RA 3AR9A 3M49A 7MHTA 1Z2NX 3DO8A 4JZYA 3JALB 3SC3A 4Y6SA 5JNSA 2PFKA 3PHHA 2F3QA 4EI2A 4IIHA 2IP2A 1T2UA 2BKUA 1SFRA 3WISA 2PGOA 2DLNA 1JDZA 2I6QA 3E81A 5HZGA 2FPSA 3CVOA 2XHZA 1UR5A 1ZW6A 1T4BA 2FSGA 3E9YA 4GG1A 4DARA 2H7YA 5I8PA 3SOPA 2JK1A 3IQFA 3NBMA 1DCMA 3NDPA 2NVOA 1V7QA 4J49A 2EP7A 4IYRA 3AEUA 4ZV7A 1FRVA 2SICE 3LHFA 1VGRA 4Z7OB 3WLRA 3PVSA 1HDYA 5C5EA 4YJFB 3A9WA 3D6MA 3OA2A 3AI7A 4RJLA 2ZDQA 3L7YA 3IC5A 4N9WA 4ACAA 1BMFA 2YJ6A 3ROTA 4ID3A 2VAWA 4Q4DA 4X44A 1MB2A 5AJTA 4F4HA 4CUJA 3WFJA 3ZHZA 5JPCA 1G5TA 3O8QB 1LU9A 2XXBA 1ZPDA 2PWZA 5FI3A 3DOUA 5C51B 3W4JA 4BZQA 2HSJA 1ZGAA 4Q1BA 1IY1A 4GQAA 2QQGA 1E63A 4L76A 5CD1A 2XRZA 2HUNA 3DG9A 4L3WA 1OSNA 4P33A 3CT6A 5F9HA 4XXHA 3F8TA 2BZ0A 2NAPA 4MHTA 4B3JA 4CIAA 2X58A 3DFKA 5JWOA 4I5FA 2FZLA 3FGZA 4YLGA 3TZEA 4W5TA 3WGTA 1XCLA 2PKEA 3AW9A 5FIUA 2GD1O 2E87A 3DMHA 2NM0A 5IABA 4QG3A 1KYZA 1TC1A 2D7CA 4AM8A 2J85A 1QV7A 3IFSA 2FR1A 3PX2A 1A7AA 2F43A 4TUYB 1VB5A 4K9NA 1WIWA 5KX5B 2E89A 1DZIA 1EM8A 1XP8A 3KQWA 1KO8A 3T5TA 1B23P 3ESQA 3DO5A 4MIKA 3PUWA 5KIAA 5LIPA 2D13A 3TN7A 5EJ8A 3D3QA 1W9MA 4MRRA 2BAGA 2PX2A 2RBKA 2VP3A 2ZYHA 4A0GA 5CFPA 3KJQA 2J9XB 2ICAA 2WV7A 3H5NA 2OD9A 3AK4A 4OX9Y 4HYYA 4J7XA 2QW8A 4H15A 4PV7A 3GDOA 3TZKA 2BMEA 4F3RA 1ML3A 3IP5A 5GIPE 5CT4A 3BGOS 4FB5A 2WYIA 4WZAE 5CX4A 4HDNB 3L77A 1B0UA 2AFHB 1JFVA 2J3LA 4Q3DA 4YN3A 1TQ6A 4YBZA 1AA9A 4MLZA 2GHQA 1Z4KA 1G1MA 1N3LA 1WD7A 4QDUA 2GN1A 1NX9A 4GDMA 1LX6A 1DT5A 4Y9UA 2WVHA 5HKKD 2PVPA 1AXRA 3A4LA 2Z6VA 3OWOA 5CGQB 5A4AA 2FPLA 1U5CA 3FWKA 3K71B 3DOJA 1WVGA 1M6NA 1A98A 5CLGA 3JVVA 4JITA 4YH1A 3ZY6A 2OY0A 2H9IA 2C99A 2A3RA 2JJQA 3KJXA 1KZYC 4OHMA 1C0IA 2D8MA 1WVIA 3MWJA 5DX0A 5GM1A 4NWIA 1M9NA 4DCUA 2Q7DA 4I55B 2XUHA 3HYSA 2X41A 3JQBA 4I8DA 2Q9BA 2WIJA 2PSFA 1QHSA 4UD2A 1NQWA 1P5FA 1TUIA 4YNBA 1V5IA 2AB0A 2IH5A 1T4CB 4WBNA 5AK4A 4QRDA 4BJ5A 2BC9A 3NHJA 1NG1A 3UMSA 2VR1A 2RFLA 3H1BA 5D6NA 4WK0B 4BRSA 4Z3OA 1HA3A 3LQYA 1CEYA 3K70B 5M34A 2VPQA 5EMKA 4IEIA 1JYSA 1WCIA 1H4QA 4ENTA 2ZYDA 1I2AA 3Q88A 2Y9PB 3RSSA 3Q2OA 3UXMA 1ECLA 1S3SA 1QNFA 1U7WA 3ILVA 1OFUX 1UK7A 3LNCA 3ZJYA 5HZKA 2OV2A 5FB3A 5TEVA 3F6CA 3HCAA 1LPMA 3HA7A 4L2IB 4H59A 1E4YA 5TE9A 1L4LA 1CUUA 4CJXA 3OE4A 3TLJA 4LXGA 3IP7A 3R24A 3OX2A 1G16A 1BVYF 4H0FA 1VHJA 4HEHA 2V1UA 3UA4A 3T5BA 3W4IA 4ESEA 4TQAA 2CL6X 1YOBA 3BIXA 2D5LA 2ZPUA 3I2FA 4HWPA 2HV9A 3PDIA 4L5AA 3RLFA 3W8NA 1PX2A 3ICVA 2XMDA 4P08A 3UWOA 4RK5A 4AL4A 5A3SA 2FUEA 1JYEA 1LDBA 1KHHA 2Q0HA 3M9LA 4MGEA 1M6EX 1ANKA 1JDSA 1R4MA 4N18A 1N5JA 4HBGA 1BHJA 3V7NA 2OD2A 4JEUA 4PYLA 1D9XA 5EIWA 4XJSA 4D3YA 4E5MA 1QG6A 1H5UA 3C43A 5IM4F 1UANA 1NZDA 5JCJA 3V2GA 2QNRA 2PANA 3VRHA 4OQPA 2Y0PA 5CXUA 4ND6A 4UHKA 3L9XA 1JA0A 2Z1DA 4HLQB 4FR5A 1YS2X 2HY7A 2WD9A 4M87A 1WMDA 1SCUB 3JARA 4KQGA 4ZXPA 1XRJA 5HP4A 1XTIA 3BXOA 1KY4A 4CG0A 1JNYA 1N9GB 1B74A 3H4VA 3NYQA 3PU6A 4AW9A 1IHDA 4FX2A 1J2JA 3UO8B 3N5KA 1YB7A 1IWPB 3GEIA 3QITA 1RWNA 3TQSA 4B3XA 3PQ4A 2PMDA 3R74A 3HL0A 3U16A 2XOEA 1MF7A 4KW7A 1IQRA 2G9NA 1M1NB 3JQ7B 1CUEA 2Y4OA 3T5DA 1OVGA 5JDIA 1UXJA 3PEFA 4NBRA 1Q1NA 5EJ4A 5LDDC 1IWOA 3I58A 1LSJA 1V8FA 4NZNA 4OOEA 1N6OA 1VLMA 2C5GA 2A2ZA 1E99A 1FFCA 1RYMA 2JATA 3AW8A 4IV8A 1QH8A 4R05A 3W1WA 3ES9A 3P4YA 3A4TA 3GQBA 3EFHA 4HMPA 3V1TC 1SB8A 4WXMA 1KSJA 1QDUA 1JQ5A 4KMSA 3OQNA 4YJ3F 2HZBA 3S2SA 2Q3BA 1BGWA 3M7IA 4EJSA 5EHXA 3D4PA 3EGWA 3R5JA 4MDFA 4FYXA 5L3QB 3RIXA 1BA2A 4NAHA 3TWOA 3BGDA 4KFSA 4B74A 5JRJA 3VDXA 1BXGB 2OHHA 4EOGA 5D3MA 2HA3A 3KU1A 2O6LA 3BL8A 1CRWG 1TZJA 2AF4C 3LHDA 4BLUA 1PNVA 1JEEA 2XR1A 2P9BA 3GEPA 5ADWA 2G09A 1U80A 1M3SA 1L9KA 1VB3A 1KK0A 2PUVA 4WDRA 5K3EA 1YU9A 1EK5A 3LC2O 3U4CA 5FOVA 4YR9A 2C92A 4RZUA 3MTAA 5T3UA 3KALA 4E22A 1NF3A 4PGMA 1F12A 2PBZA 2WHRA 1IOWA 2BFEB 3ELWA 4FGKA 4EJSC 5LP6F 4XVHA 2G04A 1K75A 3U49A 3E3LA 1B14A 1QHHA 3CINA 2FX5A 1VQ1A 2XYQA 4FKZA 4Q9IA 3LU1A 3ESZA 1TCVA 3SDZA 5DCLA 2GLUA 4MUHA 1YMVA 5EQFA 4C08A 1RM0A 3VPXA 4OQDA 3ICEA 3HKDA 1E9FA 2SCUA 5AVKA 5JYDA 5IJ0A 1D5CA 1F3OA 2A14A 1FPQA 1V11B 2CB9A 4B31A 1G9SA 3ZE2B 1RZUA 4MV6A 3UH0A 3D64A 3V7WA 3WK6A 4LNHA 1Z39A 3G2PA 4HV4A 1L4YA 1DIRA 2FLKA 4K9PA 3W7BA 1GG2A 1PD0A 1UPUA 2JIDA 2Q8QA 4ZO9A 3NONA 3B13B 4CLHA 4GR4A 2ZDGA 4Q24A 4B3DA 1TPYA 1XTZA 1LLDA 4PCVA 1JLRA 1QF7A 2VQEB 1BCRB 3WKAA 1ISIA 4JBXA 2XSZA 2R3SA 4NNJA 4K6GA 3LH5A 3B1VA 4RKEA 3EXHA 3RU3A 1AIPA 1OXVA 1XB2A 3AIIA 4EHNA 1ZUD1 4DJDC 1SCUA 1G21E 2H00A 2PMKA 4TYWA 2PMWB 3HPRA 4LYYA 1XQ1A 2FRDC 5G40A 3EIXA 1MFPA 4Q3EA 3MLAA 4AN1A 2HNKA 4HPJB 3PL5A 3AESA 4KJZA 3PTZA 5JS7A 2ZIGA 2BVNA 2NTEA 2IEYA 1FTNA 2A9FA 4AO6A 1V48A 1YZ3A 4AXBA 1U2TA 1Q0PA 1X1QA 4UHCA 5CFMA 4F71A 3JZIA 2O8EA 2PRJA 2CJPA 3CE6A 4X8HA 3AMVA 2ZS7A 5ECWA 3PC3A 1GGKA 2RH9B 5AO9A 2ZPAA 1EJ6A 5H82A 1NQUA 2QG4A 4DQLA 3RUPA 1HG1A 2ODNA 2ZVDA 1W88A 2AW5A 2UYOA 3E9CA 5EY5B 1EI9A 2XB9A 2P2DA 4G37A 4IWNA 1NYLA 4P4SA 4I66A 3KAPA 4MQFA 2OC4A 4GUDA 4TS1A 2JFVA 2HF7A 3KKPA 3NTLA 4XWAA 2GTPA 4B5LA 4ENUA 2JFUA 1P0FA 1DHRA 1TD9A 3IP3A 2AN1A 1ISJA 2WUEA 5JD4A 1E6LA 5HWSA 4EG3A 4ZQFA 2V98A 4H7FA 2DWCA 1UKYA 2X8BA 1M34B 1U1CA 3E5NA 1P5HA 4M0EA 1WPXA 1GU0A 5ALOA 1NFQA 1TYAE 2FOLA 3SVLA 2G1UA 3D7SA 1GNLA 1BE8A 2I1VB 2X86A 2ZSUA 1OMOA 3HV0A 3I9V1 4FOLA 4OHCA 4BFTA 2HWKA 4BX3A 3T1YB 2ZWMA 3I9FA 5CFOA 2MMGA 3BSSA 1L4HA 4HAOA 2IKQA 3IR5A 4FNMA 3KYCB 3KT8A 5LQNA 1PR9A 3TXXA 3EXG2 4JKYA 1ZVJA 1HFKA 2Q45A 4D26A 1CT9A 4NK4A 1FRFS 1K3UB 1TRHA 2UVPB 3QZUA 4X41A 1PK7A 5ECDA 5NLLA 5SZKB 5C5DA 1XMOB 1M5RA 4LXHA 3HM9A 4JBGA 2CDRA 1MOSA 4ZPXA 1X7HA 2ONJA 1L5MA 1T1GA 3I6MA 4CKBA 4DIUA 4FS8A 5A9SB 1DJMA 4ZFNA 5KWIA 3KZNA 4DGQA 3ESDA 2EZ8A 3N75A 4FGZA 2Q7OE 4F6RA 2VJBA 1DEKA 1JB9A 4H6WA 1RE0A 2VLBA 3E5HA 1E9EA 2GGSA 2NSJA 2HA2A 1G6OA 2PCJA 2ZAYA 4Y2XA 4KRFA 3PQDA 5A7HA 1QG4A 3GRUA 5FV4A 3KEMA 1AN9A 4EAQA 1M8KA 1CIJA 1Z6XA 1E64A 2BEJA 2EKBA 2JIOA 3BXXA 3QJ5A 5AKZA 5GM2A 5B7GA 3AC0A 4F6RB 2XUZA 2YC2C 2C0PA 4HQFA 1TVMA 2J41A 4M60A 3TMAA 2EBHX 1I10A 1E8DA 2AYZA 3O4IA 2H85A 4N82A 3TBFA 4G9BA 5IYZF 1ZGHA 5EN4A 3ZVMA 2Y1WA 1WPGA 5LXTB 3I2KA 4ALJA 1JB1A 2I3BA 4DCNA 3LGXA 3GJ5A 1IN5A 2G0NA 4KN5A 2W8BB 1M72A 1JBEA 5B2EA 2VNJA 1OZAA 1A04A 4A23A 4HZUB 2OG2A 4WIAA 1RVDA 1T5SA 2J3HA 1XEWY 3JYNA 4OUDA 2R00C 1YULA 4C0LA 1Q7BA 2BBWA 2J9RA 4EUKA 3PXGA 4Q9DA 4ZEWA 4ER3A 5HVNA 1PGNA 4QL3A 4E4YA 1GYQA 2W6NA 4TKZA 3I37X 3OMXA 4NBLA 1YU6A 1G4UR 1FU4A 2G8LA 1DG3A 1FYWA 5DIFA 5FWYB 3LP8A 3OCVA 2C04A 3QVMA 1R8JA 5C8XA 3AY6A 2DUNA 2IYTA 1C5KA 3O31A 2ZXUA 2IFTA 3DO6A 3DL4A 1U0GA 1XDDA 2IT1A 3INGA 2REQB 4P34A 1RIIA 5DT2A 3N07A 4FYKA 4UUMA 5AOAA 3W5UA 4ALIA 4F72A 1BX0A 2ZUFA 2R0QC 3F5SA 1CUJA 3LLMA 1AKEA 3CH7A 3DDOA 4HRYA 5FBRB 5IJAA 4BQSA 3K6SA 4TWJA 1KY5A 5LP1A 5K99A 4II2A 2OBYA 5CA1B 3VA7A 2HFKA 2UZAA 4I6JA 3SJ7A 2OGWA 1LLCA 2XNKA 4I9HA 2IWRA 5DNYB 1U7XA 3QVGA 2HCFA 2VS1A 4YWHA 1Z2CA 3GZJA 2HREA 1XJ5A 4DV6B 2A4MA 1EXMA 1X2EA 3K0KA 2QRJA 3GVPA 4JJKA 2ZSJA 5ICCA 3I62A 3AV0B 1JDNA 1N2ZA 3WLTA 1E3IA 1Z5VA 1A8SA 1CZOA 3HR8A 4C14A 3F6RA 3O93A 1XLWA 4F4CA 1C9NA 2O50A 1JIQA 1RYBA 3WKDA 2D8AA 3CEHA 5ALKA 2R6R1 4JH0A 3TKAA 1JXOA 2H2HA 5TQJA 3WMFA 2VT7A 4ZRDA 4FFNA 3HKBB 2I4LA 4U0KA 5FTWA 3QLTA 3STTA 3IVMA 1BMQA 1ITZA 1JR2A 3N8KA 5HQTA 1ZL0A 1C14A 1X7XB 4IFEA 2J5XA 2QQEA 2C9ZA 1XYVA 1T3ZA 2ZAOA 1JZQA 1QO7A 3H5TA 1XZQA 3DW3X 4UREA 3C5VA 4Y6QA 3CRW1 4LC9A 5IAGA 5J40A 1Y82A 3TLMA 4BMXA 2C59A 3QJGA 4LBWA 1G7RA 3WLPA 1R3DA 2CLDX 5B6PA 3TOZA 3RC1A 4GPBA 2Q6IA 4X93A 1C1XB 4DQVA 3A10A 4EJMA 3WOHA 2FDCA 1ZMRA 4EEKA 4QOJA 1ST3A 3PNOA 3AHHA 2AJLI 3MVEA 1ZSNA 4LCJA 4IHJB 2AR0A 5SY9A 2A5JA 2HJVA 2GZDA 1XDGA 2PWBA 2EFDB 3R44A 4ZYLA 5AM3A 4MVJD 4JENA 5ALMA 2CXXA 1WM1A 2AR9A 3F7NA 4IH1A 4L85A 4K9DA 2AOTB 4A6EA 4EF6A 4GOXA 3B52X 1N75A 1Y34E 2QWXA 2JH8A 3OAAA 4GP7A 3BGWA 3JXEA 2BR5A 4BEJA 4Z9BA 5J59A 3PUZA 1Z4LA 2NTYC 1WTAA 1P3JA 3MYYA 2FWBA 1TXGA 2I2FA 1EX9A 2PM8A 2BHTA 3ETJA 3N2LA 5JEDA 5ITVA 1P3Y1 1VSVA 2DY0A 3HI4A 3N8DA 1I4OA 4H16A 2Z9BA 5AKXA 5I7AA 3ZCVA 2PS1A 2FZ4A 2R65A 5JD5A 2PT7A 2XUAA 3A37A 4DG5A 5KYXA 4DBLE 1BH6A 4ISBA 3PIDA 3BL5A 2AEFA 3Q72A 4Q3OA 3FKSD 5HBGA 4DBLC 4D1YA 1HORA 4JUDX 4PO8A 3V34A 2EEPA 5K6AA 1P2VA 1G38A 1L6IA 1XN4A 2OBLA 3QKRA 1IBCA 2PUWA 1FCJA 4DR1B 1CETA 4MB0A 1GEGA 1H0SA 1R16A 1X7WB 3GGPA 5EKSA 2D6FA 1T91A 1W581 4RZ3A 5AM5A 5J4YA 3Q12A 2ILTA 4MP6A 2AYXA 2A1TS 2OMKA 3RTBA 3G2QA 4U2DA 1VLQA 5FOSA 5JADA 1KL7A 4MV8A 2FP3A 3EK2A 4JBHA 1ZHOA 4I1YA 1TNDA 1ZSVA 2NXWA 3E7DA 3JV7A 3PQ8A 1SU7A 3QXJA 4M3NA 2ZYRA 1YHYA 5CNJA 5H70A 4WLVA 2CY0A 3MGAA 1QZTA 2CJXA 1O03A 4C4AA 1ICEA 3B5IA 3BJMA 2C7GA 1RJFA 3MUOA 1Q19A 3PQ3A 4JFAA 2YQZA 1HL7A 4JP8A 1QAMA 1WEHA 4Q01A 3CX3A 3BMXA 4NULA 3RUFA 1UWCA 1SXHA 3O75A 1IZZA 1C4WA 1C8LA 1X1AA 3D6AA 4FSXA 2WR8A 1N78A 4FCVA 4FYIA 2QTRA 2P2GA 4LWQA 1IG3A 3VBEA 1DTEA 1CK4A 1BKDR 1N5KA 1WXGA 1YWGO 2VJMB 4J43A 4PCLA 4X8MA 3EZ6A 3X2FA 4Z53A 1FQWA 5F12A 1G5FA 4XWYA 3VZDA 1PAUA 4H1TA 5LU9A 1OVMA 2FUCA 2PUHA 2E0IA 4WRRA 4M1OA 2QJOA 2REXB 3TH5A 1XTUA 5AUPB 2B30A 5MFPA 1HSOA 1AKYA 2R79A 3GAFA 1CQJA 1G8MA 2HMWA 1GKLA 2P27A 2QOEA 4HADA 5JG7A 2W6CX 3HR7A 1C8BA 1CVLA 2YS6A 3ZU5A 4K0RA 3BSWA 2XUDA 4A6PA 1IOLA 3CLVA 3GFQA 3HO8A 3VKWA 4RPHA 4WAUA 2PKCA 4R7TA 3M83A 5EA2A 4ALMA 3ZDFA 5TPWA 1Q0ZA 3VKHA 2F59A 1KI1A 3TLZA 2Z5FA 5AW2A 2IHJA 1OXXK 4D25A 4L4YA 9LDBA 4JAVC 3MMXA 4H08A 1D4ZA 2VCYA 4QDTA 3H1PA 3LQQA 4OF4A 4X7RA 2CJWB 3AZOA 2HHLA 5AP9A 2VK4A 4BV9A 1H4TA 2HYDA 4CKZA 1FYVA 5BNTA 1CS4C 3HUTA 1DXOA 4BC1A 2WAYA 3P9YA 3QSYA 4OU4A 3N74A 3P0FA 1R5OA 3O84A 1JG1A 2EGUA 4F93B 4IZOA 4AS1A 3GDWA 1D0VA 1E32A 3CXRA 4NONA 4R8MA 5EIHA 4UEKA 1TM5E 2V0GA 5IKOA 3VKGA 2TMGA 4S05A 3TLAA 3EG9A 2BN4A 3PITA 1RBZA 2XYPA 3PFGA 3ZHBA 2IQ5A 3GA5A 1O5IA 4LQDA 4DIFA 2Q4BA 3Q7IA 1X80B 4YMUA 2GBLC 2O07A 4YV1A 2IXAA 2VDLB 2GFIA 5KHOC 1WJGA 3DF9A 4ND5A 1E5QA 3V8NA 3ZLUA 1LRJA 1H3NA 1N4DA 4HY3A 1PT7A 3ND7A 4AJPA 3T7KA 4Z1OA 5CFLA 1W1UA 4E07A 5DWQA 2DJ5A 5IMSA 4BNXA 3OF5A 5JEEA 2Q0SA 3ZI7A 2IS4A 2CYBA 1RKBA 1MQAA 2QDKA 5DK4A 5JAHA 2GCPA 1IFXA 1ZI8A 2NP6A 4G1EB 4JLJA 3LA8A 2OCLA 4BO2A 2WG2A 4H18A 3ZGZA 3AFIA 3A26A 2VYFA 5HPYB 4NMHA 4UKDA 4C3VA 3WLNA 4RVSA 2PK3A 1THMA 5H5JA 1V35A 4EW6A 3KAKA 2JFZA 2DZDA 2ODWA 4J16C 3QQPA 3EQ9A 5JANA 1L5OA 4K2AA 1IY9A 3OCYA 4DT1A 3D9QX 2BM0A 1V5FA 1Z07A 3L46A 1L7PA 4YHBA 1U9YA 4KZPA 4GBED 4ZTBA 2VXCA 5DN9A 5HFNA 3GXBA 3UWPA 3RHZA 5BMVA 3PNYA 2N3ZA 2LIVA 2ONCA 2QIPA 5DCWA 4MJ3A 4BNZA 2FSFA 3PR3A 4UASA 5EIAA 3W9SA 1ND6A 3K2IA 1TCUA 1U5AA 4MWCA 4BQOA 5B36A 5TGZA 3CX8A 1RKQA 2OHVA 1PT5A 5ALHA 5A04A 4F4FA 2K7FA 2HO5A 3KOUA 4LJSA 1GM5A 1IU9A 4DSAA 2OWEA 4OM7A 1BOOA 2G0AA 4LFCB 1PLLA 1Z5PA 1JHDA 1MEJA 1YVUA 4KLZA 4ND3A 3OIGA 2FKAA 4QZVA 3BWDD 4CM5A 1GZ6A 1Y7LA 4PM4A 4AUEA 1E2IA 1SJ9A 1SKMA 3H8SA 4OPMA 4IPTA 2I4TA 3LLVA 4MUNA 4F3NA 1VE6A 1JAZA 1VJ0A 3QEBZ 1QRSA 1PJ2A 3QV1A 3C7CB 3DWFA 2WJWA 4IHAA 3S2FA 2GVNA 3EBOA 3B5EA 3GW8A 3PHGA 4RX1A 1YRAA 1XMVA 5CDFE 4B81A 5CK5A 1WZIA 2EYQA 3TVDA 3C8MA 3JZDA 5TJ9A 4CG2A 4J75A 2G4LA 4R8LA 4QGBA 4ZV9A 1E59A 4PAWA 1KOLA 4I99A 1R9GA 5A5FA 2Z3VA 1NTRA 3FDJA 4K9SA 4QBGB 4X1KB 5EYPA 5IG2A 3QI7A 1Y5MA 1K7SN 1YQDA 2EHDA 3ANSA 1Z6TA 3DTVA 3K9NA 4IZIA 4F5ZA 4MUEA 1FU8A 2FAXA 1O96B 4IIBA 1D0SA 2JZCA 2ZEJA 5HG0A 2A9OA 2H2IA 4IDPA 2Y1XA 2YVAA 1OGYA 3BJIC 5E3IA 4I4CA 1QYWA 3D0KA 4Z4QA 1BWQA 1GTVA 4M9UA 5A1JA 5BN3B 1IY0A 1QP0A 3MQ4A 4ZI7B 1NJSA 4Y2RA 3QELA 3ILYA 5K3BA 3P9QA 1N2HA 3H6KA 3NIWA 2GPBA 4K2HA 3I4FA 3AF6A 1GL7A 1DX9A 1OZHA 2BKEA 4PSAA 2O2EA 4WLOA 4F6LA 1CUHA 2WKWA 1RJDA 1NXSA 2CLFB 5I8WA 4EEZA 3UNXA 3OZEA 2XY4A 2GPWA 3BH6A 3EJ6A 3ZWQA 1TA9A 5FL7A 4DT1B 3X1YA 5BN3A 1HK7A 1BEUB 3KFXA 4I9UA 2AI3A 1RI3A 3LUCA 1IPFA 1X1RA 2E9SA 2XCSB 3F1LA 1PWZA 3L0ZA 1N32B 2H48A 4OKSA 2YIDA 2PKWA 3HJBA 4AKSA 2CZQA 3RSCA 3OKAA 4X63A 3UWDA 1PFKA 1X39A 3AY0A 1HFWA 4MVCA 3IA7A 1HZZC 2D0DA 1MPTA 2JHAA 2L42A 1FW8A 1ZIDA 4CGZA 3HI6A 5HIIA 3WP0A 1DQSA 2PLNA 3WIVA 4CKEA 2GM5A 2GBIA 1Y7IA 5AVUA 2HHHB 4QXAA 1NN5A 3OIDA 2A9KA 1EH5A 3R3WA 5L3VA 5KAPA 5BR7A 1P2SA 1PZFA 3C3WA 5CA0F 4KIJA 4CVNA 4RCVA 2JAQA 1F20A 1K8RA 2ZZNA 2BJHA 3FVWA 3UHJA 3GDHA 3VPBA 4MW0A 4BZZA 1WZ2A 1MB4A 1K98A 1OIWA 2Y71A 3BB3A 3LOUA 4OBWA 3THYA 1RPJA 3E9RA 2AMYA 3IJEB 3L7JA 2CUTA 4L16A 4AI6A 3W2GA 4AYXA 3EZFA 7YASA 1JR3A 1J5XA 3TIXB 1N5DA 1J0EA 1EFKA 4EUHA 5U1PA 3IERA 4B0PA 2Y6VA 3ETDA 4GE3A 3DVQX 2NTNA 1JKJB 2OZEA 2VYCA 3PKIA 4W9MC 3PNPA 1GUBA 5K0EA 1FP7A 1PR3A 2HDOA 2IE8A 2XNDD 1T9BA 3KFVA 3M2PA 4KDRA 3WZ2A 4DCGA 5C8VA 4LOKA 3H2KA 1WDWB 3QTTA 3TPFA 4QTUB 1Q44A 4DLPA 3B12A 3NTRA 3OPVA 1QG2A 3N39C 1ZR2A 1J8MF 2AZTA 1XVLA 1XKLA 1KNQA 1MH9A 1CWUA 1O5TA 1O6FA 3MK31 3Q3JB 4YB8A 5JY1A 1RWOA 1HLDA 4N5NA 3V8PA 3EQ2A 1C8VB 3OLZA 4Q02A 1JQAA 2A0WA 4P0QB 3I42A 1A5ZA 1LPNA 4QT0A 4TTJA 1NRWA 3GRPA 4B1FA 2JBHA 3VISA 2DTXA 2JCSA 4ZAXA 2JLWA 1QYIA 1V96A 4O0LA 4O33A 3URKA 3NANA 4DA6A 3A1VA 3OZRA 3G5MA 4MICA 5JSHA 2XIQA 2INGX 4EKNB 3O4JA 1J8VA 1HBJA 1VE5A 2OBFA 1HDEA 3AFNA 3B20A 1JFRA 3KX2A 4DLXA 4I1OA 4ENRA 5HUQA 3U3DA 4US1R 3DKIA 4JLKA 4NEHB 2VDWA 1WCV1 3E18A 2BOVA 2XNJA 4XLTA 2P3QA 2WTNA 2OECA 4PC6A 5HE9A 2RHLA 4U6QA 1XG5A 5CH3A 5J9FA 4CI9A 3ITNA 4MVJP 2IODA 2PN1A 4RDCA 1Z34A 2B82A 2MSDB 4R2JA 1BWPA 4CV0A 3TFOA 4UNRA 3ZJUA 2O2DA 2GJSA 2J6IA 3G7NA 1GV1A 3K0FB 4CEIB 4ETMA 1ZK3A 1V1RA 3ZZUA 3ZHUA 2RI6A 2Q2NA 3HLYA 4ZVUA 2REBA 4TWZA 5LC1A 1LPOA 5FYDA 3ZH2A 3TNYA 1THZA 3EDMA 1H65A 4C3UA 3WJAA 3L8MA 3U4GA 3AY3A 2W2KA 4BO4A 1TVKA 2R96A 3K6JA 2PY6A 5DNEA 3SHWA 4QFDA 1Q21A 3Q9SA 3UT6A 4E6PA 1W1WA 1SU4A 1JIXA 1OAOC 3A4IA 3IP9A 1GNTA 1OC4A 1R37A 2FHPA 3KYJB 2Z4TA 4GL2A 2IPLA 4MVJH 3EEBA 5FUVA 5G1NA 4JKIA 4TVOA 1R4AA 2J46A 2WP0A 1L5FA 4RKRA 4L4XA 5CUQA 1RPNA 1SCIA 1ZH2A 4IDHA 5EMHA 3RWBA 2NNWB 3B6JA 1JSXA 3FVVA 4EPWA 2Q5OA 4R1QA 4AZSA 2GN0A 2A0FA 3B1KA 5BVHA 4JVMA 1EB8A 1JLKA 2HRBA 4DNPA 4IL5A 1VCNA 1KH3A 1CFZA 4BNMA 2UUAB 1IJFA 1P7CA 2B8JA 5BOSA 3K70D 5GJCA 1P4JA 2O2JA 2GN9A 1KO7A 2I33A 2RK6A 4ZQGA 3UC5A 1GRNA 1OFHA 5F7XA 2GCOA 2WIKA 1MV5A 1IEQA 1LBEA 3AO0B 3TFQA </