4G07A

The crystal structure of the c366s mutant of hdh from brucella suis
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
437
structure length
427
Chain Sequence
b'VTTLRQTDPDFEQKFAAFLSGDVDRAVREIVDRVRREGDSALLDYSRRFDRIDLEKTGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSRWTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAGVSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVLIVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTETASASWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAHAQSVAIRLNLLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidinol dehydrogenase
publication title Structural basis for the rational design of new anti-Brucella agents: The crystal structure of the C366S mutant of l-histidinol dehydrogenase from Brucella suis.
pubmed doi rcsb
source organism Brucella suis 1330
molecule tags Oxidoreductase
total genus 145
structure length 427
sequence length 437
ec nomenclature ec 1.1.1.23: Histidinol dehydrogenase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00815 Histidinol_dh Histidinol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4g07A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4g07A02
5KOJA 1M1NA 2RG7A 2YNMD 4FI3F 1M1YA 5HDQA 4UDNA 3GI1A 4INPA 3MWGA 1KARA 3R5TA 3HXPA 3ZK8A 3PSHA 1K7SN 5B58T 1KAHA 3LI2A 1N4DA 3CX3A 5CX1A 5BVHA 4WZBB 2AFHA 4UTOA 4WNAB 1N4AA 3AEUA 2O1EA 4CL2A 2XDQB 1PQ4A 5M29A 4HN9A 2M6LA 1TOAA 4G07A 3AESB 4IRMA 4MX8A 1G21B 4FNAA 4OXQA 3NU1A 2PHZA 2AFIB 2OV3A 3ZKAA 3K1AB 2OV1A 2ETVA 3ZK7A 2PS9A 5FLYA 5KHLB 2PS3A 4NNPA 4WN9B 3UJPA 2OGWA 5JOQA 5GGXA 1EFDN 4BBPA 3PSAA 4LS3A 4FILA 4WZBA 2OSVA 4UTPA 4WNAA 1QH1B 2MINB 3BE5A 2XDQA 2QI9F 4INOA 4LJSA 3U7QB 5BVGB 4HMQA 4NNOA 2XH8A 1MIOB 1L5HB 5HX7A 3AESA 4TKUB 1G21A 3ZTTA 2XY4A 2AFIA 2YNMC 3K1AA 3MFQA 4OXRA 1M34B 2M6KA 1QGUB 3MWFA 5AFSA 3AEKB 5JJ5A 3LHSA 3PDIB 4WZAB 4MLZA 4WN9A 5CR9A 5M2QA 5I4KA 1H1LB 2Q8PA 4PAGA 4GICA 3AEQB 5JPDA 4G09A 5KOHB 4MO9A 1QH1A 2MINA 1K0FA 3HJTA 3TEFA 3U7QA 2XV1A 1FP4B 5BVGA 5M34A 2PRSA 4HMPA 2XQVA 1MIOA 3TNYA 3R5SA 1L5HA 4TKUA 4UDOA 4PM4A 3AETB 2X4LA 1ESZA 1N2ZA 4XPIB 4OVKA 2R79A 1M34A 3TLKA 1QGUA 4FKMA 3AEKA 3EIXA 2R7AA 3PDIA 4H59A 4HMOA 4MDYA 4WZAA 5CX1B 4ND8B 3BE6A 1H1LA 1G20B 5JG7A 4DBLE 4H0FA 4B8YA 1QH8B 3AEQA 3MINB 1K75A 5KOHA 3AERB 2XUZA 1N2CB 4WESB 1FP4A 4TKVB 2Q8QA 2WI8A 5KOJB 1M1NB 3MD9A 4N01A 3AETA 1KAEA 1M1YB 3HH8A 4XPIA 3ZK9A 4K3VA 5M3BA 1XVLA 2WHYA 4ND8A 1K2VN 1G20A 5GGYA 4M7OA 3EIWA 1QH8A 3MINA 3G9QA 3AERA 1N2CA 5BVHB 1PSZA 2AFHB 4WESA 3AEUB 4TKVA 2PS0A
chains in the Genus database with same CATH superfamily
3G13A 1OMOA 2A0XA 1CFZA 4O3FA 2QR2A 4D5GA 3A9RA 4HGNA 3BGIA 2H59A 2G40A 2RK3A 3I9MA 2MWMA 2AZDA 5TVKA 3ZUGA 1GGKA 2FWMX 5AM4A 1Y6FA 3IIMA 4RFSA 5HG0A 3CZ4A 3RRXA 1I80A 4Q21A 3SS9X 4E14A 1FMJA 3X3HA 1WMEA 2Z5GA 3L7DA 1AXEA 3N76A 5JD5A 2FPLA 2NLOA 3UYLA 1V11A 1P1CA 5C81A 1NYLA 1O1YA 2VA8A 1H2YA 1XZQA 3CLRD 2ZJOA 4UUPA 4NMWA 1DINA 4HZGA 1EUCA 3HJAA 1S7GA 3OUTA 4E6EA 5HKBA 5J43A 1XI2A 3JVVA 1U2QA 5HKKD 4R51A 2DYKA 4BCCA 3Q8MA 2DUWA 3D4PA 4XGKA 4WUVA 4BKMA 1IXSB 1IXKA 1H4TA 1N8TA 1PK8A 2QD5A 2XA9A 4BQEA 4EW2A 1NVGA 4BY9E 1H2ZA 1KI2A 1F2TB 3F73A 4PO1A 3FR8A 5KTTA 4XB2A 3FGNA 4YN3A 4Q4AB 1Y3DE 4B45A 1FU7A 3GLKA 1QFZA 2QMOA 1JYEA 1NXQA 1XJ5A 2LKCA 3CUVA 4YACA 4Q4CA 2H5JA 4HVAA 1CRZA 3UO8B 3SMQA 3CQ9A 1SXJB 1FCJA 4R83A 1FBNA 2OFOA 3UUFA 1JWLA 3KSRA 4BP1A 3EGXA 2P0YA 4CV3A 4G56A 3OF5A 4JHXA 2I55A 3FYUA 4EATA 3K35A 4FZ3A 5ALHA 3E7DA 4UVDA 3KVRA 3WICA 2VDMB 4WL0A 5T8KA 1LNZA 4OUKX 1DKLA 1SVNA 2ILTA 2XLBA 4ZCPA 1DKRA 2JHAA 2CK3A 6AT1A 5LUAA 2NP6A 1OX6A 1ULSA 5CDFE 1HDRA 3B5JA 2DM6A 1WCWA 1T9HA 2LE0A 2ODWA 3GDHA 1LXCA 3BGVA 3A11A 2AXQA 4GKAA 4L2IA 3OOYA 4RLHA 3KKQA 4GZMA 3LXMA 4Y2XA 4WZ6A 5CT4A 5B53A 4RHTA 5BOVA 4AF6A 4ALKA 2ZYIA 4Q4HB 1P2UA 5DLYA 4ARBA 5D6OA 1CS4C 1NQAO 2AA3A 2ZI4A 1KDRA 2IGTA 3QBDA 4HNHA 5FWYA 4YRGA 1E3JA 1ZLXA 3TG8A 2EFHB 4N3CA 3HYSA 1DKNA 3JQAB 3MWDB 3N7TA 3PRYA 2R7AA 3LX4A 4BNGA 1WABA 1IG3A 3PNLA 2VPQA 1DMSA 5F1OA 1VSQA 4AKIA 4MWDA 4B8YA 1QH8B 4OA5A 5DK6A 1A7UA 1E60A 2GEJA 3DEIA 3D7MA 4PAWA 2JBWA 2JLWA 2A86A 3MPUA 4FFVA 3CPJB 4ZEWA 3RT1A 2PUGA 1Y6RA 1A7KA 1M1NB 4CE6A 3H7IA 4DG8A 5KNLA 4BO2A 3WGZA 2HDHA 4HN2A 2P3LA 5H8WA 4CLOB 4LNUA 4F38A 4ZICA 4DMHA 3ILXA 1M5UA 3NKLA 1SCDA 4KP7A 1UPCA 1O54A 1OU4A 1FDOA 1KJIA 5FTNA 3WRYA 5EJ4A 4RYLA 1TNDA 3DWGA 4QDUA 1OI3A 2ID7A 2YZKA 2W2TA 3CGGA 5E3HA 1NMEA 4D0RA 4DDHA 1ZM7A 3E22A 1DEKA 2C3PA 3HGMA 2C3YA 1N57A 4I5EA 3RFUA 4LUCA 4LRYA 2X3YA 3HKDB 3EOAI 1CB7A 1B1AA 1G3MA 3NV7A 4CI0B 1D2AA 3K70C 3VVLA 4RTNA 3K5HA 2FOIA 2VHWA 3P7MA 4RM3A 2I67A 4Q9AA 4BDSA 1YVPA 1DG9A 1JPUA 2QHXA 1WCIA 1XRQA 3BCSA 3G9XA 4JBLA 4ME6A 1LPOA 2YFHA 3CHYA 4BPRA 4LHWA 1L6IA 3E15A 4BQRA 2I5PO 2AR9A 4YR9A 1EUQA 5IWAB 1KARA 1U7DA 1ZH2A 3MOSA 4NMHA 3FDJA 4IGEA 1KK1A 2HYDA 2X0KA 3RR2A 1DWPA 3OIDA 1E5DA 1CZLA 2QLTA 4QOFA 2JA2A 1CUUA 2DFVA 3V7UA 2MJLA 5GVSA 1G19A 2EX4A 3AEUA 4Z86A 3SZUA 4NHEA 3T3HA 4A9AA 4E1VA 2XDQB 4TYWA 2JZCA 3T35A 1DRKA 4M89A 2F8SA 2EGGA 1P4JA 4PYNA 2YZ7A 2QUHA 4R7GA 4CR8A 4REMA 4YB8A 1YIDA 2D1SA 2A4MA 5CH8A 1TIBA 1P7ZA 1EM8A 1NU6A 1GCAA 3PEVA 1RAIA 2B1RA 3RFTA 4C7MA 4QHYA 2XMSA 2PMCA 4DR2B 4ZJPA 1M2KA 3RHFA 5JOQA 2ZI7A 4IXMA 4G25A 1KQFA 1W88B 3N3BC 5GPBA 3VHLB 4ERNA 4RTPA 1TQ6A 4H0CA 2V4ZA 4ESOA 4FILA 3WXMA 4UBLA 3DDUA 3QA3E 3SX4A 3TSCA 1U9ZA 4E33A 4ML3A 2BGGA 2GF9A 3CLTC 2G5TA 3QEMB 4ENUA 1U3VA 2PA3A 2WIDA 4MGEA 5FD8A 1YU6A 1Y8AA 3BZBA 2KE5A 4G26A 3VV2A 4ZT7A 4MWOA 2C2GA 1UMBA 2GAAA 3DE5X 1NXSA 4MUJA 1GIAA 3N8HA 2F3UA 3FXAA 1P62B 1JAYA 4C6HA 5TS2A 2WQ7A 1R0WA 3B12A 1NQXA 1JHRA 2POQX 3DMRA 2HIGA 2JLVA 3DGFC 3C3XA 5INTA 5LNK1 3MAGA 4G9BA 1N5MA 3I72A 4D57A 2DLCX 1JQEA 5A6SA 4L8YA 3TXXA 1WIWA 1FSFA 2O2CA 3QLJA 4IIJB 1GCIA 4NCKA 3A1TA 4TV8F 3UAVA 5EE3A 4C0QC 3KLBA 1NG1A 3MGCA 1FB5A 3BEDA 1J06A 3LFUA 2L0XA 4KQJA 2PRSA 4M0PA 1Y9AA 3EASA 4D82A 2R6AA 2SICE 3K0HA 4B2YA 5IULC 2QLJA 4Z5XA 4IIGA 4NS1A 4POAA 3C7TA 4DT1A 4C4OA 3PNYA 1CUJA 1A3CA 3U9LA 1Y3HA 3EODA 4E5YA 2PO7A 1PT6A 5EXXA 1CJUC 5C3UA 3ICEA 1DE0A 5IJ9A 1OXUA 3PYMA 4JUBA 3WWDA 3U60B 2PX8A 2QW1A 1BD4A 1EVZA 1BROA 1O5OA 2J9RA 3AUUA 3U3XA 1JU4A 1T8TA 2E87A 2V7UA 2AW3A 3RUFA 4BQNA 1U1DA 3L8FA 4PANA 4Q9KA 2ZVQX 4JUDX 1RPNA 2BHTA 2FP3A 5FHRA 1K68A 3ROTA 1ODTC 3UWOA 3U39A 1XKTA 2H7VA 3NYWA 1NIJA 3JQ9A 4PC2A 5IABA 3Q8LA 1RCFA 4BMSA 1K5DA 1GYQA 1F3LA 3R3VA 3DR5A 3S2SA 4LF4B 1NNI1 3WMWA 4F4FA 3P2EA 4JI7B 4FFWA 2B69A 3F96A 2G07A 3OPYB 2WK1A 2OG1A 4OYRA 4OMUA 2G63A 3GEBA 3PB3A 1HNWB 4WBNB 1PFQA 5I8PA 3FYUC 2EDCA 1ZCZA 5JSZA 3F97A 4K8OA 3R20A 1NG9A 3CVOA 1S3IA 2ZBGA 3RFCA 1UAYA 2Q28A 1TEHA 3BD7A 3VSBA 1PJBA 3EXEA 4K9NA 2HEIA 4DSAA 3N0VA 4JY7A 5B30A 2QTTA 3R3ZA 3HBFA 1GVNB 2A5DA 1OH5A 2QXTA 1N3YA 4QAJA 4XOIA 5D87A 4O1HA 5H59A 3GFTA 3T7DA 4BRZA 4X90A 2WTUA 3IEKA 3BFXA 2I7DA 3FETA 1JP7A 5AKKA 1SRQA 4C04A 1XRMA 1ZVKA 2WF7A 2ZI6A 2G5CA 3IDSA 4HD8A 4HYQA 4TMYA 3ZLBA 4W5NA 4D3YA 2P9ZA 5EGSA 5JALA 1XNRB 4U8HA 4JIMA 4X1IA 4YJDA 4ALIA 3G8BA 2I4OA 5GM1A 4LYDA 5AM5A 5LB4A 5KYYA 1PD1A 2IXEA 1V71A 4KL8S 2W6ZA 3L1KA 4QFBA 2CFTA 3N2NA 2AK2A 5A9RA 3DE4X 4KVFA 4OHUA 1TVMA 2NTEA 1S2GA 2NADA 4XXHA 1ZONA 3S70A 3ZG6A 4FJ2A 1Q74A 4G86A 4I1VA 4MVJG 3A14A 3ROZA 2JLAA 4HQLA 3OZEA 3EC2A 4G1MB 4TMXA 4W9NA 3RYHB 3RUPA 3KAKA 3DVSX 1JQKA 3VNQA 1ELOA 5B7GA 1CC1S 1PQWA 1YHYA 1LI5A 3WRYC 5GJWC 1B73A 4NG5A 1HEIA 2R7NA 2GCGA 3PX2A 3G49A 3ZVNA 1RWOA 1J9ZA 1Z12A 3LKBA 1D2CA 2PBRA 3D6VA 1XNJA 2ORED 2JBAA 1AN0A 1FQWA 1Z0KA 3DW1X 4PLFA 3WWEA 5AK5A 5BWOA 5KTKA 3KPJA 5F78A 3TNLA 2UV8A 4OHKA 2OQRA 1R5JA 2FCAA 5HCIA 4QPDA 3CN7A 3CZQA 5GJBA 1Q1EA 1HYBA 4XVQA 2GZHA 5CVUA 4KO1S 2Q6VA 4JOBA 2F00A 2O14A 3N8IA 4NMLA 3F5SA 2Q3JA 2DSTA 5JSKA 3UTCA 2W6PA 1CPYA 4K40A 4KLRA 1E99A 2V8OA 4ALLA 5LYJB 3V4OA 1MAWA 4P38A 4UCWA 5TIIA 2BF4A 5CH3A 1TKCA 1C41A 1E0SA 1IK6A 3BXGA 5FEMA 2X86A 3MW8A 2A59A 4C2TA 1SBQA 3CT4A 4J4TA 4TKUA 4CQMD 2HR1A 2PGNA 1OXBB 1XMXA 4BTEA 2QT0A 3TSWA 5C8ZA 2BWJA 2KBFA 4JCCA 1E4EA 3ZH9B 2Q3DA 4EGCB 4INJA 4H59A 2R8XA 3F6SA 2GJKA 2YHUA 4J49A 1E1DA 2AJTA 4PBRA 4U5QA 4FIZA 2O3QA 5MN4A 1WM1A 1U9YA 2RIRA 2N46A 5ITSA 3D6NB 4QXOA 4M55A 4U2DA 2W0SA 4O2BF 3ORHA 3CJTA 4ZAGA 5D7BA 3K09A 3IEUA 2EJWA 4KPGA 4L15A 4S2EA 4M1MA 1T0IA 5CYFA 2JGMA 3QXJA 4UFNA 4W7HA 3REGA 3GBVA 3A3OA 4K9KA 1ORRA 4LECA 4W8OA 3PD7A 3TW0A 4X1KA 1Z2NX 2FCRA 1Z8DA 1V8ZA 5E8JA 5IJ0A 1BE0A 3VH3A 3VZSA 1QIGA 4K3VA 4AQDA 4LMRA 3TOZA 3DKPA 1QHSA 2X8BA 5C8DA 1WVGA 1DXOA 3BD9A 5EZYF 5EXEA 3SQXA 1FL9A 4XCQA 2YJ3A 1BMQA 4F3RA 3VZPA 4GBED 3U37A 4DCCA 1OFUA 4KDFA 4ZCQA 4C87A 4PZAA 4BN4A 4NFYA 3U0VA 2QRVB 4D25A 4FIDA 1TYZA 1L1FA 4Q66C 4JYBA 2EF0A 2W6JA 3IPRA 1VYHA 4MV4A 3B1YA 5KSOA 2GEVA 2JHCA 2ZJ5A 3S1LA 1CF4A 3Q2IA 4C6TB 1S7CA 3JX9A 1TUIA 2O06A 3PXDA 3QYFA 4L4YA 4F6LA 3TI9A 2AOUB 3GRPA 5JAQA 4AJIA 5AXDA 4B7ZA 5BP7A 5CB0A 1N7JA 5FTMA 3M2TA 3ZVRA 1ZRHA 3B3FA 3K2EA 4AECA 1WBDA 1HE2A 1EYZA 4O1IA 1J42A 4PFKA 2PV0A 4X3CA 4TUYF 3TLMA 4E09A 4KX3A 5CM2Z 4DDTA 1K6MA 2QZ4A 2ZJ2A 2QEQA 1XPJA 1B1CA 4EYQA 2TRSB 4N6GA 3FPEA 5TNXA 2UAGA 3HKCB 4RACA 5JZOA 1ZFNA 5D5QA 4TSFD 4M22A 4G4SO 2IE8A 5F2EA 4IV5A 1J5XA 2Q8NA 3NYRA 2XZPA 1M67A 3FPAA 2GVNA 2HRQA 3EXHB 3SWWA 4RMIA 5C1OA 1Z83A 5HJ7A 1PYGA 4KPEC 2EFYA 2PAFA 4BMDA 3H1FA 2K2QB 3SF0A 4K0RA 3DDZX 3VGJA 3JQ9C 2O2SA 4NU0A 5DYGA 5HF8A 1GZ7A 5KC8A 1RRMA 2BCEA 2FW8A 3OCWA 1HR0B 1D0VA 1KC1A 2WC1A 3VHRA 2O5RA 2C96A 2VUTA 3IR5A 5DI3A 3MCVA 2SNIE 2V7BA 2Y0PA 3R7AA 2NQ8A 3HU2A 2X2EA 4UAJA 1BMTA 5GONF 4XE5A 3R0XA 3UAWA 4D9MA 2QENA 4WINA 1OLXA 2OCXA 5KJ1A 5DXFA 1TLLA 4J6EA 2GRUA 2GEFA 1OH6A 1Z74A 2IIQA 5ESWA 1BGVA 3SE0A 1PN3A 1HE8B 3KHSA 4RUKA 2ZAGA 4CHTA 3LECA 3MYYA 3V2UA 4EPWA 5K3AA 4G0PA 2W4IA 3U7EB 2BF7A 2EYUA 3D6FA 4S1TA 1XTUA 1QU2A 3E8XA 4JBXA 1Z37A 4J03A 4LE1A 3JARB 3UUGA 1ONNA 3V9AA 4UTRA 3JAMA 4JYAB 3I0MA 2ZRNA 3D7RA 5CXQA 1UXJA 3V4FA 4I1OA 4D44A 2F6RA 4C5AA 1WV0A 2P75A 2AOTA 1XFAA 1GPJA 2FUG6 2JIZD 2QRLA 3JQCA 1M2GA 5EWLB 1U63A 5C8VA 2CKMA 2Q3HA 2ZB4A 4EUNA 4UDYX 1LLQA 4A0QA 1OC2A 5D3MB 5JPIA 1P2BA 2X4LA 5IVPA 4CGYA 3B20A 3DBHB 4UHDA 1MKYA 1WPRA 4A8JA 2ADOA 1FDIA 2IEYA 2PY6A 1UMDA 1ZN7A 1KEEB 3NDPA 1Y80A 2HPZA 3KK0A 3NH9A 3ONNA 4NDAA 2IHTA 1SUCA 1N6PA 4C89A 4YP7A 1KKMA 4IKEA 2IH2A 1J5PA 3UMYA 4ZAVA 4ZO9A 3S8YA 4W9NC 4YJ2B 3J80A 3FCAA 1ZUWA 4LXTA 4U2FA 1EGMB 2CNKA 4GOOD 3RRFA 1DBRA 1NNLA 3L6OO 3TGWA 4F60A 5J1SB 2GBIA 1ZPDA 2FEPA 3GFPA 3FSEA 2FMHA 1MOZA 2P8SA 4N6OA 1MJ5A 1CF9A 3BXXA 3L4EA 3TTSA 4RDHA 5TPWB 2Y76A 2ZUDA 3MBIA 3H2GA 4QG3A 3IP5A 1T0HB 4I1SA 3CZ5A 1GG9A 2G7MC 1CJCA 5LBIA 4AJ9A 3GD7A 4ZPXA 2PLRA 2GYUA 3TN7A 5JNLA 1ZOLA 1HFWA 5DM2A 5J4YA 1GTSA 3EVEA 4IYJA 2F8LA 1SXIA 3B51X 3DFUA 5FNVF 1V41E 2XJ9A 5KNDD 1QQ5A 3GPCA 3C1UA 4BNKA 3ETJA 3B1VA 4JSTA 5K3BA 4FYIA 3ROGA 2J4DA 421PA 1BOOA 4IXDA 3ZDXB 3TW8B 3QG1A 5HW0A 2A5FA 4B6QA 5CNKA 3TO5A 2AF4C 5DSTA 3N2YA 1AV6A 3ZC3A 1VHWA 3BIFA 3FD8A 5K4GA 2DQKA 3GQBA 2WJHA 5A5DA 1JAZA 2IVZA 4QGHA 4XWOA 2WVHA 3I05A 4X00A 4CQMB 1H2HA 4JGBA 4W1PA 4GEGA 4K3UA 4DKXA 2VHVA 2BZ1A 5I7FA 3O4RA 3V4RA 5EHNA 1F8UA 2ZS9A 4REOA 2AX4A 2D59A 2O0LA 1QQAA 4FK8A 1NP3A 4AWAA 3I4FA 1NOKA 3K09C 2NACA 3NIBA 3UWKA 1NVAA 1F5NA 3W1EA 4FP9A 4WRRA 2Q5QA 2QXYA 2CZGA 1PS0A 2J87A 4NH0A 1HF3A 2DHDA 3IL2A 3WDLA 1LBHA 1KVTA 2B3DA 2FZ4A 5IK2A 3T3DA 5JAOA 3USCS 4DWOA 2IPOA 3FWHA 4EDHA 3ZWYA 2GSWA 3GARA 4XJSA 3ZQUA 4AQYB 1T10A 3QF7A 3EXIA 4CLRB 1J07A 4QLOA 2EGHA 4KVAA 2NQTA 3IO5A 3PGVA 4LK3A 4KMSA 3SU8A 2ZTVA 4B46A 2MU1A 4DQXA 3JPWA 1VE7A 4HDKB 4RKFA 1RZRD 1TTHA 3IXQA 2BHLA 2GVZC 5A4JA 3H3XA 2JKYA 3OX4A 5CXXA 1I4LD 2JGAA 4QYXA 1SUEA 3GUVA 3VC2A 1F8GA 2OHGA 1JIKA 3OKPA 4XWGA 2GHQA 1E6KA 2NVUA 4YJFB 5EZYA 3F4LA 1EFUA 3TRJA 2J08A 2C92A 2ZUWA 2P79A 3F2IA 3P9KA 2VP4A 1SU6A 1D5CA 2WUFA 3BMCB 3UMVA 1W4AA 4Z99A 4TMTA 5LMNB 4V2UA 2ZUUA 1JTEA 2VDWA 2BUAA 3HJTA 3M6VA 4MCHA 2ADMA 1SPBS 2O1SA 4Q1VA 4QLBA 3PC8C 3COPA 3M33A 1DUSA 4NENB 1FS4A 3DZ8A 5K0SA 4DIEA 3GOHA 3BERA 3DMPA 3L0SA 4R8LA 3SR3A 2R47A 3QX3A 1ZO8A 3Q3CA 4JKIA 1EVJA 1R6XA 3PDIA 4EVQA 1DBIA 3IVCA 5BQXA 2QSUA 3WWZA 1FZTA 3WKEA 3OX3A 3FUUA 1JALA 1SC3A 1BGXT 3WC4A 5L7TA 2OCKA 1KEUA 1DDIA 4XGRA 2Q7DA 4FFPA 1C3OB 4KR0A 4Y2YA 4BQFA 2CV0A 5KOHA 1XZBA 2CYBA 2ZWIA 4TUYA 4S35A 2ONCA 3PHLA 3R1IA 3SZOA 1E66A 4DGQA 1N34B 1U7XA 5C5DA 3AHJA 4B6OA 1DZIA 1RBYA 5A7FA 4W9MC 3LRXA 2FFRA 4A0RA 5E2AA 1ECCA 1LJLA 1YOBA 3FBGA 5JC1A 3MUEA 1YJAA 2JH3A 2IGBA 5K2MA 2AGVA 4PZ9A 2J6IA 2IDZA 2XCLA 4RENA 1AKYA 4PG7A 1ONOA 5LD2B 3V1NA 4E03A 2FPUA 3OJOA 4FDAA 4DV0B 1FYWA 1QX3A 1U5BA 2HH9A 2TYSB 2VK8A 3O2NA 4RD0A 5KJ6A 4MA4A 5FOSA 1QOPB 5JNSA 4ZVMA 3H19A 4WACA 1WA5A 3F7MA 3IHLA 2KW5A 1Z4IA 2PCLA 3C7KA 5K51A 3BL5A 5JCZA 4X60A 2QVGA 2AEMA 3I6YA 5JNTA 5B4UA 4YXWD 2IZ6A 5AJUA 5I7VA 2FEKA 1OGJA 4AJ2A 3S81A 3PICA 1Z6TA 2F48A 4TTQA 4II7A 4E4YA 3GI1A 3X2EA 1WTAA 2V7QA 3BWEA 2XD9A 1VCOA 2PGDA 4QDOA 2VTEA 2Y71A 3PHJA 3LUPA 4L5AA 4RIIA 3WHKA 2HB6A 2VXBA 4RY9A 3ORFA 5DM4A 1K8XB 1A5BB 4A8JC 1H3FA 4D8TA 1VJRA 1T36B 1OIWA 2H7CA 5IMBA 2WZQA 3JD1A 3AI3A 5GJVC 3T9CA 1WXQA 1JHZA 4UHHA 2NWQA 4MYRA 4F9GA 5LCXA 5GINE 2WG2A 2BT4A 4XEHA 4P0QB 1VMEA 3GJZA 4G0QA 2ZSKA 3DTYA 1A8UA 1CZUA 3T1VA 4IDPA 1IIBA 1PNOA 1XTTA 5F9MA 3DLIA 2D0IA 4UU0A 4BU0A 3HXOA 3PFIA 2HK9A 2PTGA 3TJRA 5I9IA 1M73E 1T26A 2PMFA 4LHSA 4DNQA 2J31A 4NP6A 5DW0A 1K9SA 5HZMA 1VECA 5L8VA 3P0IA 4IDNA 1Y1TA 3WBFA 1PX2A 2C4WA 3FMOB 5CGZA 4O4IF 3DLAA 4Q05A 1NXPA 1J8DA 1WUJS 3AP3A 3DVAA 3HJNA 3O4HA 5FL7D 5AXAA 5BN5A 5AM3A 2XKKA 1Y8ZA 1PI3A 2AEFA 4DLBA 1W52X 1OOEA 4BQSA 2HCJB 1YFZA 4YRJA 4II3A 3SAJA 1E8NA 2XF2A 3JQ7A 3TBKA 5K0JA 4EX7A 1YCDA 2DPXA 3AEKB 5DGHA 3T9AA 4EL0A 5J59A 4XB6B 1OVGA 4EF5A 5T5QA 5A7HA 2VPIA 1HMYA 3FDZA 1EXNA 5FV7A 2P6RA 4R2WA 2V7WA 2V7GA 4OSEA 1CRPA 5FOXA 3KEOA 3FWZA 2GBFA 1QB8A 2P2DA 5DHFA 2XV1A 4YK7A 5FNVA 1YZQA 1V47A 2J5KA 2PG3A 4ZI7B 4O4HF 3ETCA 4WXHA 2D2XA 5CVEA 1SIUA 2FOLA 5GV7A 4ZVQA 1I3OA 3SMVA 3ZGLA 4JLVA 4BAUA 8AT1A 1PR5A 1GA6A 2P7HA 1R0SA 4OFWA 3EG9A 5AK6A 4B6RA 2QWXA 2QUZA 1P4RA 3RF7A 5KQGA 2WT4A 3STYA 1Z13A 2VNSA 3KJEA 3ENQA 2DWPA 2RGUA 3IKVA 4IQ4A 5DEOA 3UTDA 1V6SA 2ZIUB 3DBIA 3EQ7A 4W5WA 1X1BA 1O6BA 2R87A 3BH0A 4U2GA 5CIWA 5KJFA 1B6TA 3AY7A 4IUBS 4LY9A 2HADA 2Q1UA 3T5GA 2PVCA 2RAPA 4I55F 4CDGA 4TVOA 7GPBA 2ZJBA 3CUEF 5F7JA 1D7OA 4HQ6A 1I6KA 2GPJA 1I7QB 1E18A 1JR6A 1IJEA 1DKQA 3MD9A 1KKLA 4GWLA 4D4GA 1OKKA 1T1EA 2P1RA 1VIVA 4A36A 2EJBA 1UT8A 2Q1SA 2B1GA 2XB6A 4HBGA 3REFA 2PMBA 1W5FA 3LVBA 3TFQA 4F96A 2OZLB 2PSHA 4Q93A 1FTYA 2H8KA 5C35A 1K06A 1OT3A 4AMGA 1D07A 2GEKA 2XW6A 3U1VA 3H4MA 3D0RA 4L76A 4F5DA 5EXDA 1UXHA 2RONA 2YN2A 1E2HA 3RTEA 1XGKA 2XUHA 4ZIRA 4MKRA 5JSHA 2GS9A 4QICA 5MFPA 4XSHA 3SX0A 4B80A 4LJLA 4YHHB 3CNBA 4QBHA 2IIBA 2JFHA 1ZDMA 2QV7A 1YDGA 3AR5A 3NBQA 4GI2A 4JLOA 4JQCA 1AKWA 1TQ2A 3IEPA 2VEDA 4RZIA 3R75A 4YUXA 1JPNA 3EN0A 3A1SA 2HGZA 4KO2S 4CJXA 5DSXA 1LKZA 2LIVA 3CYFA 3M5WA 5AWFC 5DWQA 1NLZA 4NNJA 1G8MA 2DUNA 1Y8QB 2NPIA 2HNBA 1TYCA 2GTHA 3A27A 1GN9A 3GRVA 3CX3A 3Q98A 3QU9A 3WXBA 2WQ6A 4R9UC 3MWLA 3RTAA 4C0LA 1YQTA 3AEXA 1UM9A 1VKZA 2ZROA 1E3DA 2AYXA 5IAJA 3BRWD 1ML4A 5AUOB 4OM8A 1NVVR 1PVDA 3HLYA 3MJ4A 4MX8A 5L3RA 5E3IA 5BYBA 3S2IA 1Z6PA 3BTUA 3COJA 1S8NA 2VJCA 2OP1A 2AZMA 4GI1A 1KFEB 5AHWA 4DNFA 9ATCA 3L82B 4JC4A 3BFKA 2OVFA 1E3IA 1SULA 1UQUA 2AD5A 3HKBA 1IM5A 3A28A 1GNVA 2VSOA 3QXSA 1GGEA 4FU0A 4QFCA 3L0CA 6ADHA 1QG6A 4HWSA 2C7QA 1BC5A 2FGJA 1T9ZA 2GAIA 2P6MA 4F3KA 5CB4A 2HQBA 2QLFA 3IKLA 3KRTA 5DMXA 3TOCA 1QLWA 2AF3C 3L7MA 4B33A 1W0KA 3D7KA 2LGJA 2A3NA 4L5CA 4OATA 5DMHA 3AU8A 5B1IA 3WKDA 4Y1RA 2CJWA 2DBRA 1FLNA 2O2JA 2XNCA 1R50A 1NW9B 3FF1A 3U4QA 1K27A 4RVUA 2KJQA 3KTAA 5DE3A 3EULA 4UBIA 1RXSA 1W9HA 2DHCA 4BMNA 4OQNA 3RC8A 1C4XA 4B8WA 5EWJB 3TLGA 1FUKA 1THTA 1VI6A 3WLRA 1J00A 2ESRA 1U0FA 2FETA 3MUFA 4C7XA 4R6XA 2YC2C 3K70D 2VC2B 1RIFA 3LTNC 2HM7A 1XAHA 1DKPA 4IHJB 4A91A 1E79A 4HS9A 5ELLA 5FWAA 4NESA 3DD5A 3LZ6A 2VZLA 2JGFA 5ITZB 5LLDA 3DXZA 4Q1AA 4C3ZA 3GK3A 4WZAA 1HBJA 2XUKA 3L1IA 3IKTA 1RZUA 2Z98A 4OQPA 3TQHA 1PZHA 3D0QA 4QQNA 4EI7A 3KQHA 2BI4A 3NTQA 3QEOA 1CY6A 3D64A 3KUXA 1SM4A 1QHGA 4BN5A 3THXA 3P2YA 4KW7A 1CJVC 1HRKA 1X7HA 3I3OA 3C3AA 2ONYA 3N2GB 4DLXA 5LQUA 2B7BA 3HB7A 4H08A 2YIDA 3SC2B 5AYVA 3BN3A 2M32A 2O3UA 3A4TA 5HOEA 5HXAA 2D74A 4M9RA 4FE7A 2I6XA 2X6TA 4F3YA 4TYNA 3IELA 2NSHA 2I2CA 4G65A 4Q39A 3HH8A 4PFSA 2XJ4A 3BMOB 4KJXA 1X80A 4RK6A 4QIHA 4QGSA 4L5YA 2GERA 1HWYA 2HDWA 3V3TA 2XT0A 2EZUA 4I1IA 1O0CA 3QU7A 5JASA 1IOVA 4N4AA 4JL5A 2OCDA 2Z30A 3FVQA 2HLHA 1MX5A 1NC1A 2OQIA 1P0FA 3CISA 3CLTD 4IW3B 3P5SA 3P9ZA 5DM60 1MZPA 2CUZA 1MMFB 2BJHA 4IDFA 1YBFA 4LI0A 2ZP1A 2EBFX 1RI2A 2FE4A 1WX1A 3S27A 2PLAA 4O4IA 1G5QA 2FH5B 2ZWVA 5EVCA 1OZAA 3Q3VA 1JAIA 2JGRA 5ENVA 2CZCA 3UXHA 3K6RA 2WLSA 1GRNA 3ENVA 4CEJA 1H2BA 2IZ1A 3IDZA 5CBKA 3DBLA 4JCOA 4ZOAA 2C9MA 2G82A 1QIHA 4L57A 4ESVA 3VR5D 4GWGA 4YXFA 2JLXA 1KPIA 3ZPXA 1T0UA 3CN9A 2XOEA 1DL5A 4NR0A 4UW9A 1R5NA 1Z2OX 3FJYA 4DLPA 2AFHA 4F92B 1N78A 3AG5A 4IILA 3GWGA 3N0XA 3S5JA 1WV1A 4NLLA 3UVEA 4F2DA 1AHPA 3PLAE 2FDXA 3E3OA 3H6HA 2BJVA 4HBZA 4PGAA 2J0QA 2WMOB 4O4HA 5CURA 2PVPA 3NB0A 4MA0A 3ONEA 1OZFA 4LKRA 2Q4TA 3NDIA 4MWEA 5C18A 3SQWA 1MU0A 2VWPA 4L4SA 1RYBA 1QH9A 2Z6VA 4RE6A 4U6SA 4FE4A 3X1DA 1JDTA 4OX9Y 1T4CB 1J5EB 3NDBB 1RVV1 1RJ9B 2NUPA 4MWGA 2Y99A 1N1GA 3AKCA 1YGYA 3R7WB 1ZU5A 2NYVA 2VHEA 3LKZA 1VMAA 3S6JA 1UIMA 4IHKA 2VXYA 3FI9A 3NM4A 4A6PA 2PRZA 5K3CA 1E1RA 2H1FA 4N0QA 1JHOA 4HQKA 2ZEJA 1MJGA 2J3IA 4CV1A 2VP6A 1EFVA 5KNCA 2G0NA 2JCGA 1SNYA 4JKOA 4N5LA 1KBOA 2DLDA 2YQ5A 1NBME 1TTTA 1T6BY 2ZRIA 3RI3A 3AYXB 1UKEA 2WSSA 2WHPA 1EGQA 1Z5UA 4IG4A 2ZTSA 1T9CA 1TA4A 2F1OA 1XQ9A 4KIWA 4P3PA 4GLFA 3W2EA 4PZYA 4QUDA 1Q22A 4HAXA 5DBEX 5KSWB 1MB3A 2ARKA 2CK3D 2Q7XA 3JQQA 4NZ9A 6NULA 5JVDF 4GX1A 1HDZA 1NGSA 3ZLTA 5EZ6B 1TJPB 3GRAA 5JRJA 5BPHA 1WOYA 2ZBQA 9MHTA 4L8GA 1FOEB 3PHIA 4V3CA 3KJGA 1L8AA 2AOXA 3QUCA 4TM7A 4Q7JB 2H16A 4WXEA 4CNQA 2JI8A 2OZVA 1RXVA 1AHNA 3EXG2 3IBFA 1H23A 4WVFA 1EE9A 3NV9A 1PV2A 2VJKA 4JBGA 2X8JB 1C3LA 1GKYA 4H17A 1A1VA 3M3PA 2DQ4A 4LZWA 3LT2A 4EKEA 3OQPA 5BQPA 1JVSA 3JYQA 4ICIA 5IW8A 4WOCA 2G08A 4IIBA 4UDXX 4ZOEA 5EKDA 1I2BA 3NNDA 1XTSA 4IIHA 4EA6A 2WWYA 4PGGA 2Q8QA 7YASA 4FT2A 4KPFC 4RVSA 4PLWA 1Y33E 2FP4B 2WYOA 3QV1A 2C04A 3R2JA 1M2EA 4Y2RA 2WHXA 3WVNA 2JHFA 2IXDA 5CA1B 3OZBA 3QLTA 4DUGD 2QAJA 3ZE6A 4F4JA 3LT5A 2EF1A 2FR1A 4NONA 1ZRSA 2I22A 4QNNA 1TMGE 5IVIA 4DSTA 1VXRA 2FVYA 4P33A 5ALYA 3I8OA 4ACBA 2NV2B 3E5NA 3P4YA 4JI2B 3MS2A 1MCZA 4Y2UA 3PUWA 1F1JA 2O8BB 4DRXA 1AN9A 2WVAA 1M1UA 3OZCA 1IB6A 4ZXPA 1P0PA 2W7TA 4FB4A 3M6AA 3ASYA 1LSUA 3HO1A 4MQEA 1F4VA 1DO8A 1GRQA 1UP6A 1V3UA 1BIFA 1ZM9A 1KIFA 2IQ5A 3DMDA 2IYRA 3I9FA 3NC0C 3OD1A 4OD0A 4ZEOA 2MYUA 5REQA 1VG1A 1YRHA 1MC8A 1SUDA 1KF0A 2AUNA 2F59A 2XQKA 3H75A 3HGQA 4HWPA 4O2RA 2VDOB 2YUTA 1KA9H 2GXSA 2BEWA 2P2NA 1UZUA 2IY9A 3IAM6 4PG5A 3PNPA 5K01A 1Q15A 1I2CA 1B43A 3AJEA 3ZV5A 5JQGB 2VHXA 3FUVA 1M34E 3I2JA 4W82A 1CUIA 1OVMA 1Y6GA 4RJIA 5A0FA 4DV7B 3EXFA 4LQ4A 5ES3A 1LK7A 2QD3A 1IN4A 1J20A 4E5NA 1V5IA 3VR5H 1LWOA 1UBMS 4GYWA 4BNXA 2YN4A 4I50B 4LJ5A 4YCNA 2HMUA 2PT7A 1L9KA 3LK7A 4DUYB 2GZ2A 4IH4A 3K0AB 4L95C 1B3BA 1ZM4A 4EY5A 1FMFA 3E2IA 3L8DA 3IMKA 2XE4A 5M5BA 2WMNB 1UP4A 2ZAMA 2Q49A 1V4NA 1QFSA 1DDGA 2FDRA 4FCVA 2JK0A 1XQ1A 3G2IA 3ORRA 3OMWA 5HBRA 4AJJA 1PZGA 1QO0A 4EK9A 3AW8A 3B7WA 4PGMA 4JLDA 5EQDA 5FUQA 3FTFA 2WIFA 2E5FA 3SM3A 3NO4A 1Z29A 2H2WA 3D3WA 3MUOA 3MJRA 3B2NA 1XU7A 3U4GA 1UQRA 2YY7A 4BNYA 1UANA 3TF5A 4XD7A 5A4FS 3QKTA 4IWYA 3K5IA 1EE1A 2GAOA 4H31A 1VIMA 2QTGA 5ALTA 2UZ1A 3EQZA 2IYLD 4JOCA 3JASA 4HYYA 3VUEA 2Z1NA 1YVDA 2Z56A 4EEXA 1KU0A 4CM1A 4CM4A 2FUCA 4L4XA 2ZE6A 1YS2X 3OEYA 1S3FA 5EFOA 1F6BA 1B16A 1L7EA 1OI7A 2B6HA 1OLSA 3IESA 1U9JA 4MP8A 1H6CA 3EA5A 4UUQA 1SUIA 3ZOKA 5GZ3A 1O96B 1X1TA 1WHSA 1E2KA 1EQAA 2H54A 4IJQA 5ARCA 2NM0A 1MEJA 3AF6A 2EKQA 1QGUA 5KVSA 1E2DA 2G36A 3OKAA 3QP9A 4UTVA 1LFAA 3N2LA 1FBTA 1G3QA 1T5SA 4QL3A 4YJ3B 2DY1A 2I76A 2NTYC 1B8VA 1FFDA 2H2IA 2JFPA 4DNPA 4DZZA 4ZKEA 1V2HE 3PT9A 2YR0A 2DTXA 1ZNYA 2GJ9A 3H5RA 3QMMA 4KUGA 2ZWPA 3LH5A 3WMGA 1ZUHA 2HCRA 1T9BA 1Q91A 2YMMA 1SXHA 2VPXA 2B36A 2RHMA 2PKCA 2VYVA 5ENDA 3L07A 4RCVA 4B7AA 2HWKA 2ZXFA 4ZMSA 2AC2A 1M33A 3EW7A 2ZYVX 4NJEB 2B8JA 5ETJA 3ZHXA 3RRNA 4TL9A 1YB4A 3UG7A 1XWIA 2C1EA 4ONEA 5JNUA 1L8LA 1TU0A 5DRYA 4TLLB 1N2JA 1XCJA 2V55B 4DXAA 3C3DA 2FX5A 3V97A 3DMTC 1U28A 2C8VA 3WA6A 3DZDA 1EX1A 2V9ZA 3ANSA 5L4NA 5KO2A 3KKKA 1UP7A 1GNRA 4CGZA 1BX1A 2EFEB 1X86B 1U3CA 1SKBA 3AFGA 2JW5A 5IEBA 1IK4A 4F2HA 3AB7A 4ISBA 5J58A 1L7XA 2BM0A 2O7NA 1GPNA 4N7JA 1W0CA 2RHDA 1TJ3A 2JGIA 2E1PA 3SOPA 3GCWA 4YUZA 1LBIA 2XWPA 3EOZA 4RQTA 1PGJA 3KJIA 4I3FA 5LBTA 3SXJA 5GIPE 4IM7A 4EDFA 4J9UE 3ETHA 3HXPA 4JB2A 1OJLA 4LYYA 3URKA 2AZ4A 2LRHA 4PLPA 4GQBA 3DWEX 3CG4A 3NTVA 2NT3A 4OB6A 3LTEA 5E7QA 1Y37A 2HSEA 4ZZ1A 3UC9A 4QOIA 3WQBA 1FJHA 2WFMA 1I24A 5FTJA 2Y1DA 1Y3BE 4C6RA 4NBLA 4J0GA 1Y8RA 2WJJA 2JLRA 1PZNA 2VQDA 4MJ7A 5JVDA 1CZOA 2WA2A 3TAHA 2WKWA 1XZEA 1KDTA 4B84A 1Q57A 3O2JA 3WHIA 4M1OA 2GMWA 2GZ3A 5E9AA 4TSRA 4ZI3A 3AYZB 4MW2A 4Y67A 4A8PA 3L8CA 3L0IB 3HA5A 4KI7A 2GBCA 3NYIA 1PJ3A 3IUMA 2IPAB 1EUZA 4A2WA 4XIYA 3U7GA 3QBJA 5JCXA 1GTJ1 1KZYC 3HNRA 3C6YA 1KNXA 3JQEA 3MBOA 4AS2A 4YT4A 3F7NA 5F52A 4YY3B 1W2WB 4DANA 5AXBA 3WSTA 4F5WA 1HT3A 1OUMA 3VNBA 4GO1A 2ZI3A 2I3ZA 3H97A 3M4JA 1J0AA 4L5BA 4U63A 4WLOA 1CIJA 1VIAA 4UREA 5E8RA 4YDQA 4BVBA 1QIEA 2X8AA 2V7XA 4DMGA 1KTVA 2GD6A 3HBLA 1DU4A 4EW6A 1U8XX 1Y5RA 3QFRA 1L4MA 1P5FA 1OXMA 4MR8A 5JW6A 1KQ3A 1C14A 2WMDA 2CF6A 1W4CA 5U1PA 5DIZA 3RUDA 5LIPA 1AMUA 1WZIA 3ISTA 4H6XA 5HIJA 3FYHA 5GV8A 3S40A 4KVGA 5DEIA 5BRAA 3BGDA 2IBMA 4QVKA 1GT6A 3MS7A 2ZS7A 3EZ9A 4Y2HA 4ZHSA 4X7RA 4LGMA 2CL5A 2VDQB 3G2MA 3NHZA 4ZHQF 4X62B 1H93A 2DPMA 2J3LA 2CUNA 3P2OA 4FQ7A 4HAWA 1CE8B 4AP6A 4X1OA 2REXB 3IQWA 4HDRB 3IBYA 2QXUA 1VM6A 3F7OA 4NOKA 1HX7A 3G5TA 1KWGA 4I3GA 1U0HC 5B3AA 3RK1A 1Q50A 1Z07A 2VF2A 5C8YB 4L8VA 2JG3A 4U7PB 1IY8A 3TZ6A 4CKXA 1PK7A 3HTXA 3MT8A 2QRUA 2ZRMA 3BUSA 4KOEC 1BWRA 3WNQA 4BNZA 5JATA 1A5SB 2NXNA 1U0SY 2W6CX 1H8HA 4OHWA 1E1NA 1AXRA 2UDPA 2O6LA 1F6DA 2BGJA 5IN5A 2WTXA 4QNMA 4DREA 2O2HA 3JYLA 2RCYA 4JENA 4W63A 1GZSA 5GZ6A 3RQIA 1GRRA 4C08A 1MV5A 4BS9A 4N7RA 1KO5A 4B6FA 3OJEA 2PXXA 2JJ8A 3H2ZA 4UOEA 2V45A 2B3TA 1L0BA 2B4RO 2QSZA 1UBLS 5CHEA 5EJEA 5BYAA 1SURA 4DNOA 3WJ2A 4LVOA 2W6JD 4CTKA 4DLAA 3PK0A 3PITA 1GDDA 2PH3A 2I33A 1P33A 1RLOA 5FB3A 3L7NA 2JATA 2QP9X 4XGNA 3M4XA 5A6SB 3TCKA 1DNPA 2R2AA 4ROSA 5FPSA 5IHPA 2ZB7A 1XN4A 3I0ZA 3V80A 1ONPA 3D31A 3FDXA 1PTKA 3SQOA 2ZSIA 4RW0A 2G67A 1N25A 1Q44A 3F5DA 4QO8A 4AJ4A 4CKWB 4JYZA 4NAVA 1PHPA 2DBQA 2HLNA 3AH8A 4MI9A 4FW8A 3UANA 1KMNA 4EHLA 1YZFA 3HJUA 3H8SA 1H2EA 2W8BB 2WKRA 5G53C 4PEVA 2H65A 3GLFE 3FFAA 1TD9A 1KHTA 4NYJQ 5FLEX 5BR4A 4PZZA 5BSFA 4HDAA 3ODGA 5IAOA 1NNSA 3DZIA 4D3DA 4IJVA 3RKSA 2I80A 3UFXB 1T3ZA 2ZSAA 1HV8A 3DFFA 3QVLA 3V8QA 3WLKX 4HVTA 1SD5A 4W9RA 2KSQA 4FMPA 1TK2A 1FX0A 1C9NA 5BRNA 3CNOA 2IA5A 2QDKA 3GEHA 3HEBA 1N3BA 4GOXA 2O50A 1U28C 2ASEA 3Q6NA 4OHZA 3TEMA 4CV2A 3K30A 5G4KB 1O5IA 3LKDA 2WILA 4I81A 5AOCA 4YPFA 2GCEA 4WH0A 2HSDA 4D79A 3R7FA 4HN4B 5KEIA 3HY4A 3LX8A 4FFMA 2DFTA 3FKQA 4PVDA 2IYSA 5DULA 1KHHA 3CMCO 3QFCA 4MW7A 4DPLA 1EVKA 2R4QA 3HB9A 5DTIA 4AJLA 3DLBA 4J0CA 1GCOA 3NATA 5CA0F 5CYPA 1T5IA 1BTOA 3AV0B 3EXEB 3EWAA 1WF6A 4TRMA 1APBA 4M9SA 1G0NA 3UATA 4ASUD 4D92A 3ZQKA 5FBWB 5AKEA 3FGZA 2GKOA 5K5EA 2GLXA 3NPAA 4MZDA 3RSHA 2FZWA 5HTKA 4Z51A 1D8TA 1DT3A 1UMCB 1MENA 1DFGA 1MB0A 2CDBA 3EGIA 3JXEA 4MI1A 3BWMA 3D1VA 1YJQA 3LLSA 4FKMA 3USZA 2O1XA 4DGSA 1U7TA 2GK4A 4RLSA 3UY4A 3EIEA 5BW4A 2OP0A 3QYJA 2NYAA 1VLVA 3CRMA 5KI6A 4F21A 5MF6A 5DT9A 4YUVA 5EUCA 2IYAA 4HX2A 3A4LA 5HIMA 1NKSA 1JBQA 2P40A 4JH0A 2ZJYA 4RVOA 5FT9A 5LZ8A 3QF4B 4DV4B 2VR1A 4DCMA 3LK6A 2BI7A 4JXJA 3HHEA 4BWGA 5DNCA 4BUCA 2VDVE 1KI1A 3G8CA 3A1NA 1ZIYA 1SO8A 2LZ0A 2IHKA 5KINB 4ER3A 4ZT6A 3AIKA 4UFOA 4QU5A 3OIYA 3ZGOA 3K6SB 4BFLA 2NU7A 3PL1A 4N8DA 2C2WA 2XQJA 4DJAA 3HY6A 2YRFA 1N32B 2WNHA 2FFAA 4J90A 4UFPA 5LP1A 4LHZA 3DUWA 4BNNA 1GCGA 3U3KA 1FS6A 5C4MA 1KQOA 2GJAA 1XHLA 1T2AA 1FMTA 3SKYA 3O1JC 3KSMA 4UDNA 4YHBA 4ZXFA 2YJNA 4Y6GB 2G83A 2OM2A 3DJFA 1IHYA 3P1JA 4FYWA 1T4MA 3ZHBA 2V3CC 5TQ0B 4QGBA 4FI3C 1HXHA 1D2EA 2ZB8A 1TUGA 4RQUA 4EENA 5JMTA 1SUPA 2P5UA 2BGTA 4TLEA 5IVDA 1J23A 5K0LA 1LJ8A 3V7FA 4C4AA 3RUHA 2ECQA 3LDFA 1LI7A 2CVPA 5B36A 3UJHA 5A05A 3VHQA 5JI2E 5AIAA 1P73A 3MGBA 3H5LA 1E0KA 1NDHA 2PRIA 2XWBF 2HNAA 1W19A 4X6XA 3AESB 1PP4A 1MG5A 1ENPA 1G42A 1WKCA 3M0EA 4LYEA 3UPDA 1KE1A 1P91A 4PX5A 1G9XA 2M98A 3ZHTA 4RO0A 4ZHQA 2YBEA 1UT5A 4G4JA 4WK6A 1W4RA 4FOSA 4GSYA 3HU1A 1H69A 3KHUA 3W5IA 3PLRA 3U7FB 1NXTA 3O95A 2ES4A 3SHVA 4I7EA 3P9IA 4OKIA 3K92A 3RIXA 4WLUA 3OFNA 5CLGA 2PLFA 3IPXA 4QPZA 2CLOB 1VMDA 2C78A 2G88A 2N75A 4INOA 4X3PA 2V3WA 2I6FA 4E5SA 2P9EA 5JO9A 3S55A 1C0KA 3CNHA 3NT5A 4J4HA 1UBCA 5IF9A 1JLRA 2IF0A 3H6GA 1NN0A 4RSHA 1EK1A 3AF4A 3QKSA 3WNVA 3ZVKA 2SKEA 3ADBA 2O2IA 1ZM3A 3I6ZA 2Q07A 2V6GA 3NVMB 2FPIA 4G0ZA 3IT0A 1RT9A 2BVNA 4A6EA 1R88A 1QP7A 4FFDA 1H1LB 3MLEA 5AJHA 4C03A 3WZMA 1FVFA 2QYSA 1EWQA 3HFGA 3DOOA 4BX3A 4UQPA 3QFTA 4G0NA 3UN1A 5I7OA 4AS1A 3IV7A 2RH5A 1BSVA 1NE2A 3K9CA 3O3OB 3V2HA 1NW6A 1TD1A 1VE5A 5BQFA 2CXXA 2GM9A 1G6HA 2FEMA 3MJFA 5BSHA 3V33A 2AMFA 1HDIA 1H9BA 1JHAA 3ICCA 3IQDB 3KQSA 4MVJM 4F84A 2WU4A 3OZGA 3K0CA 1IHDA 2HSGA 1UADA 3KXIA 3SE7A 2CVFA 1E1CB 4RX1A 4YUWA 4IOKA 1WOMA 4MIKA 4RDXA 3R9XA 4P53A 1DIBA 1FFGA 1XEWY 2RGBA 4K6HA 3U49A 3V1KA 4FWBA 4ND8B 3VZQA 4G0VA 1V5WA 4FNMA 1UK7A 1CX9B 4TV8B 3VO2A 1BDBA 3EJWA 4FGKA 3ZHOA 4H6PA 5CRIA 4ZI5A 1ZH0A 1L4HA 2J0VA 7ABPA 4XPZA 1XQXA 3DTVA 5FBHA 1PRYA 5T64A 3UK0A 1EK2A 5KYXA 3D8RA 1XCLA 3ILVA 5CT5A 3HDVA 3O31A 1AUPA 3KOWA 4NPCA 3AUFA 4RVDA 1GNQA 2AG8A 1D4FA 5SYMA 3EEIA 1NUSA 4JODA 1LVUA 2EQ5A 5JXGA 4RHXA 3AVYA 2EL9A 2KM1A 3JRNA 2BKEA 3ZXSA 2A9QA 3W34A 7MDHA 1PFGA 2G0TA 1VCHA 4E5KA 3JYPA 4BVHA 1QC5B 1Z18A 2WTBA 4PO8A 3LAWA 2VOJA 5AW5A 1XA3A 3LQKA 4QAQA 4YQFA 3B36A 2MR5A 3OCYA 3ZBUA 3IP6A 2EJTA 1LV7A 3QPCA 1CQXA 3WY9A 3RS9A 4CT0A 3AFOA 2UZ4A 1GM5A 3EH1A 5DV9A 4A27A 4R5MA 1TECE 1Z9BA 4DEYA 3ZZNA 4MW9A 1KE2A 4A15A 4CF6A 4KSYA 2HMYB 2E2WA 3BQMB 3FSGA 1D4OA 1CDEA 3CPEA 3TE6A 4LCEA 5THKA 1UKBA 2V7QD 4EJ6A 3G79A 3GRFA 4W1RA 1J2RA 5BUSA 1VHJA 5BT9A 3AVWA 4GLOA 4FFNA 4YAOA 1E4VA 4EFKA 1E7YA 3C1TA 4PGFA 4IJ5A 3D43A 5CJJA 1L7MA 2OYSA 4AB1A 1BAPA 4D45A 2Q9BA 1U2RA 3KHTA 3LX5A 4J0EA 4WN3A 4BVKA 5EJ7A 3OOEA 1SCJA 1E6WA 3J7TA 1RDFA 1YS4A 3MB5A 5B6PA 3MLAA 2R6GA 4GF5A 3DV0B 3RHTA 4E70A 3MMXA 4BEBA 4EA9A 1EFCA 2GN8A 3H99A 4YONB 3TSZA 4Z6KA 3U44A 2DXIA 4WASA 2C2YA 3O47A 5HMLA 1EFHA 4BMZA 5BUQA 2WKPA 1CEYA 4TS1A 5I5GA 3UT5A 2YKGA 2VH5R 2FN4A 3NBKA 2OZPA 3PNSA 4LMBA 4DYHA 2HYIC 3KZOA 2RIPA 2EBHX 1G21A 4NCXA 1IBMB 1YA8A 2ZBPA 5ALKA 4UZFA 2XUJA 5NLLA 1RNLA 3MCZA 4D9GA 5K0BA 1N5LA 3OLXA 1WXDA 1YE5A 1VL5A 2EFCB 3QTLA 2OVBA 2GARA 4CMJA 4NXNB 1FFAA 5HUQA 4H7IA 2WOJA 4CIYA 4V3BA 1QHHB 2Y1KA 5L3VA 2XI4A 3TNJA 3WHPA 1YQDA 2XTNA 3C3CA 3COSA 2VHUA 3L0PA 3RUAA 3VGPA 3GL9A 1NLUA 1ODLA 5C1PA 4CXMA 2FUG1 5D1HA 4EFDA 3W3ZB 1IM8A 5KTYA 1C1HA 2AI1A 4RKEA 1HETA 3B1WA 4ZQHA 4KG7A 1U8UA 2YBDA 4MRSA 1WZNA 1OWPA 3UIEA 4C7OA 4QBIA 3D2BA 3ZY2A 5TGTA 4L1KA 5J5AA 1R4MB 3K1ZA 2H1IA 1VLJA 4FBMA 4AN0A 3IVAA 1PS8A 2QJOA 1CHDA 1CUEA 3AJAA 3I9OA 3CURA 1FX1A 5HIAA 4M49A 2VJMA 1TDJA 3BULA 3GVXA 4B2LA 3DEAA 2ENUA 5EPEA 4AT1A 1WHTB 2C3MA 3N28A 1K3TA 2YJTD 3PDUA 5EPOA 1V26A 4B3BA 3KQUA 4JYMA 4JBIA 1P81A 5IBQA 4I4NA 4V1CB 1OKKD 4GXTA 3TJZA 1AGXA 3EVGA 2BEVA 4O2BB 4QFMA 3W5AA 3ZZMA 4LHYA 3I5XA 5A9SB 5AHKA 1RLMA 4P34A 4S05A 4HUQB 2P9CA 4FKBA 4F4CA 1USWA 4L22A 1RCTE 3CPHA 5AI5A 4B1FA 5FBLB 1YB6A 2JJ2A 5A03A 1X94A 1SH7A 1OYYA 1ULUA 2DBVO 1R6BX 1PZXA 2NYRA 2ZCVA 1YQQA 2C8KA 3JD4A 3KT8A 2JFQA 1NUTA 1BE6A 4XEUA 4RQAA 1E1KA 5ITVA 2JI6A 3DEJA 3AY3A 3L92A 4KZKA 3VOTA 1W85A 5KX5F 3DOCA 4RZXA 3KXPA 4BNIA 1WUKS 3N0TA 4P93A 3EGOA 4LDZA 4MJLA 3RROA 5LPNA 4PG6A 1HQDA 4OHMA 2XIJA 3ABRB 3CB2A 1T1RA 2JGDA 3K0CC 5B58T 3THYA 4H2DA 3TIGA 2CLFB 4ZARA 5IH3A 1D0SA 5GWXA 2FZEA 2PKEA 1ZJJA 3MQ2A 4EAQA 1G8SA 1WE2A 2IU6A 4DHWA 5IDQA 2AKAB 1QYCA 1E2MA 1M76A 3UJ3X 1N7GA 1Y1SA 4CL2A 3LOQA 1NFRA 1JFSA 2Z8XA 1SG9A 1OV4A 2JAQA 2AKYA 2OOSA 3IIJA 5EJFA 4EVRA 2OV3A 2C5FA 1KI9A 1FYDA 1SIWA 4P81A 3TPZA 1XR3A 3ZS9A 4K2AA 2VLBA 4O6VA 1ODKA 3G5AA 3WJ7A 2NZJA 5KVVA 4Y2JA 4IIYA 1IXYA 1S2IA 3QBEA 4RV5A 3BFJA 2WT8A 3TWOA 1KDPA 1CEXA 2V5AA 2YN0A 5IP5A 4FZJA 4CTNA 5LDHA 2ERCA 3JVEA 2Q5HA 2W37A 2A84A 1DPGA 5D00A 2J0UA 2GZMA 1ZI6A 4EOGA 4Q15A 4AJ1A 1ESCA 3EQ2A 1X3LA 4QO7A 3UV3A 2GK7A 3BILA 1J7KA 2IP1A 3ZEAA 2COKA 3A1UA 3AT1A 1NF9A 3M6MD 1K3UB 1W0KD 3P5BA 3TZCA 1WXXA 3BWVA 3KL2A 1GNTA 3O8QB 2DQYA 4NQZA 1CR0A 2NW6A 3HCPA 3G5UA 3R0IA 4Z3DA 4AKGA 3PQ4A 3OQIA 2YYSA 3MD0A 5CNMA 5GONB 5I45A 5IKXA 2YWEA 2WUGA 4PLVA 5AH0A 3WL4A 4ZV4A 5JPDA 2QM0A 1A7AA 3DAFA 3RREA 5IBPA 2GZSA 4A2CA 2ZJ6A 1DBWA 2AH5A 5EUQB 3IAEA 4D4JA 4QU0A 3R5SA 2OYRA 1RW4A 4ND2A 9LDBA 1X1CA 2RAFA 1PJ2A 2BKLA 2GXQA 3PPIA 2XZOA 3BT7A 1H2RS 4LF8B 4OP1A 1BVYF 1BCRB 5LXTF 3TXYA 1IZYA 3FOAA 1EA7A 4AXXA 2QMQA 3KG2A 5HKAA 3NHMA 4FINA 1LF0A 1XXHA 1NATA 1I94B 2IHNA 2FFQA 2JI4A 1EMDA 4WD3A 2UXDB 3ZZTA 2H4FA 3KJQA 4BWYA 4RPCA 3NAQA 5EKXA 4MDFA 3PFKA 1JPJA 1ZN9A 5IZCA 1C7RA 1IATA 1ZNXA 3H16A 3HBNA 4OHYA 1Z8HA 5HCNA 3I6MA 3A37A 3ZE9A 3BMQB 4C2AA 6Q21A 3O73A 1YE8A 3FDFA 4NJMB 3QPDA 4JR0A 2F43A 4W7IA 4AY2A 2W6QA 4POOA 5LZ5A 2JARA 3WLIA 3FUWA 4ZQEA 1OWOA 3B9RA 2F9LA 4JAVC 5F23A 3L46A 1NBHA 1ULZA 3SNHA 3K0EA 4QGAA 1PGQA 1ULTA 2IUFA 3MTQA 1QK3A 2ERXA 2C5GA 4K9SA 4AMVA 4B44A 4CG1A 4RY2A 1TEZA 2RJ3A 3P4UA 2VJOA 4HLCA 3UOGA 3QVMA 2OHXA 4ND6A 4TVBA 3NWEA 4JBWA 4LXYA 2DWQA 3FDZB 2H1VA 3GUZA 5COBA 1I9CA 3EPRA 4L74A 2ZZKA 4D3XA 4M9CA 2EP5A 2FNAA 1EWRA 2PX3A 3CBQA 1P1JA 5JYDA 4IUCS 4Y6PA 2C94A 4PPFA 5J2UF 2V6BA 1T2NA 1PKEA 2INGX 3FHTA 3KS9A 4CEHB 1BN6A 1WUYA 3SYNA 4ER0A 4YAGA 1XCOA 4RGBA 3RK4A 4CYMA 1Q77A 3AB3A 5LQMA 3NMUF 1E2QA 4JJEA 3WB9A 5ES4B 2JLYA 4RH1A 3EPKA 4KMRA 3GP3A 1G16A 1SQ0A 4E1AA 1HDGO 2WD7B 1NVWQ 4PHGA 2HMSA 4RLFA 4TTSA 4TQGA 1QP4A 1PEYA 4L7QA 1GUZA 2DPHA 2WHQA 5DASA 3ZTYA 3ZV7A 5LKRA 4R8SA 3W8FA 3JZAA 4DLVA 2VFAA 3F6YA 4TM8A 3GLGE 1Y5MA 1MX3A 1VA5A 1DUVG 2HU8A 2CNBA 3NTXA 4OP2A 5DBFA 3WLSA 2JFFA 2RHHA 2R25B 1ZMBA 3QELB 4MVJE 5BQ3A 4BOYA 1RS0A 4CKZA 3AILA 4JQSA 1YULA 4Q1FA 4D74A 1CUYA 3EIQA 4FTWA 1U3TA 1USIA 1MTZA 2DQZA 1VCMA 3RYFA 3U3ZA 4ZYZA 1MIOB 4HB3A 4R2IA 1T15A 3D8NA 4RV4A 4BV3A 2ZYWX 3WLPA 3T7AA 4B31A 5GM2A 3PRJA 2QM3A 1QE3A 4O29A 1X1EA 3UAZA 4WNYA 1GUFA 4EG4A 2YJ5A 4IRUB 4EG5A 1W48A 4TTPA 4HGYA 3OQVA 4YV7A 1E9SA 4NZYA 2NSDA 1QV6A 4RJJA 1P8AA 1PR2A 4KC0A 1NDQA 3KKLA 4W5TA 3LO5A 4JT9A 4RPHA 4KBFA 4MPJA 1SQFA 4YLYA 2C7VA 3NHLA 3UEOA 4N8SA 1LI4A 3EA0A 2IQIA 3GLHA 5KX5A 3NIDB 1U65A 1UBKS 1OSNA 3NALA 4LMAA 5IXJA 1O8BA 3EE6A 3WISA 4JP8A 1EK5A 2E82A 1TA9A 2JAXA 1V25A 4MI3A 4R71A 4YJGA 5HJ5A 3P20A 2XMPA 5FORA 3STWA 2WRZA 4TOIA 3LCMA 3K16A 3D54D 3KYIB 3QVUA 1OW3B 5H4HA 1EDOA 3FFBA 3QVXA 3VU0A 1R5OA 4E30A 3BWYA 2ISQA 3IBSA 3NONA 4I1YA 3UQZA 1YFKA 4DLSA 4DMRA 2ZUBA 1T8RA 3IQXA 1GUDA 3U1TA 4XDZA 2ZWAA 3GIWA 1JQBA 4HRXA 3GAZA 1RPTA 4IVRA 1XQVA 2XADA 4D9IA 4KV9A 1UBNA 2JNWA 2VG8A 1XD8A 2WM8A 4HLUA 1YD7A 2J32A 3MRXA 2IW1A 3ZWAA 2OESA 5GGYA 1NZDA 1R64A 4L8FA 3Q9UA 4E1BA 5JD3A 5AVJA 1NM5A 3QWHA 2IYVA 2O2YA 2XXJA 4JBHA 4KRGA 1DQPA 1YL7A 5FRDA 1MR3F 1MOPA 3T95A 3QWIA 3ELBA 1YK0A 3KV1A 1ZESA 1PWYE 2D2EA 2FSVA 2CY0A 1Y48E 3VDXA 1PR9A 2FF7A 2ODAA 2BD0A 1H6BA 3A3YA 3B3QA 3GEEA 2Z2ZA 1BX0A 2CLSA 4U7TB 2VLIA 4CF4A 4PZEA 4GBMA 3T54A 2R6ZA 2R1VA 4WCFB 3MWEB 2D00A 3BREA 4ZDKA 1R00A 3G68A 5TQVA 1QIDA 2ZQ5A 3NTLA 4HC4A 3DHVA 4DLZA 5ECWA 3W05A 2XSZA 2AVDA 1LCIA 1W4ZA 2RCNA 1JR3E 2X41A 4AIIA 2VF4X 4H1TA 3TIVA 3RF6A 4A3SA 2B0JA 3LP6A 4NYMQ 2UVDA 4GOLD 4XH9B 1PK9A 1X8LA 3AF0A 4RA9B 3U6BA 1DTWA 3DV2A 3IMFA 1TZCA 3QX9A 2WM3A 4WLNA 5LXTA 1JEYA 4PFJA 4P6VF 5FFMA 2O52A 1Q7RA 3P2JA 4ARZA 3JD0A 3IV6A 4RAQA 4BV2A 1N8KA 4JJ6A 3ES9A 3W78A 4Z2AA 1M66A 3A1FA 4GE3A 3ANMA 2WFZA 3A6GA 3PJEA 4UTPA 1M7GA 5FYDA 4RIFA 4BNLA 3KVNA 1BYUA 1E3LA 2JIMA 3OOJA 3UK1A 3B5IA 1FY2A 1N7IA 3FNQA 5C51B 4UCXA 1XTRA 1K7FB 4R5HA 2G5PA 4XARA 4Y8VA 2PUAA 2MYNA 4RF5A 4PG8A 4XD7D 1FEZA 1UJMA 3M5PA 4Q7LA 4O08A 3SDSA 4LFCB 2HMWA 2PUWA 5DN9A 4N5DA 5DXAA 2ZK7A 4NHOA 1XRLA 2J1LA 3DM9B 3E9NA 1MT3A 3NH6A 3BSFA 3SDBA 3I4CA 4FN4A 4GZLA 4G09A 2WICA 3HMQA 3C41J 3N53A 4LV5B 1QCDA 2W00A 5CK5A 3SK0A 1CLUA 3EMDA 3UJ9A 1SXPA 4HAYA 3QLEA 1GWNA 1XUOA 5I7AA 1TAHA 4K2HA 2VBFA 2UXBB 1JIVA 4O8ZA 3RWBA 2ID4A 3P27A 4MV5A 3ZXYA 3RASA 2ZYHA 4AQ7A 1KZ4A 1OLOA 2A4KA 3A4MA 4XWAA 4WFQA 4ZEMA 2I2AA 2UZIR 4R2MA 3X1JA 2I54A 4KQ6A 2X8LA 1KH2A 3C8UA 2AX3A 3GJXC 1JA1A 2ZUVA 3G7UA 1E2IA 3IRVA 3GT4A 1L4FA 4MTCA 5IYZB 2QPTA 5J2UA 1Z06A 3M6UA 1I7NA 4ZVRA 1NVEA 3AERB 2GN2A 1PS9A 1A95A 1EI9A 1R0LA 3LYHA 1VLQA 3AJ9A 5I7EA 5KQMA 1TU3A 2Q6OA 2ZRFA 4NZMA 3EYAA 1WXFA 2BW0A 3KLMX 2EXXA 3OQBA 4UATA 1P19A 3TTWA 4RWZA 1RBMA 1ISGA 4A73A 2JCXA 2AN4A 1CY8A 2VYVD 2WUVA 1GUYA 4PLYA 3B1JA 2VBCA 3NBFA 1QYIA 4QTXA 5LZ2A 3PGLA 4E2ZA 4WA8A 2IUUA 2DKOA 4DC0A 3NNNA 4J9VA 4HH4A 4I55B 1AS0A 4P0PB 1OFGA 4N3NA 1JEEA 1FRZA 2I4LA 2J6BA 2DU8A 4QDXA 3W6PA 3WO0A 4DR1B 2XWJI 4BO7A 3R3WA 3IVMA 2RGYA 3QPBA 1YE3A 1JFLA 2Z4RA 3KD2A 1UOEA 3LKVA 1KEPA 4IDGA 4R1NA 2YOHA 4U02A 3W06A 3QHAA 4RULA 2PH7A 1RABA 3OPQA 4G63A 2P7IA 1W34A 2VT6A 3AR6A 2XGSA 2H9IA 2NU9A 1RE0A 3DP9A 3MZ0A 2W98A 4KK4A 3VPGA 2FQWA 3TLEA 1E7SA 5F73A 4CL3A 4D81A 1AY0A 1YV9A 4C21A 5LA6B 5T7BA 2FK7A 3AVUA 1Y7LA 2BEUB 3PG5A 4U2BA 4YQZA 3D6TB 2AEEA 2Q4OA 1OBHA 2PEZA 3LCCA 4A2QA 3KTOA 1B8UA 4PCAA 4ETMA 1II8B 5JH7F 2UUAB 2BE7A 3UMFA 4M8LA 2E89A 4NBSA 1U8YA 1WUHS 2BKVA 4FDMA 2ATVA 4CIBA 5DNYB 4O2LA 5BW8A 4P1ZA 2BFOA 5BWCA 5K3OA 1ZI8A 8LDHA 3RS4A 3WRWA 5D01A 5D5HA 4QYIB 4HNUA 5HR5A 2OBYA 1I3CA 2HFJA 2JC3A 5C7OO 5CDTA 1M3SA 5HM8A 3N2KB 3UCXA 2PZAA 5HZGA 2ID8A 1JDZA 4LEIA 2B35A 3DLPX 3SEZA 2B20A 3V55A 4K9RA 3T7RA 3RJZA 4E07A 3HG7A 2Q62A 3P26A 3OZAA 2C1XA 1UKAA 1U8ZA 3SIPA 2PL9A 1NM5C 1H5QA 4BX8A 1QNLA 3RFXA 2CLMB 4Y6LA 3ZIAA 3RRBA 3GZJA 4D8UA 2P9GA 4XUDA 2P0AA 3GNLA 4V02A 4Z54A 2OCAA 1ZRMA 4BFXA 4L28A 5KMGB 3GLIA 1QB7A 4HZIA 3MIIA 1M34B 4UD6A 5IDVA 2YJ4A 4ZAZA 3IE0A 2O54A 5I9MA 2FSVC 1OBOA 3QPWA 4QOSA 2X58A 1DG1G 1G7TA 3NG1A 3FH0A 4DIKA 5KC9A 1DVRA 4MNTA 1XVIA 4EPXA 2A9VA 4ZAYA 3VPFA 4BP3A 1NY5A 4HEA6 2RGEA 1EVQA 3OZWA 3L02A 1E5XA 2WU8A 1JVNA 1V7QA 1KS9A 1P1KA 1PAUA 2QTFA 3U3MA 5FTLA 3KLPX 4B82A 1P9RA 5J4LA 2YZMA 3MJCA 2Z6UA 3TR0A 5GJCA 3HN7A 3Q3HA 2IYQA 1H3EA 4NDNE 3ZCRA 2ADFA 2FGKA 4Q1CA 1JG4A 2CE7A 1EHIA 3E4DA 1Q5PA 4HMOA 1N2OA 1P18A 4JL8A 5C37A 2R60A 1HSZA 1PR3A 3R5XA 5F1PA 2RKBA 4NBKA 1GPH1 5P21A 3MN1A 4XIFA 3VC3A 2P62A 1R6TA 2JFGA 4TQ9A 1YASA 1NX9A 5FAKA 2ZRHA 3LE8A 1R0XA 5E9QA 1GDTA 4RTLA 2RGRA 3PKZA 1FRNA 4ADSG 1EFPA 2C57A 3KDSE 2CLEB 3PENA 1JHPA 3GW8A 1SKUA 2ECFA 2O2EA 4IIFA 5DLDA 4RVFA 1JEQA 1W75A 1A9TA 4O25A 2AV6A 4D9JA 1H8HD 2ZYUX 4XRRA 5CITA 1GFWA 2CBXA 4KYTA 2ZXUA 3PX7A 3C45A 2PMEA 2TECE 1JHVA 3WV5A 1Z3IX 3X1MA 3AF2A 2JGEA 3ZDYB 1Q3HA 3N70A 1U1EA 3T9DA 4IBOA 2QTVA 3GUYA 3AJ8A 3MINA 5DB4A 4HY3A 1GCUA 5HE8A 1T2UA 3AKZA 4JELA 2GWHA 4Q7EA 2BFCB 2E3JA 2Q2WA 3JTMA 4RL6A 4WCDA 2IK8A 4CM7A 4ZVOA 4BCBA 1OGIA 2R1UA 2ZM6B 4Z4QA 1W93A 1QTIA 16PKA 2UZ1B 4LHVA 3OPNA 1MTOA 1RKBA 3SGLA 3IVXA 2VK1A 3GDWA 4LC1A 1I30A 1WZCA 3HL4A 2GN9A 3HA3A 4CKEB 3R5TA 2CSXA 1N9ZA 2BZGA 3K32A 1PHRA 1ZIOA 4BO9A 2IEZA 3Q9NA 1LPBB 2PR2A 4UUMA 2F9MA 4R1OA 4ZQGA 2XYHA 4DR5B 2Z8ZA 1Z63A 4ZFNA 3IEIA 4D97A 3D3QA 1XVVA 5LWHA 4IG9A 4C2UA 2GESA 2X5OA 1JJFA 3KR0A 4KUHA 4ZREA 4BQPA 1T4GA 3J81k 3K0SA 1F06A 1Z36A 5DBGA 3KU1A 3PCTA 4OUDB 1PT5A 1Q2XA 1ULAA 2HUNA 4IRMA 4K26A 5CG2A 1CNMA 1N75A 3ZN2A 2ZKIA 1HMPA 2R8EA 3GPIA 3WL8A 4BYMA 4R1LA 5BN3B 2CXOA 3KQQA 3NT2A 1H2XA 5DWVA 1NI5A 1YOVB 2VZ0A 3E7PA 5IBRA 3T3PB 2XAAA 4AO6A 1MAUA 1MHPA 3HA7A 2IP4A 4DKJA 2H5EA 3HCCA 2VKQA 4LPSA 2EOAA 5ALSA 4ZODA 2RI1A 5DLQC 3EBOA 1Q20A 1IBSA 3JATA 2XKJE 4J7AA 3ZW8A 5CBPA 5HS4A 1T6YA 2CCGA 3ENZA 2CEKA 4M6WB 5H3LA 4R40A 2REQA 4BVLA 2CMHA 3I0NA 1C0PA 1U4NA 5K03A 3ZTTA 3PFCA 2RBEA 3G0GA 4HNQA 3CC8A 1T2FA 3EC1A 1M8KA 1S89A 5HKLA 1G4HA 2B7CA 3M6WA 3P9PA 3UWMA 3DAYA 1TM3E 4J76A 1I1OA 3PYXA 3RKRA 3T1YB 3T3EA 4EBFA 4IFBA 1NXVA 2ZE7A 3HJCA 1TU4A 1VP9A 1UFOA 2XNKA 5FTWA 4M9UA 2PGJA 5SZKB 2ATIA 1ZINA 5LYYA 4I1PA 4DPMA 2I7VA 1NAIA 3D8TA 4QNRA 4XUCA 5EE0A 4DM4A 1VCIA 1W5SA 4YCCA 5LFAA 4UHEA 2OLKA 3DOJA 1WSDA 3AQ4A 2PX6A 4GX0A 1TEVA 4W8HA 4S1VA 3RSFA 4MA5A 1RHKA 4JFAA 1QSGA 3R6TA 1O03A 2W2LA 2D7CA 3A9UA 3SZMA 2JRCA 4YAUA 3B3GA 3QNWA 1S1CA 2QE7A 1C7IA 2QD1A 4X6UA 1J2EA 1QF7A 1P4SA 1Y6ZA 4H15A 1HDYA 1S8OA 3OMXA 3ZVLA 4LVCA 5FXMA 2XBUA 4QYSA 3L6CA 2OHVA 3FTEA 4ZALA 1EDDA 2XHEA 2FSPA 2VTBB 3KQTA 1V16B 2ZI9A 3D2LA 1EX9A 3ISJA 4P2BA 4YWJA 2GOYA 3MELA 3MSXA 5JH7A 2NPOA 3AI7A 1T43A 2XCSB 4OAPA 5ECYA 2IRWA 1ZOOA 2VWQA 3D5QA 3EF0A 3NC1C 4G24A 1V3QE 4HOYA 2QTMA 2KBEA 3EHEA 4WTOA 4BB9A 5JBNA 2MTBA 2ZJ7A 4EZIA 5B1SA 3K8OE 3OETA 3V48A 4BLOA 4OO3A 2B9VA 4HNAA 3U9SA 1P2SA 1ISMA 4X61A 3MWYW 3EIWA 2EBUA 1L2TA 3DL2A 2C54A 2HDOA 2GLUA 3E8SA 4MGIR 3WWYA 3R6LA 2FPXA 3MJDA 3NM6B 3LDGA 4HB4A 3JALB 5DP1A 1SVUA 4L75A 4PCVA 4GI3A 3PWKA 2GEUA 1Z5NA 1DJNA 1DIAA 2G1UA 3CSUA 5A04A 4P80A 2VPPA 3LCRA 3E35A 4KAFA 1M0TA 1G7RA 4B74A 1DEOA 3D8SA 4RZ2A 2Q4DA 4CKBB 2WF5A 3B1FA 4JGGA 4TWJA 1SBIA 1NQTA 3MWGA 3SX2A 3ZZ0A 4ENRA 5MN5A 5EKUA 5JS6A 1NI4A 4EYEA 4V2IA 1X13A 3ESXA 4YBZA 4JLMA 3CKKA 4IIJF 4PZ0A 3ZV6A 3H8VA 1LA2A 3T7SA 2Z3VA 3I9LA 1I7LA 5FA6A 3SQLA 1TAUA 2NTNA 2DH6A 3GFGA 4IWXA 2LKDA 2I6GA 3VU3A 2HI0A 1QCCA 3EVBA 2E5WA 2OHFA 4HNRA 4IV8A 2O3SA 4MRPA 4JB8A 4I6EA 1PNVA 4IF4A 4Z0PA 1P74A 3ET4A 4ZK2A 5FOQA 3LQQA 3U4CA 4IHAA 4ND1A 1U04A 5KHLB 4Z9FA 3VYWA 1ZW1A 3DKIA 3AEYA 3WNDA 3WX0A 3OFKA 2OGWA 2BCGY 4YRPA 4H1WA 1A4RA 4M2LA 4G5HA 4LRUA 1GGJA 4LQCA 3EOBI 4GC5A 3B8HA 4M9ZA 4PBTA 1DKUA 1UJ2A 3NHFA 4G97A 4IPTA 4QC2A 3CLKA 2A2ZA 1B26A 5C4IA 4I99A 5IDYA 5H82A 4DG5A 5I7UA 1L3BA 4MEJA 4ZYLA 5B7QA 1KEVA 3N87A 2GK3A 1I0IA 5KYKA 3AVXA 2GBPA 3QUQA 2VO1A 4DF3A 3FCXA 1E2BA 1Y4UA 3HCOA 4F56A 5H83A 3DZGA 1PQUA 1VC2A 3MWFA 2NUAB 4D26A 3Q0IA 4WBNF 2J4FA 2VP3A 1F2TA 1GZUA 1ZHHA 2B78A 5LP6A 3GFFA 2YJ6A 1MVLA 3GLFB 4Q4AA 4KR3A 3RE1A 1J56A 2P9JA 1KVRA 3C97A 4UVIA 3L0BA 5EHGA 2I1VB 3DMGA 4RJTA 1FP2A 1SXJA 5JMPA 3F6BX 1G8YA 2PT5A 3PPWA 4Q9DA 5FPHA 4NBVA 1E6LA 2OBLA 2IHUA 4JYPA 1KBZA 4V0LA 1SVMA 1KP3A 3HSYA 1JI0A 1CQIB 1ECJA 4UM9D 3UNXA 4X7BA 1SPXA 1XDBA 2VSNA 2XMQA 3FMPB 3H7AA 1W5EA 3OHMA 5E4YA 4RMHA 4MS3B 1Q7CA 3QVKA 5BSUA 3T1OA 1EINA 4LBZA 4RANA 4TKLA 1ZU4A 1DX4A 2WINI 3CNLA 1PNTA 2IV2X 4Q4HA 4CLHA 4DLLA 1QRDA 4QUHA 4H1HA 1YF3A 3DTVD 5F51A 3G2NA 4HSGA 3ZV3A 3BBLA 3I42A 1V1MB 2ZRDA 1ZHFA 4QFDA 4IQ8A 3JQAA 3MWDA 2IYOA 2VATA 4S12A 4B3FX 2X3UA 3HCWA 3VKGA 1I1QB 2X0FA 2R7KA 1Y7PA 1OZHA 1CRLA 2I3GA 1UBRS 1WU7A 3QM1A 1QH8A 5FA5A 4BE4A 4GAEA 4AJNA 5I4CA 3NBYC 2DPGA 1EAMA 1JYFA 3EG5A 4KQ2A 4KAAA 2CCJA 1NU8A 2ZKLA 3R24A 4MW4A 4HB0A 4RMJA 1BXRB 4UNSA 1M1NA 3ZIUA 4K8RB 1DDOA 3ZX4A 5ER9A 1SAYA 3RDPA 3ZWQA 1CTQA 4PWZA 1J97A 4W6QA 3T4UA 4CLOA 3LM8A 3N39C 2OORA 4Y0VA 1ORTA 2BOVA 1CUSA 5DLEA 1ARZA 1J90A 1C2TA 4OL0A 2BE9A 3BDIA 2I6SA 3DE1X 4G67A 4DLNA 4Q02A 4F4UA 1Q0ZA 3G8YA 2QV0A 4LG1A 3FSGD 5LYJF 1WB4A 1K92A 2HTFA 1W30A 2OO5A 5AQEA 1EU1A 4TLAA 2CMDA 1OXKB 3HKDA 2HT6A 4E22A 3B6MA 2OAEA 4QODA 3SF8B 3UAYA 1N7HA 3L6RA 4CI9A 1BGWA 2JKVA 4FCWA 4HTFB 2IZZA 1M7HA 5A5GA 4Q3NA 4TMKA 1SKQA 1TF5A 4EO7A 1AURA 5KTNA 2EJVA 2H57A 3P9QA 4G1BA 1V96A 2HJRA 3KJNA 3CUUA 3LIPA 2G3YA 1ZJ5A 2V0GA 5K6AA 3LUBA 4JT8A 1NJ2A 2Q99A 2IEGA 1YRAA 2CSUA 5JE8A 4M36A 2RGAA 4XGQA 3C5HA 3T6KA 5C3MA 1IJFA 1ECGA 1HYQA 1SUSA 1WB6A 2XDQA 1KR2A 3EH2A 3KYCB 1FW6A 2PXHA 3F71A 4LTMA 4P9NA 3RTDA 3ZZ1A 2IDMA 2C9BA 1E7MA 2D54A 1ZP6A 4KQGA 3VJKA 4DJTA 4I19A 4E94A 2OC4A 1WDTA 2ZE5A 2ZRCA 3NWPA 2DX7A 3B6ZA 2PSSA 4D5EA 4B3JA 5FPQA 3RVRA 2H2HA 5HFJA 1AQNA 2PX2A 3H1GA 2Z2XA 2WWTA 1UIRA 4EARA 4JBYA 4I6JA 3CVVA 1ZXXA 3ZCVA 1ZAKA 2XRMA 3L1JA 4NS4A 5ESXA 5LJIA 4I08A 1W88A 3CXRA 2MOKA 4MR9B 2EARA 2W0MA 1XYGA 4M1EA 3LUFA 2GZ1A 1MFPA 4FMBB 4MVJP 3RJMA 3QEMA 4HWGA 1QBKC 2ATXA 2PD4A 4KITB 5KHOC 4RTOA 3UXYA 1FXWF 3PXGA 1XLVA 5EZQA 1ODJA 5E3JA 2LCIA 1DC4A 3JYOA 4EZBA 1UZLA 4Y18A 2IYXA 2PSJA 2X14A 4HLDA 4J1NA 5SZHB 3PXAA 3WK5A 5C53B 1POWA 1SCUB 3GJ5A 2H29A 1UAGA 1PZFA 4F93B 4JB3A 5DYIA 3PUXA 4I8XA 2C29D 2ZIWB 5ER6A 1MDBA 3ZCPA 3LPMA 3O8OB 2I1LA 5D3ZA 4IIJA 5BYJA 2PMKA 3DXYA 2IYFA 3HB0A 2AHRA 4PHFA 3O9MA 2NZWA 2IS4A 3O90A 3KQKA 4E32A 2XMGA 2I8LA 4FOTA 2YCLA 4S3MA 3OH8A 1XL0A 3T0IA 3WBJA 2BONA 3DYBA 4LZPA 2KX7A 5JI3E 2P9QA 5ALDA 2XAUA 2Q3BA 1RXIA 3U5ZB 4Q0MA 3YASA 1EA5A 2WHEA 4UNPA 3DMNA 2IL1A 4NF2A 3NHBA 3G0DA 1TKBA 2PSFA 2Y1XA 3CEMA 4XD2A 1GQOA 3BC1A 4UXHA 5AKJA 2FMKA 5LLSA 3CVJA 4D99A 2X1LA 4YUYA 4YMIA 4ALJA 4CDNA 4QJBA 5JJIA 1T5BA 1WNTA 3KQOA 1WU8A 2CNNA 3IP7A 4LFAB 3TLJA 4MMYB 2XUIA 1NXWA 2JJ2D 1K8ZB 3HI4A 2XBLA 4R8KA 3ESBA 1DHTA 1PFYA 2BKUA 2LP4Y 3C4QA 1GTL1 3HR4A 3IULA 5DN6A 1V5GA 5G0WA 3TX2A 5KWSA 4D80A 1EWKA 1EP2B 4DCJA 1FPQA 1L4UA 2FAXA 4K28A 4RDCA 4RIHA 4DIBA 2AZXA 3BIJA 1E32A 4X95A 3OPYA 3IOBA 4TWAA 5FUYA 5BRJA 1UFKA 3CFYA 1XELA 3VRHA 4WBNA 1LPPA 5EIBC 2QJTA 2WU0A 2MSCB 5BSGA 1DRJA 2G76A 2HBQA 1FJGB 2GB4A 1O89A 2OWDA 2BKXA 1Z2EA 3H0EA 2RHCA 4N18A 1V5EA 3U17A 4KFTA 3K4PA 4D9FA 1K4KA