4G0BA

Structure of native hct from coffea canephora
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
434
structure length
421
Chain Sequence
MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPALKTAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
publication title A structural basis for the biosynthesis of the major chlorogenic acids found in coffee.
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
total genus 124
structure length 421
sequence length 434
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g0bA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g0bA01
2RKTA 1EAEA 3MAEA 3FP0A 3B2SA 1C4TA 5DUAA 2E1TA 2II5A 4JN3A 4JN5A 4G22A 1E2OA 2VSQA 1QCAA 5KJTA 5T3EA 1CIAA 2CLAA 4KECA 3L60A 2IHWA 5KJSA 4CLAA 5DU9A 3CLAA 3FOTA 4N72A 5KJWA 1DPCA 1XMCA 2RKVA 3B30A 2ZBAA 1EACA 1DPDA 1EAFA 2I9DA 2JGPA 1EAAA 4G0BA 4HVMA 5FALA 1EADA 5KJUA 3U9FA 1XL7A 2XHGA 2E1UA 5FANA 2II4A 2BGHA 3U9BA 4G2MA 1XL8A 1L5AA 1PD5A 1XMDA 5KJVA 1Q9JA 2E1VA 1CLAA 1SCZA 1DPBA 1NOCB 1EABA 2II3A 2XR7A 1Q23A 4KE4A
chains in the Genus database with same CATH superfamily
2RKTA 3MAEA 2H3WA 4JN5A 4G22A 1QCAA 2FY2A 1T7QA 4CLAA 1EAFA 2DEBA 5FALA 1EADA 2FY4A 1XL8A 5KJVA 1Q9JA 2II3A 4EP9A 3B2SA 5DUAA 2E1TA 4EPHA 4JN3A 2VSQA 5KJSA 5DU9A 3CLAA 1DPCA 2I9DA 2FYOA 4G0BA 2JGPA 3U9FA 5FANA 1Q6XA 1T1UA 1L5AA 1XMDA 2RCUA 1T7OA 2E1VA 1CLAA 1SCZA 1EABA 1T7NA 2XR7A 4KE4A 1EAEA 1S5OA 3FP0A 1C4TA 2II5A 1E2OA 2CLAA 4KECA 2H3PA 5KJWA 3B30A 2RKVA 2H3UA 1DPDA 1EAAA 5KJUA 1XL7A 2II4A 2BGHA 3U9BA 4G2MA 1PD5A 1NOCB 1NDIA 1NM8A 2H4TA 2FY3A 1NDBA 5KJTA 5T3EA 1CIAA 3L60A 2IHWA 3FOTA 4N72A 1NDFA 1XMCA 2ZBAA 1EACA 4HVMA 2XHGA 2E1UA 2FY5A 2FW3A 1DPBA 1Q23A 4EYWA
chains in the Genus database with same CATH topology
2RKTA 1EAEA 3MAEA 3FP0A 3B2SA 1C4TA 5DUAA 2E1TA 2II5A 4JN3A 4JN5A 4G22A 1E2OA 2VSQA 1QCAA 5KJTA 5T3EA 1CIAA 2CLAA 4KECA 3L60A 2IHWA 5KJSA 4CLAA 5DU9A 3CLAA 3FOTA 4N72A 5KJWA 1DPCA 1XMCA 2RKVA 3B30A 2ZBAA 1EACA 1DPDA 1EAFA 2I9DA 2JGPA 1EAAA 4G0BA 4HVMA 5FALA 1EADA 5KJUA 3U9FA 1XL7A 2XHGA 2E1UA 5FANA 2II4A 2BGHA 3U9BA 4G2MA 1XL8A 1L5AA 1PD5A 1XMDA 5KJVA 1Q9JA 2E1VA 1CLAA 1SCZA 1DPBA 1NOCB 1EABA 2II3A 2XR7A 1Q23A 4KE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKT A;  1EAE A;  3MAE A;  3FP0 A;  3B2S A;  1C4T A;  5DUA A;  2E1T A;  2II5 A;  4JN3 A;  4JN5 A;  4G22 A;  1E2O A;  2VSQ A;  1QCA A;  5KJT A;  5T3E A;  1CIA A;  2CLA A;  4KEC A;  3L60 A;  2IHW A;  5KJS A;  4CLA A;  5DU9 A;  3CLA A;  3FOT A;  4N72 A;  5KJW A;  1DPC A;  1XMC A;  2RKV A;  3B30 A;  2ZBA A;  1EAC A;  1DPD A;  1EAF A;  2I9D A;  2JGP A;  1EAA A;  4G0B A;  4HVM A;  5FAL A;  1EAD A;  5KJU A;  3U9F A;  1XL7 A;  2XHG A;  2E1U A;  5FAN A;  2II4 A;  2BGH A;  3U9B A;  4G2M A;  1XL8 A;  1L5A A;  1PD5 A;  1XMD A;  5KJV A;  1Q9J A;  2E1V A;  1CLA A;  1SCZ A;  1DPB A;  1NOC B;  1EAB A;  2II3 A;  2XR7 A;  1Q23 A;  4KE4 A; 
#chains in the Genus database with same CATH topology
 2RKT A;  3MAE A;  2H3W A;  4JN5 A;  4G22 A;  1QCA A;  2FY2 A;  1T7Q A;  4CLA A;  1EAF A;  2DEB A;  5FAL A;  1EAD A;  2FY4 A;  1XL8 A;  5KJV A;  1Q9J A;  2II3 A;  4EP9 A;  3B2S A;  5DUA A;  2E1T A;  4EPH A;  4JN3 A;  2VSQ A;  5KJS A;  5DU9 A;  3CLA A;  1DPC A;  2I9D A;  2FYO A;  4G0B A;  2JGP A;  3U9F A;  5FAN A;  1Q6X A;  1T1U A;  1L5A A;  1XMD A;  2RCU A;  1T7O A;  2E1V A;  1CLA A;  1SCZ A;  1EAB A;  1T7N A;  2XR7 A;  4KE4 A;  1EAE A;  1S5O A;  3FP0 A;  1C4T A;  2II5 A;  1E2O A;  2CLA A;  4KEC A;  2H3P A;  5KJW A;  3B30 A;  2RKV A;  2H3U A;  1DPD A;  1EAA A;  5KJU A;  1XL7 A;  2II4 A;  2BGH A;  3U9B A;  4G2M A;  1PD5 A;  1NOC B;  1NDI A;  1NM8 A;  2H4T A;  2FY3 A;  1NDB A;  5KJT A;  5T3E A;  1CIA A;  3L60 A;  2IHW A;  3FOT A;  4N72 A;  1NDF A;  1XMC A;  2ZBA A;  1EAC A;  4HVM A;  2XHG A;  2E1U A;  2FY5 A;  2FW3 A;  1DPB A;  1Q23 A;  4EYW A; 
#chains in the Genus database with same CATH homology
 2RKT A;  1EAE A;  3MAE A;  3FP0 A;  3B2S A;  1C4T A;  5DUA A;  2E1T A;  2II5 A;  4JN3 A;  4JN5 A;  4G22 A;  1E2O A;  2VSQ A;  1QCA A;  5KJT A;  5T3E A;  1CIA A;  2CLA A;  4KEC A;  3L60 A;  2IHW A;  5KJS A;  4CLA A;  5DU9 A;  3CLA A;  3FOT A;  4N72 A;  5KJW A;  1DPC A;  1XMC A;  2RKV A;  3B30 A;  2ZBA A;  1EAC A;  1DPD A;  1EAF A;  2I9D A;  2JGP A;  1EAA A;  4G0B A;  4HVM A;  5FAL A;  1EAD A;  5KJU A;  3U9F A;  1XL7 A;  2XHG A;  2E1U A;  5FAN A;  2II4 A;  2BGH A;  3U9B A;  4G2M A;  1XL8 A;  1L5A A;  1PD5 A;  1XMD A;  5KJV A;  1Q9J A;  2E1V A;  1CLA A;  1SCZ A;  1DPB A;  1NOC B;  1EAB A;  2II3 A;  2XR7 A;  1Q23 A;  4KE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...