4G0BA

Structure of native hct from coffea canephora
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
434
structure length
421
Chain Sequence
MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPALKTAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
publication title A structural basis for the biosynthesis of the major chlorogenic acids found in coffee.
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
total genus 124
structure length 421
sequence length 434
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g0bA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g0bA01
1EAAA 1EAEA 1NOCB 2CLAA 1CLAA 2II3A 4N72A 1EACA 3CLAA 3FOTA 1XL8A 2VSQA 1Q23A 1XL7A 3B2SA 2BGHA 2II5A 4G0BA 1QCAA 5T3EA 1XMDA 1Q9JA 4KE4A 5DU9A 2E1VA 2JGPA 5KJSA 3B30A 3U9BA 2ZBAA 5KJWA 1EADA 4G2MA 1C4TA 5DUAA 3MAEA 1DPCA 3U9FA 2XHGA 5KJTA 5KJUA 1E2OA 1EABA 1XMCA 2I9DA 2IHWA 2RKTA 5KJVA 1CIAA 2XR7A 1SCZA 1L5AA 4G22A 4JN5A 2E1UA 3L60A 2II4A 1DPBA 4KECA 1DPDA 4JN3A 4CLAA 5FANA 5FALA 2RKVA 4HVMA 2E1TA 1PD5A 3FP0A 1EAFA
chains in the Genus database with same CATH superfamily
2FY4A 1EAEA 4N72A 1NM8A 3CLAA 1T7QA 2FY3A 1T7OA 2RCUA 4KE4A 5T3EA 5KJSA 3B30A 2ZBAA 1EADA 2H4TA 5KJTA 2IHWA 4JN5A 2E1UA 3L60A 1DPBA 4KECA 1DPDA 1NDFA 1EAFA 2II3A 1NDBA 2FY5A 2FYOA 3FOTA 1XL8A 2II5A 1Q9JA 2E1VA 1C4TA 3U9FA 1XMCA 1L5AA 2FW3A 1S5OA 2II4A 4CLAA 2RKVA 4HVMA 2H3WA 2H3PA 1NOCB 2CLAA 1EACA 1Q23A 1XL7A 2BGHA 4G0BA 2JGPA 3U9BA 1DPCA 1E2OA 5KJVA 1CIAA 2H3UA 4G22A 4JN3A 5FANA 2E1TA 1PD5A 1EAAA 1CLAA 1T7NA 2FY2A 2VSQA 1Q6XA 1T1UA 4EPHA 3B2SA 1NDIA 1QCAA 4EYWA 1XMDA 5DU9A 5KJWA 4G2MA 5DUAA 3MAEA 2XHGA 5KJUA 1EABA 2I9DA 2RKTA 2XR7A 1SCZA 4EP9A 5FALA 2DEBA 3FP0A
chains in the Genus database with same CATH topology
1EAAA 1EAEA 1NOCB 2CLAA 1CLAA 2II3A 4N72A 1EACA 3CLAA 3FOTA 1XL8A 2VSQA 1Q23A 1XL7A 3B2SA 2BGHA 2II5A 4G0BA 1QCAA 5T3EA 1XMDA 1Q9JA 4KE4A 5DU9A 2E1VA 2JGPA 5KJSA 3B30A 3U9BA 2ZBAA 5KJWA 1EADA 4G2MA 1C4TA 5DUAA 3MAEA 1DPCA 3U9FA 2XHGA 5KJTA 5KJUA 1E2OA 1EABA 1XMCA 2I9DA 2IHWA 2RKTA 5KJVA 1CIAA 2XR7A 1SCZA 1L5AA 4G22A 4JN5A 2E1UA 3L60A 2II4A 1DPBA 4KECA 1DPDA 4JN3A 4CLAA 5FANA 5FALA 2RKVA 4HVMA 2E1TA 1PD5A 3FP0A 1EAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAA A;  1EAE A;  1NOC B;  2CLA A;  1CLA A;  2II3 A;  4N72 A;  1EAC A;  3CLA A;  3FOT A;  1XL8 A;  2VSQ A;  1Q23 A;  1XL7 A;  3B2S A;  2BGH A;  2II5 A;  4G0B A;  1QCA A;  5T3E A;  1XMD A;  1Q9J A;  4KE4 A;  5DU9 A;  2E1V A;  2JGP A;  5KJS A;  3B30 A;  3U9B A;  2ZBA A;  5KJW A;  1EAD A;  4G2M A;  1C4T A;  5DUA A;  3MAE A;  1DPC A;  3U9F A;  2XHG A;  5KJT A;  5KJU A;  1E2O A;  1EAB A;  1XMC A;  2I9D A;  2IHW A;  2RKT A;  5KJV A;  1CIA A;  2XR7 A;  1SCZ A;  1L5A A;  4G22 A;  4JN5 A;  2E1U A;  3L60 A;  2II4 A;  1DPB A;  4KEC A;  1DPD A;  4JN3 A;  4CLA A;  5FAN A;  5FAL A;  2RKV A;  4HVM A;  2E1T A;  1PD5 A;  3FP0 A;  1EAF A; 
#chains in the Genus database with same CATH topology
 2FY4 A;  1EAE A;  4N72 A;  1NM8 A;  3CLA A;  1T7Q A;  2FY3 A;  1T7O A;  2RCU A;  4KE4 A;  5T3E A;  5KJS A;  3B30 A;  2ZBA A;  1EAD A;  2H4T A;  5KJT A;  2IHW A;  4JN5 A;  2E1U A;  3L60 A;  1DPB A;  4KEC A;  1DPD A;  1NDF A;  1EAF A;  2II3 A;  1NDB A;  2FY5 A;  2FYO A;  3FOT A;  1XL8 A;  2II5 A;  1Q9J A;  2E1V A;  1C4T A;  3U9F A;  1XMC A;  1L5A A;  2FW3 A;  1S5O A;  2II4 A;  4CLA A;  2RKV A;  4HVM A;  2H3W A;  2H3P A;  1NOC B;  2CLA A;  1EAC A;  1Q23 A;  1XL7 A;  2BGH A;  4G0B A;  2JGP A;  3U9B A;  1DPC A;  1E2O A;  5KJV A;  1CIA A;  2H3U A;  4G22 A;  4JN3 A;  5FAN A;  2E1T A;  1PD5 A;  1EAA A;  1CLA A;  1T7N A;  2FY2 A;  2VSQ A;  1Q6X A;  1T1U A;  4EPH A;  3B2S A;  1NDI A;  1QCA A;  4EYW A;  1XMD A;  5DU9 A;  5KJW A;  4G2M A;  5DUA A;  3MAE A;  2XHG A;  5KJU A;  1EAB A;  2I9D A;  2RKT A;  2XR7 A;  1SCZ A;  4EP9 A;  5FAL A;  2DEB A;  3FP0 A; 
#chains in the Genus database with same CATH homology
 1EAA A;  1EAE A;  1NOC B;  2CLA A;  1CLA A;  2II3 A;  4N72 A;  1EAC A;  3CLA A;  3FOT A;  1XL8 A;  2VSQ A;  1Q23 A;  1XL7 A;  3B2S A;  2BGH A;  2II5 A;  4G0B A;  1QCA A;  5T3E A;  1XMD A;  1Q9J A;  4KE4 A;  5DU9 A;  2E1V A;  2JGP A;  5KJS A;  3B30 A;  3U9B A;  2ZBA A;  5KJW A;  1EAD A;  4G2M A;  1C4T A;  5DUA A;  3MAE A;  1DPC A;  3U9F A;  2XHG A;  5KJT A;  5KJU A;  1E2O A;  1EAB A;  1XMC A;  2I9D A;  2IHW A;  2RKT A;  5KJV A;  1CIA A;  2XR7 A;  1SCZ A;  1L5A A;  4G22 A;  4JN5 A;  2E1U A;  3L60 A;  2II4 A;  1DPB A;  4KEC A;  1DPD A;  4JN3 A;  4CLA A;  5FAN A;  5FAL A;  2RKV A;  4HVM A;  2E1T A;  1PD5 A;  3FP0 A;  1EAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...