The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
75
|
sequence length |
290
|
structure length |
290
|
Chain Sequence |
AELACFCYPHLENDSYKFIPFNNLAIKAMLTAKVDKKDMDKFYDSIIYGIAPPPQFKKRYNTNDNSRGMNFETIMFTKVAMLICEALNSLKVTQANVSNVLSRVVSIRHLENLVIRKENPQDILFHSKDLLLKSTLIAIGQSKEIETTITAEGGEIVFQNAAFTMWKLTYLEHQLMPILDQNFIEYKVTLNEDKPISDVHVKELVAELRWQYNKFAVITHGKGHYRIVKYSSVANHADRVYATFKSNVKTGVNNDFNLLDQRIIWQNWYAFTSSMKQGNTLDVCKRLLFQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Hydrolase
|
molecule keywords |
Non-structural protein 2
|
publication title |
Crystallographic Analysis of Rotavirus NSP2-RNA Complex Reveals Specific Recognition of 5' GG Sequence for RTPase Activity.
pubmed doi rcsb |
source organism |
Simian 11 rotavirus
|
total genus |
75
|
structure length |
290
|
sequence length |
290
|
chains with identical sequence |
B, C, D, E, F, G, H, I, J
|
ec nomenclature |
ec
3.6.4.-: |
pdb deposition date | 2012-07-09 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | HIT family, subunit A | Rotavirus NSP2 fragment, C-terminal domain | ||
Alpha Beta | Alpha-Beta Complex | Rotavirus NSP2 fragment, N-terminal domain | Rotavirus NSP2 fragment, N-terminal domain |
#chains in the Genus database with same CATH superfamily 1L9V A; 4G0J A; 2R7J A; 2R7P A; 4G0A A; 2GU0 A; 2R8F A; 2R7C A; #chains in the Genus database with same CATH topology 4YKL B; 1XML A; 4ZKV A; 3TW2 A; 4QDV A; 2R7J A; 5ED6 A; 4EGU A; 3BL7 A; 4G0J A; 4NDI A; 1AV5 A; 4ZGL A; 3N1T A; 1FIT A; 3ANO A; 3RHN A; 5CS2 A; 2FHI A; 3LB5 A; 3OHE A; 2R7C A; 3I4S A; 1HXP A; 2R7P A; 4G0A A; 3IMI A; 1GUP A; 3KSV A; 3SP4 A; 1RZY A; 6FIT A; 2POF A; 4NJX A; 3O1C A; 3SZQ A; 2Q4H A; 1Y23 A; 1HXQ A; 1EMS A; 5IPD A; 2R8F A; 5FIT A; 4NDH A; 4RHN A; 4XBA A; 5ED3 A; 4INI A; 3O0M A; 1VLR A; 4NK0 A; 1KPF A; 4ZKL A; 2FIT A; 4INC A; 3SPL A; 1ZWJ A; 1L9V A; 5EMT A; 5IN3 A; 2Q4L A; 3BLA A; 4QDE A; 4EQE A; 3P0T A; 1KPE A; 1GUQ A; 3L7X A; 5I2E A; 1KPB A; 1ST4 A; 3WO5 A; 5I2F A; 4QEB A; 4NDF A; 1Z84 A; 2EO4 A; 4NJY A; 1FHI A; 3I24 A; 3OJ7 A; 4EQH A; 3OXK A; 3FIT A; 5IPE A; 3NRD A; 5RHN A; 1KPC A; 4NDG A; 6RHN A; 3R6F A; 5IPC A; 5IPB A; 4I5W A; 4I5T A; 3O1Z A; 3BL9 A; 5BV3 A; 3O1X A; 2OIK A; 3SPD A; 2LJW A; 2GU0 A; 4I5V A; 1XMM A; 3N1S A; 4FIT A; 1KPA A; 1ST0 A; 4EQG A; 3OMF A; 3QGZ A; 2H39 A; 4NJZ A; #chains in the Genus database with same CATH homology 1L9V A; 4G0J A; 2R7J A; 2R7P A; 4G0A A; 2GU0 A; 2R8F A; 2R7C A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...