4G0LA

Glutathionyl-hydroquinone reductase, yqjg, of e.coli complexed with gsh
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
327
structure length
327
Chain Sequence
b'GQLIDGVWHDTWYDTKSTGGKFQRSASAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAGDYYPPALQTKIDELNGWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHGRDVRFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein yqjG
publication title Structural understanding of the glutathione-dependent reduction mechanism of glutathionyl-hydroquinone reductases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 105
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 1.8.5.7: Glutathionyl-hydroquinone reductase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g0lA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g0lA01
2FNOA 4KAEA 4ECBA 2HSMA 4IGJA 2OA7A 3TOUA 1N2AA 3VWXA 1YKCA 3VURA 1GUKA 3Q19A 1GTBA 4ZBBA 4RI7A 1F3AA 4JBBA 3EE2A 3MAKA 4ID0A 4KF9A 3M1GA 4EC0A 5D73A 2N5FA 1MTCA 5ECPB 1GLQA 4GSNA 4KSMA 3GUSA 5DAKB 3KTLA 2VCQA 19GSA 13GSA 4F03A 3ZMKA 1JZRA 1K0MA 5F8BA 4IS0A 2C3QA 1K3YA 3HJOA 1EV4A 5ECLB 3FYGA 1B8XA 1DUGA 1F3BA 2WB9A 1K0BA 1PX7A 4EXJA 4IELA 5AGYA 3GSSA 22GSA 4ECCA 1XWKA 4Q5QA 4I97A 3LSZA 1VF1A 2F3MA 3I6AA 4BVXB 4IQAA 3IK9A 1G7OA 4MP4A 2PMTA 1Z9HA 1K0OA 3I69A 2C3TA 4NAXA 2WS2A 1VF4A 2VD1A 4JEDA 4ISDA 5ECKB 5D9TA 4IW9A 6GSTA 1MD4A 3GSTA 3G7IA 4G0LA 2D2ZA 4IKHA 4EE0A 2OACA 4ZXGA 5FHIA 5J4UA 16GSA 3DD3A 5BMUA 4JZQA 3VLNA 1R5AA 4ECIA 3D0ZA 2FHEA 3Q74A 6GSUA 5A4VA 20GSA 1NHYA 1AXDA 4PQHA 3CSIA 1OE7A 4ZBAA 3F6DA 3UARA 5DALB 1PGTA 5ECRB 4YQMA 3FR3A 4EDYA 2GTUA 2IMKA 3VI7A 1GTAA 3GTUA 3SWLA 2F8FA 1K3LA 4GTUA 4N0VA 4OMVA 3M3MA 1USBA 5D9VA 4OFTA 1GNEA 3LG6A 3VPQA 2DC5A 5ELGA 1YQ1A 2C80A 2GLRA 4AGSA 5AIXA 1GSUA 4MDCA 4E8EA 1YDKA 3CSJA 1OKTA 1A0FA 1OE8A 3WYWA 4HI7A 1GWCA 5EL8A 8GSSA 1IYIA 2VCTA 2VD0A 1M99A 4ACSA 5DDLA 4E8HA 4BL7B 1K0AA 1GSQA 3Q18A 5GSSA 5ECOB 4LMWA 3FR9A 1TU8A 3VPTA 4YQUA 1IYHA 2AB6A 1B48A 4OFMA 4BVYA 2ON5A 1EV9A 2R4VA 1C72A 2CAQA 1GTUA 2C8UA 4IVFA 2YCDA 3PR8A 1YJ6A 6GSXA 10GSA 4Q5NA 5ELAA 4ZBDA 3TGZA 1E6BA 1JLWA 2WRTA 4KGIA 4F0BA 3M8NA 3HJMA 4PNFA 4YH2A 18GSA 4GF0A 4PTSA 2PVQA 1LJRA 1GUHA 3VK9A 3QAVA 3UAPA 2R6KA 1AW9A 2HSMB 5G5EA 6GSWA 5FWGA 5JCUA 1Y6EA 3KMNA 4TOPA 2CAIA 1F2EA 3PPUA 1EEMA 2GSSA 2HRKA 4L5OA 3NIVA 2HQTA 3F6FA 5GZZB 3U6VA 4ECJA 2LJRA 4KDUA 5D9WA 3KJYA 1EOGA 3GH6A 1JLVA 3LYPA 4MF7A 14GSA 1GULA 1MD3A 5J41A 4YAPA 2X64A 5F06A 1HNBA 4KX4A 1PA3A 2PBJA 5DJMA 2R3XA 3W8SA 1K0CA 4K0GA 1PKZA 2UZ8A 3CSHA 4PUAA 1M0UA 5DCGA 5J5NA 3GURA 4KH7A 3CBUA 1HQOA 4USSA 3F63A 5ECQB 4WR4A 2OADA 5FT3A 9GSSA 4O92A 1FW1A 4MF5A 1RK4A 1XW5A 4EDZA 4G19A 4Q5RA 5ECSA 4O7HA 2R5GA 2VCWA 5GSTA 1AQXA 1V40A 2PGTA 3PGTA 4G0IA 7GSSA 5ECHB 1GSSA 4HZ2A 2JL4A 1BG5A 1VF2A 2J9HA 3LQ7A 5EVOA 1GSYA 3VI5A 1U87A 1HNCA 3IBHA 3KM6A 5DQSA 2GDRA 3LFLA 4PNGA 3IE3A 4LMVA 3IC8A 5A5KA 2VO4A 2V6KA 4PQIA 17GSA 3ZMLA 3ZFLA 4CHSA 3GTUB 5DJLA 1EOHA 5DAKA 1PD21 4IJIA 1GSDA 4PURA 5LD0A 3G7JA 4QQ7A 1LBKA 2GSRA 1BX9A 3IR4A 1PL1A 1V2AA 2YV9A 1PX6A 4GLTA 1M9AA 4HJ2A 3TOTA 3L0HA 4J2FA 1G6YA 4ZB6A 4K0NA 1HNAA 5F05A 3FY7A 4BVXA 2A2SA 4F0CA 4PXOA 4ZB8A 4MF6A 1BYEA 5EY6A 3N5OA 1TU7A 4KDXA 11GSA 3FRCA 2WJUA 3MDKA 4HZ4A 5IQYA 2CVDA 5LCZA 1VF3A 1B4PA 3P8WA 4IQ1A 1XWGA 4BVYB 3EINA 3R2QA 2HSNB 2VCZA 2DSAA 4G0KA 3BBYA 1TW9A 4G10A 4L5LA 4RI6A 2CZ3A 6GSVA 1PL2A 1Q4JA 1BAYA 5AISA 2A2RA 5ECMB 3UBKA 5ECIB 3LJRA 1FHEA 3KXOA 4MPFA 3WD6A 5A4WA 1GUMA 1YY7A 4DEJA 2CZ2A 5DALA 2WDUA 5A4UA 1AQWA 5D9XA 5F07A 4IBPA 4KDYA 3RBTA 2VCXA 1AQVA 3CRUA 3HKRA 4ZB9A 3M0FA 5F0GA 5JCWA 3LXZA 3ISOA 4FQUA 5AIVA 3CRTA 1U88A 3AY8A 1KBNA 3LYKA 2IMIA 1ML6A 3UVHA 4GCIA 4KE3A 4OFNA 3QR6A 1GTIA 1K0NA 2HRKB 1GLPA 2C4JA 3O3TA 4GSSA 2AHEA 4PX1A 3QAGA 5B7CA 1PKWA 4WR5A 3ZFBA 3H1NA 3GX0A 4NHWA 3UBLA 2VCVA 3KMOA 2GSQA 3IK7A 2HRAA 3P90A 5G5FA 1G6WA 2HNLA 5AN1A 3FR6A 4Q5FA 1M9BA 1GNWA 5HFKA 3R3EA 4MZWA 2CA8A 4G9HA 4PGTA 4GSTA 1GSEA 1U3IA 6GSYA 3DGQA 2GSTA 4BL7A 6GSSA 3LXTA 1K0DA 4YAVA 2C3NA 3N9JA 3ERFA 3C8EA 4YQVA 4MK3A 2NTOA 4L8EA 4HOJA 1OYJA 1GSFA 5ECNB 1UA5A 2IL3A 3QAWA 4NHZA 2ON7A 5KEJA 1PMTA 1ZGNA 3O76A 2PERA 1PN9A 1TDIA 12GSA 3ERGA 2AAWA 1XW6A 1ZL9A 2YV7A 4MPGA 1K3OA
chains in the Genus database with same CATH superfamily
4ECBA 2OA7A 1V57A 1N2AA 2B1LA 3VWXA 4AKGA 3VURA 1M3IA 4KNDA 3DMLA 1Z6NA 4HQSA 2H1LA 1GTBA 2RM6A 3WGDA 3TKPA 4ZBBA 4GQCA 4OCFA 2OKAA 4ID0A 2HSYA 4GSNA 3GUSA 2IFQA 4K7NA 1JZRA 1K0MA 3GKNA 1K3YA 2V32A 2AUVA 2KOKA 3DKSA 2WB9A 2JSZA 4ECCA 2WW1A 4Q5QA 2YWOA 3D5JA 4P3YB 3WT2A 5G30A 4K7IA 2MMAA 4KB3A 3RAZA 4MP4A 1K0OA 4NAXA 2DJ2A 3HXSA 2OE0A 2WW0A 1XPVA 2OE1A 4IW9A 3FHKA 6GSTA 2L57A 4PHZC 4HS1A 1S3RA 1SD9A 3GRXA 4EE0A 2OACA 4K5SA 3HJPA 5HR2A 5J4UA 1U3AA 5BMUA 4ILFA 1JZWA 2RLIA 2JU5A 4AKXB 2XHFA 2FHEA 1Z7RA 1NHYA 1O85A 3HVSA 4ICYA 3CSIA 1A8LA 1OC8A 1AC1A 4NMUA 3KIJA 3RFRC 5B6NA 2XC2A 4YQMA 2MBSA 2OJLA 2GTUA 1ZYEA 4OWYA 5JWOB 2H0GA 3VI7A 1GTAA 2F8FA 4L0WA 4ZILA 4GTUA 4OMVA 3M3MA 5D9VA 1TK8B 1GNEA 3D21A 4N30A 4V2LA 3MSZA 2FA4A 2DC5A 5ELGA 5J9BA 4PI2C 1THXA 3C1SA 1ZYPA 2VLVA 2VLTA 2QSIA 1XWCA 2IIYA 1QUWA 2YN1A 2O5VA 5EL8A 4MH3A 1IYIA 5ENUA 1X0RA 1TK5B 5ID2B 4DVCA 1K0AA 1GSQA 1UVZA 1SYRA 4K2DA 2ZCTA 5H5SA 2RUEA 4HJMA 2DBCA 5J4YA 1UC7A 2VL3A 4HEA2 1WOUA 2IJYA 10GSA 2LRTA 4Q5NA 4ZBDA 3RHBA 3TB2A 1E6BA 1JLWA 2RM5A 4PNFA 4GF0A 1BEDA 3H8QA 1M7TA 3UAPA 2DIZA 2R6KA 1AW9A 4OD7A 1QFNA 3FK8A 3F4RA 3APOA 1AUCA 1OVNA 4TOPA 3UIWA 4FYUA 1XIYA 3IHQA 5HQPA 3IV4A 3PPUA 5A34A 1N25A 3F6FA 5KN3A 4KDUA 3A2VA 1EOGA 3LYPA 3HMJG 14GSA 1GULA 5J41A 3CQFA 4YAPA 4GWRA 3SBCA 1HNBA 4KX4A 3F9UA 2PBJA 5G31A 3DVXA 4K0GA 3FZ5A 3CSHA 1JHBA 3HCZA 4PUAA 2DIYA 4KH7A 1Y1UA 5CRHA 5HFGA 3CBUA 1HQOA 1DSBA 2YOIA 5FT3A 2L59A 3GMFA 4MF5A 3ZREA 2VL2A 2H75A 4EDZA 4Q5RA 4O7HA 2H1AA 3QMXA 2PGTA 2L4CA 3DYRA 2HRFA 4MA9A 2HZFA 2IMEA 4O5QA 2OE3A 1RW1A 2Z9SA 2EFHA 3FW2A 1VF2A 2M46A 4OCEA 1U87A 1EGOA 1HNCA 1M2BA 2HZEA 5IOXA 3O6TA 5DBQA 2H1BA 4AI6A 3IC8A 4FXYP 5D96A 3IA1A 1I9DA 3KGKA 2VO4A 4POMA 2WZ9A 4CHSA 5DAKA 1KNGA 5L71A 1V2AA 2LNSA 3QFBC 1PX6A 1M9AA 3HZ4A 3TOTA 1G6YA 1V98A 2M72A 4K0NA 4QL7A 5HR0A 3EMXA 2LEGA 3FZ9A 3GL5A 3HVNA 2JZSA 2WJUA 4HZ4A 1O81A 1VF3A 4BVYB 3EINA 1SVOA 3DWVA 1DE2A 3D4MA 2VCZA 2DSAA 3IXRA 4G10A 4BA7A 2QKEA 1R26A 2PWJA 1PSQA 5CAXA 3TJFA 2XBIA 5J9CA 1PL2A 4DSQA 5AISA 3F4SA 5ECMB 2YJHA 3UBKA 5ECIB 3KXOA 4MPFA 3EU4A 4AKHA 5A4UA 2WDUA 3U5RE 4IBPA 4GQFA 4ZB9A 2F9SA 3CRTA 3AY8A 3LYKA 1KBNA 4TXOA 1OKDA 2IMIA 4OO5A 4GCIA 4NXIA 1GTIA 2DJ1A 2HRKB 3CHXC 2C4JA 1GL8A 4GSSA 2AHEA 3QAGA 1SD8A 2V2GA 4POLA 3CXGA 4MMMA 4NHWA 4PUFC 3KMOA 2KHPA 5AN1A 3FR6A 3GKMA 1XVWA 4G2EA 3EMPA 3R3EA 4GSTA 1MEKA 4I6XA 3LXTA 3N9JA 3L4NA 3ZYWA 2LJAA 5JCGA 2FWFA 3KTBA 1A2JA 4HSCX 1UA5A 4TKYA 3PH9A 5JWQB 3O76A 1GH2A 1PN9A 1GRXA 4J57E 1FG4A 3IDVA 3ERGA 1ZL9A 3ME8A 1UN2A 2YV7A 2N5AA 4KAEA 2HSMA 4IGJA 2H70A 3ZL5A 3LEFA 1YKCA 1X5EA 1NM3A 1SU9A 2H6YA 3G7YA 1W89A 3F0IA 2L5OA 3KP9A 3ZVJA 2O87A 4JBBA 3MAKA 4KF9A 1N8JA 1YEPA 3VWUA 4KSMA 4FO5A 3TUEA 3ZVJD 2ZUPA 4F03A 4IS0A 1XXUA 2B6MA 2MBTA 4AJ8A 5ECLB 1FAAA 2VL9A 1H75A 1PX7A 4EXJA 4A5PA 3GSSA 22GSA 5BRTA 3LSZA 2PN8A 3ZTLA 2F3MA 5LNKe 3IK9A 3I69A 4JR6A 5IPHA 2QGVA 2FWHA 2VD1A 4ISDA 3IPZA 4ZL9A 2H1DA 5D9TA 2DKHA 2CVKA 4G0LA 4WKWA 4ZXGA 4TR1B 4V1Ap 16GSA 3DD3A 1R4WA 1B9XC 4JZQA 2EFCA 4KCAA 1R5AA 2YANA 3D0ZA 1ACVA 1TXXA 2L5LA 4IP6A 3F3RA 4EIQA 5DALB 4EVMA 3GX8A 4EDYA 3EURA 4DSSB 4N0ZA 5J4VA 5IMCA 2V6OA 5CRGA 1YF1A 2IPAA 1K3LA 4WXTA 2IN3A 4OFTA 1EGRA 1THOA 3C73A 3UJ1A 1J08A 4XS6A 3W8JA 2GLRA 1FVKA 2UV8G 1GSUA 1VRSD 4ML1A 3CSJA 4WEYA 1A0FA 3WYWA 1GWCA 1X9SB 3H79A 2VCTA 2OT3A 4ACSA 3UL3A 4E8HA 3IOSA 3RPPA 2P0GA 3M9KA 4BL7B 3IAS2 3Q18A 2A4VA 4XCSA 3FR9A 3VPTA 2FLSA 4OFMA 2ON5A 1EV9A 3FEUA 5D93A 2HSNA 2C8UA 3PR8A 1YJ6A 6GSXA 3ZRDA 4ZIJA 2GT6A 2C1YA 3E0UA 2WRTA 4KGIA 4F0BA 3M8NA 18GSA 3H93A 2WZSA 4PTSA 3APSA 2CV4A 4NV2A 4XS1A 1GUHA 3QAVA 1TXUA 4F82A 2ZNMA 3D4TA 1XWAA 6GSWA 5FWGA 5JCUA 1V58A 4NV5A 2O3EA 5G1KA 4FYBA 4ULXA 5GAND 2X4AA 4CY6A 3CTFA 1EEMA 3C71A 3CWGA 4I8BA 3U6VA 5GZZB 4ECJA 2O8VB 2TIRA 1Z3EA 2WVZA 3GH6A 2JZRA 4O32A 1MD3A 1BF5A 3H4KA 5F06A 1U6TA 1PA3A 3J7Yb 5DJMA 2R3XA 3MNGA 2UZ8A 1O8XA 3TU3B 1NSWA 5DCGA 5J5NA 2KP2A 3GURA 2F51A 2K9FA 3CMIA 4GDFA 3F63A 2OBIA 2M80A 2YZHA 1XWBA 2H66A 4QMKA 2R37A 2LQOA 2R5GA 3DIEA 4WF5A 2CT6A 2VCWA 5GSTA 1B4QA 4OO4A 4KA0A 1CQHA 3TKSA 4XRDA 2PUKC 2FWGA 1V40A 1TJDA 5INYA 2H72A 3F4TA 2FD3A 5ECHB 2PVOC 4D73A 1GSSA 1ZYNA 2DJJA 3V1WA 3LQ7A 1GSYA 2E7PA 3IBHA 2FUG2 3JCML 1A2LA 5DQSA 2GDRA 1ZOFA 3IE3A 4LMVA 3RDWA 1QQ2A 1WIKA 1O8WA 1G0TA 4XS4B 1FOHA 2V6KA 17GSA 3DXBA 1AAZA 4CY8A 3ZMLA 5IMZA 3ZFLA 3I9V2 3GTUB 1EOHA 4ZB7A 2DMLA 1PD21 3E3EA 4IJIA 2IMFA 1DE1A 4LA1A 5C00A 4MJAA 1TKDB 1EP8A 5A1NB 2HSHA 3HZ8A 3IAM2 2GSRA 1BX9A 4YKGA 2QA1A 3FMWA 2YV9A 4GLTA 3KH7A 1XFLA 1X5DA 5H5RA 1TRUA 1XVQA 5F05A 4F0CA 5J47A 3EPTA 3BD2A 1BYEA 2MZCA 4MCUA 1A8YA 1TU7A 4KDXA 1QGVA 11GSA 2YNXA 3KD0A 3BJ5A 3IHGA 2CVDA 3MWHA 3HDCA 4IQ1A 1XWGA 2VAFA 2X8HA 3BBYA 2MYGA 2E2MA 4XRAA 4RQXA 5IMVA 3ZITA 1BG1A 4AJ7A 6GSVA 4V2MA 1MDIA 3DVWA 2YPMA 2A2RA 1JZDA 1FHEA 2BJXA 2LUSA 1YY7A 2K8SA 2CZ2A 5COHA 3GL3A 2K8VA 5JCWA 1TOFA 2G2QA 1MDKA 4FQUA 1T1VA 2EFEA 4Z2UA 4AJ6A 3UVHA 5IMAA 4KE3A 4OFNA 2B5EA 3VWVA 4BIKA 1K0NA 1GLPA 4PX1A 1BJXA 3H1NA 1WE0A 3IK7A 2HNLA 1M9BA 1GNWA 4IJ3A 1M3JA 4EUYA 4MZWA 2QC7A 4PGTA 3J7Yk 5ID2A 1WRYA 1TI3A 1TRWA 1TRVA 1K0DA 2C3NA 2WVYA 3ERFA 4TR3A 3C8EA 1J9BA 4L8EA 4HOJA 1M2DA 2QA2A 5G2ZA 1OYJA 4MJEA 1G7EA 2MMZA 3TJKA 2ON7A 1PMTA 5A5HB 1ZGNA 2PERA 2YP6A 2WFCA 4X1UA 1YEWC 2LRNA 3NOFA 3APQA 3WGXA 1YF0A 3RGBC 1FB0A 4WBJA 2AAWA 2K18A 1FO5A 1OC9B 2L6DA 3TOUA 2NBSA 1GUKA 3WT1A 5E4WA 1YEXA 3Q19A 1Y25A 3KEBA 2KP1A 2B5XA 2REMA 1R7HA 4RI7A 1F3AA 4KW6A 3QOUA 3TRQA 2NDOA 5D73A 1XOBA 4N3ZA 5ECPB 1F9MA 3GIXA 1GLQA 4FIWA 3KTLA 2VCQA 4X4JA 5F8BA 4YKFA 4Z2TA 2WCIA 2C3QA 2G0FA 1WPIA 2GVPA 2K6VA 3HJOA 1EV4A 4PI0C 1DUGA 1F3BA 2MMNA 1K0BA 3C7MA 4F9ZA 1EZKA 4POKA 2IWTA 1T00A 2NVLA 3L9UA 5DCHA 2YJ7A 3I6AA 4BVXB 3MIXA 2PMTA 4BWQA 2C3TA 1ERUA 2WS2A 2X8GA 4I2TA 4W66A 4HQZA 1WMJA 2CVBA 1H4OA 3GSTA 1TP9A 1XW9A 2B7JA 1ZCPA 2H1GA 1SL0B 2EIRA 5JWRB 2H19A 3GYKA 1SKSB 1VGLA 6GSUA 5A4VA 20GSA 1F6MC 1SL2B 2LJKA 3IC4A 2VKZG 1SENA 1OE7A 1TTZA 3GHAA 1FOVA 3UARA 1PGTA 1F37A 2GQLA 2B5YA 3FR3A 5E59A 1HD2A 1FB6A 4ZL7A 2VIMA 4MZBA 1T4YA 2C0FA 2DLXA 2OBKA 3HD5A 2IMKA 2I9HA 4JU5A 3SWLA 3ZZXA 4N0VA 4X0XA 1USBA 4H86A 3LG6A 3VPQA 2HI7A 1YQ1A 2LSTA 2HYXA 2WGRA 4MDCA 4E8EA 4EF0A 4ZL8A 1OE8A 4MABA 8GSSA 4KUNA 4MNNA 2VD0A 5DDLA 2O36A 1S3AA 2LQQA 1WP0A 1ILOA 1XZOA 2H76A 4YQUA 1IYHA 2AB6A 5IO2A 1B48A 4BVYA 1C72A 1ON4A 2CAQA 3ZIJA 4K5RA 1GTUA 2WVXB 3EWLA 4EL1A 4TR0A 4NPBA 4IVFA 1PRXA 3TJGA 2VUPA 2HE3A 3A3TA 3TGZA 4K1FA 3HJMA 4AKIA 2PVQA 2XPDA 1SK1A 1SK0A 5G5EA 2IMDA 4E68A 2DJ0A 5HFIA 2HRNA 5CO3A 1S4BP 4MH2A 2GSSA 4ML6A 2YWIA 2HRKA 2VLUA 2VM2A 4HUAA 2AV4A 2LKUA 2LNTA 3KJYA 5DQYA 3VFIA 4MF7A 3NZNA 2H0IA 2IFQB 5KOXA 1EEJA 2LS5A 1K0CA 1PKZA 4BWSA 3GV1A 1S3CA 5C04A 1TI1A 4O92A 1FW1A 1XW5A 1X9WB 4EO3A 5ECSA 4FYCA 2VOCA 2DJKA 3CTGA 1PQNA 3L9VA 3S9FA 1M2AA 1W4VA 2GQKA 7GSSA 4HU7A 5CRDA 2A4HA 5BMUB 2I4AA 2LTKA 2J9HA 5EVOA 3VI5A 2AJQB 3KM6A 3LFLA 5IIZA 2GQMA 2PPTA 2I1UA 2H8LA 4MLYA 5KOWA 2KLXA 4DSRA 4PQIA 4Z2RA 3E9JB 5DJLA 2DMMA 4BPYA 1QMVA 4PURA 5LD0A 3G7JA 4QQ7A 5KN1A 4TVEA 1URMA 3IRAA 1SKRB 2L4QA 2TRXA 4HDEA 3LW9A 3HHVA 4HJ2A 2RUFA 3TDGA 2A2SA 4K2XA 4ZB8A 2XPEA 1GP1A 1JZOA 1YKAA 3RHCA 5HR1A 2P5QA 3UMAA 2DKIA 1SVLA 3W6GA 2HLSA 2H71A 5LCZA 1B4PA 2F8AA 2HT9A 3R2QA 1T3BA 2C0EA 5IOWA 4PQ1A 4TR1A 4L5LA 2JSYA 2P31A 4RI6A 3ED3A 3TJJA 2CZ3A 3TKRA 1Q4JA 3GN3A 2C0GA 5HR3A 5CRWA 3GKKA 3LJRA 1TRSA 2GZYA 2R0PA 1GUMA 4DEJA 4MZCA 5DALA 4XHMA 5D9XA 1XG8A 2VCXA 2E2GA 2YWNA 1ZYQB 2FGXA 3CRUA 4DSSA 1SYXA 4K9ZA 2JACA 3LGCA 3P2AA 3BCIA 1ML6A 5IMDA 2DJ3A 2TRCP 3QR6A 4CDOA 5A34B 4O5RA 4L0UA 1PKWA 4WR5A 2VCVA 2HRAA 5G5FA 3M9JA 3CYNA 5HFKA 6GSYA 1U3IA 3DGQA 3A2WA 5GAPD 2GSTA 4BL7A 6GSSA 2L6CA 5B6MA 3UOMA 4YAVA 2H6ZA 4J56E 3QPMA 2EFDA 3KZQA 2GZPA 2VM1A 4YQVA 1EWXA 4MK3A 2NTOA 5CNWA 2NPBA 5ECNB 2R0GA 3QAWA 5B8AA 4NHZA 1A23A 5D8IA 1TDIA 4F2IA 2A2PA 4RQRA 4HU9A 1XW6A 1EP7A 1HYUA 2YWMA 4MPGA 3BOAA 2EIQA 2FNOA 3GFKA 2I3YA 1SVMA 2LRCA 3FZAA 1I1IP 1NHOA 5IMFA 2O7KA 2FCHA 3EU3A 2HZEB 4NWYA 4K6XA 4TXVA 1R5PA 3KH9A 1ABAA 3F3QA 5G1LA 3EE2A 1CQGA 3M1GA 4EC0A 2N5FA 1MTCA 2ES7A 5DAKB 19GSA 13GSA 3ZMKA 1AIUA 5ABRA 2HXKA 3FYGA 2H01A 1B8XA 1X5CA 5B8BA 4XIHA 4IELA 5AGYA 5CREA 1XWKA 5KN0A 4I97A 3QD9A 1VF1A 1LU4A 5EPFA 4IQAA 1G7OA 2H6XA 1Z9HA 3TKQA 1VF4A 1PFOA 1J0FA 4JEDA 3A5WA 5ECKB 1MD4A 3G7IA 2D2ZA 4IKHA 3HYPA 4EIPA 1JFUA 5FHIA 1ERVA 5J40A 1SK2A 2E0QA 3VLNA 3F8UA 2JADA 4ECIA 2BMXA 3UVTA 3Q74A 4JRRA 1AXDA 2CX3A 4PQHA 4I5QA 3D6IA 4ZBAA 4TN8A 2O85A 3F6DA 4MJBA 4WETA 4XS4A 5ECRB 4MJCA 4Z7XA 1T8EB 3EVIA 5IO0A 3A2XA 4N11A 3HY2A 3GTUA 4LL1B 2WULA 3EC3A 4TXOB 1T4ZA 3EYTA 2AYTA 5A1NA 1SJIA 2GZZA 2C80A 4AGSA 1XOAA 3TRPA 5AIXA 1XBSA 1YDKA 2EIOA 1OKTA 4HI7A 1O73A 3FKFA 2X49A 3WGEA 1QXHA 1M99A 5GSSA 5ECOB 4LMWA 1TU8A 4IP1A 3PINA 2B7KA 2R4VA 3C1RA 2WW2A 2YCDA 3ERWA 2N5BA 4K7OA 5ELAA 2C0DA 2H30A 4YH2A 1FVJA 3MYDA 4JR4A 1LJRA 5KN2A 4IHUA 3VK9A 1MDJA 2HSMB 2MMOA 1Y6EA 3KMNA 2CAIA 1Z5YE 1O6JA 2V1MA 1F2EA 5CYYA 4TW5A 4L5OA 1Z7PA 3NIVA 2HQTA 2LJRA 5D9WA 1JLVA 2X8CA 3I43A 1YZXA 2X64A 3P7XA 2O89A 2YZUA 4K8MA 3W8SA 2RIIA 3GKXA 1M0UA 4O5UA 5CP1A 2P5RA 4LL4B 4USSA 5ECQB 2PU9C 4WR4A 2OADA 9GSSA 1B9YC 1RK4A 4JE1A 2R2JA 1SJ6A 1OC3A 2CX4A 4G19A 3ZIVA 5A5HA 1KEBA 1O7UA 3ZLPA 4EKZA 5IM9A 1AQXA 3A5IA 1E2YA 3PGTA 4G0IA 3TKSC 2EC4A 4HZ2A 2JL4A 3BCKA 1BG5A 1OC9A 2H74A 2FY6A 1SJZA 4I2UA 2H73A 4AF2A 3HVVA 4PNGA 3FZ4A 5H5QA 4CW9A 2FA8A 5A5KA 3US3A 1XCCA 2LV3A 4WBRD 1ST9A 1I5GA 4G01A 1BQ7A 1GSDA 3L78A 4FH8A 2JZTA 1ERWA 1LBKA 3IR4A 1SL1B 1PL1A 2BTOT 2B3SA 3L0HA 4J2FA 4ZB6A 1HNAA 3FY7A 4BVXA 3QFAC 2B1KA 3KP8A 4PXOA 1A0RP 2GGTA 4MF6A 1A2MA 2ALBA 5EY6A 2GT5A 2X99A 3GH9A 3N5OA 3QCPA 3TRXA 3D22A 3FRCA 3MDKA 2KUCA 5IQYA 1ZMAA 3P8WA 4N10A 3G9BA 4TRXA 2HSNB 1Q98A 4G0KA 1TW9A 1WJKA 3QDNA 3HVXA 3K8NA 1ZZYA 4POBA 3Q6OA 2CQ9A 3L9SA 1BAYA 1WWJA 4TR4A 4XTSA 4X43A 2R0CA 3WD6A 5A4WA 4LLRA 1AQWA 5F07A 4KDYA 3RBTA 1AQVA 1T7PB 3HKRA 1Z6MA 1DBYA 3M0FA 5F0GA 3LXZA 3ISOA 2H0HA 1PN0A 5AIVA 3HA9A 1U88A 1RQMA 4WF4A 3GNJA 2VL2C 3O3TA 5B7CA 3UEMA 2J23A 3ZFBA 3DEXA 3GX0A 3UBLA 4KCEA 2GSQA 3P90A 2WW3A 1G6WA 2I81A 4Q5FA 3LWAA 3GA4A 5IPGA 3TKSE 3KCMA 2CA8A 4G9HA 4KSOA 1GSEA 1S3DA 3TJBA 4IN0A 3ME7A 4GRFA 3DRNA 1OAZA 1SKWB 1TK0B 4QL9A 2GS3A 1V9WA 5J3RA 1GSFA 1QK8A 4V1Ag 2WVXA 4RUVA 1ERTA 5DVBA 1A24A 4GXZA 2IL3A 5KEJA 1NW2A 1YVLA 2HFDA 3LORA 1X9MB 2V41A 4V2NA 12GSA 3TCOA 2XBQA 3RPNA 3VWWA 2FWEA 1KTEA 4D73B 1K3OA 3OR5A
chains in the Genus database with same CATH topology
4ECBA 2OA7A 1V57A 1N2AA 2B1LA 3VWXA 4AKGA 3VURA 4KNDA 3DMLA 1Z6NA 4HQSA 2H1LA 1GTBA 2RM6A 3WGDA 3TKPA 4ZBBA 4GQCA 4OCFA 2OKAA 4ID0A 2HSYA 4GSNA 3GUSA 2IFQA 4K7NA 1JZRA 1K0MA 3GKNA 1K3YA 2V32A 2AUVA 2KOKA 3DKSA 2WB9A 2JSZA 4ECCA 4Q5QA 2YWOA 3D5JA 4P3YB 3WT2A 5G30A 4K7IA 2MMAA 4KB3A 3RAZA 4MP4A 1K0OA 4NAXA 2DJ2A 3HXSA 2OE0A 1XPVA 2OE1A 4IW9A 3FHKA 6GSTA 2L57A 4HS1A 1SD9A 3GRXA 4EE0A 2OACA 4K5SA 3HJPA 5HR2A 5J4UA 1U3AA 5BMUA 4ILFA 1JZWA 2RLIA 2JU5A 4AKXB 2XHFA 2FHEA 1Z7RA 1NHYA 1O85A 3HVSA 4ICYA 3CSIA 1A8LA 1OC8A 1AC1A 4NMUA 3KIJA 5B6NA 2XC2A 4YQMA 2MBSA 2OJLA 2GTUA 1ZYEA 4OWYA 5JWOB 2H0GA 3VI7A 1GTAA 2F8FA 4L0WA 4ZILA 4GTUA 4OMVA 3M3MA 5D9VA 1TK8B 1GNEA 3D21A 4N30A 4V2LA 3MSZA 2FA4A 2DC5A 5ELGA 5J9BA 1THXA 3C1SA 1ZYPA 2VLVA 2VLTA 2QSIA 1XWCA 2IIYA 1QUWA 2YN1A 2O5VA 5EL8A 4MH3A 1IYIA 5ENUA 1X0RA 1TK5B 5ID2B 4DVCA 1K0AA 1GSQA 1UVZA 1SYRA 4K2DA 2ZCTA 5H5SA 2RUEA 4HJMA 2DBCA 5J4YA 1UC7A 2VL3A 4HEA2 1WOUA 2IJYA 10GSA 2LRTA 4Q5NA 4ZBDA 3RHBA 3TB2A 1E6BA 1JLWA 2RM5A 4PNFA 4GF0A 1BEDA 3H8QA 1M7TA 3UAPA 2DIZA 2R6KA 1AW9A 4OD7A 1QFNA 3FK8A 3F4RA 3APOA 1AUCA 1OVNA 4TOPA 3UIWA 4FYUA 1XIYA 3IHQA 5HQPA 3IV4A 3PPUA 5A34A 1N25A 3F6FA 5KN3A 4KDUA 3A2VA 1EOGA 3LYPA 3HMJG 14GSA 1GULA 5J41A 4YAPA 4GWRA 3SBCA 1HNBA 4KX4A 3F9UA 2PBJA 5G31A 3DVXA 4K0GA 3FZ5A 3CSHA 1JHBA 3HCZA 4PUAA 2DIYA 4KH7A 1Y1UA 5CRHA 5HFGA 3CBUA 1HQOA 1DSBA 2YOIA 5FT3A 2L59A 3GMFA 4MF5A 3ZREA 2VL2A 2H75A 4EDZA 4Q5RA 4O7HA 2H1AA 3QMXA 2PGTA 2L4CA 3DYRA 2HRFA 4MA9A 2HZFA 2IMEA 4O5QA 2OE3A 1RW1A 2Z9SA 2EFHA 3FW2A 1VF2A 2M46A 4OCEA 1U87A 1EGOA 1HNCA 1M2BA 2HZEA 5IOXA 3O6TA 5DBQA 2H1BA 4AI6A 3IC8A 5D96A 3IA1A 1I9DA 3KGKA 2VO4A 4POMA 2WZ9A 4CHSA 5DAKA 1KNGA 5L71A 1V2AA 2LNSA 3QFBC 1PX6A 1M9AA 3HZ4A 3TOTA 1G6YA 1V98A 2M72A 4K0NA 4QL7A 5HR0A 3EMXA 2LEGA 3FZ9A 3GL5A 2JZSA 2WJUA 4HZ4A 1O81A 1VF3A 4BVYB 3EINA 1SVOA 3DWVA 1DE2A 3D4MA 2VCZA 2DSAA 3IXRA 4G10A 4BA7A 2QKEA 1R26A 2PWJA 1PSQA 5CAXA 3TJFA 2XBIA 5J9CA 1PL2A 4DSQA 5AISA 3F4SA 5ECMB 2YJHA 3UBKA 5ECIB 3KXOA 4MPFA 3EU4A 4AKHA 5A4UA 2WDUA 3U5RE 4IBPA 4GQFA 4ZB9A 2F9SA 3CRTA 3AY8A 3LYKA 1KBNA 4TXOA 1OKDA 2IMIA 4OO5A 4GCIA 4NXIA 1GTIA 2DJ1A 2HRKB 2C4JA 1GL8A 4GSSA 2AHEA 3QAGA 1SD8A 2V2GA 4POLA 3CXGA 4MMMA 4NHWA 4PUFC 3KMOA 2KHPA 5AN1A 3FR6A 3GKMA 1XVWA 4G2EA 3EMPA 3R3EA 4GSTA 1MEKA 4I6XA 3LXTA 3N9JA 3L4NA 3ZYWA 2LJAA 5JCGA 2FWFA 3KTBA 1A2JA 1UA5A 4TKYA 3PH9A 5JWQB 3O76A 1GH2A 1PN9A 1GRXA 4J57E 1FG4A 3IDVA 3ERGA 1ZL9A 3ME8A 1UN2A 2YV7A 2N5AA 4KAEA 2HSMA 4IGJA 2H70A 3ZL5A 3LEFA 1YKCA 1X5EA 1NM3A 1SU9A 2H6YA 3G7YA 1W89A 3F0IA 2L5OA 3KP9A 3ZVJA 2O87A 4JBBA 3MAKA 4KF9A 1N8JA 1YEPA 3VWUA 4KSMA 4FO5A 3TUEA 3ZVJD 2ZUPA 4F03A 4IS0A 1XXUA 2B6MA 2MBTA 4AJ8A 5ECLB 1FAAA 2VL9A 1H75A 1PX7A 4EXJA 4A5PA 3GSSA 22GSA 5BRTA 3LSZA 2PN8A 3ZTLA 2F3MA 5LNKe 3IK9A 3I69A 4JR6A 5IPHA 2QGVA 2FWHA 2VD1A 4ISDA 3IPZA 4ZL9A 2H1DA 5D9TA 2CVKA 2DKHA 4G0LA 4WKWA 4ZXGA 4TR1B 4V1Ap 16GSA 3DD3A 1R4WA 1B9XC 4JZQA 2EFCA 4KCAA 1R5AA 2YANA 3D0ZA 1ACVA 1TXXA 2L5LA 4IP6A 3F3RA 4EIQA 5DALB 4EVMA 3GX8A 4EDYA 3EURA 4DSSB 4N0ZA 5J4VA 5IMCA 2V6OA 5CRGA 1YF1A 2IPAA 1K3LA 4WXTA 2IN3A 4OFTA 1EGRA 1THOA 3C73A 3UJ1A 1J08A 4XS6A 3W8JA 2GLRA 1FVKA 2UV8G 1GSUA 1VRSD 4ML1A 3CSJA 4WEYA 1A0FA 3WYWA 1GWCA 1X9SB 3H79A 2VCTA 2OT3A 4ACSA 3UL3A 4E8HA 3IOSA 3RPPA 2P0GA 3M9KA 4BL7B 3IAS2 3Q18A 2A4VA 4XCSA 3FR9A 3VPTA 2FLSA 4OFMA 2ON5A 1EV9A 3FEUA 5D93A 2HSNA 2C8UA 3PR8A 1YJ6A 6GSXA 3ZRDA 4ZIJA 2GT6A 2C1YA 3E0UA 2WRTA 4KGIA 4F0BA 3M8NA 18GSA 3H93A 4PTSA 3APSA 2CV4A 4NV2A 4XS1A 1GUHA 3QAVA 1TXUA 4F82A 2ZNMA 3D4TA 1XWAA 6GSWA 5FWGA 5JCUA 1V58A 4NV5A 5G1KA 4FYBA 4ULXA 5GAND 2X4AA 4CY6A 3CTFA 1EEMA 3C71A 3CWGA 4I8BA 3U6VA 5GZZB 4ECJA 2O8VB 2TIRA 1Z3EA 3GH6A 2JZRA 4O32A 1MD3A 1BF5A 3H4KA 5F06A 1U6TA 1PA3A 3J7Yb 5DJMA 2R3XA 3MNGA 2UZ8A 1O8XA 3TU3B 1NSWA 5DCGA 5J5NA 2KP2A 3GURA 2F51A 2K9FA 3CMIA 4GDFA 3F63A 2OBIA 2M80A 2YZHA 1XWBA 2H66A 4QMKA 2R37A 2LQOA 2R5GA 3DIEA 4WF5A 2CT6A 2VCWA 5GSTA 1B4QA 4OO4A 4KA0A 1CQHA 3TKSA 4XRDA 2PUKC 2FWGA 1V40A 1TJDA 5INYA 2H72A 3F4TA 2FD3A 5ECHB 2PVOC 4D73A 1GSSA 1ZYNA 2DJJA 3V1WA 3LQ7A 1GSYA 2E7PA 3IBHA 2FUG2 3JCML 1A2LA 5DQSA 2GDRA 1ZOFA 3IE3A 4LMVA 3RDWA 1QQ2A 1WIKA 1O8WA 1G0TA 4XS4B 1FOHA 2V6KA 17GSA 3DXBA 1AAZA 4CY8A 3ZMLA 5IMZA 3ZFLA 3I9V2 3GTUB 1EOHA 4ZB7A 2DMLA 1PD21 3E3EA 4IJIA 2IMFA 1DE1A 4LA1A 5C00A 4MJAA 1TKDB 1EP8A 5A1NB 2HSHA 3HZ8A 3IAM2 2GSRA 1BX9A 4YKGA 2QA1A 3FMWA 2YV9A 4GLTA 3KH7A 1XFLA 1X5DA 5H5RA 1TRUA 1XVQA 5F05A 4F0CA 5J47A 3EPTA 3BD2A 1BYEA 2MZCA 4MCUA 1A8YA 1TU7A 4KDXA 1QGVA 11GSA 2YNXA 3KD0A 3BJ5A 3IHGA 2CVDA 3MWHA 3HDCA 4IQ1A 1XWGA 2VAFA 2X8HA 3BBYA 2MYGA 2E2MA 4XRAA 4RQXA 5IMVA 3ZITA 1BG1A 4AJ7A 6GSVA 4V2MA 1MDIA 3DVWA 2YPMA 2A2RA 1JZDA 1FHEA 2BJXA 2LUSA 1YY7A 2K8SA 2CZ2A 5COHA 3GL3A 2K8VA 5JCWA 1TOFA 2G2QA 1MDKA 4FQUA 1T1VA 2EFEA 4Z2UA 4AJ6A 3UVHA 5IMAA 4KE3A 4OFNA 2B5EA 3VWVA 1K0NA 1GLPA 4PX1A 1BJXA 3H1NA 1WE0A 3IK7A 2HNLA 1M9BA 1GNWA 4IJ3A 4EUYA 4MZWA 2QC7A 4PGTA 3J7Yk 5ID2A 1WRYA 1TI3A 1TRWA 1TRVA 1K0DA 2C3NA 3ERFA 4TR3A 3C8EA 1J9BA 4L8EA 4HOJA 1M2DA 2QA2A 5G2ZA 1OYJA 4MJEA 1G7EA 2MMZA 3TJKA 2ON7A 1PMTA 5A5HB 1ZGNA 2PERA 2YP6A 2WFCA 4X1UA 2LRNA 3NOFA 3APQA 3WGXA 1YF0A 4WBJA 1FB0A 2AAWA 2K18A 1FO5A 1OC9B 2L6DA 3TOUA 2NBSA 1GUKA 3WT1A 5E4WA 1YEXA 3Q19A 1Y25A 3KEBA 2KP1A 2B5XA 2REMA 1R7HA 4RI7A 1F3AA 4KW6A 3QOUA 3TRQA 2NDOA 5D73A 1XOBA 4N3ZA 5ECPB 1F9MA 3GIXA 1GLQA 4FIWA 3KTLA 2VCQA 4X4JA 5F8BA 4YKFA 4Z2TA 2WCIA 2C3QA 2G0FA 1WPIA 2GVPA 2K6VA 3HJOA 1EV4A 1DUGA 1F3BA 2MMNA 1K0BA 3C7MA 4F9ZA 1EZKA 4POKA 2IWTA 1T00A 2NVLA 3L9UA 5DCHA 2YJ7A 3I6AA 4BVXB 3MIXA 2PMTA 4BWQA 2C3TA 1ERUA 2WS2A 2X8GA 4I2TA 4W66A 4HQZA 1WMJA 2CVBA 1H4OA 3GSTA 1TP9A 1XW9A 2B7JA 1ZCPA 2H1GA 1SL0B 2EIRA 5JWRB 2H19A 3GYKA 1SKSB 1VGLA 6GSUA 5A4VA 20GSA 1F6MC 1SL2B 2LJKA 3IC4A 2VKZG 1SENA 1OE7A 1TTZA 3GHAA 1FOVA 3UARA 1PGTA 1F37A 2GQLA 2B5YA 3FR3A 5E59A 1HD2A 1FB6A 4ZL7A 2VIMA 4MZBA 1T4YA 2C0FA 2DLXA 2OBKA 3HD5A 2IMKA 2I9HA 4JU5A 3SWLA 3ZZXA 4N0VA 4X0XA 1USBA 4H86A 3LG6A 3VPQA 2HI7A 1YQ1A 2LSTA 2HYXA 2WGRA 4MDCA 4E8EA 4EF0A 4ZL8A 1OE8A 4MABA 8GSSA 4KUNA 4MNNA 2VD0A 5DDLA 1S3AA 2LQQA 1WP0A 1ILOA 1XZOA 2H76A 4YQUA 1IYHA 2AB6A 5IO2A 1B48A 4BVYA 1C72A 1ON4A 2CAQA 3ZIJA 4K5RA 1GTUA 4EL1A 3EWLA 4TR0A 4NPBA 4IVFA 1PRXA 3TJGA 2VUPA 2HE3A 3A3TA 3TGZA 4K1FA 3HJMA 4AKIA 2PVQA 2XPDA 1SK1A 1SK0A 5G5EA 2IMDA 4E68A 2DJ0A 5HFIA 2HRNA 5CO3A 4MH2A 2GSSA 4ML6A 2YWIA 2HRKA 2VLUA 2VM2A 4HUAA 2AV4A 2LKUA 2LNTA 3KJYA 5DQYA 3VFIA 4MF7A 3NZNA 2H0IA 2IFQB 5KOXA 1EEJA 2LS5A 1K0CA 1PKZA 4BWSA 3GV1A 1S3CA 5C04A 1TI1A 4O92A 1FW1A 1XW5A 1X9WB 4EO3A 5ECSA 4FYCA 2VOCA 2DJKA 3CTGA 1PQNA 3L9VA 3S9FA 1M2AA 1W4VA 2GQKA 7GSSA 4HU7A 5CRDA 2A4HA 5BMUB 2I4AA 2LTKA 2J9HA 5EVOA 3VI5A 2AJQB 3KM6A 3LFLA 5IIZA 2GQMA 2PPTA 2I1UA 2H8LA 4MLYA 5KOWA 2KLXA 4DSRA 4PQIA 4Z2RA 3E9JB 5DJLA 2DMMA 4BPYA 1QMVA 4PURA 5LD0A 3G7JA 4QQ7A 5KN1A 4TVEA 1URMA 3IRAA 1SKRB 2L4QA 2TRXA 4HDEA 3LW9A 3HHVA 4HJ2A 2RUFA 3TDGA 2A2SA 4K2XA 4ZB8A 2XPEA 1GP1A 1JZOA 1YKAA 3RHCA 5HR1A 2P5QA 3UMAA 2DKIA 1SVLA 3W6GA 2HLSA 2H71A 5LCZA 1B4PA 2F8AA 2HT9A 3R2QA 1T3BA 2C0EA 5IOWA 4PQ1A 4TR1A 4L5LA 2JSYA 2P31A 4RI6A 3ED3A 3TJJA 2CZ3A 3TKRA 1Q4JA 3GN3A 2C0GA 5HR3A 5CRWA 3GKKA 3LJRA 1TRSA 2GZYA 2R0PA 1GUMA 4DEJA 4MZCA 5DALA 4XHMA 5D9XA 2VCXA 2E2GA 2YWNA 1ZYQB 2FGXA 3CRUA 4DSSA 1SYXA 4K9ZA 3LGCA 2JACA 3P2AA 3BCIA 1ML6A 5IMDA 2DJ3A 2TRCP 3QR6A 4CDOA 5A34B 4O5RA 4L0UA 1PKWA 4WR5A 2VCVA 2HRAA 5G5FA 3M9JA 3CYNA 5HFKA 6GSYA 1U3IA 3DGQA 3A2WA 5GAPD 2GSTA 4BL7A 6GSSA 2L6CA 5B6MA 3UOMA 4YAVA 2H6ZA 4J56E 3QPMA 2EFDA 3KZQA 2GZPA 2VM1A 4YQVA 1EWXA 4MK3A 2NTOA 5CNWA 2NPBA 5ECNB 2R0GA 3QAWA 5B8AA 4NHZA 1A23A 5D8IA 1TDIA 4F2IA 2A2PA 4RQRA 4HU9A 1XW6A 1EP7A 1HYUA 2YWMA 4MPGA 3BOAA 2EIQA 2FNOA 3GFKA 2I3YA 1SVMA 2LRCA 3FZAA 1NHOA 5IMFA 2O7KA 2FCHA 3EU3A 2HZEB 4NWYA 4K6XA 4TXVA 1R5PA 3KH9A 1ABAA 3F3QA 5G1LA 3EE2A 1CQGA 3M1GA 4EC0A 2N5FA 1MTCA 2ES7A 5DAKB 19GSA 13GSA 3ZMKA 1AIUA 5ABRA 2HXKA 3FYGA 2H01A 1B8XA 1X5CA 5B8BA 4XIHA 4IELA 5AGYA 5CREA 1XWKA 5KN0A 4I97A 3QD9A 1VF1A 1LU4A 5EPFA 4IQAA 1G7OA 2H6XA 1Z9HA 3TKQA 1VF4A 1J0FA 4JEDA 3A5WA 5ECKB 1MD4A 3G7IA 2D2ZA 4IKHA 3HYPA 4EIPA 1JFUA 5FHIA 1ERVA 5J40A 1SK2A 2E0QA 3VLNA 3F8UA 2JADA 4ECIA 2BMXA 3UVTA 3Q74A 4JRRA 1AXDA 2CX3A 4PQHA 4I5QA 3D6IA 4ZBAA 4TN8A 2O85A 3F6DA 4MJBA 4WETA 4XS4A 5ECRB 4MJCA 4Z7XA 1T8EB 3EVIA 5IO0A 3A2XA 4N11A 3HY2A 3GTUA 4LL1B 2WULA 3EC3A 4TXOB 1T4ZA 3EYTA 2AYTA 5A1NA 1SJIA 2GZZA 2C80A 4AGSA 1XOAA 3TRPA 5AIXA 1XBSA 1YDKA 2EIOA 1OKTA 4HI7A 1O73A 3FKFA 2X49A 3WGEA 1QXHA 1M99A 5GSSA 5ECOB 4LMWA 1TU8A 4IP1A 3PINA 2B7KA 2R4VA 3C1RA 2YCDA 3ERWA 2N5BA 4K7OA 5ELAA 2C0DA 2H30A 4YH2A 1FVJA 3MYDA 4JR4A 1LJRA 5KN2A 4IHUA 3VK9A 1MDJA 2HSMB 2MMOA 1Y6EA 3KMNA 2CAIA 1Z5YE 1O6JA 2V1MA 1F2EA 5CYYA 4TW5A 4L5OA 1Z7PA 3NIVA 2HQTA 2LJRA 5D9WA 1JLVA 2X8CA 3I43A 1YZXA 2X64A 3P7XA 2O89A 2YZUA 4K8MA 3W8SA 2RIIA 3GKXA 1M0UA 4O5UA 5CP1A 2P5RA 4LL4B 4USSA 5ECQB 2PU9C 4WR4A 2OADA 9GSSA 1B9YC 1RK4A 4JE1A 2R2JA 1SJ6A 1OC3A 2CX4A 4G19A 3ZIVA 5A5HA 1KEBA 1O7UA 3ZLPA 4EKZA 5IM9A 1AQXA 3A5IA 1E2YA 3PGTA 4G0IA 3TKSC 2EC4A 4HZ2A 2JL4A 3BCKA 1BG5A 1OC9A 2H74A 2FY6A 1SJZA 4I2UA 2H73A 4AF2A 3HVVA 4PNGA 3FZ4A 5H5QA 4CW9A 2FA8A 5A5KA 3US3A 1XCCA 2LV3A 4WBRD 1ST9A 1I5GA 4G01A 1BQ7A 1GSDA 3L78A 4FH8A 2JZTA 1ERWA 1LBKA 3IR4A 1SL1B 1PL1A 2BTOT 2B3SA 3L0HA 4J2FA 4ZB6A 1HNAA 3FY7A 4BVXA 3QFAC 2B1KA 3KP8A 4PXOA 1A0RP 2GGTA 4MF6A 1A2MA 2ALBA 5EY6A 2GT5A 2X99A 3GH9A 3N5OA 3QCPA 3TRXA 3D22A 3FRCA 3MDKA 2KUCA 5IQYA 1ZMAA 3P8WA 4N10A 3G9BA 4TRXA 2HSNB 1Q98A 4G0KA 1TW9A 1WJKA 3QDNA 3HVXA 3K8NA 1ZZYA 4POBA 3Q6OA 2CQ9A 3L9SA 1BAYA 1WWJA 4TR4A 4XTSA 4X43A 2R0CA 3WD6A 5A4WA 4LLRA 1AQWA 5F07A 4KDYA 3RBTA 1AQVA 1T7PB 3HKRA 1Z6MA 1DBYA 3M0FA 5F0GA 3LXZA 3ISOA 2H0HA 1PN0A 5AIVA 3HA9A 1U88A 1RQMA 4WF4A 3GNJA 2VL2C 3O3TA 5B7CA 3UEMA 2J23A 3ZFBA 3DEXA 3GX0A 3UBLA 4KCEA 2GSQA 3P90A 1G6WA 2I81A 4Q5FA 3LWAA 3GA4A 5IPGA 3TKSE 3KCMA 2CA8A 4G9HA 4KSOA 1GSEA 1S3DA 3TJBA 4IN0A 3ME7A 4GRFA 3DRNA 1OAZA 1SKWB 1TK0B 4QL9A 2GS3A 1V9WA 5J3RA 1GSFA 1QK8A 4V1Ag 4RUVA 1ERTA 5DVBA 1A24A 4GXZA 2IL3A 5KEJA 1NW2A 1YVLA 2HFDA 3LORA 1X9MB 2V41A 4V2NA 12GSA 3TCOA 2XBQA 3RPNA 3VWWA 2FWEA 1KTEA 4D73B 1K3OA 3OR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNO A;  4KAE A;  4ECB A;  2HSM A;  4IGJ A;  2OA7 A;  3TOU A;  1N2A A;  3VWX A;  1YKC A;  3VUR A;  1GUK A;  3Q19 A;  1GTB A;  4ZBB A;  4RI7 A;  1F3A A;  4JBB A;  3EE2 A;  3MAK A;  4ID0 A;  4KF9 A;  3M1G A;  4EC0 A;  5D73 A;  2N5F A;  1MTC A;  5ECP B;  1GLQ A;  4GSN A;  4KSM A;  3GUS A;  5DAK B;  3KTL A;  2VCQ A;  19GS A;  13GS A;  4F03 A;  3ZMK A;  1JZR A;  1K0M A;  5F8B A;  4IS0 A;  2C3Q A;  1K3Y A;  3HJO A;  1EV4 A;  5ECL B;  3FYG A;  1B8X A;  1DUG A;  1F3B A;  2WB9 A;  1K0B A;  1PX7 A;  4EXJ A;  4IEL A;  5AGY A;  3GSS A;  22GS A;  4ECC A;  1XWK A;  4Q5Q A;  4I97 A;  3LSZ A;  1VF1 A;  2F3M A;  3I6A A;  4BVX B;  4IQA A;  3IK9 A;  1G7O A;  4MP4 A;  2PMT A;  1Z9H A;  1K0O A;  3I69 A;  2C3T A;  4NAX A;  2WS2 A;  1VF4 A;  2VD1 A;  4JED A;  4ISD A;  5ECK B;  5D9T A;  4IW9 A;  6GST A;  1MD4 A;  3GST A;  3G7I A;  4G0L A;  2D2Z A;  4IKH A;  4EE0 A;  2OAC A;  4ZXG A;  5FHI A;  5J4U A;  16GS A;  3DD3 A;  5BMU A;  4JZQ A;  3VLN A;  1R5A A;  4ECI A;  3D0Z A;  2FHE A;  3Q74 A;  6GSU A;  5A4V A;  20GS A;  1NHY A;  1AXD A;  4PQH A;  3CSI A;  1OE7 A;  4ZBA A;  3F6D A;  3UAR A;  5DAL B;  1PGT A;  5ECR B;  4YQM A;  3FR3 A;  4EDY A;  2GTU A;  2IMK A;  3VI7 A;  1GTA A;  3GTU A;  3SWL A;  2F8F A;  1K3L A;  4GTU A;  4N0V A;  4OMV A;  3M3M A;  1USB A;  5D9V A;  4OFT A;  1GNE A;  3LG6 A;  3VPQ A;  2DC5 A;  5ELG A;  1YQ1 A;  2C80 A;  2GLR A;  4AGS A;  5AIX A;  1GSU A;  4MDC A;  4E8E A;  1YDK A;  3CSJ A;  1OKT A;  1A0F A;  1OE8 A;  3WYW A;  4HI7 A;  1GWC A;  5EL8 A;  8GSS A;  1IYI A;  2VCT A;  2VD0 A;  1M99 A;  4ACS A;  5DDL A;  4E8H A;  4BL7 B;  1K0A A;  1GSQ A;  3Q18 A;  5GSS A;  5ECO B;  4LMW A;  3FR9 A;  1TU8 A;  3VPT A;  4YQU A;  1IYH A;  2AB6 A;  1B48 A;  4OFM A;  4BVY A;  2ON5 A;  1EV9 A;  2R4V A;  1C72 A;  2CAQ A;  1GTU A;  2C8U A;  4IVF A;  2YCD A;  3PR8 A;  1YJ6 A;  6GSX A;  10GS A;  4Q5N A;  5ELA A;  4ZBD A;  3TGZ A;  1E6B A;  1JLW A;  2WRT A;  4KGI A;  4F0B A;  3M8N A;  3HJM A;  4PNF A;  4YH2 A;  18GS A;  4GF0 A;  4PTS A;  2PVQ A;  1LJR A;  1GUH A;  3VK9 A;  3QAV A;  3UAP A;  2R6K A;  1AW9 A;  2HSM B;  5G5E A;  6GSW A;  5FWG A;  5JCU A;  1Y6E A;  3KMN A;  4TOP A;  2CAI A;  1F2E A;  3PPU A;  1EEM A;  2GSS A;  2HRK A;  4L5O A;  3NIV A;  2HQT A;  3F6F A;  5GZZ B;  3U6V A;  4ECJ A;  2LJR A;  4KDU A;  5D9W A;  3KJY A;  1EOG A;  3GH6 A;  1JLV A;  3LYP A;  4MF7 A;  14GS A;  1GUL A;  1MD3 A;  5J41 A;  4YAP A;  2X64 A;  5F06 A;  1HNB A;  4KX4 A;  1PA3 A;  2PBJ A;  5DJM A;  2R3X A;  3W8S A;  1K0C A;  4K0G A;  1PKZ A;  2UZ8 A;  3CSH A;  4PUA A;  1M0U A;  5DCG A;  5J5N A;  3GUR A;  4KH7 A;  3CBU A;  1HQO A;  4USS A;  3F63 A;  5ECQ B;  4WR4 A;  2OAD A;  5FT3 A;  9GSS A;  4O92 A;  1FW1 A;  4MF5 A;  1RK4 A;  1XW5 A;  4EDZ A;  4G19 A;  4Q5R A;  5ECS A;  4O7H A;  2R5G A;  2VCW A;  5GST A;  1AQX A;  1V40 A;  2PGT A;  3PGT A;  4G0I A;  7GSS A;  5ECH B;  1GSS A;  4HZ2 A;  2JL4 A;  1BG5 A;  1VF2 A;  2J9H A;  3LQ7 A;  5EVO A;  1GSY A;  3VI5 A;  1U87 A;  1HNC A;  3IBH A;  3KM6 A;  5DQS A;  2GDR A;  3LFL A;  4PNG A;  3IE3 A;  4LMV A;  3IC8 A;  5A5K A;  2VO4 A;  2V6K A;  4PQI A;  17GS A;  3ZML A;  3ZFL A;  4CHS A;  3GTU B;  5DJL A;  1EOH A;  5DAK A;  1PD2 1;  4IJI A;  1GSD A;  4PUR A;  5LD0 A;  3G7J A;  4QQ7 A;  1LBK A;  2GSR A;  1BX9 A;  3IR4 A;  1PL1 A;  1V2A A;  2YV9 A;  1PX6 A;  4GLT A;  1M9A A;  4HJ2 A;  3TOT A;  3L0H A;  4J2F A;  1G6Y A;  4ZB6 A;  4K0N A;  1HNA A;  5F05 A;  3FY7 A;  4BVX A;  2A2S A;  4F0C A;  4PXO A;  4ZB8 A;  4MF6 A;  1BYE A;  5EY6 A;  3N5O A;  1TU7 A;  4KDX A;  11GS A;  3FRC A;  2WJU A;  3MDK A;  4HZ4 A;  5IQY A;  2CVD A;  5LCZ A;  1VF3 A;  1B4P A;  3P8W A;  4IQ1 A;  1XWG A;  4BVY B;  3EIN A;  3R2Q A;  2HSN B;  2VCZ A;  2DSA A;  4G0K A;  3BBY A;  1TW9 A;  4G10 A;  4L5L A;  4RI6 A;  2CZ3 A;  6GSV A;  1PL2 A;  1Q4J A;  1BAY A;  5AIS A;  2A2R A;  5ECM B;  3UBK A;  5ECI B;  3LJR A;  1FHE A;  3KXO A;  4MPF A;  3WD6 A;  5A4W A;  1GUM A;  1YY7 A;  4DEJ A;  2CZ2 A;  5DAL A;  2WDU A;  5A4U A;  1AQW A;  5D9X A;  5F07 A;  4IBP A;  4KDY A;  3RBT A;  2VCX A;  1AQV A;  3CRU A;  3HKR A;  4ZB9 A;  3M0F A;  5F0G A;  5JCW A;  3LXZ A;  3ISO A;  4FQU A;  5AIV A;  3CRT A;  1U88 A;  3AY8 A;  1KBN A;  3LYK A;  2IMI A;  1ML6 A;  3UVH A;  4GCI A;  4KE3 A;  4OFN A;  3QR6 A;  1GTI A;  1K0N A;  2HRK B;  1GLP A;  2C4J A;  3O3T A;  4GSS A;  2AHE A;  4PX1 A;  3QAG A;  5B7C A;  1PKW A;  4WR5 A;  3ZFB A;  3H1N A;  3GX0 A;  4NHW A;  3UBL A;  2VCV A;  3KMO A;  2GSQ A;  3IK7 A;  2HRA A;  3P90 A;  5G5F A;  1G6W A;  2HNL A;  5AN1 A;  3FR6 A;  4Q5F A;  1M9B A;  1GNW A;  5HFK A;  3R3E A;  4MZW A;  2CA8 A;  4G9H A;  4PGT A;  4GST A;  1GSE A;  1U3I A;  6GSY A;  3DGQ A;  2GST A;  4BL7 A;  6GSS A;  3LXT A;  1K0D A;  4YAV A;  2C3N A;  3N9J A;  3ERF A;  3C8E A;  4YQV A;  4MK3 A;  2NTO A;  4L8E A;  4HOJ A;  1OYJ A;  1GSF A;  5ECN B;  1UA5 A;  2IL3 A;  3QAW A;  4NHZ A;  2ON7 A;  5KEJ A;  1PMT A;  1ZGN A;  3O76 A;  2PER A;  1PN9 A;  1TDI A;  12GS A;  3ERG A;  2AAW A;  1XW6 A;  1ZL9 A;  2YV7 A;  4MPG A;  1K3O A; 
#chains in the Genus database with same CATH topology
 4ECB A;  2OA7 A;  1V57 A;  1N2A A;  2B1L A;  3VWX A;  4AKG A;  3VUR A;  1M3I A;  4KND A;  3DML A;  1Z6N A;  4HQS A;  2H1L A;  1GTB A;  2RM6 A;  3WGD A;  3TKP A;  4ZBB A;  4GQC A;  4OCF A;  2OKA A;  4ID0 A;  2HSY A;  4GSN A;  3GUS A;  2IFQ A;  4K7N A;  1JZR A;  1K0M A;  3GKN A;  1K3Y A;  2V32 A;  2AUV A;  2KOK A;  3DKS A;  2WB9 A;  2JSZ A;  4ECC A;  2WW1 A;  4Q5Q A;  2YWO A;  3D5J A;  4P3Y B;  3WT2 A;  5G30 A;  4K7I A;  2MMA A;  4KB3 A;  3RAZ A;  4MP4 A;  1K0O A;  4NAX A;  2DJ2 A;  3HXS A;  2OE0 A;  2WW0 A;  1XPV A;  2OE1 A;  4IW9 A;  3FHK A;  6GST A;  2L57 A;  4PHZ C;  4HS1 A;  1S3R A;  1SD9 A;  3GRX A;  4EE0 A;  2OAC A;  4K5S A;  3HJP A;  5HR2 A;  5J4U A;  1U3A A;  5BMU A;  4ILF A;  1JZW A;  2RLI A;  2JU5 A;  4AKX B;  2XHF A;  2FHE A;  1Z7R A;  1NHY A;  1O85 A;  3HVS A;  4ICY A;  3CSI A;  1A8L A;  1OC8 A;  1AC1 A;  4NMU A;  3KIJ A;  3RFR C;  5B6N A;  2XC2 A;  4YQM A;  2MBS A;  2OJL A;  2GTU A;  1ZYE A;  4OWY A;  5JWO B;  2H0G A;  3VI7 A;  1GTA A;  2F8F A;  4L0W A;  4ZIL A;  4GTU A;  4OMV A;  3M3M A;  5D9V A;  1TK8 B;  1GNE A;  3D21 A;  4N30 A;  4V2L A;  3MSZ A;  2FA4 A;  2DC5 A;  5ELG A;  5J9B A;  4PI2 C;  1THX A;  3C1S A;  1ZYP A;  2VLV A;  2VLT A;  2QSI A;  1XWC A;  2IIY A;  1QUW A;  2YN1 A;  2O5V A;  5EL8 A;  4MH3 A;  1IYI A;  5ENU A;  1X0R A;  1TK5 B;  5ID2 B;  4DVC A;  1K0A A;  1GSQ A;  1UVZ A;  1SYR A;  4K2D A;  2ZCT A;  5H5S A;  2RUE A;  4HJM A;  2DBC A;  5J4Y A;  1UC7 A;  2VL3 A;  4HEA 2;  1WOU A;  2IJY A;  10GS A;  2LRT A;  4Q5N A;  4ZBD A;  3RHB A;  3TB2 A;  1E6B A;  1JLW A;  2RM5 A;  4PNF A;  4GF0 A;  1BED A;  3H8Q A;  1M7T A;  3UAP A;  2DIZ A;  2R6K A;  1AW9 A;  4OD7 A;  1QFN A;  3FK8 A;  3F4R A;  3APO A;  1AUC A;  1OVN A;  4TOP A;  3UIW A;  4FYU A;  1XIY A;  3IHQ A;  5HQP A;  3IV4 A;  3PPU A;  5A34 A;  1N25 A;  3F6F A;  5KN3 A;  4KDU A;  3A2V A;  1EOG A;  3LYP A;  3HMJ G;  14GS A;  1GUL A;  5J41 A;  3CQF A;  4YAP A;  4GWR A;  3SBC A;  1HNB A;  4KX4 A;  3F9U A;  2PBJ A;  5G31 A;  3DVX A;  4K0G A;  3FZ5 A;  3CSH A;  1JHB A;  3HCZ A;  4PUA A;  2DIY A;  4KH7 A;  1Y1U A;  5CRH A;  5HFG A;  3CBU A;  1HQO A;  1DSB A;  2YOI A;  5FT3 A;  2L59 A;  3GMF A;  4MF5 A;  3ZRE A;  2VL2 A;  2H75 A;  4EDZ A;  4Q5R A;  4O7H A;  2H1A A;  3QMX A;  2PGT A;  2L4C A;  3DYR A;  2HRF A;  4MA9 A;  2HZF A;  2IME A;  4O5Q A;  2OE3 A;  1RW1 A;  2Z9S A;  2EFH A;  3FW2 A;  1VF2 A;  2M46 A;  4OCE A;  1U87 A;  1EGO A;  1HNC A;  1M2B A;  2HZE A;  5IOX A;  3O6T A;  5DBQ A;  2H1B A;  4AI6 A;  3IC8 A;  4FXY P;  5D96 A;  3IA1 A;  1I9D A;  3KGK A;  2VO4 A;  4POM A;  2WZ9 A;  4CHS A;  5DAK A;  1KNG A;  5L71 A;  1V2A A;  2LNS A;  3QFB C;  1PX6 A;  1M9A A;  3HZ4 A;  3TOT A;  1G6Y A;  1V98 A;  2M72 A;  4K0N A;  4QL7 A;  5HR0 A;  3EMX A;  2LEG A;  3FZ9 A;  3GL5 A;  3HVN A;  2JZS A;  2WJU A;  4HZ4 A;  1O81 A;  1VF3 A;  4BVY B;  3EIN A;  1SVO A;  3DWV A;  1DE2 A;  3D4M A;  2VCZ A;  2DSA A;  3IXR A;  4G10 A;  4BA7 A;  2QKE A;  1R26 A;  2PWJ A;  1PSQ A;  5CAX A;  3TJF A;  2XBI A;  5J9C A;  1PL2 A;  4DSQ A;  5AIS A;  3F4S A;  5ECM B;  2YJH A;  3UBK A;  5ECI B;  3KXO A;  4MPF A;  3EU4 A;  4AKH A;  5A4U A;  2WDU A;  3U5R E;  4IBP A;  4GQF A;  4ZB9 A;  2F9S A;  3CRT A;  3AY8 A;  3LYK A;  1KBN A;  4TXO A;  1OKD A;  2IMI A;  4OO5 A;  4GCI A;  4NXI A;  1GTI A;  2DJ1 A;  2HRK B;  3CHX C;  2C4J A;  1GL8 A;  4GSS A;  2AHE A;  3QAG A;  1SD8 A;  2V2G A;  4POL A;  3CXG A;  4MMM A;  4NHW A;  4PUF C;  3KMO A;  2KHP A;  5AN1 A;  3FR6 A;  3GKM A;  1XVW A;  4G2E A;  3EMP A;  3R3E A;  4GST A;  1MEK A;  4I6X A;  3LXT A;  3N9J A;  3L4N A;  3ZYW A;  2LJA A;  5JCG A;  2FWF A;  3KTB A;  1A2J A;  4HSC X;  1UA5 A;  4TKY A;  3PH9 A;  5JWQ B;  3O76 A;  1GH2 A;  1PN9 A;  1GRX A;  4J57 E;  1FG4 A;  3IDV A;  3ERG A;  1ZL9 A;  3ME8 A;  1UN2 A;  2YV7 A;  2N5A A;  4KAE A;  2HSM A;  4IGJ A;  2H70 A;  3ZL5 A;  3LEF A;  1YKC A;  1X5E A;  1NM3 A;  1SU9 A;  2H6Y A;  3G7Y A;  1W89 A;  3F0I A;  2L5O A;  3KP9 A;  3ZVJ A;  2O87 A;  4JBB A;  3MAK A;  4KF9 A;  1N8J A;  1YEP A;  3VWU A;  4KSM A;  4FO5 A;  3TUE A;  3ZVJ D;  2ZUP A;  4F03 A;  4IS0 A;  1XXU A;  2B6M A;  2MBT A;  4AJ8 A;  5ECL B;  1FAA A;  2VL9 A;  1H75 A;  1PX7 A;  4EXJ A;  4A5P A;  3GSS A;  22GS A;  5BRT A;  3LSZ A;  2PN8 A;  3ZTL A;  2F3M A;  5LNK e;  3IK9 A;  3I69 A;  4JR6 A;  5IPH A;  2QGV A;  2FWH A;  2VD1 A;  4ISD A;  3IPZ A;  4ZL9 A;  2H1D A;  5D9T A;  2DKH A;  2CVK A;  4G0L A;  4WKW A;  4ZXG A;  4TR1 B;  4V1A p;  16GS A;  3DD3 A;  1R4W A;  1B9X C;  4JZQ A;  2EFC A;  4KCA A;  1R5A A;  2YAN A;  3D0Z A;  1ACV A;  1TXX A;  2L5L A;  4IP6 A;  3F3R A;  4EIQ A;  5DAL B;  4EVM A;  3GX8 A;  4EDY A;  3EUR A;  4DSS B;  4N0Z A;  5J4V A;  5IMC A;  2V6O A;  5CRG A;  1YF1 A;  2IPA A;  1K3L A;  4WXT A;  2IN3 A;  4OFT A;  1EGR A;  1THO A;  3C73 A;  3UJ1 A;  1J08 A;  4XS6 A;  3W8J A;  2GLR A;  1FVK A;  2UV8 G;  1GSU A;  1VRS D;  4ML1 A;  3CSJ A;  4WEY A;  1A0F A;  3WYW A;  1GWC A;  1X9S B;  3H79 A;  2VCT A;  2OT3 A;  4ACS A;  3UL3 A;  4E8H A;  3IOS A;  3RPP A;  2P0G A;  3M9K A;  4BL7 B;  3IAS 2;  3Q18 A;  2A4V A;  4XCS A;  3FR9 A;  3VPT A;  2FLS A;  4OFM A;  2ON5 A;  1EV9 A;  3FEU A;  5D93 A;  2HSN A;  2C8U A;  3PR8 A;  1YJ6 A;  6GSX A;  3ZRD A;  4ZIJ A;  2GT6 A;  2C1Y A;  3E0U A;  2WRT A;  4KGI A;  4F0B A;  3M8N A;  18GS A;  3H93 A;  2WZS A;  4PTS A;  3APS A;  2CV4 A;  4NV2 A;  4XS1 A;  1GUH A;  3QAV A;  1TXU A;  4F82 A;  2ZNM A;  3D4T A;  1XWA A;  6GSW A;  5FWG A;  5JCU A;  1V58 A;  4NV5 A;  2O3E A;  5G1K A;  4FYB A;  4ULX A;  5GAN D;  2X4A A;  4CY6 A;  3CTF A;  1EEM A;  3C71 A;  3CWG A;  4I8B A;  3U6V A;  5GZZ B;  4ECJ A;  2O8V B;  2TIR A;  1Z3E A;  2WVZ A;  3GH6 A;  2JZR A;  4O32 A;  1MD3 A;  1BF5 A;  3H4K A;  5F06 A;  1U6T A;  1PA3 A;  3J7Y b;  5DJM A;  2R3X A;  3MNG A;  2UZ8 A;  1O8X A;  3TU3 B;  1NSW A;  5DCG A;  5J5N A;  2KP2 A;  3GUR A;  2F51 A;  2K9F A;  3CMI A;  4GDF A;  3F63 A;  2OBI A;  2M80 A;  2YZH A;  1XWB A;  2H66 A;  4QMK A;  2R37 A;  2LQO A;  2R5G A;  3DIE A;  4WF5 A;  2CT6 A;  2VCW A;  5GST A;  1B4Q A;  4OO4 A;  4KA0 A;  1CQH A;  3TKS A;  4XRD A;  2PUK C;  2FWG A;  1V40 A;  1TJD A;  5INY A;  2H72 A;  3F4T A;  2FD3 A;  5ECH B;  2PVO C;  4D73 A;  1GSS A;  1ZYN A;  2DJJ A;  3V1W A;  3LQ7 A;  1GSY A;  2E7P A;  3IBH A;  2FUG 2;  3JCM L;  1A2L A;  5DQS A;  2GDR A;  1ZOF A;  3IE3 A;  4LMV A;  3RDW A;  1QQ2 A;  1WIK A;  1O8W A;  1G0T A;  4XS4 B;  1FOH A;  2V6K A;  17GS A;  3DXB A;  1AAZ A;  4CY8 A;  3ZML A;  5IMZ A;  3ZFL A;  3I9V 2;  3GTU B;  1EOH A;  4ZB7 A;  2DML A;  1PD2 1;  3E3E A;  4IJI A;  2IMF A;  1DE1 A;  4LA1 A;  5C00 A;  4MJA A;  1TKD B;  1EP8 A;  5A1N B;  2HSH A;  3HZ8 A;  3IAM 2;  2GSR A;  1BX9 A;  4YKG A;  2QA1 A;  3FMW A;  2YV9 A;  4GLT A;  3KH7 A;  1XFL A;  1X5D A;  5H5R A;  1TRU A;  1XVQ A;  5F05 A;  4F0C A;  5J47 A;  3EPT A;  3BD2 A;  1BYE A;  2MZC A;  4MCU A;  1A8Y A;  1TU7 A;  4KDX A;  1QGV A;  11GS A;  2YNX A;  3KD0 A;  3BJ5 A;  3IHG A;  2CVD A;  3MWH A;  3HDC A;  4IQ1 A;  1XWG A;  2VAF A;  2X8H A;  3BBY A;  2MYG A;  2E2M A;  4XRA A;  4RQX A;  5IMV A;  3ZIT A;  1BG1 A;  4AJ7 A;  6GSV A;  4V2M A;  1MDI A;  3DVW A;  2YPM A;  2A2R A;  1JZD A;  1FHE A;  2BJX A;  2LUS A;  1YY7 A;  2K8S A;  2CZ2 A;  5COH A;  3GL3 A;  2K8V A;  5JCW A;  1TOF A;  2G2Q A;  1MDK A;  4FQU A;  1T1V A;  2EFE A;  4Z2U A;  4AJ6 A;  3UVH A;  5IMA A;  4KE3 A;  4OFN A;  2B5E A;  3VWV A;  4BIK A;  1K0N A;  1GLP A;  4PX1 A;  1BJX A;  3H1N A;  1WE0 A;  3IK7 A;  2HNL A;  1M9B A;  1GNW A;  4IJ3 A;  1M3J A;  4EUY A;  4MZW A;  2QC7 A;  4PGT A;  3J7Y k;  5ID2 A;  1WRY A;  1TI3 A;  1TRW A;  1TRV A;  1K0D A;  2C3N A;  2WVY A;  3ERF A;  4TR3 A;  3C8E A;  1J9B A;  4L8E A;  4HOJ A;  1M2D A;  2QA2 A;  5G2Z A;  1OYJ A;  4MJE A;  1G7E A;  2MMZ A;  3TJK A;  2ON7 A;  1PMT A;  5A5H B;  1ZGN A;  2PER A;  2YP6 A;  2WFC A;  4X1U A;  1YEW C;  2LRN A;  3NOF A;  3APQ A;  3WGX A;  1YF0 A;  3RGB C;  1FB0 A;  4WBJ A;  2AAW A;  2K18 A;  1FO5 A;  1OC9 B;  2L6D A;  3TOU A;  2NBS A;  1GUK A;  3WT1 A;  5E4W A;  1YEX A;  3Q19 A;  1Y25 A;  3KEB A;  2KP1 A;  2B5X A;  2REM A;  1R7H A;  4RI7 A;  1F3A A;  4KW6 A;  3QOU A;  3TRQ A;  2NDO A;  5D73 A;  1XOB A;  4N3Z A;  5ECP B;  1F9M A;  3GIX A;  1GLQ A;  4FIW A;  3KTL A;  2VCQ A;  4X4J A;  5F8B A;  4YKF A;  4Z2T A;  2WCI A;  2C3Q A;  2G0F A;  1WPI A;  2GVP A;  2K6V A;  3HJO A;  1EV4 A;  4PI0 C;  1DUG A;  1F3B A;  2MMN A;  1K0B A;  3C7M A;  4F9Z A;  1EZK A;  4POK A;  2IWT A;  1T00 A;  2NVL A;  3L9U A;  5DCH A;  2YJ7 A;  3I6A A;  4BVX B;  3MIX A;  2PMT A;  4BWQ A;  2C3T A;  1ERU A;  2WS2 A;  2X8G A;  4I2T A;  4W66 A;  4HQZ A;  1WMJ A;  2CVB A;  1H4O A;  3GST A;  1TP9 A;  1XW9 A;  2B7J A;  1ZCP A;  2H1G A;  1SL0 B;  2EIR A;  5JWR B;  2H19 A;  3GYK A;  1SKS B;  1VGL A;  6GSU A;  5A4V A;  20GS A;  1F6M C;  1SL2 B;  2LJK A;  3IC4 A;  2VKZ G;  1SEN A;  1OE7 A;  1TTZ A;  3GHA A;  1FOV A;  3UAR A;  1PGT A;  1F37 A;  2GQL A;  2B5Y A;  3FR3 A;  5E59 A;  1HD2 A;  1FB6 A;  4ZL7 A;  2VIM A;  4MZB A;  1T4Y A;  2C0F A;  2DLX A;  2OBK A;  3HD5 A;  2IMK A;  2I9H A;  4JU5 A;  3SWL A;  3ZZX A;  4N0V A;  4X0X A;  1USB A;  4H86 A;  3LG6 A;  3VPQ A;  2HI7 A;  1YQ1 A;  2LST A;  2HYX A;  2WGR A;  4MDC A;  4E8E A;  4EF0 A;  4ZL8 A;  1OE8 A;  4MAB A;  8GSS A;  4KUN A;  4MNN A;  2VD0 A;  5DDL A;  2O36 A;  1S3A A;  2LQQ A;  1WP0 A;  1ILO A;  1XZO A;  2H76 A;  4YQU A;  1IYH A;  2AB6 A;  5IO2 A;  1B48 A;  4BVY A;  1C72 A;  1ON4 A;  2CAQ A;  3ZIJ A;  4K5R A;  1GTU A;  2WVX B;  3EWL A;  4EL1 A;  4TR0 A;  4NPB A;  4IVF A;  1PRX A;  3TJG A;  2VUP A;  2HE3 A;  3A3T A;  3TGZ A;  4K1F A;  3HJM A;  4AKI A;  2PVQ A;  2XPD A;  1SK1 A;  1SK0 A;  5G5E A;  2IMD A;  4E68 A;  2DJ0 A;  5HFI A;  2HRN A;  5CO3 A;  1S4B P;  4MH2 A;  2GSS A;  4ML6 A;  2YWI A;  2HRK A;  2VLU A;  2VM2 A;  4HUA A;  2AV4 A;  2LKU A;  2LNT A;  3KJY A;  5DQY A;  3VFI A;  4MF7 A;  3NZN A;  2H0I A;  2IFQ B;  5KOX A;  1EEJ A;  2LS5 A;  1K0C A;  1PKZ A;  4BWS A;  3GV1 A;  1S3C A;  5C04 A;  1TI1 A;  4O92 A;  1FW1 A;  1XW5 A;  1X9W B;  4EO3 A;  5ECS A;  4FYC A;  2VOC A;  2DJK A;  3CTG A;  1PQN A;  3L9V A;  3S9F A;  1M2A A;  1W4V A;  2GQK A;  7GSS A;  4HU7 A;  5CRD A;  2A4H A;  5BMU B;  2I4A A;  2LTK A;  2J9H A;  5EVO A;  3VI5 A;  2AJQ B;  3KM6 A;  3LFL A;  5IIZ A;  2GQM A;  2PPT A;  2I1U A;  2H8L A;  4MLY A;  5KOW A;  2KLX A;  4DSR A;  4PQI A;  4Z2R A;  3E9J B;  5DJL A;  2DMM A;  4BPY A;  1QMV A;  4PUR A;  5LD0 A;  3G7J A;  4QQ7 A;  5KN1 A;  4TVE A;  1URM A;  3IRA A;  1SKR B;  2L4Q A;  2TRX A;  4HDE A;  3LW9 A;  3HHV A;  4HJ2 A;  2RUF A;  3TDG A;  2A2S A;  4K2X A;  4ZB8 A;  2XPE A;  1GP1 A;  1JZO A;  1YKA A;  3RHC A;  5HR1 A;  2P5Q A;  3UMA A;  2DKI A;  1SVL A;  3W6G A;  2HLS A;  2H71 A;  5LCZ A;  1B4P A;  2F8A A;  2HT9 A;  3R2Q A;  1T3B A;  2C0E A;  5IOW A;  4PQ1 A;  4TR1 A;  4L5L A;  2JSY A;  2P31 A;  4RI6 A;  3ED3 A;  3TJJ A;  2CZ3 A;  3TKR A;  1Q4J A;  3GN3 A;  2C0G A;  5HR3 A;  5CRW A;  3GKK A;  3LJR A;  1TRS A;  2GZY A;  2R0P A;  1GUM A;  4DEJ A;  4MZC A;  5DAL A;  4XHM A;  5D9X A;  1XG8 A;  2VCX A;  2E2G A;  2YWN A;  1ZYQ B;  2FGX A;  3CRU A;  4DSS A;  1SYX A;  4K9Z A;  2JAC A;  3LGC A;  3P2A A;  3BCI A;  1ML6 A;  5IMD A;  2DJ3 A;  2TRC P;  3QR6 A;  4CDO A;  5A34 B;  4O5R A;  4L0U A;  1PKW A;  4WR5 A;  2VCV A;  2HRA A;  5G5F A;  3M9J A;  3CYN A;  5HFK A;  6GSY A;  1U3I A;  3DGQ A;  3A2W A;  5GAP D;  2GST A;  4BL7 A;  6GSS A;  2L6C A;  5B6M A;  3UOM A;  4YAV A;  2H6Z A;  4J56 E;  3QPM A;  2EFD A;  3KZQ A;  2GZP A;  2VM1 A;  4YQV A;  1EWX A;  4MK3 A;  2NTO A;  5CNW A;  2NPB A;  5ECN B;  2R0G A;  3QAW A;  5B8A A;  4NHZ A;  1A23 A;  5D8I A;  1TDI A;  4F2I A;  2A2P A;  4RQR A;  4HU9 A;  1XW6 A;  1EP7 A;  1HYU A;  2YWM A;  4MPG A;  3BOA A;  2EIQ A;  2FNO A;  3GFK A;  2I3Y A;  1SVM A;  2LRC A;  3FZA A;  1I1I P;  1NHO A;  5IMF A;  2O7K A;  2FCH A;  3EU3 A;  2HZE B;  4NWY A;  4K6X A;  4TXV A;  1R5P A;  3KH9 A;  1ABA A;  3F3Q A;  5G1L A;  3EE2 A;  1CQG A;  3M1G A;  4EC0 A;  2N5F A;  1MTC A;  2ES7 A;  5DAK B;  19GS A;  13GS A;  3ZMK A;  1AIU A;  5ABR A;  2HXK A;  3FYG A;  2H01 A;  1B8X A;  1X5C A;  5B8B A;  4XIH A;  4IEL A;  5AGY A;  5CRE A;  1XWK A;  5KN0 A;  4I97 A;  3QD9 A;  1VF1 A;  1LU4 A;  5EPF A;  4IQA A;  1G7O A;  2H6X A;  1Z9H A;  3TKQ A;  1VF4 A;  1PFO A;  1J0F A;  4JED A;  3A5W A;  5ECK B;  1MD4 A;  3G7I A;  2D2Z A;  4IKH A;  3HYP A;  4EIP A;  1JFU A;  5FHI A;  1ERV A;  5J40 A;  1SK2 A;  2E0Q A;  3VLN A;  3F8U A;  2JAD A;  4ECI A;  2BMX A;  3UVT A;  3Q74 A;  4JRR A;  1AXD A;  2CX3 A;  4PQH A;  4I5Q A;  3D6I A;  4ZBA A;  4TN8 A;  2O85 A;  3F6D A;  4MJB A;  4WET A;  4XS4 A;  5ECR B;  4MJC A;  4Z7X A;  1T8E B;  3EVI A;  5IO0 A;  3A2X A;  4N11 A;  3HY2 A;  3GTU A;  4LL1 B;  2WUL A;  3EC3 A;  4TXO B;  1T4Z A;  3EYT A;  2AYT A;  5A1N A;  1SJI A;  2GZZ A;  2C80 A;  4AGS A;  1XOA A;  3TRP A;  5AIX A;  1XBS A;  1YDK A;  2EIO A;  1OKT A;  4HI7 A;  1O73 A;  3FKF A;  2X49 A;  3WGE A;  1QXH A;  1M99 A;  5GSS A;  5ECO B;  4LMW A;  1TU8 A;  4IP1 A;  3PIN A;  2B7K A;  2R4V A;  3C1R A;  2WW2 A;  2YCD A;  3ERW A;  2N5B A;  4K7O A;  5ELA A;  2C0D A;  2H30 A;  4YH2 A;  1FVJ A;  3MYD A;  4JR4 A;  1LJR A;  5KN2 A;  4IHU A;  3VK9 A;  1MDJ A;  2HSM B;  2MMO A;  1Y6E A;  3KMN A;  2CAI A;  1Z5Y E;  1O6J A;  2V1M A;  1F2E A;  5CYY A;  4TW5 A;  4L5O A;  1Z7P A;  3NIV A;  2HQT A;  2LJR A;  5D9W A;  1JLV A;  2X8C A;  3I43 A;  1YZX A;  2X64 A;  3P7X A;  2O89 A;  2YZU A;  4K8M A;  3W8S A;  2RII A;  3GKX A;  1M0U A;  4O5U A;  5CP1 A;  2P5R A;  4LL4 B;  4USS A;  5ECQ B;  2PU9 C;  4WR4 A;  2OAD A;  9GSS A;  1B9Y C;  1RK4 A;  4JE1 A;  2R2J A;  1SJ6 A;  1OC3 A;  2CX4 A;  4G19 A;  3ZIV A;  5A5H A;  1KEB A;  1O7U A;  3ZLP A;  4EKZ A;  5IM9 A;  1AQX A;  3A5I A;  1E2Y A;  3PGT A;  4G0I A;  3TKS C;  2EC4 A;  4HZ2 A;  2JL4 A;  3BCK A;  1BG5 A;  1OC9 A;  2H74 A;  2FY6 A;  1SJZ A;  4I2U A;  2H73 A;  4AF2 A;  3HVV A;  4PNG A;  3FZ4 A;  5H5Q A;  4CW9 A;  2FA8 A;  5A5K A;  3US3 A;  1XCC A;  2LV3 A;  4WBR D;  1ST9 A;  1I5G A;  4G01 A;  1BQ7 A;  1GSD A;  3L78 A;  4FH8 A;  2JZT A;  1ERW A;  1LBK A;  3IR4 A;  1SL1 B;  1PL1 A;  2BTO T;  2B3S A;  3L0H A;  4J2F A;  4ZB6 A;  1HNA A;  3FY7 A;  4BVX A;  3QFA C;  2B1K A;  3KP8 A;  4PXO A;  1A0R P;  2GGT A;  4MF6 A;  1A2M A;  2ALB A;  5EY6 A;  2GT5 A;  2X99 A;  3GH9 A;  3N5O A;  3QCP A;  3TRX A;  3D22 A;  3FRC A;  3MDK A;  2KUC A;  5IQY A;  1ZMA A;  3P8W A;  4N10 A;  3G9B A;  4TRX A;  2HSN B;  1Q98 A;  4G0K A;  1TW9 A;  1WJK A;  3QDN A;  3HVX A;  3K8N A;  1ZZY A;  4POB A;  3Q6O A;  2CQ9 A;  3L9S A;  1BAY A;  1WWJ A;  4TR4 A;  4XTS A;  4X43 A;  2R0C A;  3WD6 A;  5A4W A;  4LLR A;  1AQW A;  5F07 A;  4KDY A;  3RBT A;  1AQV A;  1T7P B;  3HKR A;  1Z6M A;  1DBY A;  3M0F A;  5F0G A;  3LXZ A;  3ISO A;  2H0H A;  1PN0 A;  5AIV A;  3HA9 A;  1U88 A;  1RQM A;  4WF4 A;  3GNJ A;  2VL2 C;  3O3T A;  5B7C A;  3UEM A;  2J23 A;  3ZFB A;  3DEX A;  3GX0 A;  3UBL A;  4KCE A;  2GSQ A;  3P90 A;  2WW3 A;  1G6W A;  2I81 A;  4Q5F A;  3LWA A;  3GA4 A;  5IPG A;  3TKS E;  3KCM A;  2CA8 A;  4G9H A;  4KSO A;  1GSE A;  1S3D A;  3TJB A;  4IN0 A;  3ME7 A;  4GRF A;  3DRN A;  1OAZ A;  1SKW B;  1TK0 B;  4QL9 A;  2GS3 A;  1V9W A;  5J3R A;  1GSF A;  1QK8 A;  4V1A g;  2WVX A;  4RUV A;  1ERT A;  5DVB A;  1A24 A;  4GXZ A;  2IL3 A;  5KEJ A;  1NW2 A;  1YVL A;  2HFD A;  3LOR A;  1X9M B;  2V41 A;  4V2N A;  12GS A;  3TCO A;  2XBQ A;  3RPN A;  3VWW A;  2FWE A;  1KTE A;  4D73 B;  1K3O A;  3OR5 A; 
#chains in the Genus database with same CATH homology
 4ECB A;  2OA7 A;  1V57 A;  1N2A A;  2B1L A;  3VWX A;  4AKG A;  3VUR A;  4KND A;  3DML A;  1Z6N A;  4HQS A;  2H1L A;  1GTB A;  2RM6 A;  3WGD A;  3TKP A;  4ZBB A;  4GQC A;  4OCF A;  2OKA A;  4ID0 A;  2HSY A;  4GSN A;  3GUS A;  2IFQ A;  4K7N A;  1JZR A;  1K0M A;  3GKN A;  1K3Y A;  2V32 A;  2AUV A;  2KOK A;  3DKS A;  2WB9 A;  2JSZ A;  4ECC A;  4Q5Q A;  2YWO A;  3D5J A;  4P3Y B;  3WT2 A;  5G30 A;  4K7I A;  2MMA A;  4KB3 A;  3RAZ A;  4MP4 A;  1K0O A;  4NAX A;  2DJ2 A;  3HXS A;  2OE0 A;  1XPV A;  2OE1 A;  4IW9 A;  3FHK A;  6GST A;  2L57 A;  4HS1 A;  1SD9 A;  3GRX A;  4EE0 A;  2OAC A;  4K5S A;  3HJP A;  5HR2 A;  5J4U A;  1U3A A;  5BMU A;  4ILF A;  1JZW A;  2RLI A;  2JU5 A;  4AKX B;  2XHF A;  2FHE A;  1Z7R A;  1NHY A;  1O85 A;  3HVS A;  4ICY A;  3CSI A;  1A8L A;  1OC8 A;  1AC1 A;  4NMU A;  3KIJ A;  5B6N A;  2XC2 A;  4YQM A;  2MBS A;  2OJL A;  2GTU A;  1ZYE A;  4OWY A;  5JWO B;  2H0G A;  3VI7 A;  1GTA A;  2F8F A;  4L0W A;  4ZIL A;  4GTU A;  4OMV A;  3M3M A;  5D9V A;  1TK8 B;  1GNE A;  3D21 A;  4N30 A;  4V2L A;  3MSZ A;  2FA4 A;  2DC5 A;  5ELG A;  5J9B A;  1THX A;  3C1S A;  1ZYP A;  2VLV A;  2VLT A;  2QSI A;  1XWC A;  2IIY A;  1QUW A;  2YN1 A;  2O5V A;  5EL8 A;  4MH3 A;  1IYI A;  5ENU A;  1X0R A;  1TK5 B;  5ID2 B;  4DVC A;  1K0A A;  1GSQ A;  1UVZ A;  1SYR A;  4K2D A;  2ZCT A;  5H5S A;  2RUE A;  4HJM A;  2DBC A;  5J4Y A;  1UC7 A;  2VL3 A;  4HEA 2;  1WOU A;  2IJY A;  10GS A;  2LRT A;  4Q5N A;  4ZBD A;  3RHB A;  3TB2 A;  1E6B A;  1JLW A;  2RM5 A;  4PNF A;  4GF0 A;  1BED A;  3H8Q A;  1M7T A;  3UAP A;  2DIZ A;  2R6K A;  1AW9 A;  4OD7 A;  1QFN A;  3FK8 A;  3F4R A;  3APO A;  1AUC A;  1OVN A;  4TOP A;  3UIW A;  4FYU A;  1XIY A;  3IHQ A;  5HQP A;  3IV4 A;  3PPU A;  5A34 A;  1N25 A;  3F6F A;  5KN3 A;  4KDU A;  3A2V A;  1EOG A;  3LYP A;  3HMJ G;  14GS A;  1GUL A;  5J41 A;  4YAP A;  4GWR A;  3SBC A;  1HNB A;  4KX4 A;  3F9U A;  2PBJ A;  5G31 A;  3DVX A;  4K0G A;  3FZ5 A;  3CSH A;  1JHB A;  3HCZ A;  4PUA A;  2DIY A;  4KH7 A;  1Y1U A;  5CRH A;  5HFG A;  3CBU A;  1HQO A;  1DSB A;  2YOI A;  5FT3 A;  2L59 A;  3GMF A;  4MF5 A;  3ZRE A;  2VL2 A;  2H75 A;  4EDZ A;  4Q5R A;  4O7H A;  2H1A A;  3QMX A;  2PGT A;  2L4C A;  3DYR A;  2HRF A;  4MA9 A;  2HZF A;  2IME A;  4O5Q A;  2OE3 A;  1RW1 A;  2Z9S A;  2EFH A;  3FW2 A;  1VF2 A;  2M46 A;  4OCE A;  1U87 A;  1EGO A;  1HNC A;  1M2B A;  2HZE A;  5IOX A;  3O6T A;  5DBQ A;  2H1B A;  4AI6 A;  3IC8 A;  5D96 A;  3IA1 A;  1I9D A;  3KGK A;  2VO4 A;  4POM A;  2WZ9 A;  4CHS A;  5DAK A;  1KNG A;  5L71 A;  1V2A A;  2LNS A;  3QFB C;  1PX6 A;  1M9A A;  3HZ4 A;  3TOT A;  1G6Y A;  1V98 A;  2M72 A;  4K0N A;  4QL7 A;  5HR0 A;  3EMX A;  2LEG A;  3FZ9 A;  3GL5 A;  2JZS A;  2WJU A;  4HZ4 A;  1O81 A;  1VF3 A;  4BVY B;  3EIN A;  1SVO A;  3DWV A;  1DE2 A;  3D4M A;  2VCZ A;  2DSA A;  3IXR A;  4G10 A;  4BA7 A;  2QKE A;  1R26 A;  2PWJ A;  1PSQ A;  5CAX A;  3TJF A;  2XBI A;  5J9C A;  1PL2 A;  4DSQ A;  5AIS A;  3F4S A;  5ECM B;  2YJH A;  3UBK A;  5ECI B;  3KXO A;  4MPF A;  3EU4 A;  4AKH A;  5A4U A;  2WDU A;  3U5R E;  4IBP A;  4GQF A;  4ZB9 A;  2F9S A;  3CRT A;  3AY8 A;  3LYK A;  1KBN A;  4TXO A;  1OKD A;  2IMI A;  4OO5 A;  4GCI A;  4NXI A;  1GTI A;  2DJ1 A;  2HRK B;  2C4J A;  1GL8 A;  4GSS A;  2AHE A;  3QAG A;  1SD8 A;  2V2G A;  4POL A;  3CXG A;  4MMM A;  4NHW A;  4PUF C;  3KMO A;  2KHP A;  5AN1 A;  3FR6 A;  3GKM A;  1XVW A;  4G2E A;  3EMP A;  3R3E A;  4GST A;  1MEK A;  4I6X A;  3LXT A;  3N9J A;  3L4N A;  3ZYW A;  2LJA A;  5JCG A;  2FWF A;  3KTB A;  1A2J A;  1UA5 A;  4TKY A;  3PH9 A;  5JWQ B;  3O76 A;  1GH2 A;  1PN9 A;  1GRX A;  4J57 E;  1FG4 A;  3IDV A;  3ERG A;  1ZL9 A;  3ME8 A;  1UN2 A;  2YV7 A;  2N5A A;  4KAE A;  2HSM A;  4IGJ A;  2H70 A;  3ZL5 A;  3LEF A;  1YKC A;  1X5E A;  1NM3 A;  1SU9 A;  2H6Y A;  3G7Y A;  1W89 A;  3F0I A;  2L5O A;  3KP9 A;  3ZVJ A;  2O87 A;  4JBB A;  3MAK A;  4KF9 A;  1N8J A;  1YEP A;  3VWU A;  4KSM A;  4FO5 A;  3TUE A;  3ZVJ D;  2ZUP A;  4F03 A;  4IS0 A;  1XXU A;  2B6M A;  2MBT A;  4AJ8 A;  5ECL B;  1FAA A;  2VL9 A;  1H75 A;  1PX7 A;  4EXJ A;  4A5P A;  3GSS A;  22GS A;  5BRT A;  3LSZ A;  2PN8 A;  3ZTL A;  2F3M A;  5LNK e;  3IK9 A;  3I69 A;  4JR6 A;  5IPH A;  2QGV A;  2FWH A;  2VD1 A;  4ISD A;  3IPZ A;  4ZL9 A;  2H1D A;  5D9T A;  2CVK A;  2DKH A;  4G0L A;  4WKW A;  4ZXG A;  4TR1 B;  4V1A p;  16GS A;  3DD3 A;  1R4W A;  1B9X C;  4JZQ A;  2EFC A;  4KCA A;  1R5A A;  2YAN A;  3D0Z A;  1ACV A;  1TXX A;  2L5L A;  4IP6 A;  3F3R A;  4EIQ A;  5DAL B;  4EVM A;  3GX8 A;  4EDY A;  3EUR A;  4DSS B;  4N0Z A;  5J4V A;  5IMC A;  2V6O A;  5CRG A;  1YF1 A;  2IPA A;  1K3L A;  4WXT A;  2IN3 A;  4OFT A;  1EGR A;  1THO A;  3C73 A;  3UJ1 A;  1J08 A;  4XS6 A;  3W8J A;  2GLR A;  1FVK A;  2UV8 G;  1GSU A;  1VRS D;  4ML1 A;  3CSJ A;  4WEY A;  1A0F A;  3WYW A;  1GWC A;  1X9S B;  3H79 A;  2VCT A;  2OT3 A;  4ACS A;  3UL3 A;  4E8H A;  3IOS A;  3RPP A;  2P0G A;  3M9K A;  4BL7 B;  3IAS 2;  3Q18 A;  2A4V A;  4XCS A;  3FR9 A;  3VPT A;  2FLS A;  4OFM A;  2ON5 A;  1EV9 A;  3FEU A;  5D93 A;  2HSN A;  2C8U A;  3PR8 A;  1YJ6 A;  6GSX A;  3ZRD A;  4ZIJ A;  2GT6 A;  2C1Y A;  3E0U A;  2WRT A;  4KGI A;  4F0B A;  3M8N A;  18GS A;  3H93 A;  4PTS A;  3APS A;  2CV4 A;  4NV2 A;  4XS1 A;  1GUH A;  3QAV A;  1TXU A;  4F82 A;  2ZNM A;  3D4T A;  1XWA A;  6GSW A;  5FWG A;  5JCU A;  1V58 A;  4NV5 A;  5G1K A;  4FYB A;  4ULX A;  5GAN D;  2X4A A;  4CY6 A;  3CTF A;  1EEM A;  3C71 A;  3CWG A;  4I8B A;  3U6V A;  5GZZ B;  4ECJ A;  2O8V B;  2TIR A;  1Z3E A;  3GH6 A;  2JZR A;  4O32 A;  1MD3 A;  1BF5 A;  3H4K A;  5F06 A;  1U6T A;  1PA3 A;  3J7Y b;  5DJM A;  2R3X A;  3MNG A;  2UZ8 A;  1O8X A;  3TU3 B;  1NSW A;  5DCG A;  5J5N A;  2KP2 A;  3GUR A;  2F51 A;  2K9F A;  3CMI A;  4GDF A;  3F63 A;  2OBI A;  2M80 A;  2YZH A;  1XWB A;  2H66 A;  4QMK A;  2R37 A;  2LQO A;  2R5G A;  3DIE A;  4WF5 A;  2CT6 A;  2VCW A;  5GST A;  1B4Q A;  4OO4 A;  4KA0 A;  1CQH A;  3TKS A;  4XRD A;  2PUK C;  2FWG A;  1V40 A;  1TJD A;  5INY A;  2H72 A;  3F4T A;  2FD3 A;  5ECH B;  2PVO C;  4D73 A;  1GSS A;  1ZYN A;  2DJJ A;  3V1W A;  3LQ7 A;  1GSY A;  2E7P A;  3IBH A;  2FUG 2;  3JCM L;  1A2L A;  5DQS A;  2GDR A;  1ZOF A;  3IE3 A;  4LMV A;  3RDW A;  1QQ2 A;  1WIK A;  1O8W A;  1G0T A;  4XS4 B;  1FOH A;  2V6K A;  17GS A;  3DXB A;  1AAZ A;  4CY8 A;  3ZML A;  5IMZ A;  3ZFL A;  3I9V 2;  3GTU B;  1EOH A;  4ZB7 A;  2DML A;  1PD2 1;  3E3E A;  4IJI A;  2IMF A;  1DE1 A;  4LA1 A;  5C00 A;  4MJA A;  1TKD B;  1EP8 A;  5A1N B;  2HSH A;  3HZ8 A;  3IAM 2;  2GSR A;  1BX9 A;  4YKG A;  2QA1 A;  3FMW A;  2YV9 A;  4GLT A;  3KH7 A;  1XFL A;  1X5D A;  5H5R A;  1TRU A;  1XVQ A;  5F05 A;  4F0C A;  5J47 A;  3EPT A;  3BD2 A;  1BYE A;  2MZC A;  4MCU A;  1A8Y A;  1TU7 A;  4KDX A;  1QGV A;  11GS A;  2YNX A;  3KD0 A;  3BJ5 A;  3IHG A;  2CVD A;  3MWH A;  3HDC A;  4IQ1 A;  1XWG A;  2VAF A;  2X8H A;  3BBY A;  2MYG A;  2E2M A;  4XRA A;  4RQX A;  5IMV A;  3ZIT A;  1BG1 A;  4AJ7 A;  6GSV A;  4V2M A;  1MDI A;  3DVW A;  2YPM A;  2A2R A;  1JZD A;  1FHE A;  2BJX A;  2LUS A;  1YY7 A;  2K8S A;  2CZ2 A;  5COH A;  3GL3 A;  2K8V A;  5JCW A;  1TOF A;  2G2Q A;  1MDK A;  4FQU A;  1T1V A;  2EFE A;  4Z2U A;  4AJ6 A;  3UVH A;  5IMA A;  4KE3 A;  4OFN A;  2B5E A;  3VWV A;  1K0N A;  1GLP A;  4PX1 A;  1BJX A;  3H1N A;  1WE0 A;  3IK7 A;  2HNL A;  1M9B A;  1GNW A;  4IJ3 A;  4EUY A;  4MZW A;  2QC7 A;  4PGT A;  3J7Y k;  5ID2 A;  1WRY A;  1TI3 A;  1TRW A;  1TRV A;  1K0D A;  2C3N A;  3ERF A;  4TR3 A;  3C8E A;  1J9B A;  4L8E A;  4HOJ A;  1M2D A;  2QA2 A;  5G2Z A;  1OYJ A;  4MJE A;  1G7E A;  2MMZ A;  3TJK A;  2ON7 A;  1PMT A;  5A5H B;  1ZGN A;  2PER A;  2YP6 A;  2WFC A;  4X1U A;  2LRN A;  3NOF A;  3APQ A;  3WGX A;  1YF0 A;  4WBJ A;  1FB0 A;  2AAW A;  2K18 A;  1FO5 A;  1OC9 B;  2L6D A;  3TOU A;  2NBS A;  1GUK A;  3WT1 A;  5E4W A;  1YEX A;  3Q19 A;  1Y25 A;  3KEB A;  2KP1 A;  2B5X A;  2REM A;  1R7H A;  4RI7 A;  1F3A A;  4KW6 A;  3QOU A;  3TRQ A;  2NDO A;  5D73 A;  1XOB A;  4N3Z A;  5ECP B;  1F9M A;  3GIX A;  1GLQ A;  4FIW A;  3KTL A;  2VCQ A;  4X4J A;  5F8B A;  4YKF A;  4Z2T A;  2WCI A;  2C3Q A;  2G0F A;  1WPI A;  2GVP A;  2K6V A;  3HJO A;  1EV4 A;  1DUG A;  1F3B A;  2MMN A;  1K0B A;  3C7M A;  4F9Z A;  1EZK A;  4POK A;  2IWT A;  1T00 A;  2NVL A;  3L9U A;  5DCH A;  2YJ7 A;  3I6A A;  4BVX B;  3MIX A;  2PMT A;  4BWQ A;  2C3T A;  1ERU A;  2WS2 A;  2X8G A;  4I2T A;  4W66 A;  4HQZ A;  1WMJ A;  2CVB A;  1H4O A;  3GST A;  1TP9 A;  1XW9 A;  2B7J A;  1ZCP A;  2H1G A;  1SL0 B;  2EIR A;  5JWR B;  2H19 A;  3GYK A;  1SKS B;  1VGL A;  6GSU A;  5A4V A;  20GS A;  1F6M C;  1SL2 B;  2LJK A;  3IC4 A;  2VKZ G;  1SEN A;  1OE7 A;  1TTZ A;  3GHA A;  1FOV A;  3UAR A;  1PGT A;  1F37 A;  2GQL A;  2B5Y A;  3FR3 A;  5E59 A;  1HD2 A;  1FB6 A;  4ZL7 A;  2VIM A;  4MZB A;  1T4Y A;  2C0F A;  2DLX A;  2OBK A;  3HD5 A;  2IMK A;  2I9H A;  4JU5 A;  3SWL A;  3ZZX A;  4N0V A;  4X0X A;  1USB A;  4H86 A;  3LG6 A;  3VPQ A;  2HI7 A;  1YQ1 A;  2LST A;  2HYX A;  2WGR A;  4MDC A;  4E8E A;  4EF0 A;  4ZL8 A;  1OE8 A;  4MAB A;  8GSS A;  4KUN A;  4MNN A;  2VD0 A;  5DDL A;  1S3A A;  2LQQ A;  1WP0 A;  1ILO A;  1XZO A;  2H76 A;  4YQU A;  1IYH A;  2AB6 A;  5IO2 A;  1B48 A;  4BVY A;  1C72 A;  1ON4 A;  2CAQ A;  3ZIJ A;  4K5R A;  1GTU A;  4EL1 A;  3EWL A;  4TR0 A;  4NPB A;  4IVF A;  1PRX A;  3TJG A;  2VUP A;  2HE3 A;  3A3T A;  3TGZ A;  4K1F A;  3HJM A;  4AKI A;  2PVQ A;  2XPD A;  1SK1 A;  1SK0 A;  5G5E A;  2IMD A;  4E68 A;  2DJ0 A;  5HFI A;  2HRN A;  5CO3 A;  4MH2 A;  2GSS A;  4ML6 A;  2YWI A;  2HRK A;  2VLU A;  2VM2 A;  4HUA A;  2AV4 A;  2LKU A;  2LNT A;  3KJY A;  5DQY A;  3VFI A;  4MF7 A;  3NZN A;  2H0I A;  2IFQ B;  5KOX A;  1EEJ A;  2LS5 A;  1K0C A;  1PKZ A;  4BWS A;  3GV1 A;  1S3C A;  5C04 A;  1TI1 A;  4O92 A;  1FW1 A;  1XW5 A;  1X9W B;  4EO3 A;  5ECS A;  4FYC A;  2VOC A;  2DJK A;  3CTG A;  1PQN A;  3L9V A;  3S9F A;  1M2A A;  1W4V A;  2GQK A;  7GSS A;  4HU7 A;  5CRD A;  2A4H A;  5BMU B;  2I4A A;  2LTK A;  2J9H A;  5EVO A;  3VI5 A;  2AJQ B;  3KM6 A;  3LFL A;  5IIZ A;  2GQM A;  2PPT A;  2I1U A;  2H8L A;  4MLY A;  5KOW A;  2KLX A;  4DSR A;  4PQI A;  4Z2R A;  3E9J B;  5DJL A;  2DMM A;  4BPY A;  1QMV A;  4PUR A;  5LD0 A;  3G7J A;  4QQ7 A;  5KN1 A;  4TVE A;  1URM A;  3IRA A;  1SKR B;  2L4Q A;  2TRX A;  4HDE A;  3LW9 A;  3HHV A;  4HJ2 A;  2RUF A;  3TDG A;  2A2S A;  4K2X A;  4ZB8 A;  2XPE A;  1GP1 A;  1JZO A;  1YKA A;  3RHC A;  5HR1 A;  2P5Q A;  3UMA A;  2DKI A;  1SVL A;  3W6G A;  2HLS A;  2H71 A;  5LCZ A;  1B4P A;  2F8A A;  2HT9 A;  3R2Q A;  1T3B A;  2C0E A;  5IOW A;  4PQ1 A;  4TR1 A;  4L5L A;  2JSY A;  2P31 A;  4RI6 A;  3ED3 A;  3TJJ A;  2CZ3 A;  3TKR A;  1Q4J A;  3GN3 A;  2C0G A;  5HR3 A;  5CRW A;  3GKK A;  3LJR A;  1TRS A;  2GZY A;  2R0P A;  1GUM A;  4DEJ A;  4MZC A;  5DAL A;  4XHM A;  5D9X A;  2VCX A;  2E2G A;  2YWN A;  1ZYQ B;  2FGX A;  3CRU A;  4DSS A;  1SYX A;  4K9Z A;  3LGC A;  2JAC A;  3P2A A;  3BCI A;  1ML6 A;  5IMD A;  2DJ3 A;  2TRC P;  3QR6 A;  4CDO A;  5A34 B;  4O5R A;  4L0U A;  1PKW A;  4WR5 A;  2VCV A;  2HRA A;  5G5F A;  3M9J A;  3CYN A;  5HFK A;  6GSY A;  1U3I A;  3DGQ A;  3A2W A;  5GAP D;  2GST A;  4BL7 A;  6GSS A;  2L6C A;  5B6M A;  3UOM A;  4YAV A;  2H6Z A;  4J56 E;  3QPM A;  2EFD A;  3KZQ A;  2GZP A;  2VM1 A;  4YQV A;  1EWX A;  4MK3 A;  2NTO A;  5CNW A;  2NPB A;  5ECN B;  2R0G A;  3QAW A;  5B8A A;  4NHZ A;  1A23 A;  5D8I A;  1TDI A;  4F2I A;  2A2P A;  4RQR A;  4HU9 A;  1XW6 A;  1EP7 A;  1HYU A;  2YWM A;  4MPG A;  3BOA A;  2EIQ A;  2FNO A;  3GFK A;  2I3Y A;  1SVM A;  2LRC A;  3FZA A;  1NHO A;  5IMF A;  2O7K A;  2FCH A;  3EU3 A;  2HZE B;  4NWY A;  4K6X A;  4TXV A;  1R5P A;  3KH9 A;  1ABA A;  3F3Q A;  5G1L A;  3EE2 A;  1CQG A;  3M1G A;  4EC0 A;  2N5F A;  1MTC A;  2ES7 A;  5DAK B;  19GS A;  13GS A;  3ZMK A;  1AIU A;  5ABR A;  2HXK A;  3FYG A;  2H01 A;  1B8X A;  1X5C A;  5B8B A;  4XIH A;  4IEL A;  5AGY A;  5CRE A;  1XWK A;  5KN0 A;  4I97 A;  3QD9 A;  1VF1 A;  1LU4 A;  5EPF A;  4IQA A;  1G7O A;  2H6X A;  1Z9H A;  3TKQ A;  1VF4 A;  1J0F A;  4JED A;  3A5W A;  5ECK B;  1MD4 A;  3G7I A;  2D2Z A;  4IKH A;  3HYP A;  4EIP A;  1JFU A;  5FHI A;  1ERV A;  5J40 A;  1SK2 A;  2E0Q A;  3VLN A;  3F8U A;  2JAD A;  4ECI A;  2BMX A;  3UVT A;  3Q74 A;  4JRR A;  1AXD A;  2CX3 A;  4PQH A;  4I5Q A;  3D6I A;  4ZBA A;  4TN8 A;  2O85 A;  3F6D A;  4MJB A;  4WET A;  4XS4 A;  5ECR B;  4MJC A;  4Z7X A;  1T8E B;  3EVI A;  5IO0 A;  3A2X A;  4N11 A;  3HY2 A;  3GTU A;  4LL1 B;  2WUL A;  3EC3 A;  4TXO B;  1T4Z A;  3EYT A;  2AYT A;  5A1N A;  1SJI A;  2GZZ A;  2C80 A;  4AGS A;  1XOA A;  3TRP A;  5AIX A;  1XBS A;  1YDK A;  2EIO A;  1OKT A;  4HI7 A;  1O73 A;  3FKF A;  2X49 A;  3WGE A;  1QXH A;  1M99 A;  5GSS A;  5ECO B;  4LMW A;  1TU8 A;  4IP1 A;  3PIN A;  2B7K A;  2R4V A;  3C1R A;  2YCD A;  3ERW A;  2N5B A;  4K7O A;  5ELA A;  2C0D A;  2H30 A;  4YH2 A;  1FVJ A;  3MYD A;  4JR4 A;  1LJR A;  5KN2 A;  4IHU A;  3VK9 A;  1MDJ A;  2HSM B;  2MMO A;  1Y6E A;  3KMN A;  2CAI A;  1Z5Y E;  1O6J A;  2V1M A;  1F2E A;  5CYY A;  4TW5 A;  4L5O A;  1Z7P A;  3NIV A;  2HQT A;  2LJR A;  5D9W A;  1JLV A;  2X8C A;  3I43 A;  1YZX A;  2X64 A;  3P7X A;  2O89 A;  2YZU A;  4K8M A;  3W8S A;  2RII A;  3GKX A;  1M0U A;  4O5U A;  5CP1 A;  2P5R A;  4LL4 B;  4USS A;  5ECQ B;  2PU9 C;  4WR4 A;  2OAD A;  9GSS A;  1B9Y C;  1RK4 A;  4JE1 A;  2R2J A;  1SJ6 A;  1OC3 A;  2CX4 A;  4G19 A;  3ZIV A;  5A5H A;  1KEB A;  1O7U A;  3ZLP A;  4EKZ A;  5IM9 A;  1AQX A;  3A5I A;  1E2Y A;  3PGT A;  4G0I A;  3TKS C;  2EC4 A;  4HZ2 A;  2JL4 A;  3BCK A;  1BG5 A;  1OC9 A;  2H74 A;  2FY6 A;  1SJZ A;  4I2U A;  2H73 A;  4AF2 A;  3HVV A;  4PNG A;  3FZ4 A;  5H5Q A;  4CW9 A;  2FA8 A;  5A5K A;  3US3 A;  1XCC A;  2LV3 A;  4WBR D;  1ST9 A;  1I5G A;  4G01 A;  1BQ7 A;  1GSD A;  3L78 A;  4FH8 A;  2JZT A;  1ERW A;  1LBK A;  3IR4 A;  1SL1 B;  1PL1 A;  2BTO T;  2B3S A;  3L0H A;  4J2F A;  4ZB6 A;  1HNA A;  3FY7 A;  4BVX A;  3QFA C;  2B1K A;  3KP8 A;  4PXO A;  1A0R P;  2GGT A;  4MF6 A;  1A2M A;  2ALB A;  5EY6 A;  2GT5 A;  2X99 A;  3GH9 A;  3N5O A;  3QCP A;  3TRX A;  3D22 A;  3FRC A;  3MDK A;  2KUC A;  5IQY A;  1ZMA A;  3P8W A;  4N10 A;  3G9B A;  4TRX A;  2HSN B;  1Q98 A;  4G0K A;  1TW9 A;  1WJK A;  3QDN A;  3HVX A;  3K8N A;  1ZZY A;  4POB A;  3Q6O A;  2CQ9 A;  3L9S A;  1BAY A;  1WWJ A;  4TR4 A;  4XTS A;  4X43 A;  2R0C A;  3WD6 A;  5A4W A;  4LLR A;  1AQW A;  5F07 A;  4KDY A;  3RBT A;  1AQV A;  1T7P B;  3HKR A;  1Z6M A;  1DBY A;  3M0F A;  5F0G A;  3LXZ A;  3ISO A;  2H0H A;  1PN0 A;  5AIV A;  3HA9 A;  1U88 A;  1RQM A;  4WF4 A;  3GNJ A;  2VL2 C;  3O3T A;  5B7C A;  3UEM A;  2J23 A;  3ZFB A;  3DEX A;  3GX0 A;  3UBL A;  4KCE A;  2GSQ A;  3P90 A;  1G6W A;  2I81 A;  4Q5F A;  3LWA A;  3GA4 A;  5IPG A;  3TKS E;  3KCM A;  2CA8 A;  4G9H A;  4KSO A;  1GSE A;  1S3D A;  3TJB A;  4IN0 A;  3ME7 A;  4GRF A;  3DRN A;  1OAZ A;  1SKW B;  1TK0 B;  4QL9 A;  2GS3 A;  1V9W A;  5J3R A;  1GSF A;  1QK8 A;  4V1A g;  4RUV A;  1ERT A;  5DVB A;  1A24 A;  4GXZ A;  2IL3 A;  5KEJ A;  1NW2 A;  1YVL A;  2HFD A;  3LOR A;  1X9M B;  2V41 A;  4V2N A;  12GS A;  3TCO A;  2XBQ A;  3RPN A;  3VWW A;  2FWE A;  1KTE A;  4D73 B;  1K3O A;  3OR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...