4G0NA

Crystal structure of wt h-ras-gppnhp bound to the rbd of raf kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
164
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
molecule tags Protein binding/transferase
source organism Homo sapiens
publication title Allosteric Effects of the Oncogenic RasQ61L Mutant on Raf-RBD.
pubmed doi rcsb
total genus 58
structure length 164
sequence length 166
ec nomenclature
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g0nA00
2AD5A 4AIIA 2I1QA 2IYLD 2QE7D 4Q4JB 2YYZA 1E4VA 3WYGA 2CMKA 3TUJC 3EG5A 4BGDA 2IS6A 4IEIA 2QGNA 2VPPA 3BRWD 4TMVA 2ZRMA 2BDTA 3MMPA 1NG9A 1LS1A 3U6KA 1N3BA 2A5FA 3FHOA 3LBIA 3RC8A 5DE3A 4BLTA 4M8NE 3QBTA 4B3BA 2QTHA 5JFGA 3A4MA 3ETLA 4C4PA 1VIAA 3OFND 1E9FA 4GRAA 1RZ3A 4PSAA 4WXRA 3ZZTA 2EFEB 2ZEJA 1E9DA 3EARA 4WBSA 1H8HA 4AC9A 5IF9A 1YQTA 2SHKA 4HZUA 4C0BA 3GJ7A 4Q01A 1JB1A 3FMIA 2OXCA 2JJ8A 4NYJR 2FFQA 4PHHA 3PUVA 4AYTA 3K70C 1W5TA 2VSFA 5CLLA 1ZNZA 3Q5DA 2C99A 4RCZA 3NBZC 2A3RA 3L82B 1ZM2A 3FHCB 1W0KA 3BAFA 3W3AA 5DI9A 3R9XA 4TSFA 2XEXA 4OI2A 1P5ZB 2MSCB 4A0FA 1NJFA 2QSZA 3DM5A 3A1SA 2RGAA 1JXOA 2OUKA 1IXSB 4G5RA 3GD7A 4A9AA 4NYIR 4MRRA 1US8A 4KBFA 1J90A 1E0KA 1EWQA 3IIKA 5EP3A 2FPKA 2HEIA 4BASA 1JBKA 2Y8EA 1AKEA 4JBXA 5G53C 1KMHB 1T0HB 1OF1A 3ADKA 4DUGA 1J7KA 1F2UA 2QMUA 4LBVA 2WWHA 4XVQA 2WM9B 1XCGB 1NKTA 2WWIA 2EYQA 4KVGA 1M7GA 3QVVA 3KJGA 3ZVMA 1A2BA 5FBRB 1KJZA 2FE4A 3OIYA 4PC3A 3IHLA 2DB3A 5HPYB 1BH2A 3NBFA 3RSLA 2Z4SA 1YKSA 1NL3A 2GJAA 5EE9A 4PAQA 2DWPA 5EJEA 2ONKA 4UNPA 2WICA 3HPRA 3AVWA 3LO5A 3RHFA 3U4QB 4V0KA 1F48A 4YDSA 2BKEA 1VHTA 1P72A 5KPDA 3LRPA 1EFCA 2YVUA 2CLCX 3WHLA 1C1YA 1XXHB 1Z0JA 2O5VA 1SXJA 1UADA 3EA5A 5CM9C 3TAHA 4NYIQ 4RCYA 4DLUA 3LA6A 1KK3A 4WIAA 3ZGXA 3J81k 2MSDB 4FMCB 3BJIC 4LCBA 2QNRA 1TX4B 1XF9A 2D2EA 4NDZA 4MITA 2FSFA 2QPTA 5EUMA 2Q21A 4MUBA 3IO3A 1Z2CA 2KB0A 621PA 2JJ2D 3U5ZB 1G8HA 3HWSA 1AZSC 1UBCA 1CS4C 4C30A 4HAWA 4H1UA 1N6IA 4TL9A 4X8HA 1RE0A 2RKOA 4JT4A 3GLIE 1AQYA 2JJ2A 2JDIA 2GXQA 3BK7A 3JZMA 5TARA 2X1VA 1E2MA 1BIFA 2VF7A 3SHFA 3RANA 1GAJA 4A15A 1G7RA 3LQRA 3WY9A 2OBNA 2QBYA 2OESA 4LYFA 1FX0A 3VU9B 3VR5A 1DARA 1P3JA 3QUSA 2FPLA 4PQYA 2JLRA 1E2PA 4YLGA 3T5GA 1AA9A 2QAGA 2AK2A 1XMIA 4FMCF 4DLVA 1VHLA 5JZVA 2D3WA 4QJ3A 2HUPA 2VP9A 3UK6A 3GLGE 1OFIA 1KI7A 2J59A 5DNYB 1TMKA 5DGXA 3DDCA 5AJZA 3CRVA 3CR7A 5KSZA 5F9FA 2F43B 4BLPA 4F91B 1XXHA 3CZPA 1QHYA 2R9VA 1Z2AA 2F9LA 4LPKA 4CEHB 1Q20A 2HYIC 1HURA 1U81A 2CDNA 1TUIA 4PC6A 3BD9A 2QP4A 1DO2A 4TTRA 1E1RA 4IFBA 2Z6VA 1S1CA 4HYYA 1OFHA 3U3RA 1KDOA 1RRCA 1X6VA 1E79D 2JASA 4AYWA 4BFWA 4LJ9A 1KKMA 4PSVA 3WRXC 1ZUHA 1SQ5A 4LGMA 4BFUA 4HLUC 5CK5A 1DS6A 3B60A 5TDHA 3AVYA 1COWD 3OFNA 2R6FA 1Z63A 4HAXA 2OAQ1 2QORA 3OE7D 4R2HA 4PQRA 3HP1A 4FN5A 2GZHA 4GNKA 3OAAD 4M22A 3KTAA 1E9SA 2REOA 2XOKD 3EIQA 3UATA 4EIWA 4LYJA 2G0NA 3TSOA 2BC9A 2ERYA 2ANBA 2PEZA 1O3YA 3CH4B 1ZNWA 5L3RA 2HV8A 1GRRA 1G8PA 2A5DA 3MSXA 3RS5A 1NN1A 1MOZA 4LUCA 2Q6TA 4P32A 5IRCD 1XTRA 2VYFA 2BBTA 2FEOA 1W0KD 4B3FX 4HDOB 4HEJA 4ASUA 4F38A 1XEFA 3BE4A 5KHOC 3EZ7A 3QXJA 1TQ4A 1OH8A 1EK0A 1P9NA 1Z3IX 4UNSA 2WOOA 1U9IA 3EZFA 3OZXA 2G6BA 4G0NA 1MRSA 2ZIAA 4NE2A 4ARZB 3WP0A 2CL6X 5BYKA 1KAOA 5FL7A 1QF9A 3DKPA 5K8IA 2CCGA 1S2MA 2C9CA 4DLXA 4AY2A 2E87A 2O8CA 5JJLA 4I99A 1OLOA 1ESNA 3HU3A 5DYGA 3EPLA 1JI0A 5CLQA 3NVAA 3MWYW 3LBNA 2IXEA 4CW7A 4W7SA 5EE1A 3ZS9A 1TNDA 3RABA 2W00A 3IPYA 1GKYA 1VG0B 1G16A 3QXHA 4R71A 1MABB 1N5LA 1R7RA 1OXXK 2IWRA 1G7CA 4KLNA 5IT5A 2J0VA 4GMDA 1L7VC 1XMVA 1GZSA 2BHRA 2EQBA 5KNDA 4OHZA 2EFCB 5FBWB 5JS7A 4Y0VA 4DLRA 2JAQA 3F0TA 1GP2A 5AWFC 1HYQA 3UWOA 2C03A 3P20A 2CK3D 4L5BA 4B76A 4AKEA 1AM4D 1AS2A 1P60A 4V0NA 2ZUDA 2ZJOA 3A1VA 4X8OA 2YOFA 3PR1A 4OK3A 4B44A 3CONA 2ZJ2A 2FG5A 4ZDWA 3AF1A 4N0EA 5EZ6B 5KPJA 2ZU0C 3TAUA 1FL9A 2A5GA 1ZC3A 3F3YA 3K9HA 1I2DA 1WXQA 4MYCA 2AWOA 2KE5A 5JWRA 1EG7A 3IBGA 4TSFD 2BJWA 1VPLA 4YMWA 3TVTA 2G9NA 1QDEA 1W46A 1E99A 1WE2A 4Z1MA 4ZO4A 3AP3A 2RHDA 1QVAA 3QPUA 1II0A 4DB2A 2IUUA 4A8JC 3DPUA 3B1YA 1E69A 2ASEA 4KAXA 3GJ0A 4QGGA 2YOHA 3RRZA 1CF4A 3D8BA 2HDNB 4Q1DA 3RS3A 1P4SA 3QF7A 4MKGA 2D62A 4LWZA 2QTFA 1ZYUA 4ZCMA 4C3ZA 2DBYA 3N5CA 4WW0A 2C8VA 1UEIA 4ZIRB 3R7WA 2J41A 4ZV4A 3JVUA 4C0LA 1OXTA 1ONBA 1D9XA 2V54A 2FJUA 1T3LA 1LVGA 2BEJA 2D7DA 3ONWA 2F1HA 4QHSA 3QKSB 1DADA 2VP4A 4QBHA 5TMPA 3FMOB 4JIMA 3UKDA 3OESA 1NN3A 3UXMA 4B75A 2V8OA 5BYJA 5A0FA 4RY2A 3PQCA 1XMSA 4I1UA 2N1BA 3WNDA 3K0SA 4TQAA 4LJ4A 1XTQA 3GLHE 2C9OA 4GOXA 3C5HA 3CWZA 3CWQA 4PPGA 3VHLB 1KO7A 5GJBA 1YR8A 4PPFA 3KKNA 4CGZA 1KSHA 2FN4A 2ZRNA 1DTSA 2ZE7A 4ZCIA 3AF2A 1WBDA 3ZLJA 4Z8YA 4P0TA 1T8UA 4Q4AA 2W83A 3CPHA 4U02A 1RC8A 4DSNA 1VCNA 5GVSA 2QQEA 3L0IB 1EFHA 2ZRGA 2ANCA 4X8MA 4Z8XA 2E9SA 3C8UA 1K6MA 1U0JA 5SZJA 5AUOB 3T5DA 1ZU5A 1QHNA 2IT1A 2DFTA 4C0HA 1KHTA 2BMJA 3SQWA 1T8TA 4XD7A 5GJVC 1IM2A 1IN4A 4LRWA 5FPYA 4B2IA 1KJWA 4IOMA 1FMLA 5KSPA 1A5TA 2PZGA 3N2IA 4NMMA 3WMEA 3FTQA 2JCSA 2CHQA 3R9WA 3ICQB 2WMNB 1GM5A 1HE8B 4JJKA 4ZI3A 3I73A 2WIAA 4AWXA 1N6HA 1LF0A 1Z0FA 4XJXA 3CKLA 2FDCA 1NI3A 1GIAA 2D06A 4BPBA 3AKYA 1P75A 1JQLB 2J9RA 2OXRA 121PA 4JSYA 2F1IA 4XVRA 1HV8A 3MLEA 1XDBA 3CX8A 1GKIA 1AIPA 1R0ZA 1QHSA 2AHOA 1XD2A 2C96A 2YC2C 5DN6A 3ZYCA 1P2SA 5EP2A 1DAFA 1N0VC 4B47A 1ZUIA 3HU2A 3CF6R 2QAGB 4IXNA 3NDPA 2ZUCA 1P9RA 2WWGA 3LW7A 5E7JA 3CRMA 3CBQA 5KYKA 1HY3A 2HLDD 3EIEA 1KZGB 4IVQA 1U9IC 2O8FB 2GZAA 4WZ6A 3O8RA 2NO1A 4ZDKA 4HB2A 5CB8A 4IDNA 1G6OA 1XMJA 1E2NA 3B2EA 3CPJB 3GJ4A 3NHBA 4KU4A 4LV6A 4A2QA 2FA9A 2P5TB 2BBWA 2PLRA 1W36D 1N6OA 1UDWA 3X1ZA 1XPRA 1OIVA 3GJ8A 2G88A 5EUQB 5JHGB 4YMVA 1X3SA 2ZRKA 1EFRA 4L8GA 4Q9IA 3ZJYA 2BOVA 4PO1A 3U4QA 3PEVA 3NKVA 5EP1A 3VX4A 4F4CA 4TMXA 1AK2A 3VQTA 1P73A 3T1OA 3B82A 1B23P 4BFYA 3Q7PA 4EFMA 5LB2A 2X2EA 1U8ZA 3AKCA 3OHMA 3Q8XB 1E2QA 5BWMA 4YMTA 4B3DA 3KL4A 2VP5A 4PPNA 2CBZA 1XTSA 1YVDA 1XPOA 2WKQA 4DSUA 1E9BA 3H86A 3IUYA 3L0OA 1KMHA 2AR7A 5HKKD 3LVQE 4JLBA 4EDHA 4PHFA 3ZZ0A 1M6NA 2QENA 1D6JA 2DR3A 2KI5A 4LHYA 4FCTA 4A92A 4QG7A 2ZRJA 1SKYB 4JT2A 3E2IA 2IHBA 4URWR 1R8QA 2GCOA 1KK2A 2PT7A 2ZTSA 3DMNA 3U6BA 4GMXA 2ZAMA 4YC7A 1GL9B 4PAOA 5K8UA 3GQBA 1GSIA 1ZNXA 5GVRA 1S9DA 1YZNA 1ZC4A 2OV2A 1Q1ZA 2VHQA 2QTVB 3W5IA 2HF8A 1KI6A 4RSGA 4MYHA 3JVVA 5ELXA 4W5HA 3IQXA 2ZR9A 1ZUNB 3TBKA 3TIFA 5JBQA 1HQCA 1ZAKA 2ZI5A 3I32A 4H9GA 1XTIA 4YDHB 5AJVB 4RZXA 3TGPA 4TZ6A 2Q9CA 4EFLA 2QG6A 5KSYA 3GLIB 3FFBA 3QENA 4M9XA 1D2NA 2F1RA 1DG1G 1E9EA 2D74A 2CL7X 2WWYA 1FNNA 2BCGY 3MRSA 4B48A 1R10A 2C95A 2FH5B 4LX0A 4DRZA 4HATA 3IIMA 4Q4AB 5FBLB 4LYHA 5JSZB 2FSGA 2ZE6A 1QBKC 4PTLA 3ND8A 4Z1MD 3RS0A 4RFSA 1JQJC 2OBMA 3HPQA 3CO5A 1N5IA 3Q5EA 4BLQA 2NG1A 1HT2E 4D81A 1Z6XA 4D0NA 2GHIA 3QSYA 1Z0KA 1E2FA 2FU5C 3IBYA 3L43A 4JBYA 4B73A 2QMHA 2J5XA 4OQMA 4F93B 3MWKA 5TVKA 2C9YA 2V7QA 1X8LA 1ZU4A 3KZ1E 5FTMA 4L9WA 3FFAA 1G8FA 4RD6A 2W2TA 3WNBA 3AKDA 3GLFE 1Q21A 4CEJA 2IEZA 2FMXA 4KFTA 2XJ9A 1XCMA 1W0JD 4C2TA 3BGWA 4B2LA 2EFHB 1KK1A 2VH5R 1KSGA 1D9ZA 1GITA 2AX4A 2JIZA 1VYVA 3SYKA 2V1UA 2DFKB 2OCPA 4TLEA 3MCAA 1GRQA 4BWYA 2CE2X 4AG5A 1OH7A 4QFMA 4PC2A 5HZHA 1X86B 1PLJA 4JLMA 3SR0A 4KODA 1IN7A 4NZYA 2P2LA 2UZ3A 1YJ5A 2P6UA 3K09A 3HYRA 3KXIA 5EP4A 5TXGA 1QVRA 2NMVA 1DE0A 2VL7A 1GKUB 5J5CA 4M9SA 2B6HA 4LJ8A 3SU8A 3DM9B 5D3MA 1VG1A 4US0R 2PMDA 5BN3A 1ZD8A 4TMKA 1CTQA 1YE8A 1W4CA 4B3XA 3PVSA 5AK0A 5FTLA 3OEHA 1GL7A 4TLDA 2K5UA 3BH6A 4V0OA 2ORIA 3M4YA 3B13B 3KFXA 3SJAA 2NZ8A 5C18A 1U98A 2DPXA 3JZAA 3RSOA 1CP2A 2AFIE 2HJGA 1Q22A 1ZCBA 5FL7D 4RD3A 1CEEA 1UBGA 3P27A 2ATXA 3IEVA 2NIPA 4KV9A 1NLFA 2CXXA 1FMJA 4A0GA 3HR7A 5KDDA 5J4VA 5JHHB 2H18A 4UKDA 1I4LD 1VG9B 3SHWA 3CF2A 1YZGA 2XSZA 3VMFA 1L8QA 4DT1B 1RJ9B 1HE1C 1YZLA 4W5JA 4E22A 1AS0A 4OYHA 3TMKA 3LY5A 3A37A 4YMUA 1I4DD 2IF2A 4QM6A 2L0XA 3V4FA 1AZTA 1VKJA 2FFHA 5DH9A 1ZM4A 4FWIB 3X1WA 4XWOA 3WBJA 4QM7A 2W2VA 2R8RA 1DBSA 2IBMA 3MG9A 4GP7A 1KI3A 2JEOA 1L4YA 3R9IA 2P5SA 1KJYA 4G5SA 3QIAA 3KJHA 1UBEA 1ZBDA 1TU4A 1RIFA 2HLDA 2NO9A 2WSSA 4PZZA 4DDUA 1UKYA 1QZXA 4C9BA 1OHHA 3BH0A 3AVOA 2J46A 1XBTA 2PMKA 1KO5A 2IYRA 2D7CA 1JALA 2RMKA 4UXHA 2AKAB 1M8PA 1E0SA 1E32A 2GZDA 1E1QA 1NBMD 4DEXA 4DZZA 4R7ZA 1OJLA 3R8FA 1SVIA 2ZRDA 4LSGA 1S0UA 2ZRBA 3DHWC 4UXIA 4LYAA 4CEIB 3G82C 2PX0A 2GEDA 3KQKA 1XRJA 2CVHA 2ZYWX 2WPDA 3KQNA 1DO0A 3VHXA 2AD1A 3B85A 2HCJB 3OE7A 2IYSA 2LCFA 4QNMA 3UG7A 4B74A 4OI0A 1Z8FA 1IONA 1OB5A 1OSNA 2XOKA 1G20E 4KITB 2JLYA 2RGNC 4CIDA 1VCMA 1FNMA 2R6DA 4B34A 2ZRIA 3QKRA 2BV3A 2XX3A 4CRWB 2FOLA 2Q3HA 2DYKA 4C2UA 1EFUA 4PC7A 4NYJQ 1LF5A 2O0KA 2Z4RA 3O47A 1G19A 2UVQA 4ESHA 3VX3A 4CVNA 1M7BA 1KK0A 4QGAA 1FUKA 4A8JA 2A5JA 1E0AA 1GNRA 2OILA 3BOSA 2PX3A 2CNWA 5G41A 4IHQA 3C14C 4TWZA 4MDFA 2BM1A 3ZH9B 2NOAA 2FZ4A 5FBVB 4HB0A 3O8BA 2QMOA 3FKSD 4X8LA 1WMSA 2C2HA 2ZU6A 3IO5A 2W58A 3VU9A 2O8EB 4JBWA 1G6HA 2ZJYA 4XTRA 1DOAA 3I92A 4JLJA 4DCNA 1G8YA 1UFQA 3QPWA 3K0AA 4ZI2A 1S3SA 1XJQA 4EUNA 4XWKA 1IJFA 1NVWQ 2C98A 3AP2A 3BB4A 5C4GB 1T3SA 2P3SA 2ZS7A 4QHYA 3DZ8A 5EXTA 4HAZA 3TE6A 2F55A 3AVVA 2Q9BA 1OIXA 4MKFA 2YV5A 4MRNA 1QG4A 3DOFA 4BQSA 5GJCA 4DB4A 1IHUA 1U0LA 3QE0A 4DJTA 4LJAA 1JPNA 2XTZA 4OQXA 3NHAA 1IY0A 4EPYA 5A4JA 4MRSA 2ZUBA 2NPFA 3WNCA 3RWMB 3W3ZB 4JVMA 5DISB 2P67A 4GPTA 2GEVA 2BIFA 3KJIA 3TVDA 1M2OB 5FPHA 3ZQJA 1SXJB 3FWYA 4JLNA 4AKIA 4ZKEA 4Q48A 4OBEA 4KLZA 5KNCA 1T5IA 2C04A 3NXSA 6Q21A 3EAQA 1EFTA 2NQ2C 1YZKA 5DSZA 3TKLA 4D25A 4BZPA 4QBGB 3REFA 1VYTA 2ZJ8A 3IHWA 2R6CA 3BB1A 2X2FA 5JRJA 2FZLA 3A6PC 1Z5ZA 3BFXA 2V6JA 3W6OA 4L16A 2GRJA 1A1VA 3QKUA 5JWHA 4MRPA 2HT1A 1YR9A 2JIZD 4UXJA 2ZE8A 5HTKA 1KKLA 3KB2A 4KFSA 4R9UC 1GFIA 1KSFX 2UKDA 5IK2A 3WYAA 4M2LA 5FOSA 4AK9A 5FTNA 5DHFA 3TR5A 4ASUD 4ILEA 2QGZA 4B71A 4PHTA 4KJZA 3QPVA 1UBFA 3Q72A 4M1TA 2NTYC 4G5OA 5L3SA 4HUQA 2ZYUX 2O0JA 4G01B 2CJWB 3IILA 4PQFA 2R6GA 3QF4A 1F5NA 1AGPA 1U0HC 5AJWA 2WWXA 2DFNA 4S35A 2IWHA 4FW9A 2IL1A 5BN5A 4M1OA 2DY1A 1SXJD 1Z0DA 5JMTA 2XGJA 3VR4A 3FGNA 4C7OA 3T1TA 1VYUA 3OEED 4PAMA 1P62B 1N5KA 2QMEA 4M1SA 1CRPA 4JSTA 4DDTA 1GVNB 3B78A 3T06B 2WZQA 5EZ5A 1HTWA 5EE3A 1COWA 4ACAA 3SJCA 4NKRA 1Z29A 4BEBA 3Q85A 2YWEA 4BFSA 2X19A 5BXQC 2V1XA 4AKGA 2F3RA 4W5WA 1CBUA 1G5RA 4LC0A 2QRZA 2ECKA 4G5QA 4NH0A 4TLAA 1SHKA 4TYPA 1HQYE 3RNLA 5L3QB 2FFBA 1IXZA 1OYYA 1CXZA 1U2RA 5CYPA 3KFVA 2O8EA 2OEPA 1GDDA 1YZUA 5G3YA 2ZSAA 1Z0IA 4R2IA 2DFLA 2BMDA 2UZIR 1OH5A 5B57C 2ZRLA 4Q4HB 1E2LA 3RDPA 1KGDA 4WZBE 3EWAA 3TJZA 2VHTA 2ONJA 1T9HA 4P4SA 5K8TA 1F6BA 2IUSA 2IW3A 2OFWA 3EA0A 1N5JA 1XTKA 2O8BB 2ZPTX 2V7QD 2ORVA 4PHGA 4TLCA 3B9QA 1KY2A 1MT0A 1IJEA 2X8AA 1QRAA 1I4TD 5JCPA 5DN6D 1IY1A 5EXXA 4RD0A 1P6XA 2IXGA 3EZ9A 4L9SA 3U3KA 3X1XA 2XXAA 2P65A 3AUYA 3WBKA 3B6EA 3MWLA 4ITRC 4U5XA 5E4FA 4US1R 5ANRB 4NYMQ 1E2JA 3K0CC 2NO6A 1ZM9A 3EPJA 5AJXA 4YMSA 5CM8B 4CF7A 5JCZA 2ZXUA 3RC3A 1JXMA 3SI7A 2WWFA 2O8DA 1NVVR 3K0EA 3CRQA 2HYDA 2JJ1A 2WWWA 3EASA 2DWOA 2WJVA 1VMAA 4IRUB 1FP6A 3P4XA 1R2QA 2PJZA 4O0MA 3K1JA 3HU1A 4QKQA 3THWB 2A78A 1G41A 2FWRA 1CR4A 4Q21A 3U44A 2YHSA 2D2FA 1XJ0A 2GWHA 2IYUA 2WSMA 4OQFA 1Z6AA 1ZNYA 2QUZA 4Q9HA 1G1MA 1ZCAA 2IS1A 4OHYA 1Q3TA 3KQHA 1H8ED 2ZRAA 4FD2A 3LBHA 4O3MA 1TF2A 2ZE5A 2EYUA 2YC4C 3L8ZA 1UM8A 2GJ9A 1KDTA 1QHIA 2Z0MA 3FVQA 3N70A 3THYA 2XZPA 4Q19A 5UKDA 3AV0B 3SBEA 2HXSA 3NH6A 5LBIA 1W2GA 3LXRA 3RS4A 3TSWA 1W44A 3THXA 3VKHA 4EFNA 4CT5A 1U94A 5DYIA 3PXGA 2YINC 1TADA 1U8YA 1NY5A 2IYQA 3CR8A 2ZSFA 3VAAA 2WTUA 2XJ4A 4POAA 3OF5A 4DLSA 2F7SA 5FUWA 5JJKA 1XB2A 1XFAA 3I3SR 4GBMA 4NU0A 4WZAE 4NP6A 2RGEA 4EPRA 1KI9A 4AKHA 4C7OB 3TW8B 3BB3A 2ZQ5A 4TMTA 4TYQA 3PUZA 2GKSA 1R4AA 2ZI6A 1JJVA 1UKEA 1UF9A 3QF4B 1GG2A 4BFZA 1W36B 5DHAA 4F92B 5EE5B 4ZCLA 5CDFA 3Q3JB 3KX2A 4DDVA 521PA 5HKKA 3M0EA 1NVXQ 3IKJA 5KSOA 4R98A 3ADDA 2BEKA 1M34E 1WCV1 2ODNA 4US2R 5TV2A 4TZ0A 1GRNA 2XAUA 3TUIC 5F2EA 3K0FB 4Y0AA 3U3OA 5K8LA 3SNHA 5J4HA 2VP6A 2QY9A 4AG6A 3C4JA 5JI2E 2GETA 1KY3A 1WA5A 2XB2A 5FBQB 3WXMA 1W4BA 4ON9A 4PSKA 3CNOA 1R5NA 1R5OA 3CPEA 4HZUB 4JLDA 2Z43A 4MYTA 4Q02A 5G40A 3W6NA 4D80A 4EJSA 5B64A 1H8HD 2PLFA 2ZR7A 4V03A 4E07A 5C2JB 1XEXA 2JGNA 2ZI9A 1IN5A 1MRNA 2VF8A 1T0JB 4DEYA 4IOJA 1XZQA 3TR0A 4E09A 4B32A 3R7WB 4JLKA 4DLZA 3WMGA 3CX6A 3DEFA 4QRHA 4Q9JA 4MYUA 4NCNA 1Q12A 4Q1CA 4C0QC 4A8JB 3EX7C 4IOLA 3CNLA 3EPKA 4TQUS 1JEEA 2WHXA 2J0QA 1ZVQA 4TYYA 5AUPB 4FXPA 1K8RA 2J1LA 4HB4A 4Q7LA 2ZM5A 4BRWA 1AKYA 1G21E 1G5PA 3DZDA 1E94E 1X8KA 4EPXA 2QP9X 3LWNA 4NYMR 4B43A 3N2EA 1P9WA 2VA8A 3GEEA 3GLHB 5CIWA 221PA 1CULC 2GCPA 5HZKA 2GXSA 2H1LA 1FQKA 3DVLA 5JEEA 3QXSA 2JLWA 3QXCA 1N6KA 3ZD6A 1NRJB 4Q9KA 2WIBA 3LD9A 5HCIA 3KXLA 1TTTA 4Q7KA 4EJSB 2OCBA 3KKOA 3EC2A 4N3NA 4QGHA 4A0HA 3K70D 1GNPA 1CR1A 4XH9B 4ZDJA 2CHVA 3U7HB 1D5CA 4NHOA 2O52A 1JR3E 1CU1A 1RFLA 4RD4A 2IC5A 3FKSA 4EKDA 4A2WA 1T3HA 2QPAA 1II8A 1E2HA 1XZPA 3QG1A 2ZR0A 5JS8A 3C5CA 3KQUA 4V0MA 3GJ6A 4H1VA 1G3RA 2HT6A 2A7QA 2BKUA 2FF7A 1NLZA 3MAAC 3V9PA 1SXJC 4HLQB 4ESVA 1MR3F 2D4HA 3GJ3A 4PX9A 4RZ2A 3IQWA 4OK5A 4URYR 4YQFA 5KDOA 1E0JA 1AS3A 1E2DA 1R8SA 4HAVA 3SJBA 5J4KA 4GL2A 4Q7JB 3AGPA 2EU8A 4BECA 2W0MA 1G9XA 4BE7B 3QVUA 5FPKA 2DCUA 1ODFA 3V00A 1E96A 1LW7A 1W5SA 2B7BA 2V6IA 4FI3C 4BLRA 4NCIA 4ZPXA 2LKDA 1TF7A 1M7HA 3MWJA 2OZEA 1RYHA 1HEIA 4ARZA 1KI2A 3BS4A 1ZM7A 3THXB 2EVWX 3OEHD 1ZP6A 4W9MC 1F2TA 1PLKA 2AXPA 2EWWA 3CF0A 4QXAA 3I8SA 1R6BX 4KVAA 4RJLA 4RZ3A 3AVTA 1A4RA 3AH8A 1F60A 3QJYA 4QC2A 2HXYA 3T15A 3W8RA 4RKEA 2R44A 3KDSE 3NEJA 1CJVC 3QBVA 5KTYA 2ZRFA 3B1ZA 4N1AA 3LLMA 2EFDB 2G1KA 3QXXA 1ZD9A 4E5UA 2QI9C 4JYBA 2VHUA 3GMTA 3SYLA 4JLPA 2QT0A 4N0DA 1ZIPA 3GEHA 3IPXA 3QQ5A 4LBWA 1BO6A 5F9HA 3DOEA 2X77A 2JA1A 4BZXA 3ZVNA 2RGGA 2ZRHA 1SVSA 5JWOA 2JJ1D 2V3CC 1XU4A 1TPZA 1N6NA 2J0UA 1J2JA 3PG5A 5AUQA 1ELOA 3QI2A 5FI1B 1E9RA 5LB4A 1CJMA 3E70C 4HUTA 1Q1EA 3RWOA 5KU1A 1FUUA 4HZIA 2RH5A 3A4LA 1N6PA 3SYNA 1NJGA 1ZRHA 2GK7A 1GL6A 4OJKA 4PC1A 1OH6A 1KMQA 2PH1A 2Z83A 3CRRA 1G64A 5JLJA 1Y3AA 3LFUA 3VR3A 2OFXA 1SXJE 2BJVA 4Q66C 1X8JA 1Q1BA 3EZ6A 1CKEA 2AKYA 1W49A 1XNJA 4FMBB 4KI0A 1OPXA 4TT3D 3PV0A 3HJNA 4JKIA 3U44B 3B8HA 4K81B 3I72A 1D8TA 4DC9A 4M53A 5CJPA 4IEEA 2OO7A 3T1VA 2WBLC 2I3BA 4P3YA 4EPVA 2IXFA 721PA 2WOJA 1KAGA 4P4SB 4IFEA 1H8EA 1FPMA 2NZJA 1LY1A 3HR8A 4D26A 2BCJQ 1DELA 1EXMA 1WP9A 1SHZA 4GFDA 1I2MA 4IKEA 2QBYB 4E03A 1E3MA 3ASYA 1EFRD 1W47A 1XD2B 4A1FA 4IDPA 1NKSA 1UJ2A 3LX8A 3KUCA 2RGBA 4L15A 5DI3A 3U7EB 3SE0A 5EQTA 1W7AA 3U61B 1QHGA 2VTKA 1JAHA 1P7CA 1XCPA 4A6XA 1W48A 1MH1A 5EE0A 3PITA 2ZSEA 4Q7MB 1S1MA 1KDPA 1TEXA 3RS7A 1LFDB 1N0WA 3AVPA 3NH9A 2JLVA 1BYUA 1TEVA 2BBOA 4RFSB 4GI7A 1AGRA 2VQSA 2IK8A 1FQJA 4QGFA 4LK2A 3RLFA 2KWIA 2OFOA 3TW4A 1IOZA 4PPQA 3A36A 2DWQA 1UPTA 1GUAA 2KSQA 2RCNA 2BBSA 1Z28A 1CIPA 1EWRA 3PCRB 4Q4HA 1X1RA 4LV5B 1YHNA 4AI6A 421PA 3ZVRA 1BYIA 4C0AC 4EQ6A 2CLSA 3NDBB 3UMSA 5H8WA 3BXZA 2RAPA 4QL3A 4NCKA 2ZITA 4KYUA 2QL6A 4CEJB 3UANA 1N2CE 2ZANA 1TQ2A 3L8YA 1UAAA 1W2HA 1GNQA 2QQ0A 1SZPA 3CW2A 1FTSA 1R0WA 2Q3MA 4FINA 4Q4LA 5LPNA 1IN6A 2ZVPX 5H70A 2PZFA 5H1YA 2GNOA 2HCBA 3FKQA 4Q1FA 1UEJA 4LBYA 2WAXA 5CB6A 2IYYA 2VRWA 5E3HA 2VSOA 3PEYA 1P2TA 2BM0A 3GJ5A 1PVOA 2RHMA 1F2UB 1SVKA 2H16A 4EJSC 1XEWY 1ZINA 1E1RD 2YNMA 2GCOB 2J45A 4MDEA 3THOA 3FHTA 1NSTA 4MGYR 2W6JD 4TL7A 4BLOA 3I61A 1RRPA 3W90A 2CVFA 1N0UA 4UJ5A 4C0KA 2C78A 1YRAA 2QRNA 3LX5A 4JLVA 3WRYC 4I4LA 3CM0A 1Z07A 1NN0A 3PENA 4TT3A 1DAGA 4JMPA 4LOAA 2PZEA 1UKVY 1G291 4AD8A 1AJEA 2J7PA 1S96A 4DSOA 1QG2A 4CT4B 2H7VA 3A4NA 3RS2A 1F3OA 1OV4A 4D6PA 3TNFA 4BFTA 1VIYA 1SVWA 4BLSA 2YJTD 4PXAA 1U99A 3SC3A 1DPFA 1G3IA 3CRW1 4DLYA 1KZ7B 4Q4JA 4QBIA 3GFPA 4HLCA 5LD2C 2GVZC 2ZI3A 4M4SA 5KO2A 4BRUA 1Q44A 4MRVA 3UMRA 1G4UR 3VR2A 2XNDA 1XD9A 2H17A 2C5LA 2OSBA 1G7SA 4JLOA 3A58B 2FGKA 2OM2A 3LDAA 3PIRA 4MUAA 3TK1A 2PL3A 3P1JA 3KB1A 3W8NA 1A82A 4Z51A 1VECA 1E4YA 2AK3A 3AP1A 3BIFA 5F3WB 3T35A 5CITA 4B33A 2OLKA 2V9PA 5E95A 2YWGA 2W6ID 3CH5A 1V43A 4JL6A 1AQUA 2AN9A 2RGDA 1PLLA 5C46F 1HA3A 2I1VB 2DHRA 4PZLA 3I5YA 4KSCA 1HT1E 2QEQA 4MA4A 5BW8A 5FI0B 1Z22A 1Q1QA 5FOXA 3U3JA 2OG2A 2MMCA 1IQPA 2VHCA 1XD8A 3H4MA 5C4MA 2JLZA 1RW4A 1YRBA 3C41J 3U2QA 1Z47A 3U3MA 1T5LA 3QY0A 2OE2A 4DCVA 2IA5A 2IYVA 4DSTA 2VSXA 3LAWA 4IJMA 2ZRCA 3X2SA 3AQ4A 4TMZA 5J4YA 3WMFA 1L2TA 2WPDD 3NEYA 3NC1C 3TSZA 1G18A 1JR6A 1PZNA 1GWNA 2FSIA 3ZVLA 4ZKDA 4EPTA 4QBFA 3GCGA 3WHKA 2IS2A 3QOFA 1XEXB 2V55B 1G8GA 4GDFA 5DI3B 3W5JA 4TTQA 2J0UB 3L0PA 3GEIA 5B58C 4Q47A 2TMKA 1RYFA 1XX6A 2ATVA 3IGFA 3REGA 5FR2A 1E2KA 3H0KA 1U8AA 2H8KA 1KOFA 3BERA 1OKKA 4HDCA 2WVJA 3AF4A 3K0FA 4FMDB 3R20A 3KXKA 3TRFA 3BWDD 3KQLA 4PO9A 4P31A 2A5YB 2CCKA 4NCHA 4RFVA 5SZIA 2WSSD 3B5JA 4IXMA 1SKQA 5E7IA 2G3YA 2XITA 1RVDA 3LV8A 4DHEA 2GESA 1NMXA 2H57A 4NPHA 5AUNB 3ZD7A 1CJUC 4WA7A 3NIBA 3NTUA 1B0UA 3HYTA 4B3GA 2PBRA 3QEOA 4JJZA 3AVQA 3VNVA 4DCTA 2J0SA 4D82A 1OE0A 4D2IA 4Q00A 3BFKA 3LH5A 1NVUQ 1Z83A 3TH5A 4A2PA 1G17A 2IUTA 1EX7A 4HB3A 1Z0AA 4UNRA 3A1TA 3X1YA 2CEAA 4DT1A 5KDLA 5C1BA 4DWJA 4IW3B 5L3SB 1YZTA 1SKYE 1SVLA 4DIDA 3AEZA 4M1WA 1C9KA 1OXUA 3I1FA 2P6RA 1J8YF 5L8VA 1CJKC 1NBME 1ZJ6A 1IN8A 4GSYA 4KSBA 5FTKA 4ZIRA 1KI4A 5FL3A 4J0QA 1TF5A 3BH7A 1P2VA 1J8MF 3ZDQA 4GZLA 1G7TA 1D2MA 2GJ8A 3GFOA 2NPIA 4A0RA 4Q1EA 2CCJA 2W2XA 1NG1A 2FSHA 2PCLA 1OFUX 4P4UA 3FOZA 1G5TA 2JLUA 2HF9A 3UG6A 3P4YA 3ZIAA 4LPSA 3AUXA 3RRMA 4B2PA 4KBGA 3E1SA 4UQOA 2QP3A 3VKWA 1LTQA 3T61A 1JJ7A 4Q1BA 4XIGS 5D3MB 2QT1A 2VP2A 4HSEA 2O8DB 3SEAA 2WJGA 3FMFA 1NSFA 1J99A 3GLFB 4M9ZA 4F4IA 2B8TA 1KO8A 1VCIA 3NBYC 4IVRA 2OBLA 1C4OA 1BKDR 1KI8A 3VNUA 2ORWA 2CHGA 1QHHA 2REBA 2JLQA 3FE2A 3LVRE 4JLAA 4PANA 2XZLA 1Q57A 2QM7A 1LS6A 4NTZA 3BFVA 1NIJA 2ZROA 1EGAA 4AURA 2QA5A 2QM8A 1II8B 3OIVA 3I8XA 3KKMA 3UIEA 4OQNA 5A5GA 821PA 2A9KA 3PEWA 2GEUA 1JR3D 4M1KA 4HI0E 4OQLA 1MABA 4U7DA 4L4UA 3ZS8A 4A4DA 4QJ4A 3W34A 4PZYA 3AF3A 1NBMA 4HLDA 4G5GA 4LJ5A 4URUR 1TUEA 1W4RA 1DAKA 2R6AA 4PFSA 2AXNA 3ADCA 5EXSA 4TYNA 4MGIR 1HH4A 2PEYA 2IS4A 2O8CB 5P21A 5DO9A 2ZJAA 4URXR 1M74A 2IF0A 3GLHA 1NVVQ 2NGRA 3K9GA 2GF9A 4QOSA 2IYTA 3X1DA 5LDDC 5J47A 2W6JA 1FFHA 1KSJA 2B8WA 4LJ6A 4UJ3A 3CB4A 4DBLC 4DDWA 3GLIA 2EFGA 2RGCA 4TL8A 3B1WA 1NY6A 4D0LB 3D31A 1D2EA 1Y63A 2J7PD 3SZRA 1US8B 3T34A 3Q7QA 2GTPA 4BZQA 3I62A 4Q1AA 1U90A 2P6NA 2XNDD 4XSHA 2AL7A 3SJZA 3AVUA 2F6RA 4OJQA 1CLUA 3OIWA 5LD2B 2IYXA 2FEMA 1LNZA 1NMYA 3L2OB 2ZETA 3Q9LA 2XTNA 4D0GA 4CEIA 1S9HA 1Q0UA 2H92A 4C0JA 3K8YA 3K9NA 2CLDX 1W0JA 5CJ2A 1E9AA 3TQFA 2GDJA 1AN0A 2GILA 1BS1A 3SQXA 4DKXA 3GJXC 1ZIOA 5KUTA 1XXHE 1NP6A 2FX3A 4IDQA 1GILA 4XWAA 1PUJA 4I1SA 4BFXA 2V4ZA 3TQCA 4DCSA 3THYB 2Q9AA 2G0TA 1DVRA 4TN1A 1RRFA 1FTNA 4JVNA 3VR6A 3IEUA 4HDQB 4XVUA 2EWVA 3VTKA 2WJYA 3M1IA 5SZHB 1OB2A 2E1RA 4FCWA 5CK4A 1J70A 1ZMXA 3ND9A 2YWFA 1IY2A 1DAIA 4EQ6B 2VIIA 3TUZC 2QZ4A 2CK3A 3OEEA 5G3ZA 2KJQA 2WJIA 4F7WA 3OIUA 2ZSDA 3GLGB 1VCOA 4EAQA 4A36A 2PT5A 4TMWA 5FOWA 2LWIA 2R65A 2XZOA 4MQBA 4QNRA 2GK6A 4MKIA 3SS8A 4KYIB 2OCAA 1SGWA 4RD2A 1OT3A 3CZQA 1Z6GA 1TU3A 1NF3A 2WJJA 2OT3B 3VKGA 4MGKR 1E9CA 2REXB 1RJ9A 1IBRA 1GTVA 1KIMA 1JAIA 2YZ2A 1WQ1R 5DIFA 1W1WA 3SFZA 3ZIAD 5EXPA 1JECA 1CR2A 1OKKD 4S2EA 2ZS8A 3LXXA 4OHXA 4OK6A 1XPUA 3K0AB 1R0XA 4YONB 2XXAB 4Q9LA 4CYMA 3MUFA 2HJVA 1II9A 5FPTA 2QROA 4D4KA 2O8FA 4Q18A 1T6NA 5BQ5A 1RPZA 3THWA 3EPHA 3EC1A 4I81A 5HCNA 2ZS9A 1NIPA 2IX3A 4IDHA 2R2AA 4RZUA 1OFTA 3V4RA 4IOKA 3A1WA 3U7GA 4PR0A 4I1VA 4GT1A 3BORA 4ABYA 3QEJA 4O2LA 2OLJA 2W0SA 3K70B 5KNBA 2O0HA 5FFMA 4PO8A 1E79A 1MO3A 3NG1A 3PFIA 2ZJBA 3P26A 3MGCA 4O25A 5FTJA 1G4AE 4WAUA 2EW1A 1KNXA 4XTCS 3A1UA 3L0SA 1P2UA 5DLQC 1NMZA 4M21A 4B6FA 2J7KA 4D4JA 3C16C 2PJRA 2GCNA 5HE8A 4FWTA 1R5BA 3SBDA 4LC1A 2ZSBA 3G5UA 3UWKA 1KTVA 3LNCA 4KFRA 1R0YA 4U00A 1TAGA 3LQQA 1YU9A 1S8FA 3AKEA 4KCGA 2QPOA 1V5WA 4G3XA 3SN6A 3KUDA 3DKVA 3B7GA 3TLXA 3S1AA 2P0EA 1WRBA 4QHTA 1YZQA 2ERXA 2IYZA 3WP1B 5GADl 2H5EA 4DXAA 2GXAA 4HUQB 3VFDA 5BN4A 3EWSA 3CX7A 4I1OA 1XEWX 2WAYA 1BMFA 4NBSA 4AYXA 4BEJA 4CZ2A 3I5XA 5CIQA 2GJKA 1Z6TA 1OIWA 5AJYA 1X1SA 1DAEA 1DAHA 4CDGA 4WVFA 4V02A 5FH9A 1DG3A 2GA8A 4LHXA 5L3QA 4JVLA 3D3QA 4II7A 3C7KA 4A6PA 4MH0R 1N25A 1RRGA 2A2ZA 5KOYA 4RKFA 2N42A 2GF0A 4TQ9A 2IEYA 3AGQA 2XB4A 2QAGC 2FNAA 3DMDA 5HR5A 3GLGA 1JEDA 5GJWC 3GFTA 5SZKB 1E2GA 5J40A 2JDID 3E5HA 4DIEA 2AFHE 5FPSA 3RYTC 2KBEA 3AF0A 4LHZA 2ZRPA 2JLSA 4JYCA 2QAJA 1E98A 1E2EA 3B9PA 5JECA 4XSGA 1K5DA 4NL4H 3RRNA 5CDFE 3QKSA 3K53A 3K9LA 2CJWA 3M6AA 2KBFA 2JLXA 4GOJA 3FMPB 3CUEF 4LV8B 1Q3HA 4LJ7A 3MD0A 1JNYA 4K8OA 4P4TA 5FOVA 1KI6B 4ACBA 1RKBA 2ZAOA 5JEDA 1FW6A 5HE9A 2WMOB 4GP6A 2Z5FA 3AVXA 4D4LA 3BBPA 5L3VA 1OXVA 2ZJ5A 4MKHA 4JL5A 5F98A 3H84A 1PUIA 2FPMA 2ZREA 1OHHD 2JATA 5JJIA 4ZDIA 4V0ME 3C15C 1EESA 2OCYC 2WJHA 1O87A 2Q3FA 1WBBA 4KFUA 3F8TA 2QN6A 2F9MA 3B1VA 2YKGA 5TY0A 1NLYA 1ZD1A 2BMFA 1WB9A 2WV9A 3RRYA 3PJRA 2VO1A 4OI1A 3FYHA 1UKZA 3SFVA 3ZQ6A 1ZM3A 4NCJA 3OAAA 3QG5A 3GPLA 2GXUA 4JL8A 2FFAA 1A2KC 5IK2D 3H2YA 3PUYA 4WOPA 1WF3A 3CLVA 1W4AA 1SULA 2BMEA 3P32A 3FDIA 4URVR 4YXWD 4OHVA 1MKYA 2YWHA 3KKPA 1IAQA 2WKRA 1PV4A 4M0LA 2B21A 5IHPA 2J87A 2LKCA 4A82A 1SVOA 2F1JA 4LY6A 4DCUA 1CJTC 3AM1A 4TTPA 3W9YA 4JKYA 2CL0X 2I4IA 4FMDF 1TQDA 4MGZR 5B30A 3KJEA 3GLFA 5FUYA 4LJYA 4O2RA 4DUGD 4URZR 3DL0A 1G3UA 4LDJA 2QE7A 2G1JA 4Q5IA 1E2IA 4QJ5A 3B1XA 3PEUA 4D4MA 1JPJA 1H65A 1XP8A 4Z54A 4C0SA 5JI3E 4LHWA 4JS0A 4JZKA 4LI0A 2IHYA 4IVPA 2R62A 4OKSA 2VP0A 4M9QA 1DAMA 3F5FA 3O8DA 3R8CA 3MJHA 1YR6A 4G1UC 1MO4A 4KXFB 5JRZA 1L4UA 1PJRA 2YOGA 1QHHB 2OAP1 5FR1A 1KO1A 1BOFA 2GVDC 2PCJA 3K09C 3UMFA 1A7JA 2GAAA 4P33A 3PUWA 3I4LA 4EPWA 5JSZA 4WXPA 2ZYTX 2QSYA 2GBLC 1FZQA 2ZYVX 3T1QA 1LV7A 2VBCA 1K5GA 4KHZA 2AWNA 4FCVA 4V0LA 4LHVA 3LW8A 4Q03A 3EW9A 1G3MA 1S4QA 3SOPA 5IDVA 3ECCA 4GZMA 3MFYA 3QKRB 1DEKA 4RD1A 3ASZA 5CYOA 1N6LA 3CIOA 3VR1A 1NNEA 2XSZD 2G83A 1WDTA 1VG8A 1SVMA 4B6EA 2B92A 4HAUA 5FOTA 3W6PA 4HAYA 4ERNA 2VEDA 1TQ6A 1VDZA 2Q0HA 1Z6YA 2OHFA 5FUXA 4OL0A 4XD7D 3GP8A 4LBZA 4B35A 3QKTA 1MO5A 2WKPA 1T91A 3KTAB 5E7MA 3NWJA 4OI4A 3FB4A 2GJSA 5J4LA 1OYWA 1IXRC 1NN5A 1ETUA 2MMGA 3UPUA 2VHJA 2G77B 2CNWD 1OXSC 1KO4A 1KI1A 1P61B 2B7CA 4LZZA 5H68A 4DVGA 5FOUA 1W36C 4CEHA 1XWIA 1YR7A 1XJCA 2RGNA 3BC1A 3H1TA 1KDRA 4UNQA 2N46A 4GOKA 1E6CA 1F2TB 3FPAA 1ANKA 5D3QA 3K0CA 4YXWA 3IIJA 1TL7C 3S1AB 2CE7A 4XOIA 3O8CA 2VLIA 4M1YA 3EIHA 3MJRA 4RVCA 5M04A 1MV5A 2RGXA 3AB3A 5B2ZA 2QU8A 4TLBA 4BUJA 2FGJA 4M1MA 2ODBA 5TB5A 3A8TA 3D6TB 2F3TA 1XTJA 3ADBA 1LB1B 1UDXA 2BWJA 2W6IA 1ESMA 3WYFA 2BVNA 1E1QD 4BFVA 3ICEA 4DLTA 2XTMA 3RVBA 4K46A 3G0HA 4OHWA 1VTKA 1HUQA 4JVSB 2A30A 2O8BA 2J3EA 2F43A 1CR0A 2ODWA 2FV8A 2ZI7A 4TL6A 4FIDA 1OW3B 3KKQA 3PUXA 2ZJZA 3QNUA 1FP7A 2ZVQX 2IYWA 1ZW6A 1QHXA 1FOEB 3HDTA 5AR1A 4UNNA 3U60B 3RAPR 3IDQA 3T12A 3LLUA 5FUVA 2GBLA 4TYWA 1S3GA 1BMFD 2NO0A 2NO7A 1FX0B 1KNQA 4IDOA 1N6RA 3U7FB 4NONA 1GOTA 2C77A 3D7MA 4HLUA 4KO8A 2ODEA 2XNSA 4B3CA 1MO6A 1Z08A 1G3QA 3NC0C 3EXAA 1CRQA 4DLWA 2MSEB 1KYIA 3EZ2A 2RB4A 3SDZA 1EX6A 3ZZUA 8OHMA 2ZI4A 2GAOA 4F4JA 1M1YE 1T4GA 3DO6A 3NBXX 3CNNA 1Z06A 1JR3A
chains in the Genus database with same CATH superfamily
1QRRA 3ZGOA 5J43A 1NMQA 2DQSA 1E4VA 2CWDA 1Z88A 5B6IA 3TUJC 2FKAA 1P7ZA 3DEHA 4IEIA 5C8YA 4TMVA 1E8NA 1GCAA 2ZRMA 2J09A 3MMPA 1GZ5A 2VJAA 1O1YA 4FK8A 4OH7A 1YQEA 4F4HA 5HW0A 4OXNA 5I51A 1NG9A 4BO9A 3I9NA 2OZLB 6NULA 1QTIA 3LBIA 3VR3D 4M8NE 3JRXA 4B3BA 3S2ZA 2PMEA 3A4MA 4IQ8A 3ETLA 2R47A 1K88A 4NARA 1Q2UA 2YV1A 2GPSA 3WKAA 2Z3VA 3DAFA 3A27A 4PGAA 3JX9A 4J4TA 1E9FA 3TFOA 1I13A 1RZ3A 4Z53A 4WXRA 3DOHA 3ZZTA 1OWNA 1YS1X 1PQYA 5LUBA 4AC9A 3O3CA 3GAAA 2BN4A 5BOSA 3BRCA 4Q01A 3GA0A 2QVLA 3RT9A 3FMIA 2OXCA 4JBXA 5IJ9A 1V96A 2CW5A 3OHSX 4UPVA 5EIHA 4NYJR 4PHHA 3HEAA 1CPYA 1AKWA 3L6UA 3FXAA 3PUVA 1KDVA 2LCQA 1K06A 1ZI6A 1W5TA 2JVKA 1EDOA 3C6MA 3ILSA 3NBZC 4YT5A 1VMIA 5CUQA 5B3LA 4GC9A 1KORA 2J3DA 2V7EA 1DV1A 1DBPA 2AW5A 1C1DA 2Y9MB 4X0EA 5DI9A 4YT2A 1C9MA 1JG1A 4OI2A 4IUBS 2BGNA 2EKPA 2MSCB 5IJ9B 3AM5A 3UMMA 3QP9A 5HKAA 1ND5A 2QSZA 4GBJA 2F8MA 1RRMA 2OUKA 3GBSA 3KZKA 1IXSB 2BFMA 3GD7A 1EWTA 4A9AA 1TYDE 2WHYA 2X5JO 4KBFA 3D6NB 7ABPA 2XRZA 3X43A 1EWQA 5CPFA 5EP3A 2HEIA 2IYFA 4P80A 3UA3A 1AKEA 5CDGA 4A23A 3U19A 4OO3A 2DZDA 1JMYA 3WDLA 1NHWA 2QMUA 1IN1A 4G41A 4DC0A 2UZ1A 1JW9B 2WM9B 4Z4QA 1XG5A 1NKTA 2BFAA 1K92A 1M7GA 4I9UA 1HMPA 2VYVD 3CEHA 2PZAA 3TSAA 2P90A 1LI7A 2HA2A 3KYCA 3OIYA 4PC3A 4CIVA 3S8YA 2DB3A 4E4YA 2GUWA 5C8DA 2R48A 3M33A 5ADHA 1NL3A 1JIIA 2MOKA 2YZGA 2GTIA 5EE9A 3VVLA 1PGJA 2M6RA 3RVLA 2V74B 2OHOA 3U4QB 2J3IA 4H1TA 1F48A 3FYUA 1TEHA 4CV2A 5DX1A 1L7AA 4HGPA 4MR8B 3V5NA 1ISGA 4BMOB 3LRPA 5LQJA 1IHOA 1DTEA 3K05A 3WKDA 5ITZB 1N0IA 4MX8A 4OB6A 3WHLA 3U39A 3ZWWA 4OQ4A 3VU1A 4EY8A 4RV9A 1NVTA 2FEWB 2H2IA 5FNZA 3GLKA 3TAHA 2HN9A 4OGLA 2R1TB 2GPBA 1TE2A 2GF2A 3LA6A 4A26A 3WYEA 2G67A 1B6TA 1AKQA 3HUEA 2Z5LA 3DMFA 4O2AA 5KU7A 1XF9A 4NDZA 3ZWYA 3G9QA 3KAKA 3VV3A 1Z7WA 1MB2A 2F17A 4N48A 4LFCB 4U39A 1JSCA 4XQ9A 1INLA 1CHDA 1GSOA 5F9MA 3HWSA 1D2RA 2FMHA 3JWJA 3RREA 3FTFA 2QQ5A 1AY0A 1GFZA 1PWZA 1ECCA 3E8XA 1QCCA 4C30A 4HAWA 2G40A 2HIGA 2EDCA 3W79A 2E5LB 3EGXA 3AZPA 3LUHA 1UMKA 3O3MB 3LHKA 3BWCA 4ZYXA 2Z30A 2ZK7A 6REQA 2XCRB 3FZYA 3JZMA 2O0LA 1BIFA 1CIVA 1FW8A 2JKZA 1A1VA 4MWOA 1AUVA 2OBNA 2QBYA 3HNPA 3R6DA 3O4IA 3F3SA 4LYFA 2WIGA 3VU9B 5BV1A 2C94A 4FHGA 1Z17A 2QVGA 5JY6A 4MV0A 4ODIA 1E2PA 1LWNA 4PZDA 4RHEA 1VRVA 3CPSA 4R1TA 4RBNA 3N0VA 1E8DA 2Q8QA 4D0SA 4FMCF 4GXNA 4BO6A 1VHLA 1RWOA 2JCYA 4LQDA 1LGYA 2VP9A 1OFIA 2C4KA 4G4SO 3ROTA 3NCHA 2RBKA 3CR7A 5AW5A 1T2CA 2DBVO 2WG1A 2C0CA 4HTFB 1Z2AA 3MC1A 4DADA 1BWSA 2PMFA 5KHLB 2QNIA 1U81A 1K6XA 4ROTA 4PC6A 2FWIA 2M9MA 1DO2A 2QP4A 2VYNA 2YNMD 4IJVA 4IFBA 3U4IA 4XGRA 4EUKA 1WULS 4RDIA 4HYYA 1OFHA 1PTJA 3LIPA 4IWXA 4WH0A 4AYWA 4CV1A 3R8XA 3JTMA 1KKMA 2B4YA 4LJ9A 4PCAA 4KP7A 3WRXC 4MGHA 3EXIB 2IY7A 1ZUHA 1E2BA 1SQ5A 4RTNA 4P6VF 1ABBA 4BFUA 2G1AA 5CLJA 3PNOA 3HDVA 5TDHA 3YASA 5TQ2B 3G3EA 4HXFB 3AVYA 2MR5A 1Z63A 1A5ZA 2OAQ1 2QORA 1OXBB 1SCKA 2VRCD 3OE7D 5JSYA 5K0SA 3HP1A 4E51A 3NDRA 2GZHA 2H4HA 2MSLA 4G56A 2DU8A 1E9SA 4KDCA 2OYRA 3EIQA 1CVIA 3UATA 1LUAA 4XUDA 4EIWA 5INTA 1PNOA 2G0NA 1VE3A 4OAQA 2VYQA 2BC9A 4DZTA 1O95D 2EV9A 1C4WA 2B9VA 2DUWA 4MYDA 3ZHTA 5C7OO 1EA5A 3R0QA 4OIFA 3LPCA 2W2OA 5L3RA 2Q2VA 4HX5A 3IP1A 3MAJA 1G8PA 4S1VA 3WXBA 4L7QA 1IZYA 1NN1A 3DAGA 4E1VA 4P32A 3DFMA 3SXUB 1XTRA 2BBTA 2FEOA 3S55A 4X20A 4B3FX 4HDOB 3OM9A 2LRHA 2GBIA 3CMCO 2Z2KA 4X44A 2VNAA 4L1KA 5KC8A 3OJXA 2XQFA 1OVGA 3F1LA 1K1EA 1TD1A 4RMGA 4UNSA 1FSZA 1WZCA 2XUFA 1L4GA 2G6BA 2XUQA 2ZIAA 3KZCA 4J9VA 3WGJA 3G2HA 5L7WA 3NTXA 3JAMA 2FRDA 3DKPA 2QUKA 1CUFA 1QDUA 4JNKA 5JJLA 2E87A 4WDRA 5JXHA 1WKVA 2DQZA 1QGED 1GTL1 4NBWA 5CJJA 3NAMA 4G07A 3WFZA 4W6ZA 2XZTA 4XA8A 2GN1A 4PG4A 1Z39A 1YA4A 5F4BA 5HFNA 3JR7A 5EE1A 4GI1A 3OTIA 2Z8XA 5H02A 1CFZA 3EMBA 3K9QO 2HSZA 4PHCA 4OQEA 1DQYA 1A9XA 2XA1A 1CQIA 1BQEA 1MABB 1N5LA 1R7RA 2WUWE 2WW8A 3L7BA 4OLAA 4HDRA 2W2KA 1G7CA 2NU9A 5ITSA 1RS0A 4QT4A 3LXMA 1XMVA 2YRFA 3C6BA 4R6WA 3GGCA 4KSYA 1KYWA 3GA5A 3HN7A 2K6GA 2X1MA 3RSZA 5DWDA 4X7RA 4DLRA 2G7MC 4ZYYA 4M36A 2QTMA 5CRIA 1GP2A 3FMVA 3RUIA 5AWFC 2BSXA 2PFGA 3UWOA 2C03A 3P20A 3HY4A 5F5XA 4P86A 4BGEA 4L5AA 3NOVA 1AS2A 1ATZA 1ECPA 4V0NA 4BVLA 1C3LA 4X8OA 3NJ4A 1U1DA 1U9YA 5IAJA 2ZJ2A 3GBPA 1SK9A 3B9BA 4ZDWA 3RBXA 1PS8A 4N0EA 3WGGA 1QPGA 4RNDB 4BJ1A 4P3OA 4D9CA 4RANA 1I2CA 2Q5IA 4RVSA 5AIBA 2A5GA 3S29A 2CMFA 3KJFA 3WLNA 5CD9A 5C53B 2OV3A 1EWVA 1WXQA 3STTA 4M55A 3RE1A 4G1FA 1W1UA 1EG7A 5DHTA 2PX5A 3RHSA 1VPLA 4K6OA 5BN3B 4YMWA 1YBAA 3SC2B 3D6FA 4JUBA 3DWEX 3K5HA 3PQ8A 4Z1MA 2HL6A 3N9IA 1QAMA 3T1NA 3C3JA 3QPUA 3MYYA 4C2AA 2JLAA 2EJVA 4ND6A 4A8JC 4DMLA 3ETNA 2ASEA 1GZ3A 1CF4A 4B4VA 1OA1A 3GBVA 4Q1DA 3QF7A 3PT9A 2AJBA 4NY1A 3EPPA 4MKGA 2D62A 1FA9A 1A88A 3EVEA 3FNQA 3M9XA 4LWZA 1LDGA 2QTFA 4LSZA 4L28A 5SICE 5HKLA 1CQZA 4ZCMA 2DBYA 2H1SA 3I6IA 3P9IA 2QDXA 2LGJA 3CNQS 1UEIA 2D5IA 2SKCA 3GEPA 4PYRA 3RHTA 3ASVA 5EJ7A 3OKFA 2OV6A 1R5JA 3R7WA 1C3XA 2BGUA 2C42A 4MI9A 3WJ7A 3GUCA 1UR5A 1OXTA 2ZJ3A 1ONBA 1D9XA 2V54A 4REQB 3AEQA 5C31A 2E5FA 3CCCA 2B4TO 3T5PA 1ARZA 5JJ5A 2BEJA 4L85A 2ZIZA 3B6JA 2HU5A 4CDNA 3GYGA 4QHSA 2CFCA 2FP4B 2X14A 2XYQA 4QBHA 3FMOB 5HGJA 1NSYA 4JIMA 3CVJA 1CR6A 5TMPA 3UXMA 3UXEA 1KAMA 5I9IA 5JXJA 4U2KA 1NM5C 4BN4A 2I7VA 4QECA 3M6VA 2PX4A 4L8VA 3RV4A 1Z8NA 4GKBA 2ZB3A 4TQAA 1HFWA 1ITZA 3UUGA 4GOXA 1P1JA 4HEA6 4IF4A 2GBPA 3C5HA 3G0CA 1X74A 2XH8A 3QHPA 1YR8A 1H3EA 1HBJA 1PR6A 4HL6A 2MSWA 5AIAA 3DBHA 4PLTA 3KKNA 2NPOA 4J4HA 2J9XB 4GKAA 4Q3AA 1DTSA 2ZE7A 3CZRA 3AF2A 4IL5A 5E7QA 4Z8YA 2G76A 3WGNA 4Q4AA 5C4IA 1AKNA 4H4EA 1YZ3A 2W83A 2H0QA 3CPHA 1EQUA 1RHJA 3NNDA 5DMHA 3ZDFA 1MA0A 8ADHA 1MFZA 2ZR8A 4YAOA 1I01A 2ZRGA 4QUKA 4Z8XA 3KPVA 5SZJA 2E9SA 1NVEA 1VI6A 1U0JA 5CG1A 3LT5A 1NZDA 3TB6A 1M1NB 3LVFO 4X20B 1QHNA 2V96A 2IT1A 3AUFA 3UT0A 1DBRA 1DB3A 3ZHYA 3F74A 4CKBB 4Z2AA 4RK1A 1THGA 1ID1A 1ENOA 3SQWA 4DMCA 3EUEA 2QPLA 3HXMA 1Z18A 3O1IC 5A1TA 2X7HA 4IOMA 4UBJA 3D2AA 2I6SA 1XZBA 2PZGA 4R7TA 2ACKA 2BKXA 4XGNA 5D87A 2PWPA 3RSCA 4QUAA 2W8BB 2IPNA 3RYFB 2Q5JA 13PKA 1GQ2A 2OY0A 2D13A 1DU4A 4WMLA 3R9WA 3EVAA 1W581 4ES6A 4ER3A 7YASA 4N4AA 5HFJA 1GM5A 2FYTA 2VQDA 1Y3HA 1QIHA 3AW8A 1OLUA 1LF0A 4M9UA 4JODA 4BLWA 2JFPA 2FDCA 3DS8A 3C4VA 1NR1A 2D06A 1P75A 3EY9A 2C61A 4YRMA 8ABPA 4G4GA 5B7GA 2E0IA 3MD9A 4YRJA 1QHFA 1VSBA 1QVVA 1RVV1 2G5GX 4NJEA 5IDWA 1HV8A 3MLEA 1XDBA 5J63A 5ENDA 1NQ5A 5B1DA 1K86A 5DSXA 3OQVA 3KZMA 4MLZA 4P3NA 1AIPA 1R0ZA 2I78A 2QX8A 3NWOA 2P2DA 5CCBA 2MDTA 2XQVA 1N0VC 2R5FA 4B6OA 3GN1A 2O2XA 4EWLA 4DV7B 1N7IA 3WR5A 3K15A 1B7GO 3WWOA 4D3DA 3ZLBA 1QKKA 1B2RA 7GPBA 3NDPA 4EF6A 1OFGA 3LW7A 4GXTA 4NG4A 5EIWA 3T7KA 4RZQA 2QTTA 2DETA 5LSAA 3CX3A 5KYKA 5DK4A 4IVQA 1EBUA 4KQXA 3LU1A 4YJFB 2EW2A 3O8NA 5DT9A 2NO1A 4KRYA 4UPDA 3VTFA 2VSYA 1EE2A 3TLGA 3Q0EA 4HB2A 3KTDA 4H1WA 3NNNA 1MNAA 1T4DA 3KLBA 4CQMD 3FLBA 2NZXA 1WXFA 3RVQA 1XMJA 2XDQB 1BVUA 3GJ4A 1U7PA 1NLMA 2BBWA 1NFRA 2FXVA 2NV2B 1DKPA 1G20A 1R9NA 5AVWA 3GJ8A 3RF6A 3NDJA 3P97A 2IOHA 4KUHA 1ULZA 1J8QA 3DWIA 3GPBA 2BOVA 1L5GB 1X87A 1CY7A 1KVTA 3PEVA 5EP1A 5FULA 2AFVA 5EJ5A 4ZT2A 1PYOA 1S3FA 1XZAA 3M6UA 3H8VA 3WL7A 2GFHA 2OYSA 1AK2A 2BFCB 2FG7C 1VSVA 2PV0A 5EQDA 3VQTA 4WVLA 1G55A 1M2EA 2Q3CA 3OWOA 1F5SA 3OJWA 4JFAA 3ZHBA 4EFMA 4ZMRA 1VSQA 1NDQA 2X2EA 4EUFA 3RFFA 5AO9A 4EO9A 2ZDGA 4P4LA 2GLXA 5HJEA 3KL4A 3CLTC 1DKNA 4EHHA 5DLPA 1AQNA 1H4VB 4G0YA 1SIWA 3DZIA 3UJ3X 1XTSA 2Q45A 1KETA 3QMWA 2NTJA 1A72A 1SMKA 1Z5NA 2PZ8A 1E9BA 3FETA 1XPOA 2H3EA 3H86A 3C1AA 1RWKA 2E48A 1NT2A 2RJ3A 3VHQA 5HKKD 3PUKA 4EUSA 3C1TA 4GQIA 5CFLA 4EDHA 4OYRA 4PHFA 3CGGA 3I28A 3BA6A 1U2GA 2YXPX 1M6NA 3VR5D 3OZRA 2IE0A 4NOJA 3OEYA 4ER5A 1QF6A 3C5WP 5KS2A 4A92A 2GK4A 4JT2A 2IHBA 3E2MA 2HI0A 3AQIA 4ZT7A 3ZQ4A 1FX1A 3U6BA 5DF1A 2PGAA 1MTOA 4PAOA 5LQCA 4HNRA 4B80A 3GQBA 1NRWA 2RHCA 1UDAA 3NANA 1V5EA 1A7KA 2OV2A 1TLTA 4GPBA 4ZOLB 4WHMA 1KI6A 1VKOA 1YR3A 2I7CA 2LZ0A 1NQXA 4I1RA 1C2YA 5DASA 4X6XA 2JK0A 3K73O 2FW7A 3JZIA 3IQXA 3MWEB 2C82A 1ZI9A 1Z5GA 1Y8RB 1QIJA 3C6ZA 4ZGBA 1UKCA 5LM3A 1HQCA 4IUDS 2ZI5A 4I4TF 2RI6A 4OHRA 3WLHA 4C21A 5AJVB 1N36B 1BHSA 4KEAA 2FSVA 5DYNA 2MINA 2Q9CA 2QG6A 3JQAA 4Q4DA 3FFBA 2BFOA 5A4DA 5CDTA 4HOYA 4PU0A 3GLIB 1T4CB 1DG1G 2D74A 4K9OA 4F4UA 3QFFA 3VJRA 3L0BA 3Q2OA 1I7QB 5J2TA 4NICA 3MRSA 4J8PA 5IBRA 4FW8A 3ZG6A 4H7KA 4C5BA 2Q3BA 5JATA 4Q4AB 3AFMA 4EJ2A 2FSGA 2ZE6A 1IG3A 2OP0A 2PUAA 3RS0A 1DDIA 1YTLA 5FA6A 4P81A 4R8KA 3R5FA 1L3IA 1N5IA 2NG1A 2NT4A 1AKVA 1NZJA 2GHIA 3QSYA 5F3DA 2PGXA 1E2FA 2OENG 5E38A 3IBYA 4I5IA 4B73A 4BP8A 3D8RA 5JAZA 5JZ9A 4F93B 3NHUA 2OXFA 2FE1A 3NLLA 4F2GA 3MWKA 1RWQA 3QHAA 4Z9YA 3WNBA 3N39C 2QQFA 1BXGB 1G8FA 3FFAA 4RD6A 3AKDA 5FOQA 2D5CA 2FMXA 2QRHA 2XJ9A 5I4KA 1XR3A 4MINA 1IY8A 2EFHB 3DMHA 4OQQA 1DIBA 4KWHA 1ADYA 2BF4A 1DBIA 2V1UA 1L7EA 3IALA 4ER6A 4TLEA 1YHYA 4YAIA 2ZAYA 4AG5A 4Z4FA 3AETB 2Q0XA 4PC2A 4XLZA 2OB1A 5HZHA 2R87A 2RK3A 3ZIDA 1PLJA 1H9AA 4RV5A 1C7ZA 3D0OA 5LKRA 1L8XA 3FCXA 4ILKA 2VC2B 4BNYA 1Y9EA 3SLGA 2Y0EA 1WTAA 2NUBA 3PK0A 2PUBA 3TQQA 3VC3A 1GKUB 2QVYX 3T1YB 5TSDA 2EIXA 3PFGA 4M9SA 4JYZA 1N9ZA 1YKGA 1VG1A 4M89A 3A3YA 4P2GA 4US0R 2PMDA 2VXOA 1FNCA 2P4QA 3OCWA 4BWVA 4TMKA 2XE7A 5BN3A 3LFTA 4E5VA 4EW1A 1S02A 1YE8A 1W4CA 4F3RA 3PVSA 5LZ9A 1QP0A 4E1BA 4JH0A 2BW0A 3P2IA 5FWDA 5FTLA 3NPMA 4LE2A 2K5UA 3DLIA 3GT0A 1ZIXA 3HWRA 1HOTA 4W5RA 1VGVA 3BH6A 4KZKA 2ORIA 2F64A 4FCCA 3JQ7B 2JAWA 3SJAA 4IX1A 2NZ8A 1W94A 5C18A 2DPXA 3JZAA 5ALPA 3LE8A 4ZVLA 2G0AA 2R5WA 4AY3A 3ER8A 3W2GA 2HREA 2HJGA 1S3IA 1J00A 4RD3A 3ILYA 1VFNA 3O94A 3UHOA 4KH1A 3EDMA 1SKAA 1QRTA 4KV9A 3GFSA 1NLFA 2E89A 2CMHA 4IHJA 5CG2A 3HR7A 1I3OA 4JC8A 2WD7B 2H18A 2XKBA 1I4LD 3H5TA 4X1KB 1FLVA 1QFSA 2HQBA 3O75A 1BDMA 4J1SA 4O4LB 3UJ6A 3G5MA 1T36B 2XSZA 3V7NA 4DWOA 3GVIA 2ZW9A 2JFWA 4R2WA 4M37A 1HE1C 1XEAA 2PXHA 4W5JA 3RLIA 4CLOB 3NYIA 3UB3A 4R1OA 1AS0A 4U1RA 3H6KA 5TGDA 3TMKA 3A37A 3N2KB 3RKRA 1I4DD 1F3LA 4QM6A 3OFVA 4HGQA 4BWGA 4RIHA 3UAYA 1AZTA 1RXYA 1TM5E 3E9ZA 4TXLA 1Y98A 2FFHA 5DH9A 3TKAA 2HJRA 4FWIB 3W7BA 3ZTWA 1VLMA 1V6AA 3PQ7A 2GYVA 2IBMA 1KI3A 3R9IA 3IDZA 2P5SA 4RWEA 1L4EA 1MXHA 1V9SA 4P53A 3QIAA 3KJHA 1TO1E 1MB9A 1XDZA 5CVEA 5AXCA 2HLDA 4DDUA 3N2KA 2Q2NA 1U0GA 2RHLA 1GEGA 3BH0A 1R74A 1CZNA 1FDOA 4N8DA 3H6HA 3D2BA 1XTZA 3C2QA 2PMKA 3WLMA 1YQUA 4H27A 2WWRA 4DMMA 3F4KA 3W5CA 3FGPA 3U4HA 1WOYA 2OQIA 2I62A 3O92A 2PQMA 5BSVA 1NW4A 1JU9A 1M8PA 4MVJP 4BGUA 6ABPA 1G1AA 2GZDA 1E1QA 4TRNA 1NBMD 1XKTA 1O95A 1TFUA 5DBGA 3W5BA 2O59A 4R7ZA 1RZRA 3U1BA 3PBKA 2YHIB 5BWCA 5JDCC 2IXBA 1S7GA 3EUFA 1XRJA 3TTXA 3LQ2A 2WPDA 4YDRA 2Z6UA 3T4XA 5CGZA 5AW4A 2VRCA 3IT1A 3OE7A 4G9EA 5E4TA 3UG7A 4OI0A 1PK7A 3DBRA 4ENWA 2R8ZA 3RS9A 2WKWA 3N8NA 4QOJA 5KEIA 3IQIX 2XOKA 5TIIA 1BE6A 1ADGA 4KV7A 4CF3A 4JP3A 4EX6A 1KBZA 1Q0PA 2BV3A 3AHFA 3WLPA 2C3UA 5EHQA 1GQYA 4TRRA 1F14A 3H4TA 3U17A 4G4IA 4PC7A 3HJCA 3P2MA 4NYJQ 4V38A 5KJEA 5IT4A 5KQRA 2HHHB 2BKAA 4DRXB 4XW2A 4EG7A 3UB4A 4WLUA 2UVQA 3IBCA 1IEQA 3HLKA 3TIXB 1PNRA 2FUCA 4L5CA 4R16A 1FFXA 1M7BA 3OTHA 4L2IA 2FN9A 4FBGA 1QVWA 4Z0PA 5LWQA 5B6JA 4ARVA 3AETA 5EFZA 2CNWA 4DR4B 4IHQA 3DO8A 3CFYA 4TWZA 5TJ9A 1K89A 2HA0A 4GKJB 5FBVB 4UVGA 1QMGA 2HA6A 3R5KA 1NNSA 4MZXA 3RV3A 4C7VA 1QYIA 4X8LA 1WS6A 3KETA 2WJ3A 1RXEA 2ZU6A 2O8EB 4BJHB 3VU9A 2R1VA 2DR2A 1TUBB 1VI2A 4JBWA 3MJTA 5AJTA 2ZJYA 2XNHA 1IOLA 1G8YA 1SPBS 1UBOS 1UFQA 4XUEA 1VRWA 4YB8A 4YMHA 3CB2A 5EIEA 3EH1A 3OPYI 3GCDA 1SEVA 2A67A 4AZVA 1IJFA 3BMNA 2C98A 2PHZA 2V9CA 4E5SA 2GN4A 2SICE 2AQKA 2PQ6A 2ZTMA 2F55A 4BNMA 3P0JA 5CDYA 2QM0A 1QQ6A 3VOAA 4N18A 3P19A 5GJCA 3RU7A 4S1OA 2ONYA 5A1JA 3D7KA 1JKJA 3DBOB 4FEGA 5JBIA 1U02A 3ZY4A 3CLHA 4OQXA 2AZ4A 4AFNA 3GNLA 4ZVMA 5DXJA 3C87A 3WNCA 2NPFA 2CJFA 5F2OA 2JZOA 3JD1A 2RARA 3W5AA 2P67A 2YY7A 4GPTA 4AY5A 3VTAA 3KJIA 1W6UA 1V2HE 3EFOA 3RR2A 1M2OB 3FYDA 4A3SA 3WBBA 4BS9A 1R6AA 3FWYA 2PANA 1DDGA 4OBEA 4KLZA 1Y6RA 1U8XX 5GINE 1WMBA 3LDHA 4EYEA 5ED0A 5J4KA 3L8EA 4BZPA 2QTLA 4ZGGA 3ORSA 3V48A 2QX6A 2XUHA 2I4TA 3KBBA 4NK5A 1P0CA 2V03A 4XM2A 5JRJA 1Z5ZA 4PIPA 2V6JA 4L16A 2C1ZA 2VHZA 5JAMA 1YI0A 2EP8A 4E31A 4UXJA 1A2QA 3HYLA 3DCNA 5AVUA 2QZPA 3C74A 3FR7A 1KKLA 4UBNA 3QWIA 4H4DA 3KB2A 3SXPA 3PHCA 5EFOA 1KSFX 2MSKA 3WYAA 1G42A 4IQFA 1XO1A 2JI4A 5CX1A 5FOSA 3K2EA 3CH7A 1V25A 4EA7A 1ZSNA 4QOIA 5DHFA 4ILEA 4KQGA 4B71A 5IDQA 2ZJ6A 4PHTA 1DQSA 2NVUA 5JCOA 1TM1E 2VJKA 4ND1A 4OHMA 4GICA 3W2IA 3II6X 2CJWB 4PQFA 1T3GA 2Q2OA 3QFSA 1F8YA 2Y0PA 2JHGA 2AN5A 1M34A 2DFNA 2WF7A 3VPGA 1Z74A 2P5YA 2HPHA 3JWEA 4FW9A 5F77A 4FFPA 2OXTA 5HUJA 1E3QA 1RPAA 1YMVA 2X5KO 3K9BA 1MQSA 3FVVA 1SHLA 5JMTA 4F7DA 3R9XB 4FFWA 4C7OA 4ZCQA 3UQZA 1VYUA 5DHSA 3T1TA 1XGKA 4PAMA 4RF3A 4KUGA 1Q7BA 1YIDA 1R9GA 1K7FB 2C7BA 1N5KA 4WUVA 2IELA 4Y9DA 3WGVA 4DA9A 4XVCA 3M5DA 3EY4A 5ER9A 3VO2A 4DDTA 4ZJZA 1L5MA 2R8YA 1UBMS 5EZ5A 4I4TB 4Z4HA 5K4HA 1COWA 3EXEA 5THKA 4ACAA 3V8BA 1SBCA 2F3UA 3G1TA 4NKRA 2FJ0A 4Y9TA 3AUAA 4BEBA 3EA4A 2YWEA 3Q85A 4EAAA 5EJ6A 3EVTA 5CM2Z 3Q3GE 3UEOA 3QLTA 4HCJA 2VRNA 4QU9A 4X3OA 2IZ0A 3HCAA 1K75A 3A11A 3CA8A 1ULAA 4C4TA 1SOVA 3KDAA 3U7RA 5CYPA 1CXZA 1GA6A 2HSWA 3AHIA 3VC1A 3VSAA 3ZNOA 3KFVA 1XA3A 5KTPA 2NV6A 1H85A 2QOEA 3DD5A 3BFJA 1E6UA 4X5OA 4OHOA 4HNUA 1U0TA 1U1FA 4TS3A 3IESA 3S5UA 3TINA 3GI1A 2D1TA 3JZDA 2WTBA 5DK6A 4ZANA 2VCHA 1NVMB 2ZRLA 4Q4HB 1T5SA 1MX1A 3PLNA 1E2LA 1BW9B 1KGDA 1VE6A 4M7PA 4MQUA 3HUFA 1V4BA 3LCRA 4WZBE 5F78A 3OICA 4QBTA 1Y1LA 2ZWOA 4EQZA 2O19A 3X1MA 2W9XA 3EA0A 2IW3A 2Q4TA 2E37A 3R3ZA 1N5JA 3HVHA 3OCYA 1D2HA 3KWJA 3I6BA 3NRCA 1DC7A 2I71A 3PEEA 2O8BB 3B53X 2QL5A 3KQOA 3WC4A 4ZQEA 4DA7A 5DN9A 1BSVA 3G7UA 1QRAA 4KIJA 2HM7A 1I4TD 4CCYB 1QO9A 2QD1A 3EZ9A 4CBVA 3X1XA 1E1KA 2P65A 3DOIA 3AUYA 1L1EA 1HFEL 4MW1A 4E13A 3MWLA 5ANRB 4YHHB 2C4WA 3BSWA 2QW1A 4L8FA 4NYMQ 4AUNA 3CVUA 3K0CC 2D0PB 3IX7A 1ZM9A 4RXMA 5AJXA 3RC3A 2NYUA 3QFHA 4L50A 1KERA 4QAJA 4RVFA 1BX3A 1E7MA 2JJ1A 3B89A 4JELA 5DDIP 4IRUB 2IE8A 5H3CA 3P4XA 2AZMA 2JBAA 2RHWA 3R0JA 1ZFNA 1A7AA 1R2QA 2HLNA 3AIMA 3K1JA 3O2JA 4QKQA 3D4OA 4LZAA 1NC1A 3OH8A 1XZEA 4Q21A 4BEWA 1EI9A 2GBGA 4LDQA 3VAAA 1DMSA 5CEFA 2NXEA 4OQFA 1YCGA 1ZNYA 2QUZA 1ZCAA 3O26A 2AQIA 2Q41A 4FP9A 5H7XA 1NW9B 1F8FA 1H8ED 2JGAA 4MEAA 5EJIA 4DV0B 1EQAA 2Y9PB 3FNEA 3GRVA 4X85A 3C3PA 4O3MA 2ZE5A 3IB3A 4QUHA 4F3YA 4P1ZA 1UM8A 4UTZA 2WDPA 3BTUA 1FFCA 4HGOA 1QHIA 1WSDA 2XRYA 1Q6YA 3FVQA 5JSKA 3SJ7A 4Z4IA 2R7AA 3DEKA 3WX0A 3BTSA 1OWLA 3TOCA 2ZCUA 4OMFG 3CUSA 3RS4A 1W44A 1NX6A 2B94A 2V3WA 3W2EA 4EFNA 3R76A 3THXA 3WHPA 1M6VB 1SUEA 1U94A 3N3BC 2Y93A 4PV7A 5DYIA 1U80A 1U8YA 2YFKA 2C0QA 4I0WB 4M49A 3PPXA 2ZAIA 2G07A 1N2IA 2XJ4A 3G8BA 3OIDA 4IS3A 3IEPA 1F4PA 4TKMA 4ZC1A 3QEMA 5FUWA 2A94A 3IKLA 5JNRA 2EKLA 4GBMA 4WOBA 2Q4EA 2QF7A 2RGEA 3JWPA 4BAUA 3FPHA 1I1HA 1NBOA 3LA8A 3TBFA 3TW8B 1RI3A 1C8BA 5JQGA 1ZOSA 4TMTA 3PC8A 4TYQA 1YB5A 5IKMA 3FTPA 2VDRB 3ANLA 4LXIA 1R4AA 2ZI6A 3PVZA 3S4YA 1UXKA 3ZE6A 4DCOA 3MERA 1SELA 1UKEA 4UMFA 3REQA 3FZQA 2Q1WA 1L4BA 5DHAA 4F92B 1J21A 4JHLA 4BC1A 4MW6A 3SX4A 4C06A 3Q3JB 4ZQBA 5HKKA 2ZBUA 3ONEA 3STVA 4R98A 3UFXB 5IHXA 5ICMA 2BEKA 2IIPA 1I6KA 2WQ6A 1WCV1 3OD1A 2GZ3A 3AUTA 5ENZA 2VHVA 1PYDA 2XAUA 3SX0A 1PJBA 4O4JB 3TUIC 3EGVA 3USZA 4AWBA 4MO2A 2PXAA 5J4HA 3MHTA 2VP6A 3INGA 3DVSX 3PU6A 4NU6A 3UV6A 1B1CA 5JI2E 5K6AA 4PCUA 5IZCC 3GUZA 1QFXA 2W6MA 2QNBA 4YRBA 4ON9A 3IOMA 3IKVA 3CVOA 4RENA 1WAMA 2AFHA 1YR1A 1R4NA 3D8UA 3KD3A 4Q02A 5G40A 3ZH2A 3TDMA 2BHTA 3VH1A 5B64A 3N2GA 5BUCA 3ITNA 4PFKA 4V03A 5L53A 5KB3A 4E07A 3DTVA 1GQOA 2ZI9A 1MRNA 2P75A 2A1TS 1DDOA 3AHEA 1WPRA 2CDBA 4E09A 1OX4B 1VMKA 4JLKA 4DLZA 4AW9A 4ZVOA 1V7QA 3WMGA 5ADUS 2VJDA 3CX6A 2OZLA 1XC7A 5G4KB 3A9SA 1VMEA 4QRHA 4YV7A 2O2CA 2F67A 4MYUA 4DLLA 1YFZA 5LDHA 4UHDA 2IKSA 3EPKA 2V0GA 5AW8A 4PINA 4R5MA 3HWX1 4FXPA 1LRKA 3O0DA 1G5HA 3NOQA 4RPCA 1F7VA 1X7WA 2VHYA 5A4KA 3H5VA 1IC6A 3OE5A 1AKYA 1U8UA 4J3NA 5FI3A 4EMBA 2X41A 2QP9X 4FFRA 1V2GA 2QTRA 3LUFA 4B43A 3I34X 3N2EA 4MW0A 1P9WA 3IEIA 1A71A 2GCPA 3ZN2A 3OQNA 4BNTA 1FQKA 1LA2A 1TO6A 4RS4A 3QXCA 4XRGA 4DPKA 2EZUA 1JNXX 3OZSA 1N8SA 5ULLA 3PRHA 2PS3A 3KXLA 3HR4A 1F51E 4OKIA 3RODA 4UUBA 2R1VB 4HFMA 5A03A 4N6NA 1DUVG 1GPBA 1D4AA 1JILA 1TA0A 3GGOA 3IE0A 2O2YA 1XRLA 1IQRA 3K70D 2WSLA 3TLBA 1SBZA 4OGFA 2WUEA 4F9FA 1ZESA 1YAJA 2Z3WA 1JR3E 4ZMBA 1DFGA 3CC8A 2O9JA 1RFLA 1E92A 4MQMA 3MGKA 1QIFA 4KRGA 3NKFA 1XZJA 3L6EA 4Q82A 4BNJA 2HC9A 3O90A 5CA0B 1QQBA 4QXRA 1PG2A 2O3SA 3OWHA 4IAOA 1SB8A 2GRUA 3IODA 4Q3OA 1P1HA 3A2LA 3GGPA 2X9LA 2Y27A 3FUVA 1G3RA 4E2YA 2HJSA 1C0LA 1E3JA 2HNBA 2P2ZA 3KWMA 5DLEA 2WTEA 3ZPXA 5AW7A 3NQ41 5CLGA 4ESVA 1J42A 1E2UA 4RUKA 2F1OA 2B0CA 1IJKA 1KHHA 1PT7A 4RZ2A 3A4TA 4URYR 4Q05A 3QNWA 3UFXA 5FA8A 4XB1A 1T1RA 1BOOA 3B7WA 3KVOA 4HAVA 2IU3A 2PO7A 4H7DA 4L8WB 2RB5A 2WP0A 4QSMA 1T2FA 1Q19A 3ZOZA 4DM4A 4GL2A 5FL7A 2PSJA 4OUDA 4BE7B 3VR6D 3L4BA 1GG8A 4F2DA 5FPKA 1JU3A 2DCUA 1MVOA 1ODFA 1OI7A 3EHDA 3KEMA 3PF9A 2IYNA 3RH0A 4EG0A 2AHRA 1M1XB 4NCIA 4LF4B 4I6EA 5E2BA 3TL3A 4EO4A 2HCRA 4CF5A 3QYAA 2WD9A 4LOIA 1M7HA 3MWJA 1LRJA 4RLQA 4B6JA 3F97A 4DS3A 1HEIA 1LJUA 3SZOA 1ZM7A 1C3VA 2P1DA 2EVWX 3AFIA 3OEHD 1WNTA 1JZSA 5AVTA 1FDSA 4RZ3A 1T4MA 2JFUA 4ZQGA 1GN8A 1R6BX 3A70A 4Q34A 3AVTA 2ZIFA 1A4RA 3LHIA 4RHTA 4F8EA 1QDLB 2YTZA 2F62A 3FBGA 3OOYA 5A05A 1KQNA 3MHPA 3ZCVA 5CBPB 2FZWA 3W8RA 4RLFA 3AC0A 3M3DA 3HH8A 4R54A 4F45A 4JQOA 1EE1A 2H8GA 4JYAB 2ZRFA 4UD6A 2JAHA 3PJDA 3MMNA 3QXXA 3K9CA 2ESRA 1NQOA 1ZD9A 3MMXA 4L3OA 4E5UA 2HRRA 2ATIA 4EYQA 5JPIA 4MRMB 3SYLA 4JLPA 1E6WA 1S8NA 2QT0A 3P9KA 1IRIA 1ZIPA 3GEHA 4JU9A 4LBWA 4N0DA 4DV5B 1Y3CE 3QITA 3DOEA 2JA1A 2REQB 3LY8A 4MDHA 1WUIS 4Y6GB 1SVSA 1N2HA 2R8OA 2R6HA 1TPZA 3AYXB 2XWJI 3G8CA 1UAGA 4MW5A 5JVDB 3PG5A 4J0CA 3BF7A 5I7UA 1TA9A 5AUQA 1ELOA 2OQRA 3AUSA 1GCIA 5FI1B 4X62B 1ZVVA 1E9RA 2EF0A 3HKEB 1O97C 2YRXA 3TOSA 1RYMA 2DHCA 4AJPA 1NMEA 3A4LA 3V4OA 1D03A 1WDMA 3DCJA 3KEFA 3NM4A 4OJKA 4U4AA 2QLJA 4XFKA 1KMQA 1ZGJA 3CRRA 5JLJA 1P33A 4F21A 1Y3AA 4GUAA 1OROA 5DXAA 2OFXA 2P62A 3AERA 4RE5A 4Q66C 2C9BA