4G0NA

Crystal structure of wt h-ras-gppnhp bound to the rbd of raf kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
164
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Effects of the Oncogenic RasQ61L Mutant on Raf-RBD.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords GTPase HRas
total genus 58
structure length 164
sequence length 166
ec nomenclature
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g0nA00
3IQWA 4ZPXA 1N6OA 1OE0A 4GFDA 1W2GA 2IHBA 4HLDA 4LBVA 4NCHA 1Z0FA 4V03A 3TAHA 3PUWA 1UPTA 2BVNA 3DKPA 4R7ZA 3W34A 4C7OA 1Z3IX 4XVUA 3EZ6A 2FEOA 3KKMA 2J1LA 1Q44A 4V0KA 1Q1QA 2CL0X 2IK8A 4DEYA 1J8MF 1GUAA 4RKEA 1NG1A 2AD5A 3GQBA 4TTQA 5LD2B 1NMXA 2GKSA 4H1VA 4KBGA 1GVNB 4Q18A 4QGGA 1EFCA 5BW8A 3TAUA 2RKOA 1KMHA 1ZM2A 2FFQA 2QMOA 5DHAA 4LPSA 1YU9A 4E07A 2C78A 4EAQA 1Z08A 5GJWC 1OXUA 1N6RA 3NHBA 2UKDA 2WICA 3WNBA 2XX3A 1RJ9B 4DSTA 1UBCA 2VL7A 4IXNA 3TNFA 3MFYA 1UKZA 4D2IA 1XZPA 3ZS8A 3QIAA 1ELOA 1YZKA 4NHOA 3IQXA 5J4YA 1VPLA 3ZZUA 5AWFC 2IYVA 2CDNA 2YOHA 3EG5A 2DPXA 2HEIA 1X1RA 1VCOA 2ZI3A 3BH0A 4CRWB 4M8NE 4ZDJA 2O5VA 4EFMA 1BO6A 1Q1ZA 2XJ9A 3CRW1 4MITA 4M9QA 3DM5A 3NH6A 2ZRHA 1NN3A 2H1LA 5FTJA 1NSTA 1ZM9A 2OAP1 1RJ9A 4URYR 4DSOA 4CF7A 4TQ9A 1VG0B 2JIZD 2QE7A 5KDDA 4RD1A 3UATA 3UG7A 1XDBA 4IXMA 1E1QD 2AKYA 3KJEA 3MJHA 2QROA 4URUR 2VRWA 2HCJB 1CJUC 4ZI2A 1TL7C 1UKVY 1SVMA 2LCFA 4QM6A 1ZCBA 2FZLA 3AEZA 3TR5A 1XB2A 4NYIQ 2IWHA 1E9AA 1L4YA 2IS4A 2F3RA 3CX8A 2FE4A 5FUWA 2VEDA 5J4VA 3U3JA 1OIVA 1YR6A 1C9KA 4IRUB 3KQHA 2G3YA 1NRJB 3ADBA 4P0TA 3R8CA 4Q1AA 3H0KA 2BMDA 2ZS8A 2AXPA 2WAXA 4B6FA 2WSSD 1NVUQ 4JLOA 4MKGA 4BPBA 3SI7A 4US1R 3SS8A 1OFIA 2BBWA 2QGZA 1LW7A 3CWZA 4OI2A 5FBLB 3DMNA 3K09C 1VYVA 1SXJD 2WKQA 4UJ5A 1GNPA 1PUIA 2REOA 1M7BA 1FQJA 4F4JA 1P60A 3IHWA 4FMCF 2D4HA 2FGJA 4KFTA 1KO4A 3QEJA 2H57A 1KMQA 2ZVQX 3EWSA 3H84A 1IY0A 3MMPA 1QG2A 1GL9B 3CNOA 4XH9B 3QENA 3J81k 3B1XA 2BV3A 2YNMA 4G5QA 3LV8A 4LWZA 1E1QA 2Q0HA 2W0SA 1XD8A 4IOLA 1ESNA 3GLGE 4Q4JA 3QE0A 5KNDA 1W4AA 1IHUA 4C0BA 5SZJA 1Z6YA 2ZU0C 4NYMQ 1RIFA 5FBWB 2A5FA 3UXMA 4ARZB 2OFOA 1XCPA 3G0HA 3CPEA 3U61B 4UXIA 1N0WA 4IVRA 5FBQB 2IL1A 1VKJA 4WOPA 1V5WA 2PH1A 4L5BA 2AFIE 1Q20A 1AGPA 3SDZA 2N1BA 1DAHA 1NMYA 4B3FX 1Q3HA 2D62A 4HAXA 1TTTA 1W0JD 2ORVA 1EXMA 2IWRA 2ZSFA 4LHXA 2AR7A 1TPZA 1A82A 4J0QA 2VHTA 4KFSA 1KZ7B 4QGFA 3SOPA 5AJZA 4DWJA 1GOTA 1TUIA 2GVZC 2VIIA 4DUGA 3GLGB 3ZVRA 4GT1A 1EFRD 1BH2A 2IXEA 4AKHA 4PQFA 4RD2A 3BWDD 1QHYA 4Q01A 2PX3A 1E0KA 2FF7A 2P2LA 3QG1A 3Q7QA 3FMIA 3K70D 2OBLA 2GXQA 3V4FA 3DZDA 3PIRA 2DYKA 3KQUA 3OIUA 2WJGA 1A7JA 4A92A 4UNRA 3IKJA 1E9BA 3S1AA 1DG3A 1W48A 3RYTC 2F6RA 1GZSA 4GOXA 3AUYA 5GADl 3FKSA 2AL7A 5DN6A 3QKSA 2V4ZA 3ZIAD 1E4YA 2QSZA 2G0TA 2W2TA 2NO9A 2VF8A 1SULA 2ASEA 1ZVQA 2F1JA 3C8UA 1VCMA 3CX6A 4QJ3A 1ZC3A 4US0R 3I8XA 4FMBB 4OJQA 1ZNXA 3AKEA 4MYUA 1EK0A 2YWEA 5LDDC 3IPXA 5D3MA 2XB2A 1FNNA 2CXXA 3QSYA 2W2XA 2WKPA 3NBFA 1JJVA 1S3GA 3DOFA 4RZ3A 5FOTA 1UF9A 1DE0A 2ZJAA 2ODEA 2QY9A 1TEVA 3SHWA 1CRQA 1XMSA 4MRPA 3UWOA 2FOLA 2R44A 3KUDA 1U98A 2ZUCA 1WE2A 1F6BA 4G5RA 1A2BA 3IIKA 2JLYA 1LF0A 1WDTA 2ZE5A 4MA4A 1XBTA 1VYTA 4WAUA 4ZIRA 1XPUA 1VMAA 3C16C 4Q7KA 2WJIA 2D2FA 3OF5A 4M1OA 3SR0A 5J40A 2O8FA 5TB5A 4M22A 3IIJA 1NF3A 5HKKA 3VU9A 1LS1A 1KNQA 3QKRA 1MABB 2YKGA 4A0RA 1ZC4A 2E9SA 1AKEA 3R7WA 3AM1A 4FMCB 1E9DA 3WYGA 5TY0A 4OHXA 1S3SA 3KZ1E 1ZUNB 4YDSA 4UJ3A 3GLIA 2BKEA 1S2MA 5DSZA 2NOAA 1XD2A 3UPUA 3AF4A 3B1VA 1JBKA 3QY0A 2CJWB 4D0GA 1W5SA 1CXZA 1VHLA 4D4JA 5FR2A 4ASUA 1R5BA 3EXAA 3PEWA 1G8YA 2YWGA 2AWOA 2JDID 4M2LA 3ZIAA 2OHFA 4Q03A 1ZJ6A 1MH1A 4NYMR 4GDFA 3MAAC 1G64A 4DLUA 2Z43A 1KY3A 4K81B 4CGZA 3B2EA 3U7HB 5D3QA 2IS1A 1CKEA 1U81A 3PR1A 1N0UA 1KI9A 3PG5A 1XTKA 4I81A 2ZRMA 3TK1A 2IA5A 1P9RA 2HJVA 4XSHA 1U8ZA 1VG1A 2ZPTX 1T3HA 3M1IA 4JBYA 1NKSA 1Q57A 1R6BX 3OHMA 2BBTA 2JGNA 4YDHB 1YRBA 4F38A 5HE9A 1XJQA 4F7WA 5C1BA 1UFQA 1MRNA 5CM8B 2PCLA 2QORA 3CUEF 2OE2A 2GAAA 4FN5A 4OI1A 4TTPA 4BFXA 3C14C 3CONA 1JR3E 2PCJA 2P6NA 3FDIA 3TUIC 3I62A 3PUYA 1SVOA 3CPHA 5KUTA 4OKSA 2ZQ5A 2YC4C 3N2IA 4IKEA 4EKDA 4TYQA 1E9EA 3L2OB 1ZCAA 2Q9CA 3BXZA 3VKGA 4LV8B 1G5PA 2JLSA 3RAPR 4FWTA 4Q48A 1A2KC 2A78A 4PZLA 3WYAA 3EPHA 4KLNA 2V8OA 3REFA 4AURA 3B5JA 1R0XA 4N1AA 4HB0A 4QHSA 1KSFX 2J45A 2QMHA 5L8VA 4OL0A 5FPSA 4A0HA 3MSXA 2O8EB 4XJXA 3UKDA 1X3SA 1KDTA 3I61A 1VTKA 3LVRE 2G83A 2WAYA 3HYRA 1NKTA 3SYKA 3T12A 2WKRA 3A4MA 1OPXA 3B6EA 4MRSA 2VSXA 2ZEJA 2J0UA 5IF9A 3A58B 1S1MA 4OBEA 1G5RA 1KI1A 4BZQA 5JWOA 1C1YA 1DO0A 1JECA 4NCKA 1I4LD 3QEOA 4AKEA 4Q5IA 1D6JA 4HZUB 1DAGA 1KKLA 1S1CA 3IIMA 2GK6A 4PHGA 2GEVA 3U6KA 1W2HA 3HU1A 2H7VA 4IDOA 3ASYA 2IHYA 1TQ4A 5KSZA 2HF9A 2FJUA 3SEAA 4HAVA 2QAGB 2V1XA 1GRQA 2Z83A 3DOEA 4GMXA 5TVKA 1GG2A 1SXJC 1DAMA 3KL4A 4TQUS 3DO6A 2JLXA 3FVQA 2FPKA 2ANCA 2VHJA 4GRAA 1T0JB 3K0EA 1P3JA 1XD2B 1KY2A 3L8ZA 3CR7A 2C9CA 4ZDWA 3TQFA 3C15C 1ZBDA 2ZVPX 3FFAA 3WP0A 1DARA 4ZKDA 1A5TA 5FTKA 4Q4HB 4XVRA 3VQTA 3WMEA 4H9GA 2R6FA 2R6CA 2WBLC 2DBYA 5CYOA 4ABYA 1E2HA 2GJSA 1E6CA 3UMFA 3C5HA 1QF9A 1UKEA 2FPLA 3T1VA 1YZUA 4NDZA 2RGEA 1Z22A 8OHMA 2Z6VA 3U7FB 3TLXA 1Z6XA 1QHGA 5H68A 5L3SB 1CEEA 1NVVR 3LXRA 3T5GA 1P61B 3GEIA 4Q9KA 5AJXA 3IEUA 3QXJA 2QNRA 4JVNA 2ATVA 4XVQA 2AKAB 5AJVB 1GL6A 2ZYWX 4PZZA 4QHYA 4XWKA 4A8JC 5G40A 3T34A 2ZSDA 4OI0A 1BIFA 2CHVA 1HV8A 2RH5A 3LWNA 3Q85A 4A82A 2P0EA 2QL6A 2PLFA 2XEXA 1FQKA 3FYHA 5CK4A 2EFGA 4I99A 5K8TA 1K5DA 1OV4A 2AFHE 1TMKA 2VP0A 1IQPA 2GEUA 3NWJA 3WRYC 2F1IA 3KB1A 4C9BA 1QVRA 3CPJB 3EIEA 2GJAA 4V0NA 1R8QA 5EXXA 3AV0B 3OFNA 3S1AB 4AG5A 2HYIC 2FEMA 2A5DA 1OH5A 4LBWA 1ZD8A 4UXHA 3MJRA 3SU8A 4D26A 5FBRB 1DADA 3M6AA 4OQLA 2QE7D 3TBKA 5KTYA 5EP2A 3N2EA 4EUNA 2QUZA 4ACBA 4L4UA 5GJBA 3I32A 4LBYA 4P32A 4UQOA 2C96A 1F60A 1N25A 3EW9A 3IO5A 2A3RA 3LX8A 5JJKA 1DTSA 5EE9A 4EPTA 2WWXA 2CVFA 2O52A 4MYCA 4DDUA 4C30A 1RRPA 2YHSA 1ZP6A 2NG1A 3EASA 4JZKA 3QUSA 4TT3A 1P73A 1ODFA 4WVFA 4C0HA 4ZCIA 1PZNA 1NN0A 1T4GA 2ZIAA 2JJ1A 4Q7JB 5L3QB 3EWAA 4HB3A 5JEEA 2CK3A 2XNSA 5KSPA 5SZKB 5AUOB 1JR3D 2Q21A 4HAWA 1YHNA 4WZ6A 1ANKA 3H4MA 2OCAA 4BFYA 4V02A 3AVUA 4H1UA 2DY1A 2GETA 1KMHB 3WP1B 1P6XA 4QBFA 5JWHA 3RABA 1P2TA 2FSFA 1P7CA 5EE3A 3TIFA 3AF0A 3ZH9B 1IONA 5KSYA 3K70C 3AVVA 1UBGA 3FMPB 4Q7LA 3W6PA 1UBFA 3TSWA 1WBDA 4EPYA 1KOFA 5E7IA 4TN1A 1CULC 2FDCA 1SVKA 1HY3A 4JVSB 2R6DA 2DFNA 1VYUA 2JJ2D 3TVDA 4CW7A 3U5ZB 1YE8A 1LNZA 1F2UB 2GRJA 1TU3A 1G16A 1NJFA 1YZTA 2WJYA 1CJVC 3B85A 5IDVA 2ZRKA 4FD2A 4NMMA 4LPKA 2NIPA 1M2OB 2QI9C 3OESA 1US8A 1WA5A 3U3OA 1QHNA 1AGRA 4LHZA 1FUUA 4I4LA 4NE2A 2QAGA 2VP6A 4R2IA 4QJ4A 5A5GA 4QHTA 2E87A 3K53A 3O8BA 5JHGB 1Q1EA 5DH9A 4IEEA 5DI9A 4ZCMA 2RGDA 4LHVA 2O8CA 2ANBA 3TR0A 2OV2A 2QT0A 3WHLA 1O87A 3AF1A 1QHIA 2J0SA 4KYIB 2JEOA 4QG7A 1W0KA 5JEDA 2PEYA 1M1YE 3BFXA 3OE7A 2H16A 1JR3A 1QHXA 4LDJA 1E9SA 1RKBA 4DIEA 1M7GA 4Q9IA 5J5CA 4RSGA 3IPYA 4EPWA 1RZ3A 3E1SA 2ZYUX 4JLAA 3NH9A 5CK5A 2P5SA 3AP1A 3T1TA 1GTVA 5JHHB 2RGGA 4O2RA 1QBKC 4BLTA 3AGPA 3K09A 1NLZA 4BRWA 1EFTA 3CM0A 1YZQA 2Z4RA 2V7QD 2BHRA 3BK7A 2BM1A 1KGDA 1PV4A 2XGJA 2JASA 5AUNB 1HH4A 3QF4B 4EPVA 2WOJA 2GZHA 1PLJA 3MGCA 5JRZA 4JT2A 1KJZA 1JXOA 2G88A 3K1JA 3MWLA 4YXWD 1T9HA 1DBSA 4D81A 2GF9A 1VECA 3WMGA 3KKQA 2O0KA 3K70B 2XXAB 1WXQA 1CU1A 1OIWA 3AVOA 4HATA 2FMXA 2AXNA 4B43A 5EE1A 4A15A 4OJKA 5F2EA 4PTLA 1TU4A 2OZEA 4LRWA 3BOSA 5FPYA 4AIIA 4JL5A 1G7SA 1RW4A 2IBMA 2ZI6A 4JYCA 2J87A 4XTCS 5FUVA 5CB8A 1E1RA 2XB4A 3ZGXA 4B32A 3R9WA 5L3QA 3R9IA 1GILA 2VSFA 1HUQA 3VMFA 3ZZTA 1YR9A 1U8YA 1N0VC 3ZVNA 1KSJA 4LY6A 2IUSA 1SKQA 4URWR 2OXCA 4ERNA 4URXR 1XCGB 3QXHA 3DEFA 2WIAA 4TLBA 3LLUA 2J9RA 1T3LA 1G291 4JLBA 5IT5A 3EA0A 3CNLA 5FOWA 5HKKD 3QPWA 4IEIA 5FL3A 1ZU4A 4O25A 2ZYVX 1MO4A 4ACAA 3Q8XB 4N0EA 2VF7A 3X2SA 4AC9A 1K8RA 1JQLB 5B30A 1W36D 5DI3A 1DAFA 1P4SA 3MWKA 4U02A 1W4RA 1OLOA 3PCRB 2XTMA 2IYLD 1Z07A 3RWMB 4WZBE 4QBIA 1ONBA 2ZRNA 2QN6A 4XOIA 5JZVA 4JVLA 1KI6B 4NH0A 5CYPA 4B33A 3B13B 4MRVA 1F48A 4YXWA 5B58C 2NO7A 3W8RA 4OYHA 4Y0AA 2RGNC 2IYRA 1E2QA 3KTAA 4JIMA 3T61A 1SXJE 4B48A 4QJ5A 5E95A 1Z29A 2VA8A 1KZGB 1F3OA 2GCOB 1GAJA 3ZLJA 2J5XA 4N0DA 4NU0A 2IEZA 3RRMA 3VHXA 1ZRHA 2D2EA 3BERA 2FA9A 2H8KA 2IEYA 3FMOB 2QT1A 4B47A 1E1RD 4DBLC 4KLZA 2CLCX 2X77A 1ZM7A 3A4LA 2Q9AA 2WWFA 4CEJB 2BWJA 4Z1MA 4M53A 2WOOA 4X8LA 2HLDD 1KK0A 1EFUA 1G3QA 1KYIA 3ZVLA 1JEDA 2DWQA 2X8AA 3TUZC 3W9YA 4M1YA 4LJ5A 2W6JD 1SVWA 4G3XA 2A2ZA 4QGAA 1W44A 3LLMA 4UNQA 3SJZA 5AUPB 1FW6A 3I72A 1YR7A 5JECA 4BFTA 1UADA 3PJRA 5FR1A 1IBRA 3EAQA 1H8ED 1IY2A 1AS2A 3K9HA 4TZ0A 1OKKD 3RLFA 4I1OA 1RRCA 1DPFA 4F92B 2FPMA 2IF0A 5FI1B 4KODA 4AD8A 4JJKA 5GJCA 2W83A 2ZM5A 4M9SA 1XFAA 2CHQA 2MMGA 4KFRA 4NONA 2QAGC 4KU4A 1HURA 3EZ9A 2GTPA 4Q1EA 5CIWA 1OB5A 5JFGA 4ITRC 4M0LA 1JQJC 2PZEA 4HZUA 4LJYA 3QQ5A 2J59A 2ODNA 1S8FA 2G1KA 3HDTA 4HUQA 5K8IA 2YV5A 4DHEA 5FPKA 3H86A 1I2MA 2C9OA 1XEWY 5CITA 1B23P 4WW0A 5ANRB 4EQ6A 4RKFA 4CT5A 1YZLA 2OSBA 2NPIA 1R4AA 1Z47A 4U7DA 4Q1CA 4TYPA 4A1FA 4GP6A 1G18A 4HB4A 2ZXUA 4ZDKA 1CLUA 3QKTA 1E0SA 4Q9LA 4TL7A 4DCVA 4BE7B 2XITA 3K0AB 4AY2A 1E2GA 1IM2A 1IAQA 2DFKB 4II7A 1CJKC 1KAGA 2WJJA 1G8PA 2ZS9A 4POAA 1U90A 3KX2A 4B44A 4M4SA 2WM9B 3SQWA 1OH7A 1W4BA 3VR1A 5GVSA 2REXB 4LJ7A 2JIZA 1VDZA 4JLPA 1NN1A 4PHHA 721PA 3AGQA 3NXSA 1XXHB 3FPAA 1OW3B 1XPRA 1GRRA 4A2QA 3W5JA 5IHPA 3A1TA 4FCWA 5FUXA 4DC9A 1JI0A 4FMDF 2CE2X 2DWOA 3IBYA 1XPOA 3JZMA 4ZV4A 1D8TA 4IVPA 1R0WA 4KSCA 2QENA 1FTNA 4QGHA 3GJ7A 1OXSC 3A1WA 1DAKA 5JBQA 2FNAA 3GJ3A 2YC2C 2ZE8A 1KI2A 1OHHD 1Z2CA 2AN9A 2XNDA 1HT1E 3MUFA 4Q4LA 2IYZA 4JLMA 3NKVA 2ODWA 4DLVA 4BFWA 1NMZA 5KHOC 3AKDA 2KJQA 3THYB 4LJAA 1XJCA 2HV8A 1HTWA 4I1UA 4PSVA 1Z0AA 3FE2A 4ZDIA 2WMNB 3UMSA 2ZU6A 1ZAKA 4PQRA 4TL9A 2BMJA 2IYQA 3KJIA 3GEEA 4UNSA 3ZQ6A 3QVUA 3BIFA 1E2JA 1U0LA 2QM8A 1IXZA 2QM7A 3VNUA 3K0CC 4ZIRB 3TGPA 3A1SA 4BEBA 3REGA 2J7KA 3GJ6A 5DHFA 1XXHE 2H17A 3OEHA 4BWYA 4UNPA 4CEJA 4A0FA 4OHZA 1WB9A 1VHTA 1HA3A 1KI6A 1XF9A 3PUXA 1XD9A 3U44A 2JA1A 2WZQA 4FCTA 2QPTA 4W5HA 2PEZA 1X8LA 2J7PD 5BN3A 3P32A 2DR3A 4E03A 5HZKA 3KKOA 1N5JA 3GD7A 5HZHA 1MABA 1WQ1R 4DLSA 3LH5A 4CT4B 5BYJA 2GZAA 2YWHA 2QTFA 4JJZA 1W49A 4XWOA 3AVWA 3CF2A 3O8RA 1P9NA 4EDHA 4O0MA 3N5CA 4BEJA 4PPGA 3I73A 3C7KA 3L8YA 4D0NA 4IDNA 4QNMA 2ZJYA 5B57C 1PLLA 4C2UA 2IS2A 2CNWA 2HT1A 1JPJA 1OFUX 4I1SA 3GFPA 2R8RA 2F1HA 1XTJA 5CJ2A 3L43A 2EU8A 2HYDA 4W5WA 1UM8A 1WMSA 3A1VA 2J3EA 3HP1A 4NCIA 1GIAA 4UXJA 2ZRIA 4KV9A 3AVTA 4TSFD 3SJBA 1CP2A 1OH8A 1K5GA 5DGXA 1J90A 3AF2A 3DL0A 3KFVA 3U4QB 4AYXA 5J4KA 1U99A 3DDCA 2RHDA 4DIDA 2WHXA 5KO2A 1ZYUA 1U9IA 3RHFA 4EQ6B 4R9UC 1OSNA 4KVGA 3R7WB 3VAAA 2JJ2A 4LC1A 1QHSA 5DISB 5B64A 1SGWA 1WF3A 2F9MA 4HZIA 4URVR 1QZXA 3U2QA 1M74A 2NO1A 3NVAA 3T1QA 4TQAA 3W90A 2O8FB 3EZFA 2NPFA 4QFMA 2GF0A 2Z5FA 4Q1FA 4C7OB 2JJ8A 2PX0A 6Q21A 4DCSA 5CLQA 4ARZA 4LYHA 2EYUA 4LHWA 3SN6A 2ERXA 2OM2A 2RAPA 1YJ5A 4PHFA 2V55B 3ZQJA 1ZU5A 4LGMA 3A4NA 4JLKA 3WMFA 3SE0A 4D4KA 2RGXA 3ICQB 1HQCA 1B0UA 4QNRA 3WXMA 1E2MA 5H1YA 2G9NA 1LVGA 2TMKA 3D7MA 4U5XA 4OI4A 5CB6A 3THXB 2Q6TA 2FU5C 5F9HA 3BH7A 3E70C 3OE7D 2CNWD 4XWAA 4XSGA 2I4IA 3QI2A 4PO9A 4YMUA 4HUTA 2B7CA 3DPUA 3UIEA 4B3GA 1E94E 4F4IA 3QXCA 4K46A 4AKGA 4Z54A 3FTQA 1N6KA 1XRJA 2ZETA 3M0EA 1AKYA 2P5TB 4RD0A 2WV9A 1AS3A 421PA 2IF2A 3OEED 5EUQB 2OLKA 2QP3A 3FMFA 3PV0A 2OAQ1 4L16A 4LJ9A 3GMTA 2A5YB 4XIGS 4LJ6A 1XP8A 1RYFA 4CVNA 3DVLA 4L9WA 4B3BA 1KIMA 1VCNA 4JMPA 4ZCLA 3VR2A 2FWRA 3FHCB 1DO2A 5KNCA 2D74A 1KJWA 2HDNB 1NI3A 2XSZD 4Q47A 1FMJA 1G6OA 1R5NA 1RVDA 2OUKA 1RYHA 1T8TA 2UVQA 3EC1A 4LK2A 3U7GA 1XMIA 1QDEA 4F93B 1U94A 1SVIA 1F2TA 3DM9B 4R71A 1EG7A 1JPNA 3THWB 1E79A 2QQEA 1MV5A 2ZAMA 3NC0C 5JMTA 2AHOA 4TYYA 4NPHA 3QBTA 3QG5A 1R2QA 2JCSA 3K8YA 1IJEA 5JLJA 2PT5A 5HCNA 2FSHA 4IOJA 4TYWA 3LNCA 5G3ZA 3AB3A 2BMEA 5ELXA 1GKIA 2BCGY 1DAEA 3QPUA 2XTNA 3LDAA 1XEXA 2BC9A 4L9SA 2J46A 2W2VA 2EFEB 4LHYA 1HQYE 3CLVA 1CIPA 4WXRA 1FOEB 3D6TB 3VKHA 2JATA 5TDHA 2YOFA 3EPLA 2N46A 2VSOA 4JYBA 1Y3AA 3ND8A 3P4YA 4C2TA 1COWD 1EWQA 2GCOA 3RRNA 2ZSBA 4YLGA 5JRJA 2O8CB 1G8GA 3GFTA 1KO7A 4MUAA 1QVAA 2I1VB 1U0HC 2PMDA 4NYJR 4X8OA 3ZVMA 3RS2A 3QPVA 1GDDA 4BUJA 1KHTA 3ADDA 1FX0B 2Z4SA 3C5CA 3L0OA 4W5JA 2RB4A 1ZNWA 3VFDA 4DLWA 1BYUA 4QBGB 2WPDD 3RC3A 2L0XA 1RE0A 3BB3A 4A2WA 4Q4AB 1FPMA 1JNYA 1FTSA 4KHZA 4K8OA 5DN6D 1OJLA 3VX3A 3RRYA 2VQSA 4TL8A 3NEJA 4HDCA 3SC3A 4MYHA 4C0KA 1XTRA 1E79D 1LTQA 4JL8A 3FB4A 1XMVA 1Y63A 2PL3A 1JR6A 3SYNA 4BZPA 3V4RA 1U2RA 2OXRA 5EZ5A 2IYXA 1CR0A 3RC8A 3BD9A 3LQQA 4UNNA 3QF4A 1P2UA 4OHVA 1KK3A 2ZJZA 1KI3A 4RFSA 4LV6A 2J41A 1IXSB 4GOKA 2C5LA 1IN4A 1U8AA 1T3SA 1Z0KA 5F98A 1OYYA 3B9QA 1M8PA 4AYTA 1FNMA 1W5TA 3IO3A 1UJ2A 4LJ4A 3W3AA 4MKFA 3RS0A 5SZIA 4V0MA 3DKVA 2WWWA 4HLUA 4PX9A 3OZXA 3GJ8A 3ZD7A 2XZPA 1L4UA 4B75A 1R8SA 2OO7A 521PA 2A5JA 5JSZA 3P20A 5J47A 2WMOB 3W8NA 5JJLA 4PAQA 1DG1G 5FOXA 1RRFA 1MO3A 4PR0A 4GPTA 4HDOB 3QBVA 1E96A 1S96A 1GRNA 1LB1B 2H18A 2QAJA 1N6PA 1XWIA 3Q5DA 3W3ZB 3BFVA 3OAAD 4DDTA 5HE8A 4IOKA 1FP6A 3THOA 4MRRA 1G7CA 4DCUA 2DWPA 1RC8A 3RS4A 1NVWQ 4GZLA 2C03A 4ESVA 2F43B 2BEJA 3B1ZA 4IVQA 1HT2E 2NO0A 4P4SA 4TMVA 3EIHA 3HYTA 2GBLA 1R5OA 3TSOA 4YMWA 1RRGA 2QA5A 2D7CA 1US8B 4M1SA 1E4VA 3THWA 3A6PC 4A8JB 2OEPA 1CR4A 1OFHA 2IYUA 4PO8A 1TAGA 4DRZA 4EPRA 1T8UA 3SBDA 3TW4A 2BJVA 2CMKA 4DJTA 2CHGA 4Q9JA 1UBEA 4F4CA 4CEHB 2KB0A 5L3SA 4DT1B 1EGAA 2KE5A 2WSMA 3K9GA 4B3CA 2EFCB 5FOSA 3AVQA 4UKDA 1G21E 2CBZA 4BLPA 3NG1A 1IN6A 3H1TA 4NL4H 5C2JB 5HR5A 4GNKA 3E2IA 4OK5A 4Q4HA 1QG4A 2GDJA 5C4MA 3FOZA 1II8A 1TNDA 2MSEB 3TRFA 5TXGA 4MQBA 4B71A 5JJIA 2CL6X 5H70A 1G1MA 3OFND 2ZJ2A 2EWWA 2C99A 2QGNA 5P21A 1H8HA 1TQ2A 5KDOA 2NTYC 3SZRA 1AN0A 2LWIA 2K5UA 2GESA 3FKQA 1KK2A 2CLSA 1TX4B 2EFHB 4JLVA 2Q3FA 1PVOA 2KI5A 4L8GA 5K8LA 1D2MA 5B2ZA 4Q1DA 1W36B 1XTIA 4AG6A 4PSKA 3FHOA 1TUEA 4WA7A 1IN7A 1R10A 2O0HA 4LOAA 5IK2A 1ZM4A 3RDPA 4KFUA 3JVVA 1KO8A 1N2CE 4PC1A 4DCTA 1OH6A 2QTHA 2ZRGA 1X8KA 3P27A 4OK3A 4WBSA 2WTUA 4W7SA 2FZ4A 3AP2A 3CB4A 1AS0A 3EC2A 4MKHA 4P3YA 1DVRA 1I2DA 1FMLA 1Z0JA 4RCYA 5G41A 3WNDA 3SNHA 1E99A 1NJGA 4DXAA 2C77A 3GLHA 1N3BA 3VHLB 5EQTA 4LSGA 2XNDD 3OIYA 3GLFE 2EVWX 1CTQA 2AK2A 3DHWC 1EFHA 1MOZA 3GJ4A 1ZD9A 1XMJA 4QL3A 2DB3A 3I92A 4DSNA 2FSGA 3ZYCA 3HU2A 2ZI4A 5EP1A 3MCAA 3X1XA 3AQ4A 4E09A 2GAOA 2QG6A 5EP3A 3PENA 3CZQA 3QVVA 2GA8A 4YMSA 1UKYA 3PXGA 1Z6AA 5E3HA 2C04A 2P6RA 2XOKA 2G0NA 1GWNA 2OLJA 4U00A 1TF7A 5FL7D 1DOAA 4IOMA 3SFZA 4YMTA 4BLOA 2VYFA 2ZSEA 3X1DA 2GVDC 3OEHD 1H8HD 4QXAA 2QBYB 4MDEA 4TLAA 1T5LA 1G8FA 1XNJA 4EJSA 1F5NA 3TKLA 2GNOA 3GCGA 5G3YA 2ZR0A 4DLZA 2FFAA 1KTVA 1M34E 5K8UA 2J7PA 2ZUBA 3HPQA 3LXXA 1Z0DA 5IK2D 2IYWA 4M1TA 4HYYA 1N6LA 3HJNA 1FFHA 2NZ8A 1E2FA 1K6MA 2HXYA 4CEIA 4A2PA 1G41A 4GBMA 3U60B 2QSYA 2YZ2A 2R6GA 1NSFA 3I5YA 2CE7A 2EQBA 2JLQA 4RD4A 5TV2A 1WBBA 1BYIA 2ZR7A 1ZD1A 2XJ4A 1SKYE 2BKUA 4P4UA 2W0MA 2KWIA 1EWRA 1HE1C 1GFIA 3O8DA 4GZMA 4MGIR 4FXPA 4P4SB 3AVXA 1J7KA 3AVYA 3IEVA 2F43A 1KSGA 1NN5A 2OT3B 1LF5A 1VCIA 4OQFA 4PPFA 4RZ2A 4JKIA 3U3MA 1G3MA 4A36A 4M1MA 1KK1A 2E1RA 4Q66C 2B8WA 2WSSA 4AI6A 2V6IA 5KNBA 4TL6A 4TSFA 4BQSA 4D80A 5D3MB 2FV8A 5EXPA 4KAXA 1G5TA 2ZJ8A 2R6AA 3CRQA 1V43A 3KKNA 2ZRPA 2ZRBA 4Q9HA 1XZQA 3O47A 5BQ5A 3W6NA 4PANA 3MLEA 3GJXC 5HPYB 5EJEA 3HPRA 3GLIB 2GXSA 1ZM3A 1E69A 3AH8A 4HLQB 3B9PA 3RSOA 3EPJA 3P4XA 3Q5EA 1E2KA 1P9WA 3KB2A 2A30A 2B21A 3IUYA 3THYA 2X2EA 1FZQA 3R8FA 4IFBA 4DKXA 1AIPA 1W47A 4RY2A 4BZXA 2G6BA 1Z63A 3ICEA 1CF4A 3VR5A 3TSZA 3W6OA 1KI7A 3KQNA 2BBSA 1P72A 3X1ZA 4DEXA 3BE4A 2WWYA 3L0IB 4TT3D 1KI8A 4HLCA 1UAAA 4B2PA 3PEYA 1Z5ZA 3B7GA 1SZPA 3B8HA 3OIVA 4LYFA 5CM9C 1IXRC 2VBCA 4LBZA 2ZAOA 2ZE6A 4AYWA 1CJTC 2CK3D 1HYQA 2GCNA 3BFKA 3LBIA 1E2LA 1IN8A 3PUZA 3SBEA 3OIWA 4RJLA 4HUQB 4HB2A 1FP7A 3QJYA 1VG9B 3CR8A 4KJZA 1GKUB 1KSHA 4JBWA 4PHTA 5J4LA 2AWNA 2IT1A 3AF3A 2ZRDA 1AZSC 5TMPA 4QM7A 4EFNA 2HT6A 3OEEA 4CDGA 2OCBA 3D31A 1VIYA 3PVSA 2XAUA 5DYGA 3BJIC 4Z51A 2ZREA 2IXFA 2ERYA 3NDBB 2YWFA 1J70A 4KO8A 2R62A 4TTRA 1OXXK 3W5IA 3EZ2A 2XZLA 5A0FA 3K0FA 1X1SA 4C4PA 3FKSD 4C0QC 3AKYA 1E9CA 3GJ0A 2A5GA 4OQMA 1G3RA 5EXSA 4NKRA 2ZJBA 3Q7PA 4FIDA 2PJZA 3D8BA 3QOFA 4US2R 3DMDA 3KJGA 3PITA 3O8CA 1W7AA 2GJ8A 4PFSA 1NP6A 1Z6GA 3DZ8A 2ORWA 3BS4A 2GBLC 1TF5A 1SVSA 3LO5A 5FOUA 1Z2AA 4YQFA 3RS7A 3QXSA 2HUPA 3T15A 2O8BA 4NZYA 2J0VA 2HCBA 3EX7C 1L7VC 3LX5A 2PLRA 1NG9A 4M1KA 4I1VA 3V9PA 3GLGA 4BASA 2QEQA 4B76A 1YVDA 1W0KD 1AJEA 3CBQA 3QF7A 5CDFE 4LI0A 4NYJQ 3EZ7A 4KYUA 4Q4JB 1FUKA 2PBRA 5AJWA 3CW2A 4DLRA 3ASZA 1KO5A 4CEIB 4DCNA 2WWGA 4FWIB 2EWVA 3GEHA 3KXKA 1G8HA 4E22A 1LFDB 1YZNA 4OHWA 1G6HA 5AJYA 4JKYA 3CRRA 2GWHA 2Q9BA 1JAHA 4G5OA 3ADCA 3PEVA 3NDPA 3FWYA 5LB2A 1E2EA 4GP7A 4EJSC 1SXJA 2QMUA 5AUQA 2RMKA 3U3RA 1CR2A 1J8YF 5FI0B 4MH0R 4TLDA 1T0HB 2V1UA 2OFWA 2OILA 4NCJA 3KJHA 4FW9A 1E0AA 1XJ0A 2CVHA 2IYYA 2UZIR 3LY5A 4OQXA 3WNCA 2JDIA 2ONKA 2FSIA 1E2PA 1J2JA 2N42A 4YMVA 3T35A 4G5SA 1MKYA 1N5LA 4KXFB 3NBYC 2I3BA 1II9A 3KTAB 4R98A 3HR8A 5HCIA 1TQ6A 1ZNYA 2HF8A 1AK2A 3CX7A 1YR8A 1NL3A 3GLHE 4PZYA 4B6EA 2B8TA 4DT1A 2NMVA 4C0SA 1E3MA 3GLFA 1O3YA 3VNVA 5DYIA 4MGYR 1MRSA 2GK7A 3ZS9A 4BFZA 2ZITA 2IX3A 3VU9B 3CWQA 1G7RA 1C4OA 1NBME 3CH5A 3EARA 1G7TA 3AVPA 5FOVA 4ZI3A 4G5GA 3RS5A 3VTKA 5JS8A 1AA9A 1WCV1 1XEFA 5FPHA 2ZR9A 3EA5A 1WRBA 1N6HA 5JI2E 3ADKA 2CJWA 5CLLA 2W6IA 4DUGD 3LQRA 1JXMA 3UK6A 5FTLA 5KSOA 2FGKA 1U9IC 1PLKA 1E9FA 3CRVA 1E0JA 1QHHB 3BRWD 1S9DA 2VLIA 3NIBA 4BECA 5C46F 4KI0A 4D4MA 1KNXA 2RGCA 3CF6R 3MD0A 1JAIA 5E4FA 2VHCA 3I4LA 3AP3A 3TJZA 4QC2A 4YONB 2J0QA 1Z6TA 1G4UR 1SVLA 5C4GB 2WVJA 4Q21A 4RZXA 3Q9LA 1PJRA 3GP8A 2ZJ5A 2CL7X 3F0TA 3V00A 3GLIE 1Z28A 1P62B 1XU4A 1W1WA 2JAQA 2F7SA 2ZRCA 1R0YA 1PUJA 2QRNA 4RFSB 2ZROA 3RS3A 1CS4C 4Q1BA 3ECCA 4MYTA 1FX0A 1DAIA 1KO1A 1D2NA 3K0AA 5DIFA 3IGFA 3NHAA 4D82A 1L2TA 4PC7A 2FG5A 2Q3HA 2RGAA 2C98A 1M7HA 2ZI9A 5LD2C 1P5ZB 2V3CC 2IW3A 2YOGA 2ZE7A 3CZPA 1KJYA 4Z1MD 5F3WB 1W46A 4IDHA 2IUUA 3WRXC 4JS0A 3B60A 821PA 2VHQA 3BORA 1NY5A 3LRPA 1II0A 1SXJB 4IW3B 3KKPA 4Q4AA 4NP6A 4HLUC 1MO6A 2W6ID 1SKYB 2C8VA 1BS1A 3TQCA 1R0ZA 1KI4A 1X8JA 1F2TB 1S0UA 1S4QA 3L0PA 2JLRA 2KSQA 2OCPA 1GSIA 2R9VA 1IOZA 4LYAA 4DB4A 1E2DA 5FTMA 3RWOA 1AZTA 3VR3A 3WBJA 5KU1A 2GZDA 4RD3A 2OBMA 1NNEA 1X86B 3AKCA 4RD6A 1CBUA 3KXIA 2RGBA 1OF1A 4RFVA 2WWIA 4OQNA 4ASUD 2H92A 2NQ2C 2PMKA 2I1QA 3LFUA 4QOSA 1LV7A 3BH6A 1ESMA 1G9XA 4MGKR 4QBHA 1TF2A 3MWJA 4BLQA 4P4TA 2ATXA 2DFTA 3IILA 4NCNA 4CEHA 3UMRA 1MO5A 1OFTA 2C9YA 4BLRA 1CJMA 5AR1A 2RHMA 2ZRAA 3A36A 4A8JA 4DLXA 2F1RA 4TMXA 1G17A 4FMDB 4S2EA 4G1UC 3TE6A 2DCUA 3C41J 4DZZA 1N6NA 4ON9A 2GXUA 3TH5A 2OESA 4B74A 4PAOA 1XXHA 2LKDA 2FX3A 4IDPA 4MKIA 4DDWA 4Y0VA 3GFOA 2B7BA 4R2HA 1BKDR 3U3KA 4W9MC 2IYSA 4KVAA 4QRHA 3QKUA 3SQXA 4O3MA 2WWHA 2ZRLA 1A4RA 4PSAA 4PAMA 3UANA 1G19A 3C4JA 3EPKA 3K9NA 2PT7A 4JLDA 2IS6A 1NLYA 3EIQA 5L3RA 2F3TA 4AKIA 4HAUA 3CIOA 1T6NA 1OXVA 1E32A 1NIPA 3F3YA 2MMCA 4FINA 1UDXA 5DLQC 1UDWA 1LS6A 2ZTSA 3GLFB 4D4LA 5BWMA 1TEXA 1N5KA 4BGDA 4D25A 5C18A 4PO1A 1ZNZA 2QQ0A 3ZJYA 2XTZA 3NEYA 3U6BA 3SYLA 4CIDA 1D9ZA 2W58A 4PC3A 3K0FB 3N70A 2O8DA 4P31A 2GJ9A 4HEJA 2JLZA 1QHHA 2UZ3A 5G53C 5EZ6B 2O8DB 2QP4A 3ZZ0A 2MSDB 4C3ZA 2GJKA 1IN5A 2D3WA 2NO6A 2Y8EA 3QNUA 3BBPA 4B35A 2JJ1D 5CDFA 3CKLA 2BCJQ 2QU8A 1OHHA 1NIJA 3WY9A 4MDFA 2ZS7A 1Q21A 3HU3A 3NBXX 5J4HA 2ZRFA 1Z0IA 4LYJA 3A1UA 2FH5B 1Z83A 4E5UA 1JEEA 1I4TD 2GILA 1T91A 3F8TA 4DVGA 1GKYA 1OB2A 2V6JA 2P65A 3CF0A 4CYMA 5JS7A 4ESHA 3CNNA 2FFBA 3T1OA 5FPTA 4A6XA 4Q7MB 1LY1A 1KDOA 3JVUA 3LD9A 2HXSA 3ETLA 1U0JA 2CCGA 1JALA 2PJRA 2IUTA 3K0CA 2C95A 4TZ6A 1OIXA 1NVVQ 2XSZA 1E2IA 1XX6A 3PEUA 4HAYA 2QZ4A 5TARA 1VIAA 1TADA 1HEIA 1XTQA 2KBEA 5GVRA 2OFXA 4EJSB 4IDQA 3BGWA 1E9RA 3R20A 1DEKA 1T5IA 3I8SA 3JZAA 4TMKA 4A0GA 4TYNA 1G4AE 3SJCA 1IY1A 3LA6A 4IJMA 4NTZA 2GEDA 4WXPA 2EW1A 1D5CA 1YZGA 1YQTA 5KYKA 1VG8A 2CCJA 2VP9A 621PA 3MG9A 5F9FA 1NBMA 2BIFA 2X1VA 5DO9A 2ZANA 5EXTA 4JLNA 2ZUDA 2BBOA 4DDVA 2A9KA 1EESA 3FHTA 3WYFA 4Z8YA 3D3QA 3VX4A 4BFSA 3IBGA 3E5HA 3KQLA 2OBNA 3CO5A 4M9XA 2JLUA 4LJ8A 1GM5A 2EFDB 3BB4A 5GJVC 2ZYTX 5JCPA 5EUMA 3IDQA 1GNQA 4TLEA 2BDTA 4BFUA 1BOFA 3KUCA 3CH4B 4V0OA 5JWRA 4RCZA 2YYZA 5DI3B 5AK0A 4X8HA 1KDRA 5DNYB 1ZIOA 1ZINA 2ORIA 2XZOA 2C2HA 2V7QA 3G82C 2GHIA 4DLYA 3H2YA 1MT0A 4DSUA 1A1VA 2X2FA 4JVMA 4HDQB 2AK3A 2QTVB 3L0SA 1GP2A 3HR7A 2VP5A 1E2NA 1P2SA 3BB1A 5LBIA 4Q19A 4KITB 2X19A 1XTSA 2G1JA 3FFBA 3SFVA 2W00A 3I1FA 2ZI5A 2QMEA 4PPNA 1KDPA 3A37A 4JLJA 5LB4A 2O8EA 1R7RA 2QP9X 3LW7A 1N6IA 3PQCA 5KDLA 4DB2A 1N5IA 4JT4A 4TMWA 4QKQA 2KBFA 4FI3C 3LBHA 1NY6A 4PXAA 3KQKA 2VTKA 1DELA 4ZKEA 1BMFD 3UWKA 3CRMA 2ONJA 1NBMD 4RZUA 2F55A 4B3DA 2ODBA 2O0JA 4XTRA 2GCPA 3B1WA 1TQDA 1W0JA 4GSYA 2WIBA 1NLFA 5SZHB 1CRPA 5EE0A 1IJFA 1EFRA 2IC5A 1P2VA 4URZR 3BC1A 3M4YA 1G20E 3G5UA 5KOYA 3VR6A 4B34A 4KCGA 3MWYW 2D7DA 2GXAA 3SHFA 2EYQA 3GLHB 1D9XA 3TUJC 2BMFA 1OXTA 4B73A 1ZUHA 3RVBA 2QRZA 3Q3JB 4FCVA 5BYKA 3L82B 2WJHA 1WP9A 3FGNA 1ZMXA 3RRZA 5IRCD 2V54A 1W4CA 2YJTD 2Q3MA 4Q02A 4RVCA 2QPOA 2RGNA 2VO1A 2ZRJA 3TW8B 2ZSAA 4LX0A 4PQYA 5FFMA 4B2IA 1SQ5A 5EE5B 2B92A 3I3SR 4GI7A 4PC2A 2HJGA 4V0ME 3AUXA 2CEAA 3U4QA 5CJPA 2DFLA 3TVTA 4BLSA 3K0SA 4AK9A 3GJ5A 5CIQA 2JLWA 2H5EA 1X6VA 1BMFA 4YC7A 2VHUA 3U7EB 3P26A 5FTNA 3X1YA 5JI3E 1Q12A 1SHZA 5A4JA 2HLDA 4Z8XA 2VH5R 4LV5B 1AQYA 1F2UA 4GOJA 2NZJA 5UKDA 1ETUA 4TMTA 4XD7D 1ZIPA 3LVQE 3RSLA 1Z06A 2W6JA 5BN5A 5FBVB 1RFLA 4F91B 1FL9A 3UG6A 3A8TA 1L8QA 3ND9A 1YRAA 1COWA 4IFEA 5JSZB 2BJWA 4KBFA 2BOVA 4X8MA 2V9PA 1JB1A 3RNLA 2ZJOA 4M21A 4BFVA 1Q1BA 4C0LA 1H8EA 4P33A 1OKKA 2P6UA 4JBXA 3KDSE 5FH9A 2WPDA 2P67A 1UEJA 3GPLA 2FN4A 1OT3A 1I4DD 5HTKA 5FUYA 4A6PA 3U44B 5KPDA 4TMZA 5DE3A 5E7MA 1AM4D 1D2EA 4HSEA 1RPZA 1E98A 4D0LB 2CCKA 2VP4A 4AWXA 2R2AA 4OK6A 4JL6A 3NTUA 2QBYA 4HI0E 3RANA 1Q22A 3I5XA 4TLCA 5M04A 4TWZA 3ZDQA 4V0LA 1EX7A 4C0JA 3LBNA 5BXQC 121PA 1AQUA 1CR1A 1GNRA 3MRSA 3QKRB 4S35A 4IHQA 4A9AA 4WZAE 3LAWA 2BEKA 3Q72A 4N3NA 4DLTA 1UEIA 5BN4A 4OHYA 3F5FA 4B3XA 4JSYA 3PUVA 2AX4A 3QKSB 4MUBA 3WHKA 2JLVA 2J0UB 2Z0MA 2IYTA 3X1WA 1JJ7A 4LC0A 1OYWA 4XD7A 1XCMA 2VPPA 1G3IA 3KFXA 2XOKD 4O2LA 1ZUIA 3IHLA 4D6PA 2PZGA 2OCYC 5FL7A 2XXAA 4NYIR 3VR4A 1G3UA 1Z8FA 1SHKA 2DHRA 5L3VA 2BM0A 4G0NA 2CLDX 3PFIA 1W36C 2P3SA 4Q00A 3NBZC 1EX6A 2FFHA 2YVUA 1KAOA 2F9LA 2RCNA 3OAAA 1P75A 4EFLA 3ZD6A 3VKWA 1GITA 1XEXB 3B78A 5EP4A 3P1JA 3KXLA 4PC6A 4ILEA 3SJAA 1H65A 4M1WA 221PA 4MRNA 1II8B 2NGRA 4LZZA 2D06A 4GMDA 1ZW6A 1NVXQ 2YINC 4KSBA 2LKCA 2R65A 3NC1C 4MGZR 4G01B 2A7QA 3WBKA 4PPQA 2QPAA 4C0AC 2SHKA 2B6HA 1GL7A 3T5DA 3LW8A 3ONWA 2ZI7A 4L15A 2VP2A 4LUCA 4GL2A 4M9ZA 2OG2A 4EPXA 1S9HA 3K9LA 4JSTA 4BRUA 3R9XA 4EIWA 1Q3TA 4HAZA 1YKSA 3QXXA 2PZFA 5LPNA 4A4DA 3THXA 4NBSA 1XEWX 2WJVA 5JCZA 5KPJA 3BAFA 4B2LA 1MR3F 2AD1A 5E7JA 2O8BB 2MSCB 1KKMA 2REBA 4ZO4A 1J99A 4LCBA 3B82A 2IXGA 3TMKA 1M6NA 1DS6A 3B1YA 3HWSA 4WIAA 2G77B 3T06B 1Q0UA 5H8WA 4CZ2A 1QRAA 2ECKA 1HE8B
chains in the Genus database with same CATH superfamily
1PR3A 5DNVA 3G6KA 4J0FA 3OEWA 1P5JA 1W0CA 3NTLA 1C2TA 1N6OA 4QARA 5EIBD 2VZLA 5G0VA 1U31A 1U3GA 3TLAA 1W2GA 3KYBA 5HF5A 3RSHA 2QVYX 4Y7DA 1U11A 2FHPA 3ENWA 1UPTA 3W34A 2WM2A 3BXGA 4L5JA 3DBHA 4BTLA 2HMTA 1FU7A 3EZ6A 4XVUA 2FEOA 2XBMA 4CL0A 4MUKA 1EHYA 3KAQA 5CCDA 3A06A 3CUSA 3ILHA 3NHJA 2R60A 2RKBA 4DR6B 1W87A 1PSZA 3E05A 3TM4A 3TRKA 2PO5A 5EWMA 1J8MF 3U19A 4TTQA 3GQBA 5LD2B 2GKSA 4H1VA 5FFFA 5IBQA 1H6DA 3GROA 2HB6A 1Y37A 4QGGA 4X71A 3TAUA 2RKOA 3UW1A 3V3TA 5IKEA 1KMHA 2EKBA 2HWXA 1B43A 4M46A 4RV5A 1FTGA 4I2VA 2R8ZA 2VHZA 4KN8A 4RA9B 1CYEA 3QUQA 4EAQA 4B2YA 1P17A 1ENPA 1VB5A 1Z08A 4J0IA 4L4ZA 1N6RA 3PFNA 4MQFB 2PXAA 2UKDA 3C7CB 3WNBA 3ZKAA 1K7CA 1Q7TA 4G8CA 4I5IA 4TMFA 4NU5A 2PR7A 2GLXA 1QCCA 3MFYA 4Q0MA 1UKZA 3FPCA 2YYSA 3ETHA 4RM3A 1YZKA 2V7VA 1VPLA 3L6RA 2IYVA 1ZS9A 2YOHA 5TLSA 3EG5A 3RADC 3DLAA 1TCAA 3I6MA 4H7FA 4IJKA 3OC0A 5BUQA 1VPWA 2CF5A 1YQWA 1RWNA 4M8NE 2JBAA 2O5VA 4FYPA 4AKTA 5EMNA 1P44A 2OA0A 3F7NA 3B5IA 5F2KA 1EUCB 4MITA 1E7QA 3W8FA 3VC2A 3DM5A 1NN3A 2O59A 2ZJ6A 4MCJA 2C3PA 1ULSA 3P9IA 1ML4A 1ZM9A 4OB6A 3V4LA 1QGAA 5K0BA 4O3FA 3UCXA 4TQ9A 5CVUA 5LLSA 5FNVB 3UG7A 4RJKA 1C14A 1REQA 1E1QD 3NBUA 1KZ1A 2B1IA 4IXMA 4U4AA 1SUWA 2ZJFA 1G55A 1YNSA 3CZ9A 2QTZA 3IQGX 2FEAA 3HGTA 3MJHA 1DQYA 1UQRA 3O8NA 3EY9A 4J3NA 5LZ5A 1E1CB 2WUDA 3IUMA 5EXEA 4C4RA 1SC4A 4OHKA 1USVA 3Q3GE 4OY3A 5CVCA 4TWJA 2H9YA 5F2OA 2IWHA 2WUGA 1L4YA 1OGJA 3H04A 5AI4A 2BFPA 2F3RA 3E2PA 4IIGA 1E6WA 3RVPA 3IBSA 1KBZA 4BX9A 4RHTA 5IHXA 3AY0A 1Y6GA 3LX6A 1XMOB 3W9SA 1O0SA 1DSSG 4GBED 4HQOA 1G2PA 1NTRA 2CLIB 3LF2A 3ZTYA 1A5BB 4A0QA 2ODQA 3GFQA 4P0TA 3R8CA 1B74A 4KV7A 1FB5A 2XYHA 3ABIA 3H0KA 1RJFA 3HWX1 4KOAA 3Q98A 4WINA 4YVFA 1J8VA 5CLJA 2ZS8A 1ZJZA 4RGQA 2WAXA 2IXBA 1QV9A 2XE7A 4J16A 4L8FA 2Q1SA 4MKGA 2B7LA 1ZCFA 4QYTA 4YCJA 2JPDA 3G9TA 3I9KA 4G2NA 4MVJI 1OFIA 2XHZA 2EL7A 2OLEA 2Y1CA 1DRKA 5D3ZA 2QGZA 1LW7A 2DAPA 4HNQA 4OI2A 4W1SA 4IDBA 3K09C 1WMBA 2WAMA 3DZFA 4TM7A 1ZXBA 3ETCA 4UJ5A 3A3KA 1U7TA 4C2BA 3JQEA 2AOXA 4KXMA 2AYXA 1ULTA 4FMCF 1J39A 3ENVA 5KJ6A 1DHRA 4IIBA 3FRJA 2QVBA 3Q5GA 3CY6A 1KMQA 4IG4A 1J1IA 3MILA 3MMPA 5L4NA 1TVEA 3U3ZA 4ZHQB 3SSOA 1GZ7A 4L78A 4B5LA 1XRLA 3J81k 3B1XA 4K0RA 3WYCA 3TTSA 1JQDA 2OORA 3LV8A 1EGMB 2W0SA 1TOAA 1XD8A 1ESNA 3PF9A 5BQXA 3SXUA 3H3FA 4DV5B 1SK8A 1IZZA 2QSUA 2NYAA 3K9FC 1IHUA 2NUAB 3EFOB 2R6HA 1Y5MA 3VR5D 1U1DA 1KARA 1Z6YA 4I2NA 5SZJA 5C7OO 3T3OA 2OFOA 1XCPA 3H75A 4W7HA 4ARUA 3PPIA 3TZCA 4QDZA 1PR6A 3QJGA 3TN7A 4FFOA 1VKJA 3K6RA 2PA0A 2HNBA 2PH1A 3D4IA 2CJXA 2EBHX 2W98A 3MD9A 2XUKA 3MA0A 2HQBA 5T5QA 2J9ZB 1DAHA 1Q3HA 2D62A 2PWZA 3ROQA 2FE1A 2YR0A 3CX3A 3IAM1 2QLLA 2RSLA 2AJCA 3TL3A 1SD5A 4W9NA 3FNQA 4F9GA 1T2NA 1TPZA 3ONFA 4UREA 5C8YA 5AD1A 3F3MA 4J0QA 2AT1A 2IU4A 4ENTA 1VKRA 1KZ7B 1I4OA 2VF5X 4FONA 2D0DA 3BKXA 3SOPA 2DSNA 3GRPA 1U8UA 2C58A 3DEHA 4UUNA 1QFZA 4DUGA 5T57A 2HC9A 3GRCA 2ZB3A 4GR9A 3SSMA 3FSGA 2I55A 1I9CA 1L7RA 4WOKA 4J9UE 3BWDD 3ENNA 4ZT3A 5IFLA 4CUZA 4PZ0A 1X80B 2P2LA 3DKKA 3Q7QA 1O97C 2B35A 3IOYA 3K70D 3E9DA 3V4FA 3TINA 2GM4A 3DZDA 1C0IA 3KQUA 5FCDA 2I4LA 3RF6A 5FQNA 3UV3A 4YAUA 4UNRA 1C8LA 3IKJA 5F78A 4J4BA 1KY5A 4AQDA 2F6RA 5DLEA 3ECSA 4FGKA 2V4ZA 1ZEMA 2FY8A 2G0TA 1UC9A 2NO9A 2W71A 2IBSA 2ASEA 2OECA 3CX6A 4ZOQI 1AO3A 1VCMA 4B3SB 4FSXA 2R7MA 3I8XA 1QTRA 4FMBB 3AKEA 4MV4A 4US0R 4UVHA 3D7RA 5DHSA 5TPZA 1AA6A 3HBFA 3OFVA 2O5CA 1UBSB 1NNUA 1ORIA 2VQ6A 3GAZA 2XB2A 1FFXA 1QAMA 4OUDB 5HQ3B 2WKPA 1AHNA 1JJVA 2P11A 2P4HX 4KPUA 4X61A 3ZK8A 1JLHA 3UXHA 4MRPA 3UWOA 2FOLA 2Y76A 3LI2A 1U5CA 3K32A 2X3FA 2I7DA 1PD1A 3KUDA 1UBNA 2FW8A 4G5XA 3T0FA 3C39A 2JKVA 3IIKA 2JLYA 1IN1A 4GW3A 1LF0A 4HX9A 4MSUA 1YZVA 4MA4A 1PTJC 4ZIRA 4GKJB 1VMAA 4AZ3A 3OF5A 1TKCA 1HSOA 3WGKA 2O6LA 5J40A 3A3PA 3AEKB 4M0MA 2C84A 5LXTF 5TB5A 1V8BA 2O8FA 3VU9A 1ESDA 2JAWA 2VZ0A 1L5VA 3BXEA 3OFKA 1AKEA 2YWRA 1CQWA 1O8CA 1F4LA 2VJOA 3MF4A 4FMCB 4JQOA 4LOIA 2IV7A 2RONA 3VO9A 1Z18A 3RGWS 4G5FA 4UJ3A 3GIWA 4YDSA 2D0IA 2FWNA 1PTKA 1QIFA 2OZKA 1EBFA 3FGOA 4CM9D 3FPJA 2C7PA 2AEEA 3AF4A 2CJWB 1ACLA 1RAIA 1W5SA 1UDAA 2Q7OE 3OQPA 1VHLA 4INAA 4TS3A 5KNCD 3TNJA 2PL9A 4BVHA 1GN9A 1PJTA 3EXAA 3PEWA 1HL7A 1UK7A 3ZWWA 5LBUA 3T9EA 3J81A 1B14A 2HBRA 1SNYA 4HVTA 5IS2A 4Q03A 3IVRA 1MH1A 4NYMR 5J2TF 2Y27A 4DLUA 4X6LA 1KY3A 4K81B 1VXOA 3NM6B 1NI5A 4ZODA 4EA7A 5AK3A 3U7HB 2GPTA 5D3QA 3KETA 1CKEA 2QIPA 4IZIA 3P0FA 4Q6BA 4I81A 3WJ7A 1EZZA 4FZJA 4TQGA 4FBMA 4IV0A 2G04A 4XSHA 1U8ZA 2ZPTX 1T3HA 3D6NB 3NT5A 5C7IO 5THXA 3ACBA 3GV0A 3M1IA 4JBYA 1BXGA 3ROFA 2JGNA 4EI7A 4YDHB 1KERA 5E6SA 3ZWCA 3J80A 5HE9A 3EVAA 3EGOA 4KXWA 5D5PA 1XJQA 1F12A 4F7WA 5EIWA 5KJCA 1MRNA 3FZGA 4OJNA 1FBNA 1UJMA 3ONNA 2PCLA 1BGXT 4QAQA 5EC8A 1TZBA 1NW8A 1Z5GA 4FN5A 4M37A 5EWMB 4OI1A 1PN3A 5JSFA 4HP8A 1MAAA 4WV3A 3PUYA 4FQ7A 1EUCA 1JA1A 4NVRA 1HG0A 2ZQ5A 1B6SA 4UNIA 2WC1A 1BVRA 1E9EA 3MMSA 1CWUA 3NWBA 1YL7A 3QOYA 4HQFA 3VPDA 3NOVA 4KPYA 3BXZA 3GZTB 4XJSA 3V1LA 2HKIA 4W1QA 1GSHA 1C30B 3OG9A 4CLOB 3IE0A 4HDNA 2XYQA 3EDQA 1M8KA 3EPHA 1PJ3A 2C8KA 1QH8B 3PS9A 4FHCA 2PQ2A 4NBWA 1VL6A 1J33A 3QU2A 4QHSA 2WUFA 2YVLA 3FDFA 3INNA 2J3HA 4OB7A 2FPUA 3IJ5A 1JIKA 1R88A 1YK1A 1FFYA 2BCEA 1E1KA 3HXOA 3PC7A 1C0LA 1RXEA 4OL0A 3JTEA 1PK8A 2PANA 3V34A 2QRVA 1UBJS 2YMMA 1M1YB 1X3SA 4TX1A 1CHDA 4IH4A 1VTKA 3LVRE 1NW3A 4L8YA 4NCXA 1SRQA 2HI0A 2QK4A 4MAAA 1A8IA 3GUYA 4EL5A 1G8MA 3T12A 4PYRA 3ZUPA 2JEYA 2D4AA 2QVGA 2WKRA 1JSLA 3A4MA 3DL4A 3H2ZA 1EWTA 2P75A 2C7QA 5LP6C 5ALEA 1ZGGA 5FJIA 5IF9A 1NUHA 1YWGO 4RELA 5CD1A 5E1OA 5JZOA 3AFNA 3M1LA 5J9FA 1N9GB 5HTOA 3WOHA 3HRHA 2WJ6A 5K0ZA 2SECE 3G8AA 1HO3A 1DO0A 1T2DA 1JECA 2DLNA 3AX6A 3CLSC 3WFJA 4AKEA 5FLXA 4F2HA 1S7GA 5L51A 2ZATA 2PR2A 2P2GA 1DAGA 2J07A 1NJ5A 1S1CA 1TGVA 2GK6A 3LG2A 4IDAA 3W3AD 3U6KA 3L8GA 2JAPA 4DCCA 1J0AA 1AKUA 3SEAA 5IDXA 3VC1A 2Z83A 4XFJA 1ISHA 4LNHA 4RIFA 1GYPA 1OX4B 2GTHA 4E15A 2JLXA 3FVQA 3CVUA 2YW9A 4FYYA 2ODPA 3WL5A 1T0JB 3C3AA 3K0EA 3WLKX 3UXEA 3LDUA 3U09A 1GTRA 2XNHA 6REQA 3IKMB 4XI9A 5ILOA 5AKEA 3B2QA 1ZBDA 4CTMA 3WP0A 3RS9A 1E20A 4Q4HB 3VQTA 2R6FA 2WBLC 5CYOA 4PZPA 2I87A 2GJSA 3A1FA 1BJRE 1XR3A 4N4AA 3DE4X 4DYDA 1QF9A 1H1TA 1UKEA 3RD5A 1DQNA 5IBCA 4TV8F 4LVOA 1S02A 4NDZA 3ROXA 4YMHA 4LN1A 1Z6XA 3WHIA 1KDZA 4NZNA 3VJKA 1H2YA 3Q4GA 1P61B 3T5GA 4IGKA 5ALQA 4EY5A 5AJXA 1KMMA 1NVBA 2H4HA 5L7TA 1AMOA 2D1TA 4JC5A 4LGVA 2HA7A 4UVEA 5AJVB 4QHYA 7MDHA 1MD9A 2Q6IA 4LXGA 5G40A 3F6YA 2OWEA 2FPOA 2ZSDA 5GGXA 1B73A 5LQKA 2RH5A 2GZMA 3FI9A 5BSRA 4TTSA 2PUFA 5H7XA 5EHXA 2QL6A 2PTGA 4GLFA 1JAYA 2BONA 3P94A 3VNAA 3E9MA 5K8TA 3SHVA 1GA6A 2P1ZA 2Q3LA 2AFHE 3NB0A 4F9FA 1TMKA 1A9ZA 4BLVA 4ETNA 2A0YA 3NWJA 5H3CA 4GYYA 1TCBA 3SQMA 1AK1A 4C9BA 5BV0A 1QVRA 4CLDA 1CUUA 5KTMA 2FPGA 4HVCA 1UOOA 2PGAA 4QUAA 2I2WA 1AZLA 2AQIA 3AV0B 3OCUA 4EZIA 5A3RA 3UMCA 4MVCA 5EINA 1GV0A 4S24A 1F4VA 3HMQA 3EGXB 4LBWA 3MJRA 2XPCA 3BTVA 5AKIA 2B1QA 5FBRB 3SU8A 5IWCA 1B6GA 1DADA 2F1OA 2NT3A 5HXAA 4J1QA 3PHIA 4OV6B 1Y1KE 2REQB 3LLCA 5ABPA 1FDWA 3K5PA 5CD9A 4HG2A 1WTCA 5EP2A 3B1FA 3N2EA 4LCEA 4EUNA 4ACBA 5H4HA 3GFFA 5JYCA 4PLFA 4ZI7A 1RWXA 4UQOA 4F21A 1K66A 4CKCA 3LHKA 1F60A 4Q3AA 2IYPA 5C52B 1OGIA 1IFXA 1UOEA 4JJEA 4Z4FA 1J2UA 2DUUA 1JTEA 1RRKA 2V7PA 3A4YA 3JZFA 2QX8A 5EE9A 3RTGA 3UK2A 3IVMA 3UB3A 2GARA 2ZWOA 3DNMA 4I50A 4A5SA 4DXDA 2NVUA 4QXMA 1ZP6A 2NG1A 3LRXA 1ODFA 1W4LA 1PZNA 3LCUA 1RJDA 2QW0X 3N7AA 1G5IA 3FJYA 3PHGA 1TMOA 4L4XA 2JJ1A 1IUOA 2ACEA 4Q7JB 3HFGA 1YJXA 4RDHA 1MAUA 3U49A 1I36A 1ZSVA 1NYTA 2FRVA 1UPCA 1NVTA 3ILXA 2REQA 5HEKA 2CK3A 3L6OO 4GPAA 5AUOB 4LJLA 1GGJA 2JFHA 2WRZA 3FVWA 1HRDA 2YX1A 1ANKA 2ODTX 1VMEA 3CMCO 3O4FA 3L8DA 3AVUA 4NESA 1P6XA 5TEWA 3VUFA 1P7CA 3IAXA 1UJ4A 1E6EA 4Z86A 5C8VA 3RYIB 5KSYA 3K70C 1MGPA 3JQ8A 4G0YA 4Q7LA 4P92A 1UBFA 5EJIA 3TSWA 1JQ3A 5B2FA 5E7IA 2ECQA 1CULC 4GRDA 4JVSB 4ZOLF 2C1EA 3EG9A 4CW7A 3O2NA 4EMUA 1CDZA 1QFJA 3A4IA 3N39C 3VNRA 4EA6A 3IRVA 1TU3A 1G16A 2JI9A 2H4FA 1CJVC 3D4PA 1T9DA 3CLHA 1LRLA 3S1SA 4COOA 4H1WA 1M2OB 5AHXA 4ZVUA 1CPYA 5KNDD 2C2KA 2KLHA 3NT2A 3NALA 4I5FA 4MV7A 3M89A 3MTAA 1QHNA 1VE9A 4NH4A 5FWAA 2ZUEA 1AGRA 1B00A 4NE2A 3QU5A 4W5NA 5IW8A 1TJPB 1GTL1 4QHTA 4RS3A 5J2TB 5KTKA 1JDUA 2H11A 5CA0B 4ZCMA 5DI9A 3BEOA 3BQMB 2RGDA 1P80A 2YY7A 1M1NA 3KSRA 2Q41A 2OAGA 4Q3NA 3WHLA 4HFMA 1E61A 3IODA 1QHIA 3KOWA 5KYGA 4J3JA 4DA7A 1L0BA 2IITA 2PEYA 1UK6A 2GT1A 1O96B 2H16A 2FW6A 1EEHA 3LK7A 5JROA 3DLCA 1M7GA 4Q9IA 2IV3A 2P9YA 3MTIA 3SYRA 2QJOA 1RZ3A 1H2AS 3DF9A 2P5SA 3AR8A 2ZTMA 3T1TA 5C8YB 4LZLA 3ZX5A 4KOEC 1XU7A 4E08A 3RC9A 4TV9B 5AHOA 1L6RA 3VPGA 4PCAA 1IC6A 4DNFA 1BHSA 1UMDB 2DPHA 3IEKA 1QBKC 2CKDA 3EPPA 2H5LA 3AGPA 5A5DA 1M0WA 4EKEA 5FADA 1JMYA 4EX7A 4OH7A 1PV4A 1S5PA 2XGJA 4LX8A 2XDYA 3EVGA 4P4LA 3RUEA 5GIOE 2JASA 3IAAA 1Y9DA 2PGXA 3E5MA 4BDSA 5KX5F 1HH4A 1PP4A 2DY0A 4MO9A 3MGCA 5KWEA 4PWYA 1QV6A 2FR1A 1E7WA 5HG0A 1GKLA 4HC4A 5KZMB 3NNDA 1JEYA 1WXQA 1VLVA 4ZO8A 1CERA 1OIWA 2E5WA 1XTUA 3AVOA 2XDQA 4XIYA 2YRWA 3N2NA 2AXNA 2JGJA 4P83A 3VYWA 4B43A 2C7RA 4R2XA 4OJKA 5F2EA 2FVYA 3AR9A 4ZCTA 4EI2A 1S8AA 1T1EA 2OGTA 3BOSA 3N53A 5FPYA 4JL5A 3RSSA 2FW1A 4WKBA 4XCQA 1C81A 3N1UA 2WTMA 1N1EA 1X70A 2Y1XA 4FUTA 2J87A 3EZNA 3H9CA 3I28A 1E1RA 2ZSUA 4JMLA 3SZ3A 3V8PA 3VZCA 4CU5A 5LZ2A 3R9WA 5L3QA 3OSZA 2QRPA 3ZZTA 1HUQA 3H1GA 4MAMA 1X13A 1N0VC 3J7AC 4O4IB 5FTWA 2IUSA 3MERA 2JFGA 2OXCA 4URWR 5D5QA 4ERNA 3BCHA 1A8PA 1XCGB 1Y42X 1JDTA 3CNBA 2JHAA 2WIAA 3DEFA 4GSKA 4MWEA 4OVKA 4TLBA 5IT5A 3CNLA 3ZY2A 4PYQA 4N40A 3GLSA 5D7NA 5CMLA 1GPYA 1ZU4A 4O25A 4YAOA 1MO4A 1JIQA 4CBVA 3EGDB 4CIVA 2XMRA 2VF7A 3OHSX 1LC0A 2JRLA 2GJ4A 1K8RA 3GYBA 2EHJA 3QKWA 4PG8A 2OGZA 3ZDFA 4R8LA 1I0ZA 3FD8A 3IEXA 3DTVA 5FEUA 1KWGA 4HWSA 1Z07A 5EPUA 5K3FB 1OWLA 2QM3A 3F98A 3VPCA 3L9WA 4TUYB 5JZVA 5DHRA 1FA9A 4JVLA 1KI6B 4HOYA 5AKJA 3IDFA 4HAOA 2JVJA 3UFXB 4B33A 5JDIC 1MB9A 3IV6A 1F48A 5EWLA 1FDVA 1QQAA 1VM6A 3DULA 4KPFC 4NICA 1CQXA 1VP3A 1JLMA 2RGNC 3UH1A 3EPRA 4JIMA 3EEBA 1F0NA 3L6DA 2C07A 5EPEA 3BD8A 2ESRA 2GYYA 3BQ9A 1BJKA 3IQIX 2WZDA 4QJ5A 1AZWA 4L4YA 2G06A 4KR0A 4L9RA 3ISJA 3T7JA 5LOVA 3Q0IA 2WLSA 1N2CB 1QG0A 2P62A 3ZLJA 4CM9A 2J5XA 6YASA 3O1IC 1UWCA 2W2OA 3BERA 5IN4A 1X7YB 2H8KA 2VRCA 2IEYA 3FMOB 2QT1A 1E1RD 4KLZA 3EUWA 5LXTB 1TZKA 1VL5A 1Y48E 5BURA 3L49A 3P9PA 1TCCA 1DIBA 3HCWA 1KK0A 1LX7A 4X9XA 1X15A 4DR3B 1YU6A 1G0OA 1U4SA 3N6RA 2OB1A 3WGHA 2HIGA 3BWVA 4GBJA 2X8AA 3OZSA 5HK8A 1PZHA 4URHA 1ABEA 1ECGA 3JQAA 4G3XA 4J2HA 1WSAA 3CRZA 5AVXA 1ODSA 3H87A 5HQ3A 1CY8A 2OV4A 1KL7A 2PFKA 4NG4A 4Y67A 2NVBA 3SJZA 3GN2A 4U8HA 4TS1A 4EB6A 1P4GA 3DVAB 3QFFA 2G9ZA 3R2JA 5CXSA 5K3SA 4EW1A 4M88A 2DPYA 2Q2NA 3K9HA 1IY2A 2VT3A 3HV0A 3I52A 3AL3A 3JARA 4RM2A 4JIGA 4N49A 4WKGA 2JLCA 2F48A 4MR8B 4XW2A 3ZX4A 5FI1B 4EHHA 4N48A 4FLMA 4JJKA 4FFSA 1V6SA 1DWPA 2W83A 3DBHB 4GI2A 1WXWA 2CHQA 3AUAA 4R9SA 2QAGC 2GTPA 4U3JB 5J5AA 4XA8A 3DYIA 1V9SA 4O02B 5JFGA 3OBBA 4M0LA 4F6RB 3TRDA 1R4NA 2YJNA 3ESBA 3IMEA 1KJ9A 2QSJA 3MJVA 4ZVSA 1S8FA 3OF2A 5ESXA 4MPRA 4HUQA 4TS9A 2YV5A 1VCHA 1MB0A 3AV3A 4DHEA 1A9RA 1I2MA 1L5RA 1XEWY 5KHLB 3L6UA 5HUJA 1C3EA 3TIVA 1YZLA 3L4BA 2QVLA 3WYNA 3H5LA 4BO3A 2ZXUA 5G2OA 1A4IA 1CLUA 4E13A 5HRAA 1C3JA 1Q0ZA 4ZZIA 1OAOA 4Q9LA 2KYRA 4IUYA 1T5OA 3IAM6 3QELA 1CVLA 2CFRA 4ZJYA 2FEWB 1E5LA 2NX2A 3TR6A 1IM2A 2QM0A 1H0KA 3H1FA 5EJ2A 5CYFA 2HHJA 1MC4A 1KAGA 2ZYIA 3IAS6 2RHLA 3UF0A 1YS4A 1SOAA 3KX2A 3FHJA 2WM9B 1R3UA 4R0MA 2X0NA 4FZVA 3TZLA 4W5RA 1AKWA 1W4BA 4J43A 3VR1A 1OH7A 4V2UA 5GVSA 4R3NA 4LJ7A 3PX7A 2LDBA 1PR5A 3AUKA 2EBUA 1NN1A 2I3ZA 2JIOA 3K1ZA 2MDTA 5AHKA 4EZEA 1L4LA 3RM3A 2I7VA 2WV7A 4KBYA 3OMXA 2NSJA 3NCHA 3Q6IA 4RF2A 1GRRA 4A2QA 3W5JA 5IHPA 3A1TA 3RTAA 1D1SA 5IVKA 1GADO 2XODA 2ZQYA 4GECA 1VA5A 1JI0A 4YPOA 3SMQA 3C97A 5J1TB 3INYA 2ZDGA 1XPOA 1L7XA 3JZMA 4KVFA 3FUWA 4IVPA 1KMCA 4QGHA 3BE5A 3C3MA 1DXOA 3GJ3A 2YC2C 3WTBA 2EX1A 3ICCA 2G7ZA 1QM5A 2AN9A 2BGIA 2C82A 2XNDA 1I9GA 3BL8A 3CUKA 5KYVA 3VR6H 3PVZA 4Q4LA 2R4QA 4JLMA 5JXJA 3RVRA 3U56A 2Q49A 5ALNA 1RI3A 3HA5A 4WCFA 4F1JA 3JZIA 2KJQA 3B6KA 1G8AA 5FWNA 3EVEA 4R1QA 5JSUA 5LMZA 3EGWA 2W42A 2H2GA 4XXHA 2VRNA 1WVIA 2FFJA 4ZDIA 2J4DA 2WMNB 2ZU6A 1ZAKA 3MYRA 4CM5A 4PQRA 1RI4A 3ESAA 1DIGA 4JVOA 1C80A 1FDOA 2BMJA 3GEEA 4TL9A 4PPYA 4IUCS 3C6QA 5ICEA 1ITZA 3H9JA 4MYRA 2GYWA 2F8LA 4KHPB 5ICGA 1UPXA 4BNDB 3VNUA 1RWMA 3K0CC 4QUJA 2CXRA 3TGPA 1RP1A 4NBVA 3LKVA 4V39A 3REGA 3DVAA 5DHFA 1PKXA 4LY9A 3TXAA 5E4TA 2H17A 2N0SA 1KS9A 4HWOA 4UNPA 3LDGA 5KQLA 1MW8X 4CEJA 1HDOA 1HA3A 1KI6A 2BTQB 5G0SA 1XD9A 5LXTA 1NVMB 4PBSA 4PIPA 3GLGA 1AU9A 5DGTA 2QPTA 1VJDA 3K1AA 2CVPA 2HDOA 1RJGA 2A0WA 1X8LA 2Y0CA 3V80A 3OLQA 5ITVA 5D3KA 2HA6A 4F3NA 3GD7A 3FR7A 3P9ZA 1YJCA 4WLNA 5HZHA 1GQSA 1X3LA 2Y2UA 3EOAI 3C7TA 3LH5A 1VFPA 4BNVA 3LQFA 4CT4B 3C7AA 3RJMA 3CUUA 2GZAA 4X94A 3I9NA 2HA3A 2YWHA 2VUHB 5C0OE 5ADHA 3WNZA 1I6MA 4N3CA 1KQNA 4Y9DA 1WV0A 1BX3A 3SX0A 3O2JA 3N5CA 2CNBA 2GEJA 1YB1A 3L8YA 3IAFA 1D4ZA 3D7NA 2IS2A 1LSJA 4JBGA 5AO9A 1OFUX 3R40A 4WLVA 1RBMA 4I1SA 1IQUA 4U8GA 2F1HA 3ORHA 4M0PA 2A9RA 1T36B 2HYDA 3OFJA 4FDAA 1N1GA 3U1BA 3ZHXA 1MB4A 5REQB 2E55A 2C4VA 2ZRIA 1TT7A 4KV9A 1N2EA 1XTPA 4MV1A 4TSFD 4UM9D 5DGXA 4AN1A 1K7SN 4D8WA 5FXMA 3G79A 2BKLA 5CVJA 3U4QB 1ECFA 1U99A 3DDCA 3I34X 2ZTUA 4BP8A 2BM8A 2MYPA 4WZBA 4RPIA 1FP4B 3IE2A 4H16A 3MCUA 4R1NA 5ALWA 1QYVA 4C3UA 1QP7A 4KVGA 5DISB 4JEHA 4ONEA 5IT9A 1SGWA 2F9MA 1CFZA 1KY4A 2B4KA 3N7TA 4OHPA 3U2QA 3QUBA 2NO1A 4YCCA 1P91A 3VUEA 2PJDA 3W90A 3RSZA 1PFYA 4DJJA 9ABPA 4DE5A 3D2AA 4JUDX 4KVZA 4Y2PA 1ZGJA 2B8JA 1F0KA 4PGAA 1YCHA 2HDHA 1LLFA 4Y1RA 3TLCA 1L4NA 3TG8A 2BF4A 1QQ6A 2ZBQA 1YBFA 2ES4A 3BA6A 4KRYA 2EYUA 2NUTA 4OLBA 2XDQB 3LS2A 3Q6MA 4EHKA 1EFKA 2E1PA 1H69A 1YJ5A 2PV7A 3PI7A 5MN6A 1GU0A 1YASA 3D8TA 3D4LA 4OP3A 3K7EA 4A73A 4NEQA 3WMFA 3GUZA 4YUZA 3EOBI 5F23A 2RGXA 5LP6A 1HQCA 1B0UA 3WK7A 3TJMA 1DRJA 4DVJA 3V1MA 2TMKA 4U5XA 1DI0A 4ZEXA 3EGDA 4AMGA 5JMWA 3P2KA 2FU5C 2QVZX 2ZKLA 3CSSA 5JQGF 1W2WB 2I1WA 4JI8B 3OE7D 5I4BA 5DK6A 1XO1A 1RYYA 3QI2A 5L3ZA 4YMUA 2J9GA 1KEVA 1TIKA 2CHEA 2A0FA 3FKJA 4XEUA 4DLBA 4B3GA 1E94E 3QXCA 4PG7A 3I39X 1VI2A 2CKMA 2QJFA 4TXNA 2G0AA 4Z54A 4F46A 2VDVE 1TLTA 5CW1A 1OC4A 1Z7YA 4MB2A 4P3PA 3U1VA 421PA 1TVCA 3UOWA 4DUPA 2PK3A 1OOEA 2IZ7A 4L16A 1S2LA 3B9BA 4K3UA 2O6HA 3T8YA 4YV7A 2CHFA 2FR0A 1DWUA 1XP8A 4X90A 3DT9A 5LQSA 4C01A 1R9JA 1VCNA 2BPOA 3C3CA 3GP3A 3WZMA 4Y9SA 5JCXA 1PRYA 5KNCA 4KNYA 3O3OB 2W2LD 3GLQA 1J49A 3WB2A 3GRFA 4QTUB 3TAHA 1EVZA 4IV5A 5JO9A 4FC7A 4FUQA 4RYLA 2UVQA 1ZCZA 1QCYA 3QWHA 2OUKA 3EG9B 4BP1A 1UBTS 3EC1A 4G2TA 3Q8MA 3WJ1A 4WXHA 1QQBA 2BFAA 3ZCTA 1QDEA 2VDPB 2WE7A 3AG6A 3IOEA 1YB7A 3PGXA 4ECEA 2EBFX 4F93B 5JY1A 1EG7A 3SR3A 1GZHB 1OCEA 2ZAMA 2ZGVA 4RKYA 2P9ZA 2QTGA 1L1EA 1IL0A 3QBEA 3QBTA 4LY0A 4DRXA 4PLHA 4DYHA 4KTVE 3D1JA 4FOLA 1U6KA 4RXMA 1SOVA 2JCSA 2JKZA 3M82A 3K8YA 3N59A 5DM0A 1IJEA 2XH8A 1X1TA 4R31A 2PT5A 3RUFA 5C8YF 1BC5A 2FSHA 4BYMA 4MNTA 3AB3A 3BJRA 2BMEA 1C3OB 3LM8A 3U7RA 1MA0A 1VBMA 3P9RA 1Z68A 2B34A 2BCGY 1DAEA 1SJ9A 4FFPA 3PCTA 4ND8A 3VYRB 4BBJA 2XTNA 4GNRA 5CLIA 2CVQA 2WYUA 1Z4IA 1JI3A 1R0BA 1CJBA 4R01A 1KMNA 1B0PA 1ZG3A 2WTEA 2M1XA 5IBPA 2IH2A 1CIPA 1UKCA 3A9TA 2D8AA 3D6TB 3KYCA 5TDHA 2YOFA 1SC3A 4JXJA 5ERGB 3TLGB 4CUJA 4B82A 4OQQA 1IY9A 3GUHA 2G1AA 1OU4A 4WHMA 2BHTA 3VYUB 4HH4A 1ZN9A 1PBTA 2DH5A 1GCUA 1JWAB 3I1IA 1WBJB 1WMEA 2GCOA 2QLJA 3ABRB 3ILSA 3PEFA 5KHAA 5JRJA 1POXA 1GYRA 1A27A 1GCOA 4RMHA 4NYJR 2CB0A 3VBCA 1PR1A 4B1FA 3ZVMA 4Y6SA 4Z4QA 1GDDA 1RLMA 3AIOA 3EBLA 4BKQA 4B5KA 1SVNA 1KFJB 3W06A 1U3TA 1E7SA 1XVAA 2JHPA 4JP2A 4N7RA 3D3KA 2R1ZA 2VCYA 4FYWA 5LP6F 4DR5B 2XWBF 2L0XA 3AK4A 1K06A 1M6VB 1RE1A 3T3IA 4DZTA 4WDQA 4Z4HA 3WLAA 5I5EA 1JR2A 3JWEA 1P1HA 4KHZA 3WIOA 1EXWA 4W5QA 5C81A 2VSYA 5FJJA 1RMYA 1XRQA 1QO9A 4NK4A 1QKIA 3U4IA 5WRFA 1XRMA 4KNWA 4MYHA 1XEAA 1LTQA 2PSSA 4DA8A 1JR6A 1TUBA 5CFRA 4JI4B 4J7AA 5DNDA 4C08A 2V7UA 2IYXA 3ZYZA 4RDIA 1NT4A 1Z0UA 3QF4A 1X74A 1HE4A 1BA2A 1USIA 1KK3A 1ZXXA 3D8SA 1GZ6A 3FUUA 1JYSA 2FZGA 2F90A 2V0NA 4KLAA 2J41A 4FEAA 2DH6A 3L7MA 4N0QA 4R0NA 4FBLA 2JFBA 4D79A 1PQPA 4L3VA 3B9QA 1PZMA 2B36A 3ZEAA 4HRXA 4L5AA 1U3DA 1LK5A 1SOUA 3UBMA 1FFCA 5DNCA 5KYXA 1FNMA 3ZI4A 4A7PA 1WXIA 2R4TA 1HI9A 1N2JA 4HLUA 5C3MA 4XOUA 4D8UA 4HL6A 2NZUG 1N2GA 1FUYB 1PF7E 3RV4A 2OZPA 3FYUC 4F85A 1L4UA 2EAUA 1PYDA 5ICCA 5JSZA 3LBYA 3P20A 4TV8A 5J47A 3W8NA 5ECGC 1RRFA 3P2IA 4KI7A 1KAQA 1RDFA 3QE4A 4KQ9A 4ZVNA 2XUHA 4IGFA 2O3RA 1J09A 3R7SA 2D1FA 4KB5A 4LF6B 2B30A 2H18A 2QAJA 3O7MA 4GX2A 3Q5DA 3W3ZB 5I6DA 2FPPB 4YRPA 2CNOA 3TIGA 2C8JA 4IOKA 1XP5A 3E2MA 3THOA 4MRRA 5CPBA 4X45A 3OQBA 3I2YX 3E7PA 2W6QA 5TS2A 4DCUA 1UCFA 1NZFA 2IYFA 2Y1KA 4GZLA 3S99A 3EEOA 1E3WB 2F43B 2BEJA 3WGVA 4D4HA 5I7FA 4P4SA 4TMVA 3W7AA 4G5YA 4RMNA 3UOGA 3OQ1A 4YMWA 1RRGA 3ZZ1A 4DLLA 4B3MB 2D7CA 3W2TA 1JUDA 1VE6A 3GEMA 2W4IA 2OEPA 5L7WA 4CLXA 3G8DA 1OFHA 3K3PA 4AP6A 1TAGA 1NUUA 1S4MA 1SCNE 3CF4G 3NGXA 3TLEA 2I6XA 4KO3S 4EPRA 2BJVA 5J43A 3NYIA 1ADJA 3H42B 2PGLA 1RHKA 4FFNA 2CD9A 2JJYA 4CEHB 1TXGA 2NZ2A 4X85A 2F62A 3E5RA 4L02A 3HEBA 2WFMA 5FOSA 2J3KA 3W5CA 1LLQA 4JR0A 4LZPA 1J8DA 3KFLA 3UAXA 3H9QA 5C2JB 3H1TA 5KIAA 1Y6FA 1JIVA 2VK1A 4ZOAA 4J91A 1ZK2A 4GNKA 3G0GA 4DSZA 4J16C 5C7LO 4OK5A 4Q4HA 4WH0A 1QG4A 1GARA 2EIHA 1SU6A 2AE1A 1Y3HA 4I6EA 4IIJB 3RYFB 2ZB7A 5LJLA 1VI5A 1TYAE 1C3OA 1WDLA 2ABWA 3I0ZA 4D43A 2X1MA 2D59A 2CL6X 2R5FA 4JB0A 1WMDA 3OFND 3OUTA 4ZVQA 1T9KA 2C99A 3AXTA 4IWXA 1NVAA 1TQ2A 5KDOA 2A9OA 2CC2A 2PT6A 3RVOA 4IJ5A 3LPCA 1CRZA 1Q1NA 1TJNA 1AN0A 1QE3A 2XDAA 4K5QA 5KNBH 1NM5A 2GESA 1WMFA 1D6NA 2K5UA 3FKQA 1PFWA 1W6RA 2LE0A 4GI5A 3LYUA 4MMXB 1GEEA 3IBCA 3LDFA 1PVOA 4L8GA 1JPUA 3LBFA 4AG6A 4YJ2A 2W90A 3GCDA 5CR9A 4ZEOA 5JZMA 3VRHA 4QX6A 4RTPA 2EZUA 4UTXA 4WA7A 3C85A 3EEQA 1ZM4A 1EGVB 1U28A 2C4NA 4LOAA 5IK2A 4BJ1A 5AW6A 4PC1A 3KXPA 4DCTA 4N9WA 3P8ZA 3SM9A 1NBHA 1F3LA 1SWVA 3LKDA 1T1IA 1Z5UA 3P27A 3FPLA 2KLBA 4EY3A 4GS5A 1V4VA 3OEYA 4W7SA 4YRJA