4G0NA

Crystal structure of wt h-ras-gppnhp bound to the rbd of raf kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
164
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Allosteric Effects of the Oncogenic RasQ61L Mutant on Raf-RBD.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 58
structure length 164
sequence length 166
ec nomenclature
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g0nA00
1AS3A 5L3RA 4ZKDA 1X8LA 1FQJA 4ZV4A 2FNAA 1S9HA 3B1WA 4GRAA 1E9SA 3RRNA 4MQBA 4LJ6A 3ZD7A 3RC3A 2OV2A 3GLGB 1ESNA 4BLOA 2D7DA 4B33A 1IAQA 3U3RA 3O8DA 4IDNA 5B64A 4UXIA 1SKYE 4NL4H 2Q9AA 3MJRA 1QHSA 1XZPA 3AB3A 3WP1B 1AM4D 3PQCA 1NRJB 2OSBA 3M0EA 1KOFA 2ZJYA 3JZAA 1VHLA 4FMBB 4KFUA 5HCNA 2VP0A 2JJ2A 1II8B 1UBCA 3FOZA 1XBTA 4ZDKA 1QHGA 1TEXA 3BORA 5HZKA 1FMJA 4PO8A 2H16A 2DFLA 1KK0A 4MGYR 1JXMA 3P27A 5CB6A 1G7SA 2P6UA 4C9BA 4D4KA 4MDEA 4QNRA 2IXEA 1PVOA 4WXPA 1VCMA 1IXSB 5KSPA 4Q9LA 2A5YB 2GF0A 2PMDA 4X8LA 2KJQA 1DEKA 2P5TB 2YYZA 3TR5A 3KXKA 5D3MA 3K9HA 1H65A 4JMPA 5FFMA 2YINC 1NKTA 1OFUX 2GF9A 2IXFA 2OFOA 3SJAA 3RS3A 2X19A 3S1AB 4D0LB 1WBDA 2QA5A 3UKDA 1U0HC 1YR9A 3PVSA 1LF0A 2UKDA 2ZSFA 2XNSA 2IW3A 4TYYA 2VEDA 3K9GA 3CKLA 3GLHB 1RRGA 4GMXA 4HAWA 1HURA 4KU4A 4E09A 4AG6A 5TXGA 2QZ4A 1AZTA 1WXQA 4XSHA 3SHWA 4H1UA 3LBIA 3X1DA 2ZAMA 5SZKB 3U3JA 1GL7A 3TE6A 2O8BA 3B9QA 1E2LA 4TL6A 3TH5A 5FOTA 4Q02A 2JJ8A 4KBFA 2ZSAA 1O87A 2VH5R 3VX4A 3EC1A 3N2IA 2XXAA 1E2KA 4DSUA 3FHTA 4QL3A 1U0LA 3D3QA 1NG1A 4DVGA 4OHYA 4Q9IA 3GJ8A 2JJ2D 1Q0UA 3A1VA 2HF9A 4CT5A 4DSNA 2IYYA 4DUGA 3U7HB 3T12A 2YHSA 2FPMA 5B2ZA 4JYCA 1E9DA 3HU3A 2GXQA 1NVUQ 2WJIA 3W8RA 3B7GA 1OKKA 2J0SA 2C95A 1EX6A 3B82A 3RDPA 1A1VA 2FDCA 3KQUA 1G6HA 4MUAA 5HZHA 2HYDA 3X1ZA 1ZIPA 4QBHA 1N6KA 1EXMA 2MSCB 3LLUA 4GFDA 4NCNA 5G3ZA 1BKDR 1HE1C 5B30A 4PZZA 5FPKA 3U7EB 2ATXA 3ZJYA 4CRWB 3LVRE 1G17A 1DS6A 2OZEA 3D6TB 4LCBA 2OAQ1 4DIEA 3GJ0A 3SZRA 1YZGA 4JL5A 3UIEA 2BV3A 2Q3FA 2QT1A 2D62A 3CR7A 4DCTA 4KLZA 3AVVA 2G1JA 3PV0A 4YC7A 2PLFA 2FA9A 2V6JA 3K09C 2ODNA 4UNNA 3RSOA 521PA 4M1YA 2WWGA 2AFIE 3SDZA 2ZS8A 1DAFA 1JALA 2WOJA 3EA5A 3KJIA 3H1TA 5BXQC 1HEIA 3WY9A 2JASA 5C46F 2AK3A 4XD7D 3LXRA 2DFTA 2ASEA 1E0SA 4JVSB 3CW2A 4MYUA 5EUMA 1XU4A 3TAHA 3GLFA 1DAGA 4DUGD 3L0PA 1E1QA 2ZE8A 3IILA 3GFOA 3QXJA 4GZMA 1E1RA 4IOKA 1VCNA 4FI3C 2OCPA 2BJVA 1XTRA 4JLJA 3A4MA 4FCVA 4NP6A 4EFMA 1QG4A 4A2PA 1MRNA 3JZMA 4ESVA 1W4AA 2B21A 3TAUA 1U94A 5AJWA 3MWYW 5JCZA 2MSDB 1Q1EA 1N2CE 3RS0A 4N1AA 4RY2A 1M7BA 1UKVY 2R2AA 4CEHB 1Q1BA 1HY3A 1T0JB 2V4ZA 2Z5FA 2E87A 5E7MA 3HR7A 5A0FA 1QHIA 4QHSA 2XZOA 4C0SA 5FBRB 2WJJA 1DBSA 1F60A 1Z3IX 4C7OA 2OM2A 2AKAB 3F3YA 1WRBA 3P1JA 1FW6A 3LQQA 1VG8A 3BE4A 2WKRA 3A4NA 4KXFB 3SJZA 2IHYA 3CPJB 3LY5A 5FUXA 1ZM7A 2O52A 2JJ1D 4HAYA 5JFGA 1JAIA 5K8TA 5B57C 1P6XA 3P20A 1A4RA 1XD9A 2AKYA 1G7CA 1RZ3A 5CM9C 3B9PA 3CH4B 3BS4A 4LWZA 1T3SA 2D74A 1ZNYA 4LPKA 2NMVA 3U6BA 4M9SA 2GJ9A 2C77A 3T34A 5FTJA 1KK1A 2DBYA 5LBIA 3T5DA 2IYQA 2F1IA 3OIVA 1TEVA 5AUNB 2QN6A 1I4DD 1P73A 3LXXA 2BMFA 2P67A 4N3NA 2RH5A 1G16A 3GEEA 5KO2A 5DHFA 3A1SA 5J4HA 4Q03A 4Q4JB 1GZSA 1ZM9A 1N6IA 3SOPA 1T9HA 2HCJB 5L3SA 3DO6A 2RGDA 1Z6XA 4JIMA 2IS6A 1XJCA 2WJHA 3BB4A 4URYR 1TF2A 4OK3A 3SJBA 3OEEA 4C0QC 2XNDD 4F91B 1OFTA 3UK6A 4DLVA 2RKOA 4M53A 3ADDA 2RHDA 1E79D 4BFUA 2PEYA 3GLGE 1W46A 1OIWA 3CNNA 3NBZC 4AKGA 1XCGB 5KNDA 4Q47A 3PUVA 5GJCA 4RFSB 1CJTC 3SR0A 2F3TA 1DE0A 1Q21A 4NCIA 3SBEA 4JBWA 4OQNA 2D4HA 4V0NA 1E9EA 4ZI3A 3E5HA 1RRPA 4R2HA 1ZAKA 2IWRA 4LX0A 2Z83A 2P6NA 4F7WA 1MABA 2GRJA 2VHCA 1QHXA 3TBKA 1G3QA 5FOSA 1CJKC 2NO0A 2ZRPA 1HT1E 2IUSA 1XEXB 4YMTA 2EFHB 3MCAA 4TYQA 4WBSA 1LF5A 2ERYA 1T3LA 1S9DA 2JDID 2GEDA 2XB4A 5JECA 3R20A 2MSEB 2FSIA 1D5CA 3L0SA 1GL6A 4G3XA 4MKHA 3AKYA 3K0AA 2GAOA 4BZQA 5FTNA 1P2UA 1J99A 1GNPA 1P2TA 3OE7D 1QHHA 3UWKA 3WRXC 1NMYA 2CCGA 1OPXA 2ZRFA 5F9HA 1VDZA 2ZQ5A 3K70B 1MOZA 1CBUA 3T61A 4V0MA 3GLIE 4OYHA 4CZ2A 4TZ6A 2BVNA 5F3WB 2EFEB 3ZYCA 4O3MA 3R8CA 2CL6X 4YXWA 4ZDIA 2BMDA 3CLVA 3G82C 4HLUA 3U4QB 5AJYA 4PSVA 3TNFA 4XVQA 1XEFA 4G5QA 4HLCA 5SZIA 1ZMXA 1ZC3A 5LD2C 5AUQA 4DDWA 3GLIB 3U6KA 2IL1A 2J7KA 2AL7A 3A1UA 3CNOA 3H0KA 5TDHA 1JEEA 1KDOA 1N0WA 3QENA 5DH9A 3T1VA 3CUEF 3AVXA 5E4FA 1JAHA 2C99A 2QGZA 3CF6R 4B44A 1W2HA 1IN6A 3VX3A 1E2MA 1CJMA 2C2HA 2ZRJA 2ZI6A 2OBLA 4Q21A 4Y0AA 1CIPA 1XDBA 2VLIA 2OFWA 3OAAD 4BFSA 3K0FB 4NYJR 3EASA 1NN3A 3PEWA 4LJYA 4A1FA 3IDQA 3E70C 3AP1A 2QBYA 1AS0A 1C9KA 1P61B 3OESA 1C4OA 5M04A 4U7DA 1R0ZA 3SC3A 5L3VA 4TLCA 5KDDA 2BKUA 1GTVA 1FNNA 2O8EB 1E9CA 5JI3E 3GJXC 2QGNA 3IHLA 3PITA 3DVLA 3FKSA 3AEZA 1Z0FA 4P4SB 3MUFA 5JRJA 3K0CC 4HZUB 5ELXA 1D9ZA 5FL7A 2G0NA 2FEMA 3KXIA 4WW0A 2ZYUX 2DYKA 3KQLA 2DY1A 2DB3A 2IYVA 4PTLA 3VHXA 1YRAA 1M74A 1P9RA 2JGNA 5KOYA 3P4XA 4B6EA 3NH9A 4JL8A 4OI0A 2BMJA 4PANA 1L8QA 4LBVA 1U90A 3BH6A 1G4AE 4OHVA 1ELOA 4JLOA 4HLQB 3T1TA 2WZQA 3EZFA 5CDFA 1P7CA 1UFQA 2VYFA 1AN0A 4G1UC 4BEBA 4BPBA 3NIBA 4CEJA 1U9IA 2QRZA 3EPHA 1K5GA 3I61A 1OYWA 2V6IA 1EK0A 1AQYA 4LHWA 4WZAE 3SEAA 2CEAA 2MMGA 3UMRA 4AD8A 2GA8A 4IVRA 4KCGA 3CRQA 1NVXQ 5GJVC 3DDCA 1ZU5A 4RFVA 2J0VA 4TMXA 4B74A 3M1IA 4BZXA 1JI0A 3VTKA 1UEIA 2WICA 4YMSA 1FUKA 2AD1A 3ZLJA 2A9KA 1NI3A 2CLSA 3BK7A 4TL9A 5JWHA 1GM5A 4OHZA 2PJRA 3H86A 1VPLA 3RLFA 4CEIA 4JS0A 1R0YA 4TLBA 4CGZA 2J0UB 1GSIA 3SYKA 5K8UA 2R62A 4KYIB 4C0HA 3L43A 1L4YA 3EC2A 3EWAA 2CCJA 3Q5EA 2BBOA 1W0KA 4DIDA 4JZKA 1OH8A 3LRPA 2ZR7A 4MRNA 1ZW6A 1GOTA 1Z29A 2O0JA 3I3SR 4NKRA 1OH6A 3O8BA 3HDTA 3KKOA 1Z0KA 2D06A 3QXXA 1W36C 5EJEA 2QTFA 3LAWA 4B2PA 4D0NA 2ZJ2A 2QE7D 2DFKB 1X8JA 1W36D 2ZAOA 4RZ3A 2G77B 5DNYB 5JEEA 1E0KA 2W58A 4PQYA 3KUCA 2A2ZA 3CONA 4JSYA 3RHFA 1A82A 3UXMA 3FYHA 3V9PA 2MMCA 3K1JA 3TIFA 2KE5A 1F2UB 2IEZA 4BLRA 5EE9A 5TARA 1L4UA 4JBYA 2V9PA 3HJNA 4M4SA 2G0TA 5BYJA 3CWQA 4UQOA 4XVRA 2C78A 4QJ5A 4URWR 2QG6A 5G41A 2PEZA 4Q1CA 4QOSA 2HF8A 2EQBA 3BGWA 2CK3D 5KPJA 2R8RA 2FJUA 4G5GA 4M2LA 1SVSA 3FFBA 4RCZA 2ZRHA 5CITA 5GADl 2JLYA 3B1ZA 3KDSE 4HB2A 2IYLD 2NZ8A 3BBPA 3QG1A 4B3FX 1TMKA 2ZYVX 1XX6A 1TAGA 5HE8A 2ONJA 3FGNA 1Z5ZA 2CL7X 4NYJQ 1PUIA 1RW4A 1TUIA 2QEQA 1G5RA 3NG1A 5AJZA 5BQ5A 4MDFA 1GRQA 4JJZA 4HUTA 4NONA 1P5ZB 3QKSB 3TLXA 1EESA 3QF7A 121PA 2BWJA 1P60A 4MRRA 5GVRA 1SHZA 4B3XA 1OLOA 2CJWB 3PEYA 1KYIA 1ZCBA 1KDPA 4B3BA 1P3JA 2WWYA 1CRQA 1W5SA 3BERA 3LFUA 4ABYA 4IOLA 4TTRA 2B6HA 2NO1A 1H8EA 1G3IA 4P0TA 5BW8A 3IEVA 2I4IA 1XPOA 3QBVA 3M6AA 5JJKA 4M1OA 2QTVB 1S4QA 3KX2A 4LC0A 1F2TA 1KNQA 2RGNC 3VU9B 3IIMA 5KNCA 1EFUA 1KZGB 1IM2A 1VYVA 1KO7A 1KAGA 3REFA 2Q9CA 5H1YA 1F48A 3B85A 1G8HA 5KSYA 3WYFA 1KO8A 2H92A 1Z6GA 2VP4A 3ZH9B 3CRMA 3M4YA 1JEDA 2E1RA 2P2LA 4ACBA 4BZPA 4Q5IA 1E0AA 1VHTA 1IJEA 3SFVA 3QF4B 3CWZA 4IFBA 4KVGA 1XMIA 1WQ1R 3QNUA 3KFXA 1HV8A 4PSKA 4LHYA 3CPEA 1KGDA 2ZS7A 4JLPA 2ZRGA 4M22A 2VF7A 3AF2A 4Q4HB 5D3QA 2QQ0A 3AVQA 4G5RA 3KB1A 3MWLA 2GK7A 4LJ9A 2J3EA 2JLRA 1OH5A 3DZDA 1BMFA 3RS2A 4EAQA 1U8AA 4A6XA 3X1WA 4D6PA 1DAEA 1FL9A 1VTKA 4CDGA 5KSOA 3QEOA 2BBWA 4OI4A 1P75A 2FMXA 1IJFA 1DG3A 5CIQA 1HTWA 3WMEA 1NJFA 1XD2B 1XNJA 3HP1A 3DMDA 1AS2A 2WWFA 1CP2A 1NVVR 3WMFA 4Q4AA 5DSZA 4V0KA 3MG9A 1HYQA 1WBBA 1IBRA 2AN9A 3IBYA 1H8ED 5AJXA 2GBLA 2ZI4A 4HDOB 4AG5A 4LC1A 3TRFA 2PT7A 3SYNA 2JLQA 5IRCD 4XJXA 2WHXA 5JSZB 1W48A 4IVPA 4PHHA 3H84A 2PX0A 1GKYA 4BFZA 1U81A 4LJ8A 4ARZB 2OAP1 2XGJA 4G5SA 4KYUA 1WA5A 3QUSA 2QM8A 2O8EA 2YV5A 1MO3A 4HDQB 4RZUA 1D9XA 1JR3D 2OCAA 4LV5B 3Q5DA 1UBEA 4Z1MA 4M9QA 3C16C 2FSHA 3THWA 2OE2A 2BKEA 1R8QA 3OIWA 4RD0A 4DT1A 2W0MA 4QBFA 2IS1A 2IA5A 3A1WA 2EFCB 2HT1A 2GJAA 1OIXA 3WNBA 3HPRA 1G18A 3K53A 2G88A 1M7HA 2C04A 4DSOA 1AKEA 3QXSA 4JKIA 1VKJA 2D7CA 4PC1A 2PJZA 2QENA 3FPAA 4JT2A 1JNYA 1K8RA 2FE4A 3OFND 1OYYA 4E07A 2XTMA 4LJ4A 1G5PA 2GTPA 2J0QA 4A0RA 4HB4A 2IS2A 4OK6A 2FV8A 2HCBA 4C0LA 5L3QA 1VIYA 4ZI2A 3B6EA 3ICEA 2RGGA 4B43A 1ETUA 2G3YA 1QBKC 2WJYA 2QSZA 4ZIRB 4PPNA 2O8CA 3ND8A 4OI2A 1GKUB 1NN5A 1UPTA 2F6RA 4P31A 2PMKA 2RGXA 3RRYA 1CRPA 4EJSC 1DAIA 1WCV1 2IWHA 1FZQA 1XD8A 721PA 1NMXA 2CNWD 3FB4A 3T5GA 4LHZA 5JEDA 3ADBA 1UJ2A 4LUCA 1KIMA 3LA6A 3QPUA 3TW8B 5IF9A 4IXMA 4FCTA 4B32A 1K5DA 3EG5A 1JB1A 4A8JA 1SKYB 4M1SA 4TLEA 1LTQA 3ZZTA 4JVMA 3CX8A 3GEHA 4KSBA 2BHRA 4OL0A 4M9ZA 2XZLA 1Y63A 2F9MA 1YJ5A 2XITA 1ZD1A 2A30A 1SXJA 4CF7A 2ZJ5A 2W6JA 1M8PA 3AP2A 3UWOA 2QAGA 4R98A 3VFDA 1WMSA 4TQUS 3EW9A 4F4IA 4C2TA 4JLDA 3CF0A 4EQ6B 2O8DA 1SGWA 3MGCA 4L16A 4TQ9A 4F38A 2JLWA 1Z6TA 3RABA 4GOKA 2IK8A 4LBZA 2EVWX 2ZVPX 4XTCS 5ANRB 4IW3B 2RGEA 1GNRA 2AWNA 1DPFA 2FEOA 3HYTA 3AQ4A 4CT4B 1OHHA 1KI6A 3CH5A 4EPVA 2WKQA 1Z8FA 2OILA 1X1SA 3BAFA 3KB2A 2F55A 1OH7A 3AM1A 4WZ6A 5JRZA 1L7VC 4GNKA 1PLLA 3QXCA 4DLWA 5JI2E 5LD2B 4URUR 3LX8A 1IQPA 2ZIAA 3QOFA 1NBMA 1G7RA 3KFVA 3LH5A 4L4UA 1EG7A 1LVGA 3DKPA 5BN5A 4M1MA 3EIEA 3LLMA 2R6AA 4Q01A 1P2VA 2ZXUA 4B3DA 4PXAA 1GL9B 1UF9A 4A6PA 1I2DA 3W5JA 5DLQC 4V0ME 3K9NA 4UJ5A 2DFNA 2PCLA 2QMHA 5DE3A 4NE2A 4F4JA 1JR6A 1AGRA 2ZS9A 1NVVQ 2C9OA 2PZEA 4FCWA 4Q9KA 4BLPA 4EDHA 3L8YA 5KPDA 4QM7A 4I1UA 2PT5A 3LD9A 3R7WA 3C5HA 1P9NA 1YVDA 2WJGA 5FOWA 1W5TA 3F5FA 4LYHA 4A15A 4F92B 2BBSA 1SXJD 2D2FA 4ZO4A 2FSFA 1XPUA 1GWNA 1FX0B 1U98A 4AYWA 2Z0MA 2GAAA 5L8VA 1IONA 3RSLA 1Z2CA 1ZM4A 4NPHA 1NLYA 3ZVLA 3MSXA 1KHTA 2FFAA 1CR0A 3KTAB 3PEVA 4EPTA 4FMCF 4AKEA 2QM7A 4EPXA 2WBLC 4QNMA 2VP2A 1ZUIA 3UPUA 2X1VA 4NCHA 1Y3AA 3U44B 3U3OA 3DL0A 3FE2A 4UNQA 5JS8A 1T3HA 1US8A 2BC9A 5DI9A 4GDFA 1ZVQA 1KAOA 2QQEA 3A1TA 3C8UA 4QRHA 3F8TA 1E4VA 2J7PA 4B3GA 1FPMA 1OJLA 1NG9A 2FPKA 1NBMD 3I62A 2FFHA 3TJZA 4BFVA 5H70A 3E1SA 1W47A 3GP8A 4LK2A 3C14C 4D4LA 5FTLA 3KKNA 4Q7KA 2J41A 3BXZA 1AA9A 4W7SA 1EFHA 3A6PC 2J46A 1KMHA 2QP9X 5FPHA 3R9WA 1KKMA 1M6NA 1UBGA 2OLKA 2QSYA 4BEJA 2ZETA 1NIPA 2WAYA 4LHVA 1QRAA 2X2EA 4DRZA 1J8YF 3KJGA 1MO4A 4Q4HA 1XXHE 1Z0AA 2ODWA 4CW7A 3ZQ6A 4BWYA 4HUQB 1XEWY 1DVRA 4DLUA 3PENA 3RYTC 4B48A 2NZJA 2V8OA 4NH0A 1NN0A 3ONWA 4AYTA 1WDTA 4TL8A 4YDHB 4D26A 1OKKD 1TF5A 2G9NA 2ZSEA 4KFSA 5FL3A 1CU1A 2WWXA 2JA1A 3ECCA 4DHEA 1G5TA 1KJYA 3THYA 2QP4A 2IF2A 1RYFA 2WIBA 4JLAA 4RCYA 4MRSA 5EP4A 2V3CC 1IN8A 2I1VB 2UVQA 4NYMR 4UJ3A 4US2R 2VSXA 3AF1A 1M2OB 4QGAA 1OB5A 4I4LA 4DCNA 1Q1ZA 3FHOA 3W9YA 2AWOA 5DN6A 3TSZA 1W36B 3KXLA 5F2EA 4WOPA 5EXPA 1OSNA 2AK2A 2WPDA 3IBGA 2FGJA 1D2NA 1KJZA 3FHCB 2CBZA 3A8TA 2IYZA 3RVBA 2X77A 3UMSA 2LCFA 4LYJA 2XX3A 3MLEA 2F43A 1X86B 1NVWQ 4EFLA 5F9FA 4ON9A 1GKIA 1A2KC 5JZVA 4D81A 2JIZA 2NPIA 1RIFA 2JCSA 2Z4SA 2ZRKA 1OW3B 4KAXA 5TMPA 1WB9A 4URVR 2J59A 2F7SA 1KZ7B 2BIFA 3P26A 3CZPA 3AGQA 4ZCMA 4UNRA 4E22A 5SZJA 1MKYA 4I81A 1E1QD 5HE9A 3FMPB 1E1RD 2Q0HA 2VRWA 2CCKA 4PPFA 1T0HB 4S2EA 1E2NA 1XJ0A 3EZ7A 1ZCAA 2QROA 3GJ3A 3ZVRA 2W2TA 2ZITA 1FOEB 3I92A 2VBCA 1GITA 2VPPA 5H8WA 4HDCA 3CIOA 4PHTA 3NC0C 4RZXA 3C5CA 4LBWA 4Q66C 1I4TD 5H68A 2BM1A 4LRWA 1LW7A 1QG2A 2V7QA 5LDDC 3X1XA 2HXYA 2ZPTX 4LV6A 1T5LA 2WWHA 1DO0A 2W0SA 1G1MA 3AF4A 1SULA 3EWSA 3MWJA 2VO1A 1P2SA 2CE7A 1W49A 3BFXA 4ZCLA 2H1LA 2OBMA 2B8TA 3HPQA 1RJ9B 3T1QA 5C18A 1R2QA 1LY1A 2F9LA 2R65A 2ZU6A 4U02A 3SQXA 2ECKA 2WPDD 4BFWA 1QHNA 2CXXA 2W83A 4NTZA 1II8A 1IY1A 1Z0DA 3CF2A 3U7FB 5CB8A 2YOGA 2ZJAA 3W5IA 2J5XA 5TV2A 3F0TA 1KY3A 3U2QA 1OE0A 2HEIA 4YONB 4DKXA 1GIAA 1U99A 1BYUA 2AXNA 1IY0A 3EPJA 1QDEA 2GJ8A 4PQRA 2ZRNA 3A58B 4IEEA 1YKSA 1B0UA 4M1WA 2ZU0C 2ANBA 4LYAA 2PZFA 1R4AA 4HAVA 5B58C 1E98A 1F3OA 3H4MA 2UZ3A 1SVWA 4WAUA 1L2TA 2RGAA 821PA 4AKHA 5HTKA 2BM0A 4DDVA 1ZC4A 1ZBDA 1KO4A 1R7RA 3S1AA 2GVZC 3R8FA 1Z6YA 2GCOB 4TMTA 3LQRA 3JVVA 3HU1A 4NMMA 3THOA 1W7AA 4AWXA 3EPLA 2ZJ8A 1D6JA 1XB2A 2ZR9A 4Z51A 3GLHA 1AGPA 4LYFA 2VSFA 4NBSA 5K8IA 2AXPA 4MITA 2QMUA 1TADA 1NNEA 1R5NA 4G01B 4LHXA 3LNCA 2WSSA 2ZYWX 2GXUA 2G6BA 5E7JA 3W6OA 1J2JA 4OHXA 1CR4A 4A2QA 1YRBA 3OEED 4V0OA 1EFCA 4F93B 1ODFA 4PC6A 3QG5A 3FWYA 1XTJA 5EXSA 4PPGA 3WHKA 1JR3E 1B23P 4RD3A 2GCPA 2ZREA 5G3YA 4LZZA 4OQFA 2W6IA 2V1UA 4Q7LA 1CJVC 3W3ZB 3AKDA 1A5TA 3IIKA 1R8SA 3LO5A 1YZTA 1ZYUA 4IOMA 2JLUA 1EX7A 1YHNA 4TSFA 2B92A 5DI3B 1IN5A 1T5IA 4NYMQ 4C0JA 1T91A 3CNLA 4RVCA 1E32A 1GNQA 3CX6A 4PO9A 1GUAA 1HE8B 2XSZA 2FFBA 1TUEA 5CK5A 4B35A 1LS6A 1FX0A 1CEEA 2AD5A 1G4UR 3QEJA 3PJRA 4ASUA 1JQJC 4YQFA 1S3SA 4OKSA 3AVTA 4IJMA 1YQTA 5AR1A 4JLKA 3SHFA 3EIQA 3VKWA 1CTQA 2HT6A 1UBFA 4PQFA 2O5VA 4CVNA 1PV4A 4AI6A 4GMDA 1E96A 2ZSBA 2OG2A 2ATVA 2H17A 2WJVA 2XOKA 1MH1A 1G3UA 1N6HA 2Z4RA 1T8UA 5JS7A 1FMLA 3TSWA 2WSSD 3KJEA 1W4BA 1R0WA 4II7A 3EIHA 1S2MA 3ETLA 3IPXA 3CM0A 1BH2A 3Q8XB 5J4LA 2SHKA 5IDVA 4BQSA 1II9A 4D0GA 1TQ6A 4US1R 4HZIA 3CRW1 4BUJA 2ZEJA 4HLUC 5HKKA 1UKYA 3MJHA 3CRRA 5AJVB 3H2YA 1E2HA 1KDTA 2NTYC 3CX7A 4N0DA 4QJ3A 4TYWA 4Q48A 4YXWD 3QKRB 5EXXA 3C15C 3EZ6A 2QTHA 3LVQE 4OI1A 3RWMB 4EJSB 2H7VA 4MA4A 1VG1A 2R6CA 3DPUA 3IIJA 5AK0A 2AR7A 2ZI5A 1E0JA 3RS7A 4NCKA 2VQSA 1HUQA 2ZE7A 3WNDA 3QQ5A 5BYKA 2GVDC 1VCIA 2GETA 2XSZD 5JWRA 1CR2A 4O2LA 4M9XA 2VHJA 1ZIOA 1M7GA 4X8OA 5LB2A 1NN1A 3P32A 4CEHA 1SVKA 1XMJA 2HLDA 4RKFA 2YOHA 3BH7A 2YC2C 3BH0A 2NOAA 1EFRA 5EZ6B 3TK1A 3TQFA 2FU5C 3NWJA 1NL3A 1KY2A 3GFTA 5FTKA 4P4UA 3WXMA 1A7JA 1ZJ6A 1FP6A 3D8BA 4W5JA 4B71A 1N5KA 2GILA 4OQXA 4QG7A 4BRUA 5IT5A 221PA 2JLSA 1UADA 1OFIA 1XMVA 1KSHA 2CVHA 3N70A 1KSFX 3FKSD 1XMSA 3I72A 1XJQA 4X8HA 4R71A 3W6NA 1X3SA 3BIFA 4LJAA 3RS4A 3O8RA 2LKCA 2VTKA 3X1YA 3AVYA 5FL7D 2YVUA 3GEIA 1N0VC 3IEUA 2WKPA 3QKTA 1BS1A 2YKGA 1SXJE 3AP3A 5UKDA 4J0QA 1YZUA 3KKMA 2GEVA 2ZSDA 2TMKA 3AVUA 1OXUA 1LS1A 4XTRA 4D82A 1U0JA 4XVUA 2O8FB 2OLJA 2RB4A 3IHWA 5FBQB 1DADA 4BGDA 2NPFA 1BIFA 4A36A 4LSGA 1U9IC 2FFQA 3ZIAA 3AKCA 3OF5A 5J40A 2K5UA 1TQ4A 2IBMA 4Q4JA 3C41J 2P6RA 4E03A 2KI5A 4QHYA 1KNXA 4M8NE 5D3MB 3TGPA 2YZ2A 1CKEA 1CXZA 4NCJA 1Z28A 4WA7A 2I3BA 4A0FA 5BN3A 1NBME 4YMWA 2P0EA 3VR6A 1Q3TA 3BB3A 3L8ZA 3O47A 4EUNA 1G8PA 5BWMA 4BE7B 4EIWA 2W2XA 4KITB 1EFRD 4Q7MB 1EGAA 5EUQB 1YU9A 3FFAA 3V4RA 2ORWA 3IPYA 1S8FA 3LWNA 4Q18A 4HAZA 4C0AC 1N5JA 2ZUDA 1TTTA 2OUKA 4RFSA 1LB1B 5E7IA 5DO9A 2O8BB 1IXRC 3KZ1E 4NZYA 4DZZA 2D2EA 3I73A 4QGFA 2AFHE 5FBWB 4DLSA 4XWKA 3VQTA 1JJVA 3D7MA 4KFTA 1VG9B 2WWWA 3VHLB 1G41A 4AYXA 4L9SA 4OK5A 1W0KD 3VKHA 5J5CA 1LNZA 1XEXA 1W0JA 1Z08A 3AVWA 4DXAA 3AGPA 3AF0A 1FTNA 4IHQA 1UM8A 3AV0B 2LKDA 3WMGA 2HYIC 2ZI7A 2JLVA 4FW9A 3CR8A 5C4GB 2ODBA 1G19A 4L9WA 2HXSA 5CJ2A 3NDBB 3L2OB 3GCGA 4HAUA 3SBDA 3WHLA 4DDUA 2JEOA 3TVDA 2PCJA 1G7TA 1Z07A 1GRRA 1MV5A 2XJ9A 4B2IA 4S35A 1JBKA 4YDSA 2N46A 2ZANA 4P33A 2C9CA 1E2JA 2CVFA 2WMOB 2Z6VA 3AUXA 4EPYA 2VP6A 3LBNA 3E2IA 5IK2A 1KSJA 4A2WA 2I1QA 1TL7C 4RZ2A 2CHGA 5FI0B 3RRZA 1HQYE 4D4JA 3TUZC 3Q7QA 2V54A 1XPRA 1GILA 2VA8A 2YOFA 2RGCA 4GP7A 2ZRMA 5KU1A 2QPAA 4DDTA 4ZPXA 3W3AA 3GLFE 4IEIA 3U7GA 3U4QA 4JLVA 4TT3A 1RE0A 3EARA 4PSAA 4B47A 1EFTA 4QKQA 4JL6A 1KTVA 4GPTA 1PUJA 4MYTA 4EPWA 4GOJA 4KLNA 3DKVA 2FN4A 3GLIA 3QPVA 3MAAC 1UDWA 3ND9A 4ILEA 4PHGA 4L15A 1ZNXA 2A5JA 3NXSA 4I99A 3CBQA 1ZINA 4TMZA 1E69A 1XTSA 4FMCB 4B76A 1RC8A 2IYTA 3GLFB 3FMFA 4JLNA 4QGHA 1NP6A 1NY5A 4HI0E 4L5BA 5CYPA 4YLGA 5DHAA 2ZJOA 2QP3A 5DYIA 4DEYA 3Q85A 4B3CA 4DLRA 1SZPA 5GJWC 3K0FA 4OJKA 4Q1DA 4Z54A 2QPTA 4LY6A 3VNUA 4DCSA 1SKQA 3V4FA 1SQ5A 3UANA 1II0A 4DJTA 4KODA 5F98A 1R10A 5JCPA 2NQ2C 3K70C 4JLBA 2CHQA 4GT1A 2WM9B 4KBGA 1V43A 3BC1A 1SVLA 4IDPA 1GG2A 3OIUA 5IK2D 5A4JA 621PA 3K70D 2CMKA 4P4SA 3RS5A 3MD0A 4HZUA 4AC9A 4C7OB 3O8CA 1N6LA 2EWVA 4D80A 3VMFA 2IT1A 3GJ6A 3B78A 3QKRA 3GJ4A 1I2MA 3EZ2A 2DWOA 4TT3D 2EWWA 1BMFD 4K81B 1NLFA 2REOA 3ZZ0A 2ONKA 2YWHA 1SVOA 3V00A 3NVAA 5J4VA 4IDHA 3U61B 3TQCA 1N6OA 5E3HA 3ZVMA 4B6FA 1N5LA 1VECA 4TYPA 3U3MA 4BASA 4A0HA 5TY0A 2GBLC 1VIAA 2HJGA 3PUZA 4PZLA 4B75A 2IC5A 3B1VA 1D2EA 3THXB 2GJKA 2QMOA 3NBYC 4RKEA 4IOJA 2KBEA 3TVTA 2FPLA 3NEYA 4WXRA 2GKSA 1NSTA 3AVPA 4JT4A 3I4LA 5L3SB 1QVRA 4LDJA 3BD9A 3UATA 1AK2A 1G64A 2FF7A 4DSTA 1YR6A 4DBLC 2IS4A 1N25A 3ZQJA 4EPRA 1XTIA 2YWGA 1ANKA 2C5LA 4BFTA 4Z1MD 4KJZA 1DAKA 2J0UA 3VNVA 1JECA 1E2IA 3UG7A 4OBEA 421PA 3K0EA 2H18A 4QBGB 2QT0A 3CB4A 1ZUNB 1QF9A 3TKLA 4W9MC 3I5XA 1JJ7A 5FTMA 4GSYA 1MO5A 1JXOA 2ZYTX 2JLXA 4BLSA 3GFPA 2X8AA 3DZ8A 3MFYA 1V5WA 2ZTSA 3KKPA 3QE0A 4W5HA 1JPJA 4KO8A 2O8FA 2A78A 4TMWA 4G5OA 2OT3B 1HT2E 4OHWA 3SQWA 3HYRA 4KVAA 4RD6A 2ZE5A 2FG5A 1W4RA 1MABB 2ZRDA 3L0OA 3OHMA 4IFEA 1S0UA 3QVUA 4EKDA 2ERXA 3A37A 1YZNA 1O3YA 3DM5A 3GLHE 4A9AA 3AVOA 4C2UA 2NO9A 2QY9A 5LB4A 3GD7A 1F2UA 5FPTA 5EE1A 1ZM3A 4Q1EA 1R6BX 3FTQA 2WIAA 4U5XA 2KSQA 1YE8A 1RPZA 1DARA 4BLTA 1T8TA 3SI7A 2B8WA 5A5GA 2QL6A 4JKYA 4U00A 3K0AB 4A8JC 1UDXA 2ORVA 3HWSA 4UNPA 1PZNA 5FPYA 5KHOC 1Z2AA 2NIPA 3SU8A 3G5UA 2X2FA 4Q1AA 1LV7A 1DTSA 4UXJA 1G6OA 4FMDB 1AJEA 1SXJC 5KTYA 1QHHB 4I1OA 3KQNA 1EWRA 2FH5B 4ACAA 2QAGC 4GP6A 1IOZA 3NEJA 4IRUB 5E95A 3PEUA 1OXSC 3NBXX 1NLZA 2PLRA 1HA3A 1RKBA 3K09A 2W6JD 2GNOA 4XD7A 2KB0A 2DWQA 3QKSA 4DEXA 2EFGA 2ZI3A 2BJWA 4A4DA 3DOFA 2GZDA 4MYCA 5KNBA 2CJWA 2R44A 1IHUA 5FR2A 3WP0A 5LPNA 1S96A 3TUIC 2VHQA 3HR8A 1AZSC 1F5NA 1XCMA 2OCYC 1DELA 1OFHA 3ASZA 3GMTA 4WZBE 4HEJA 1IXZA 2E9SA 1OHHD 4DCUA 4TTQA 3QI2A 3AF3A 2W00A 5CJPA 4LOAA 5EE5B 3VU9A 4K8OA 2QUZA 4A92A 3NH6A 1RFLA 4URZR 4O2RA 4ESHA 3EXAA 4YMUA 1YR8A 2EYUA 2JLZA 2ZJZA 4MGIR 2CLCX 1MR3F 2HV8A 1ZRHA 4Q1BA 1KSGA 4POAA 1SVIA 1XCPA 2YJTD 1XZQA 1GVNB 2HUPA 2V55B 1Q12A 2PH1A 2FZLA 2BCGY 2G1KA 2IF0A 2R6GA 2W2VA 4QJ4A 1KO5A 4PC7A 4B73A 3WYAA 1YZQA 3SN6A 4C4PA 1VCOA 2IYXA 1VMAA 3QF4A 5TVKA 2DHRA 3QSYA 4LGMA 2P65A 2XAUA 3Q3JB 5EXTA 2DR3A 4JJKA 5FBLB 3NDPA 4WVFA 2GXAA 2QBYB 4V02A 1I4LD 1U2RA 3FDIA 2OFXA 4MGZR 5IHPA 4URXR 3FKQA 1Q44A 1K6MA 3Q7PA 4D2IA 4PR0A 2NG1A 4QHTA 2JJ1A 1E9RA 4IDQA 4M1TA 1G3RA 3ZZUA 3DEFA 1GP2A 3D31A 3HU2A 3L0IB 4Q19A 5JJLA 1E9BA 2ZJBA 4R9UC 1XXHB 2L0XA 5CDFE 2PBRA 2EYQA 1XD2A 4CYMA 3PR1A 3SS8A 2QPOA 1OXTA 5P21A 3VR5A 2J9RA 1D8TA 3PUYA 1MO6A 1J7KA 1Z0JA 3B8HA 2G83A 4UNSA 5FOUA 2BEKA 4DB4A 2QU8A 5JSZA 3MRSA 2VP9A 3OEHA 4CEJB 2J7PD 2DCUA 2RHMA 1XP8A 2XJ4A 3PUWA 4ARZA 4D4MA 1OXVA 2WMNB 1DG1G 3ZS8A 3IQWA 5AUPB 2H8KA 2C96A 1P4SA 1UKZA 4KHZA 1NSFA 2A7QA 1MT0A 1OXXK 1R5OA 3B60A 1GRNA 3C4JA 2BOVA 1R0XA 4RD1A 1NF3A 2XNDA 4JVLA 4PPQA 2YC4C 4V0LA 6Q21A 2OHFA 2WOOA 1FQKA 1E79A 1M1YE 4TQAA 3TUJC 5JJIA 2P5SA 3IQXA 4W5WA 3DOEA 2Y8EA 1KK2A 3VR2A 5GVSA 4IDOA 3RAPR 3ZDQA 4XOIA 2GCNA 4DLZA 8OHMA 4CEIB 4M0LA 1Q20A 5C1BA 5KSZA 3OIYA 1ZM2A 4FINA 3QBTA 4B2LA 1G291 1QHYA 1U8ZA 4GZLA 4QBIA 3ZVNA 4P4TA 3NHBA 3KQKA 2O0KA 3RC8A 4UXHA 3RRMA 2OXCA 4MKIA 4A0GA 4F4CA 2QRNA 1W2GA 3WRYC 4ZIRA 2P3SA 4KSCA 1E2QA 3ADKA 1E2GA 1S1MA 2JDIA 3BB1A 1DO2A 3CO5A 4EFNA 3THXA 5DN6D 1XWIA 2PL3A 3LBHA 1R5BA 2XB2A 2OBNA 4O25A 2IUUA 4TZ0A 2ZROA 4Q7JB 5JBQA 3OEHD 1NY6A 4ZCIA 3U5ZB 2R6DA 3W8NA 3SJCA 4GBMA 5DGXA 1Q1QA 3OE7A 4XIGS 5CLQA 2JIZD 2H5EA 4MRPA 4FMDF 1T4GA 5EQTA 4JVNA 5JLJA 3UG6A 3EA0A 1QZXA 3EPKA 4OQMA 4C3ZA 2B7BA 2IHBA 4MH0R 3QPWA 4HB0A 1X1RA 3QXHA 1P62B 2YWEA 1OB2A 4TWZA 4AURA 2BMEA 1Z6AA 2CE2X 4EQ6A 2FSGA 2CDNA 3DM9B 1IN4A 1SVMA 4C0BA 3PIRA 1N6RA 1C1YA 1KJWA 3N5CA 5K8LA 1W1WA 4NYIR 4XH9B 1LFDB 4Q00A 2C8VA 4DB2A 2NO6A 4I1VA 1E2EA 1WF3A 1KK3A 3TMKA 4H9GA 3I8XA 3T35A 4LV8B 2V7QD 1KO1A 2DWPA 3KJHA 4IVQA 2VSOA 1PLJA 1XTQA 4FXPA 4Y0VA 3TR0A 2VL7A 2WAXA 4L8GA 3LW7A 1RRFA 1KI1A 3U60B 1E99A 1J90A 2F3RA 4N0EA 4R2IA 5EP2A 4XWOA 4R7ZA 3OAAA 4GOXA 1F2TB 2XTNA 2GZAA 3A36A 3LW8A 1BYIA 3I1FA 3RWOA 1G20E 3G0HA 3K0SA 4PZYA 2Q6TA 4Q4LA 2HDNB 4Z8XA 1F6BA 3VR3A 2A5FA 2J1LA 4JYBA 3ADCA 4PFSA 2OCBA 3EAQA 3GJ7A 4PC2A 4Q9JA 4NU0A 5J47A 3IGFA 2IYWA 3LDAA 3X2SA 3AH8A 1YZLA 2ZVQX 5DYGA 4OQLA 3BOSA 2F1JA 3RANA 1XRJA 1E94E 2VF8A 4GL2A 3GQBA 5J4YA 3L82B 3K9LA 1N3BA 3K0CA 4NHOA 3KTAA 4LI0A 4BLQA 3KQHA 2IUTA 2ZRCA 1TQ2A 1ZD8A 4AKIA 3ICQB 3NKVA 2YNMA 3BJIC 3ZS9A 3CRVA 5SZHB 4PC3A 1CLUA 3U44A 5KDLA 4AIIA 1A2BA 4DLYA 4HYYA 1COWA 1FFHA 3BFKA 4CIDA 1XTKA 5AWFC 1PJRA 2Q21A 3DMNA 2J87A 2OESA 5C2JB 5EZ5A 5JWOA 1X8KA 5KUTA 3B1XA 3TW4A 2CLDX 4C0KA 3BFVA 3BWDD 2ZRAA 2JAQA 2ZR0A 4Q4AB 5EE3A 5KDOA 4WIAA 2QORA 4M1KA 5TB5A 4DLTA 1PLKA 1Z83A 2ZUBA 2NO7A 1ZUHA 3VAAA 2FOLA 2XTZA 3W34A 2W6ID 2F1RA 1TX4B 1MRSA 2VP5A 3SFZA 3AKEA 1IY2A 4QGGA 1BO6A 3OZXA 3I5YA 1KI8A 1QVAA 1M34E 4HUQA 4TSFD 3PFIA 1VG0B 1DAMA 4JLMA 3VR1A 4AK9A 4ZDWA 1G9XA 1TU3A 2GJSA 4TMVA 1G21E 3THWB 4GI7A 4Q1FA 4DT1B 3GJ5A 3PUXA 1KKLA 5DISB 4B34A 4P32A 1XXHA 4IKEA 2ANCA 3B13B 4LPSA 4ASUD 4DLXA 1VYUA 2GESA 2O0HA 4YMVA 2ZRIA 3QVVA 1E9FA 1ZU4A 4DC9A 1KDRA 1CF4A 4HLDA 4O0MA 2IYSA 2RAPA 4US0R 4K46A 3IO5A 1G3MA 2QE7A 2BDTA 1COWD 1E2FA 3KUDA 2KBFA 2XOKD 3WYGA 3QJYA 2ZRLA 4IXNA 3Q9LA 5L3QB 3LX5A 2GHIA 3NC1C 4JBXA 2WTUA 2EW1A 3NTUA 4MUBA 4NYIQ 2ODEA 4FIDA 2PX3A 2O8CB 4X8MA 2A5GA 2VIIA 5CYOA 5HKKD 3A4LA 1YZKA 1NMZA 3FMIA 4I1SA 2OO7A 4A82A 2RGBA 1G8YA 1WE2A 3BRWD 2FX3A 1KI4A 3KL4A 4NDZA 2ZM5A 1XF9A 2CK3A 4DWJA 1W4CA 2F1HA 4QC2A 3ZD6A 4QFMA 4MRVA 1ZP6A 4RSGA 4TYNA 4A8JB 1XFAA 1W44A 2IXGA 5BN4A 5KYKA 3QIAA 4BFYA 1Q22A 1GFIA 4H1VA 2J45A 2BEJA 4Z8YA 2GZHA 1SXJB 5CM8B 5FUVA 2H57A 2N42A 4RD2A 4C30A 4UKDA 1E4YA 1E3MA 2QAGB 3IKJA 5FOXA 3REGA 1NKSA 5FOVA 1P9WA 1T6NA 5HR5A 2O8DB 4M21A 1DAHA 2IX3A 3EZ9A 1D2MA 2OXRA 2QMEA 2VHTA 2HLDD 4PAQA 1N0UA 2REBA 3WBKA 1S1CA 4BFXA 1GAJA 1UAAA 4TLDA 3NBFA 4P3YA 1KI6B 1RJ9A 2WWIA 3Q72A 5G40A 1RYHA 2WSMA 4RD4A 3T06B 1CJUC 2RGNA 3AUYA 3R9IA 2AHOA 3VR4A 5FUWA 1YR7A 2R9VA 2N1BA 2QNRA 1GDDA 4MGKR 3J81k 2XXAB 3B2EA 3GLGA 2BBTA 5EP1A 2C03A 4XWAA 1Z47A 4FWTA 2NGRA 4E5UA 3CPHA 4BECA 3B5JA 1RVDA 4HB3A 5JHHB 1HQCA 4LBYA 1CULC 1CS4C 3WNCA 5CIWA 5GJBA 2V1XA 4FWIB 1TQDA 2GCOA 1OT3A 5G53C 2A3RA 4ZKEA 3R7WB 3ZIAD 3QY0A 3PG5A 4QXAA 4AY2A 5HCIA 5FBVB 2Q9BA 3W90A 2REXB 4PAMA 5JHGB 1FP7A 2IEYA 4MYHA 2KWIA 2GK6A 4PX9A 5FI1B 3SE0A 3W6PA 3LV8A 2IYUA 2GEUA 2RCNA 5JMTA 4MKFA 1Z06A 5J4KA 4V03A 4BRWA 2EU8A 3ZGXA 1AQUA 2C98A 5EE0A 1XEWX 1Z0IA 3N2EA 4QM6A 1AIPA 2D3WA 3TSOA 5EP3A 2B7CA 1J8MF 1KI3A 4HATA 1TNDA 1X6VA 1FTSA 1H8HA 1G8FA 4G0NA 1US8B 1KMQA 3I8SA 3MWKA 4RJLA 4DCVA 2Q3HA 3U3KA 1CR1A 2ORIA 3PCRB 2EFDB 2A5DA 2RMKA 1JQLB 5FUYA 4ZDJA 5DI3A 1JR3A 2ZRBA 3MMPA 1OF1A 1E9AA 1KMHB 4OJQA 3T15A 3EX7C 5C4MA 1HH4A 2FZ4A 3FVQA 1Q3HA 1W0JD 1Z63A 4TTPA 3KKQA 2ZUCA 2OEPA 1FUUA 1JPNA 4LJ7A 2XZPA 4XSGA 3GPLA 4MKGA 5HPYB 5FPSA 4D25A 2C9YA 1U8YA 3SNHA 3R9XA 2GDJA 1E2PA 5CK4A 3VKGA 3WBJA 4TL7A 5CLLA 1DOAA 1J70A 1NJGA 1KI9A 5DIFA 2Q3MA 3C7KA 1IN7A 1WP9A 2AX4A 2GWHA 3JVUA 2CHVA 4PHFA 2IYRA 3OFNA 5AUOB 2ZI9A 3K8YA 1ZNZA 3SYLA 1KI2A 4TLAA 2QI9C 4HSEA 2JATA 1N6NA 4KV9A 3THYB 2WVJA 1VYTA 1UKEA 2PZGA 5FR1A 3CZQA 1Z22A 2XEXA 3ASYA 3NHAA 1TPZA 3IO3A 1H8HD 2CNWA 3UMFA 4ERNA 1EWQA 3P4YA 2FWRA 4KI0A 1NIJA 4Q9HA 2ZE6A 4EJSA 1AKYA 4TMKA 2DPXA 4PO1A 2GXSA 2VHUA 4LJ5A 4TN1A 1S3GA 2CL0X 1E2DA 2WV9A 2F43B 4ITRC 1UEJA 1TU4A 2BCJQ 1ESMA 2YWFA 2Z43A 3I32A 1OV4A 5FH9A 4FN5A 4JSTA 1BOFA 1E6CA 1Q57A 3IUYA 1RRCA 1G8GA 2QAJA 2R6FA 4KFRA 4HAXA 4PAOA 1FNMA 1ZNWA 1SHKA 1OIVA 2UZIR 1KI7A 3FMOB 1ONBA 1ZD9A 2FGKA 3QKUA 1P72A 4FD2A 3T1OA 1N6PA 1TF7A 2HJVA 2LWIA 1N5IA 3B1YA 3RNLA 3PXGA 3DHWC
chains in the Genus database with same CATH superfamily
4HQLA 2DPGA 3HM2A 4ZKDA 2H0QA 3SF8A 3BMQA 1JG4A 4F6CA 4ZCPA 4ZV4A 3NHLA 5ABPA 3RYFA 3DEHA 3EAGA 2E6UX 3B1WA 4NK4A 3H13A 4NULA 2JHGA 1JMYA 2ET6A 5EN4A 3RRNA 3WKDA 3KOOA 4IDCA 3NT2A 4LE1A 3E9NA 3U9LA 2JFGA 4M7RA 4OGWA 5G4KB 3SSAA 4CM6A 5LUAA 3B9RA 1I7QB 2D7DA 3GIWA 4NOJA 4LYYA 1IAQA 1GSAA 1SEPA 4NH4A 3K32A 1B26A 4INOA 4NL4H 1J5PA 3DV0A 1TPYA 1NW5A 4KPUA 3V7FA 3SVZA 3MJ4A 3WP1B 4PZDA 4KTVE 5T67A 2XDQA 3JZAA 4O2AF 5JPDA 3R0JA 1S01A 1NJ6A 1J8DA 1V3UA 2JJ2A 2VP0A 3E3LA 3QBJA 4KFUA 1PR1A 4YJFB 3CVYA 1XBTA 3PFGA 2NUAA 4ZDKA 5HZKA 1T6XA 1XELA 4MEAA 2Z2IA 3BQ9A 4QU5A 4BQEA 4DA6A 4BMPB 4NBRA 4XJVA 3TIVA 5KYVA 1KETA 4QELA 2J6BA 1A96A 2P6UA 3FSGA 3GUCA 4FR0A 4ZJZA 2IXEA 3UWMA 1Z2EA 2R1ZA 3ORSA 2D1FA 1IXSB 2FPRA 4HADA 4NJEA 3U3ZA 4TRRA 2GF0A 2JAUA 2KJQA 5TGDA 3TR5A 1EDEA 5KAPA 4G0OA 1W94A 2ZUWA 3KXKA 4L22A 5F51A 5K4AA 3GBVA 1Q74A 1UMDA 3B52X 3RRBA 3ZGYA 1VJRA 1NKTA 2OFOA 4O4JF 4RYDA 3RS3A 3Q7RA 3UKDA 1CY2A 1YR9A 3P94A 4EZBA 5IYZF 5BWLA 4YQYA 3EFBA 1UZLA 2WM3A 1X19A 1JQEA 2AYYA 2H0RA 4KZKA 1LQ2A 2C29D 2CXNA 1T8PA 5JC8A 1IRXA 1L5OA 1UBSB 1MX1A 4HAWA 4Z0NA 3U4MA 2J9ZB 3O94A 4E09A 4FI3F 5EZYA 2VTEA 3U3JA 5SZKB 3B9QA 4V3CA 2PWZA 5KOHB 2QUAA 3INYA 3OZGA 3TH5A 5FOTA 1S3IA 2VPYA 4FSDA 5B5SA 3VX4A 4IHAA 2Z1DA 5GQSA 1UXGA 3OURA 1Y6QA 2XXAA 3DLPX 2ST1A 3OMLA 3HLTA 4LZPA 2WZBA 4A6EA 3DVQX 4IDEA 1N2BA 1EFPA 4WXYB 3OUZA 1EE9A 3A1VA 1BDJA 4CT5A 3NTLA 3GVCA 3WK4A 1LPMA 4QT4A 3W5DA 1E8DA 1KVUA 3BIOA 3U7HB 2WB2A 5C32A 2FPMA 5B2ZA 2EZ9A 2BFDA 3RM3A 1K2WA 5CITA 1GZHB 4CL3A 1ZSYA 3HU3A 3USZA 3FMGA 1QUEA 2D00A 3BA6A 2XXBA 1C50A 2WJIA 1DEXA 2ZIZA 3I9V6 3P96A 4PZAA 3W8RA 4CG2A 1MB2A 2G8NA 3E8MA 3PC8A 4W7HA 5I7RA 5JD4A 1A1VA 2XUPA 4MUAA 5HZHA 4KVFA 2HYDA 4YBZA 1HOTA 3AHCA 4JC4A 1JR2A 5KQMA 1NFRA 2MSCB 5CA1B 3L84A 3CT6A 1FRNA 1HE1C 1ZGZA 2JW5A 3JAWA 3LIIA 2VWPA 1OAAA 1N2JA 4CTOA 1M2VB 4LDNA 3D6TB 1YE3A 2EF1A 1JEOA 1GFSA 1W9HA 2OAQ1 3EC7A 4HX2A 1JDBB 4O4IF 4R3NA 1Z4PX 3SZRA 2IZOA 5A02A 2ZQZA 1NFFA 1IWBB 2BV3A 2Q3FA 2QT1A 3I64A 3V4LA 2D62A 5LOVA 3FGPA 5KWVA 3TIIA 5B6PA 5ALNA 3DL7A 1TQHA 3L8FA 3AVVA 3I2KA 3HZRA 5AVUA 5JJCA 4HMQA 4L57A 3CLKA 3LECA 1Z5OA 4M1YA 1Q0ZA 3E9RA 1T9GR 3SDZA 4MAMA 4N39A 1QV6A 1RHJA 5GZ6A 4XQ9A 2YWXA 4KH0A 4LMPA 1P0PA 1JILA 3C3BA 1DQRA 1SIBE 1UDCA 1VA4A 2DFTA 1AGYA 4G8CA 4JELA 4G56A 4N7JA 1YOVA 3TMAA 2RJ3A 4UU7A 4EB8A 1HEYA 1U1GA 1DOZA 1XU4A 2CZGA 3AEQB 5EUMA 1MW9X 2XE8A 5AM1A 4MR9A 1DAGA 5C1OA 2ZE8A 1E1RA 1QK3A 1VCNA 4RIHA 4BVFA 3V8VA 2QV7A 1DX9A 3G8BA 3T3HA 8ABPA 3HKBB 3DCIA 3MJSA 4FCVA 4OL9A 4A2PA 1E7QA 5KJFA 1S7GA 2W22A 3NT4A 4KOAA 2IBSA 2NXCA 3ZCVA 1TO1E 3P9XA 2GRUA 2HNKA 2PX8A 3UJBA 3G5AA 1DJLA 1EHYA 1GADO 4OXXA 1L0BA 1SOUA 3K15A 4YA6A 2MSDB 1N2CE 2DLDA 4GYYA 4DCJA 2I2BA 1F0KA 4AP5A 2R2AA 3A9WA 1Q83A 1Z39A 1PS0A 2GPNA 3WGNA 1HMYA 1L5WA 3MS4A 3BWXA 3O7WA 3HB0A 4UM9D 2O2XA 4I36A 2XZOA 5E1MA 4S1NA 3G0OA 2OBBA 3KK0A 1LNQA 1DBSA 3T6KA 5IJZA 2H1OA 2MYUA 2WNSA 3QHQA 2QD3A 1WRBA 2Q3CA 3GLRA 1OXKB 3WLFA 2WHRA 1VBFA 3OCUA 4FOSA 5EMKA 1RI2A 2WKRA 3KOXA 5H02A 3H2KA 2P9JA 1I30A 2IHYA 5L4SA 4ZZ3A 4MV8A 2GM3A 4YV7A 2JJ1D 3TPZA 1SIOA 4JJ4A 3JCZA 4F04A 1XD9A 3FUCA 2AKYA 4BX9A 1G7CA 1RZ3A 5CM9C 3PR2B 3I05A 2OA0A 3R6GA 3QFCA 2H52A 4LPKA 1R0SA 2CNBA 3EXHB 3U6BA 5AW2A 1PQYA 4I4CA 1I33A 4DE5A 4NF2A 5FTJA 4UHHA 1KK1A 2WM2A 4EUFA 4B3RB 1RBYA 1ZJ4A 2D2XA 5LBIA 4D9JA 3L1VA 5CRIA 1C8LA 2F1IA 3A04A 2QN6A 1JHMA 3D6MA 3HJAA 4BO7A 4BN0A 3IXLA 1RQLA 2RHJA 4MWCA 3FGZA 3IALA 3DZGA 1GZSA 1MJGM 3OM8A 4QOHA 4UHEA 3VOBA 3LDHA 2HXGA 1YAHA 3EZXA 2AC4A 1GYQA 2RGDA 6ABPA 2AMVA 2MINA 1XJCA 3RUPA 3Q1KA 1SC6A 1OD6A 2B20A 3DE3X 4PLGA 1VC2A 3W1VA 4RHTA 2H1SA 2I33A 4J49A 4URYR 1D2HA 4KPYA 2OMKA 4BLVA 1KJJA 5DJ5A 4PLCA 2CDBA 3UK6A 4DLVA 2RKOA 1GUFA 3IKLA 1E79D 1JFVA 5BPHA 2HDWA 2PRKA 1OIWA 3QLVC 3LPAA 1BVUA 2OLEA 2RHHA 4WLOA 2MSLA 2W37A 3EUAA 2VTVA 3G13A 4JP1A 4X41A 4KN8A 5AK6A 5GJCA 4R6XA 3RSQA 3NP9A 4BMCA 2F3TA 1DE0A 2SECE 4J0EA 1RWQA 3HVJA 3KQPA 5B37A 3C6QA 1EE1A 1FQWA 1E9EA 1LQTA 5DX8A 3E5HA 2HL6A 2WUFA 4EHHA 3L06A 2YXBA 3F4LA 5EIOA 2C2BA 2PIAA 1IB6A 2VC2B 3CEJA 4CUKA 4L51A 3S70A 4C05A 4R68A 3GT4A 3OOYA 3HY4A 3SPXA 2W6CX 2ZRPA 3FBGA 4ZVPA 2II6A 1HQDA 4IP0A 5KVVA 5AJUA 2EHJA 1P4RA 1SCKA 4WBSA 4TKMA 4OBXA 3T7RA 3NIGB 1LF5A 4KQKA 1T3LA 3H04A 2JDID 3FSEA 4L08A 5JECA 2D0PB 2MSEB 3R20A 2FSIA 3VKVA 3GL9A 5DOZA 5HJ7A 5HGXA 3E23A 1OI2A 4UOEA 2VDJA 1G0OA 3AKYA 3LL7A 4R2MA 4YUYA 4QOEA 4BZQA 1BEEA 5K6RA 5B2EA 1LEHA 3FVRA 3ZXUB 1U3VA 3QMMA 1JHUA 5KTKA 3C6YA 2EJTA 3SDSA 4CMIA 4EJFA 3REQA 4JA2A 2A5LA 3IJPA 4K3UA 3WTBA 4CUZA 3AF6A 1QHHA 4CLRB 5JQGA 3UWKA 1THZA 1W4LA 4JOSA 3D5EA 1L3IA 2XB8A 4CQLB 3K70B 4X00A 4E4TA 1CBUA 3L6UA 3M34A 3NGXA 3BD7A 3L1JA 4OV6B 3RYIB 1SKAA 2I9PA 2R96A 3N7TA 2FP4B 5F3WB 4RF4A 5TQ0A 3ZYCA 4O3MA 3R8CA 1QNLA 1QO0D 2JRLA 3P2KA 3W0LB 4DREA 3K8ZA 1UK7A 3CLVA 3G82C 4KWTA 4R1PA 4UHBA 1EX9A 2GBFA 5AJYA 5LWHA 2C0QA 3AR5A 4PSVA 4ALJA 2P4QA 3DTYA 4XVQA 4D9IA 4G5QA 1EDBA 2D1QA 1L5FA 4HLCA 3VBEA 1ZC3A 3EZLA 5EJ2A 2PVPA 2BDUA 2XNJA 3V2GA 1MZPA 4DDWA 5C8YB 4LG1A 4HCJA 3URMA 3PDIB 2HF7A 4ZJPA 1HOXA 3GLIB 3FOEC 1LI4A 2J7KA 3A1UA 4K40A 3UUGA 4QXRA 1U6KA 2EKBA 2IXAA 3YASA 4EEXA 3GEBA 4RANA 2IH4A 2QTTA 4F1KA 4AW9A 1C4XA 1E89A 2DFVA 3UHFA 1B42A 5E4FA 4CFSA 2C7BA 3T7SA 1R5JA 3D54D 2J9GA 1E2MA 4EHIA 1CJMA 4D92A 3FDZA 4RVFA 2BP7B 2ZRJA 3BWMA 9MHTA 4BC1A 5FV7A 4MW6A 2OBLA 4L2IB 3D7SA 4Y0AA 1P5RA 1W8IA 2ZJ0A 5AOCA 1E66A 5AXDA 2NVUA 3K0FB 4BFSA 3INTA 1TJ3A 2LVBA 4YK7A 2W4QA 4LJYA 3DUFB 5EMHA 5K3DA 3IDQA 2HAEA 1KXJA 1R74A 3E70C 3AP1A 2EJVA 1R0CA 4XOUA 5CFZA 1AS0A 1C9KA 2PHZA 2BSAA 4OLJA 5LP6C 3VNAA 4B3TB 1XDZA 3D6VA 3DHNA 5KDDA 2BKUA 1E9CA 3A9VA 3ELBA 4I8IA 2QPLA 4JHLA 2MSKA 3IHLA 1LZKA 4M86A 3U5TA 4PYQA 2XD4A 3DO5A 4WMLA 3WL7A 4AY5A 3C74A 3OCWA 5DTMA 4P4SB 1P7PA 3UHPA 4C20A 4EI7A 1NWHA 2B4AA 3CEPB 4HZUB 3BXOA 2I2AA 3AFGA 2INGX 3ORYA 3VDQA 1LBHA 1CZOA 1YBAA 2C5EA 1WVMA 4C6RA 1OFGA 4EB6B 3ELYA 4GMGA 4LNUA 3UW1A 3WZLA 4M83A 1D1PA 2DY1A 1QOZA 2PM8A 2YV2A 3DONA 4PTLA 3EQ6A 3HU5A 5H3CA 6CHYA 1I7PA 1P9RA 2B8NA 3FR7A 3L6BA 1QK5A 4MPTA 3R9KA 2Y3IA 3ZE1B 3DHYA 4B6EA 2CJXA 5JRDS 2WYIA 1KPIA 1TVKB 3MQ2A 4RFLA 4RKRA 4ZANA 3IBFA 1T6BY 2M1ZA 2B4TO 4J7AA 4TTSA 3T1TA 2ZYGA 2NO4A 4LQ4A 3SS7X 2VYFA 5CT6A 2IXBA 2IHTA 4G1UC 3LPCA 4BEBA 2C3PA 3WO1A 2VJQA 5KMGB 1EU1A 3RVMA 1AQYA 4KO4S 3I53A 3TTUA 5ALMA 4LF8B 2QSJA 2CB0A 3TZEA 4NCBA 2GA8A 1UMCA 4KCGA 3NWPA 1NVXQ 1T5BA 1LX7A 1H4TA 1UBHS 3DDCA 3UGTA 1ZU5A 1I9GA 4JC0A 4B6RA 2HTEA 5EPOA 3BZBA 2MT9A 5J23A 3NANA 3G23A 3KSRA 3WKCA 2A1TR 5DNDA 1ISRA 3UPDA 3ZLJA 2WICA 3FTCA 2AD1A 4XEHA 4D4HA 5KYYA 1FJGB 1SUAA 4LXIA 4F97A 3DNFA 3NHPA 1A2QA 4I6JA 1JSLA 4MS3A 4BCBA 4AZ3B 4EG8A 4Z1OA 1CUWA 1QE3A 1Z4KA 3OEWA 4RXUA 1DAOA 3ESQA 4JS0A 1NXPA 1MX5A 2X14A 4RQAA 5EWLA 4KO3S 4YS6A 4EKIA 4EYOA 1U1FA 2R62A 3FNIA 3R74A 3ZE6A 1B0AA 1M1YA 3KUKA 3U0BA 2O7NA 3M70A 4KYIB 3CNHA 1NQAO 1XUOA 2CCJA 1ZHHA 5KJEA 3LCJA 2FR8C 2BBOA 4MTLA 1OH8A 1P9LA 4IHKA 3LRPA 4EHLA 4XR9A 1KHHA 3ITEA 1DBPA 5JUWA 1DT3A 3OLYA 2PTHA 2FZEA 4ZAXA 5EI5A 3HDTA 3INRA 5JOQA 1KYTA 1JS1X 5FLKA 2G1AA 5EJEA 2I80A 1IDN1 5AYVA 3H18A 1Z9BA 1MB0A 1ZOLA 2LW7A 1TC2A 2RIPA 2VH1A 3L0BA 2HIGA 3N2YA 4YECA 1X8JA 1FDRA 4YCBA 5KYTA 4GLBA 1OLSA 1KY4A 2J3JA 1I3MA 1N5MA 3D4LA 2ZQYA 1UOEA 2BFNA 4JSYA 4S1WA 5KCMA 1MPTA 3RHFA 4EGQA 4N48A 2DTEA 3O26A 1F2UB 4FFPA 2Z1MA 4FU0A 3NDRA 1DPGA 1LBIA 4IGFA 4BLRA 4F3RA 3UAXA 4LJKA 3SIPA 4P4NA 1CUGA 2CVOA 1S8AA 4LDPA 4D8VA 1I94B 5CG2A 1LUAA 1IDOA 2O7SA 5DBFA 2G9ZA 4DV2B 2C78A 1HF3A 1ITZA 2WA2A 5AHKA 3HA5A 5G41A 5B3LA 4Q1CA 2G7MC 2Z3ZA 2HF8A 2RE8A 2CK3D 3UMGA 5IVHA 4IG4A 4E5MA 5BYAA 1DIBA 1SBIA 2ZRHA 3ELUA 3LT1A 2BGLA 2UUOA 3K05A 4KXYA 4WFQA 3UJCA 4RHFA 5E4JA 2NZ8A 1V9CA 1XXLA 3HGTA 2XVYA 4F5YA 5HE8A 1GA1A 3O5AA 3A9TA 2EKQA 2OKCA 4H3VA 4RTJA 1WWKA 3N7AA 2NTJA 1JLMA 3WKBA 3KOZA 1UZAA 4DV7B 5H83A 4ZT3A 1P5ZB 1EESA 1Q7CA 5I4IA 5JO0A 3QF7A 4MRRA 3F46A 1N5RA 3KJFA 3A4IA 5ALXA 1TB4A 3C3JA 1OLOA 5H5JA 3RBZA 3SC6A 4K9OA 5K0GA 3PEYA 4QDZA 3RYHA 1G8KA 2AG1A 1W5SA 2NZVG 3HKEB 4IOLA 1Q7RA 1MG5A 4UU1A 1H8EA 2CXTA 4P0TA 4HEA1 3QBVA 3TW0A 2OGWA 2QTVB 4BQPA 5GONB 1QZZA 4PLTA 2FDXA 2RGNC 3L04A 4YI5A 1YULA 4KXWA 3VU9B 5KNCA 2IYOA 5DYYA 5FBZA 4P3KA 5BVHA 2P9TA 1LH0A 1KO7A 1QR6A 2CMDA 1KAGA 2VG8A 1WHTA 2NTNA 4B09A 4E21A 5JDIC 2IS1A 3LUPA 3Q3IA 3IQGX 4GOMD 3A3KA 4WFKA 3VR4D 3MS2A 3EXFA 3LC1O 1D3AA 2EKPA 1Z2OX 4TPKA 4QUEA 3M4YA 5ECDA 3UJ6A 3ZH9B 2VKTA 4ACBA 1JTEA 5THQA 1V26A 4NZMA 1DLIA 2SCUA 2XOEA 1VHTA 2I4LA 4OXNA 2NUTA 1E0AA 1HI9A 4IFBA 5F1YA 5D00A 3KFXA 1HV8A 3MB5A 5DM2A 2PXCA 1PJBA 2Q49A 1G20A 1KGDA 1RAIA 2UUPA 1B43A 3O3CA 2CYAA 3AF2A 1ULHA 5BNTA 5D3QA 2GDZA 2I5PO 2FPIB 4P7FA 4WOJA 3T7JA 3NVKI 2QX9A 4LJ9A 2J3EA 2JLRA 1IUKA 3L93A 2F2TA 2KS6A 5DRTA 2QZSA 2UXBB 2QTCA 1BXGB 4H18A 3DNMA 4QOGA 3CF4G 1DAEA 1SAYA 3FWNA 1SD5A 2X58A 2OYSA 4G86A 2PZMA 3LBFA 4FYIA 5KWEA 2MR5A 4UBOA 4CR7A 4NNPA 1P75A 1DKUA 1IJFA 5IU6A 3HB4X 1XD2B 4PNHA 3HK2A 2AYZA 4GF5A 3MJFA 4TSKA 5D6NA 1NVVR 4MW1A 3W5UA 4XB2A 1DIHA 2BP7A 2VPIA 3MG9A 4L4YA 5EIBC 3WGYA 1EQAA 3TOSA 1WBBA 3QFTA 1MVOA 5AJXA 1IQUA 2APJA 2GBLA 2ZI4A 4XUEA 5DHPA 5A0VA 5JJ5A 4AJPA 2BEVB 2XKBA 3SZUA 2YRWA 1DTWB 2QRUA 3KLBA 4C6TB 2WHXA 3E0XA 2CDCA 4IVPA 3GRKA 3H84A 4CCSA 5IUJC 3L7MA 2PX0A 1RAFA 1RCUA 1GKYA 2XDWA 4EBFA 1HZZC 1K4YA 4HQKA 2ZWOA 4TM7A 1N2ZA 2BFEA 2YFYA 3EVEA 4CIXA 4NOLA 3QX3A 2GPTA 1D9XA 1OI4A 1SXIA 1C7JA 2VT2A 2WT8A 3PPYA 2GO1A 5L7YA 4AU1A 1WXWA 3BMOB 2FSHA 3C8MA 3SXPA 2BKEA 1R8QA 3LXMA 2XMGA 5YASA 1NQUA 4MDHA 1QV9A 1QTQA 2HT1A 2J3LA 2GJAA 1EG2A 5IDXA 3BK2A 3HPRA 5T64A 1AKRA 1ULBA 2JAXA 1DEAA 1WCXA 5GM2A 4YAUA 3GRFA 2QUHA 1AKEA 3QXSA 4H0FA 1LC0A 1C7IA 1VKJA 2A7XA 1O94A 2D7CA 2Z9DA 1KP2A 1YUMA 4PLWA 4RA9A 2HF2A 4WBNF 5IHXA 1QYVA 1Q7TA 1T6ZA 2V4UA 3OFND 3TD9A 3EVNA 3H2IA 4HDAA 2GTPA 4ND8A 4X90A 4A0RA 1E8MA 5CEJA 1PW5A 1O08A 2G09A 2PFGA 3OT1A 4ZI2A 3RB8A 2H2WA 3FZEA 2A9JA 2G3YA 1XRPA 2AZ4A 3W5SA 3CZ4A 5HIMA 2XYVA 3S8YA 4E33A 2OO5A 5AP9A 4BTLA 2O8CA 4O4HA 4P54A 4P31A 3HVUA 2Q4DA 2B78A 2RI6A 2C57A 1T4CA 3COPA 1CRPA 1DAIA 1WCV1 3GEMA 4X3CA 2IWHA 3VUEA 5HILA 3KPVA 1U3WA 3E9MA 4XR4A 1ZD2P 4YMIA 3VHRA 2J33A 4L3OA 4LHZA 5JEDA 3ADBA 1BA2A 3I42A 3LA6A 4LUCA 4MIKA 5TPWB 3ZZNA 4DV4B 3SC4A 2B8JA 3TXXA 4OX9B 4FCTA 5HWSA 5FF9A 1JB1A 3PA6A 3G0IA 3JY6A 3UAOA 4EY8A 4UOZA 5L7WA 4JVMA 3CX8A 3GEHA 1OU0A 1VIDA 1BW9B 4EA6A 4OL0A 2I4NA 4YJGA 1BE8A 2F8MA 4YLEA 5MF6A 2XZLA 1MQ8B 2X8JB 1W8DA 2XITA 3BFJA 1ZD1A 4ZP1A 2MDTA 1JG3A 3B6IA 2WWVD 4ZTUB 2W6JA 4DIKA 3AP2A 3RTGA 1PK9A 5HJ2A 1IY8A 1QDUA 4D8TA 5E1OA 5L51A 8ATCA 3RJTA 3A06A 4C14A 1D4AA 5A62A 1Q19A 3CF0A 5D5HA 1SGWA 4BV2A 4QDOA 4D0SA 5EYPB 3T3DA 4GOKA 4ALMA 1X0VA 4WY5A 4XTCS 4QZVA 5ANRB 2XTJA 5K4HA 4LFAB 1WQ4A 2P9QA 3GFRA 4NDNE 5JSKA 4CT4B 4F4DA 4EPVA 4LVCA 3KCQA 2HA4A 2F55A 2HGZA 3KB2A 3DBHA 4CTJA 3TIGA 5GONF 4WZ6A 4DLWA 4GNKA 4K86A 3RQIA 4I4TA 3K92A 4LWPA 2Z2KA 2IU6A 3GRYA 5KKCA 5BN5A 1AT1A 3IAS1 3AFOA 3LJKA 2J9XB 4DQKA 3EIEA 1EFAA 3LLMA 2R6AA 4Q01A 1P2VA 5F33A 1BA3A 1YJ8A 3G2MA 4G63A 2VSNA 3F2VA 3S8MA 5T6BA 2EKDA 1UF9A 4WLVA 4A6PA 4JUCA 1I2DA 1GZ5A 1VXOA 2YXLA 3EWNA 3HY6A 4V0ME 1YZ3A 1V3QE 3N2NA 5EAIA 4MUGA 4U0KA 5KYXB 1LDNA 3W1WA 1GG5A 1JI3A 1NUQA 4DA8A 4G8JA 1ZCZA 1GTMA 2PZEA 4K9RA 4X20A 4RNCA 2FSPA 5KPDA 4QM7A 3V5NA 2GHRA 3DTVA 1ZI8A 2WF7A 3N8DA 5BO5A 1QMPA 2PT5A 2Q7XA 2NX2A 1SWWA 1XYGA 4ZI7A 1AUXA 1WDMA 4DY6A 4IKOA 5FOWA 4DIOA 3JAMA 2BTEA 1FUYB 4A15A 2ZUUA 2JCYA 3KKEA 2D2FA 1GPLA 2ZG6A 1GUBA 4K6OA 1MFPA 4ZO4A 3VSDA 5K8CA 4OJYA 2GN4A 4BIIA 4NMWA 4EG4A 2IY8A 5L8VA 5AVYA 3K5HA 1DG9A 1G4HA 1Z2CA 4WNAA 3ZVLA 2XRFA 1E6MA 1V1RB 1H2AS 4G84A 1CR0A 3KTAB 2A1UB 2BF7A 3I52A 4EPTA 1BSVA 1QIIA 2QM7A 2A84A 3VNBA 2JGLA 1DRKA 3N0WA 2QRVA 2PGAA 4WLFA 5CH8A 3EISA 3B9BA 3DL0A 4WPGA 3U3OA 3QXGA 5K20A 2VDPB 2HRZA 4RAQA 5JS8A 2WD7A 1UM9B 3MPOA 3UMBA 2O3TA 4WECA 1YDFA 1US8A 3KHTA 2L19A 4LFBB 4GQIA 4XYBA 2QQEA 3ANTA 4N5MA 5DCYA 1Z4NA 1ECGA 3NUQA 3ESRA 3HB7A 4ALKA 2J7PA 1C1HA 1NG9A 1J2EA 5G1NA 5COBA 1RCTE 4WNIA 3E1SA 4BFVA 1W47A 2F48A 4MI9A 1VE3A 2J41A 3O93A 4NENB 4W7SA 4F9TA 1LK0A 2PL9A 3GN1A 1EFHA 2QDXA 2SBTA 3KQTA 4UTXA 2JCXA 3VISA 4I9UA 3U56A 2ZETA 3BIXA 5TLSA 1R12A 1S4MA 1JU4A 4ESOA 1JDJA 3OY7A 1ZVMA 1FPQA 2HLPA 2ODWA 4Y2RA 2Z6QA 2FPIA 2GSWA 1OWLA 4LXTA 1RRKA 2OHHA 3PC8C 4MUXA 2Y2UA 1NN0A 4LRUA 2H5LA 1FFYA 2V97A 3K5PA 3DDZX 2W6MA 1QAOA 2IEGA 2EGGA 4M38A 1H2RS 5JNVA 5MGBA 4D26A 5AO9A 1TF5A 1BDHA 3E9QA 3L9XA 4ZQEA 1L4FA 1U3TA 3GW8A 4LRYA 4ZYZA 1N2IA 5ITSA 1MO2A 2BGGA 2WWXA 3N3AC 4D3XA 1CT9A 1U31A 4YP6A 1KYZA 3AHJA 3WIDA 4KW7A 4M9RA 5K3CA 3E22A 1G5TA 4LTDA 2Q3JA 2QP4A 2V3CC 1SD1A 3KE9A 3ZDRA 1IN8A 2I1VB 2Y1GA 4WY2A 5DF1A 1C7RA 4MV6A 4I4LA 3ZDYB 5LNK1 1CUSA 3PNYA 3WZMA 2IZ0A 3WRYA 1IPFA 3M4ZA 3PT9A 3ZY6A 1R4MB 1Y5IA 2WPDA 1N75A 2FGJA 5ECYA 3AHHA 1KJZA 2CBZA 4HAIA 3AJRA 4V24A 3DOOA 5A9SA 2GPBA 2IYZA 4RH1A 5P8WA 4HEHA 1YASA 1Z56C 2NWQA 4I9HA 1X86B 1NVWQ 4MIOA 4EFLA 5JZVA 2JIZA 2NPIA 4NARA 4IWXA 3MUNA 3T9DA 1R15A 1NOKA 1OW3B 1XKTA 1GPUA 2P90A 3LT0A 1R6TA 5B1EA 5BV1A 2F7SA 3VVLA 4PZUA 2VYND 2C3MA 3P26A 4TLLB 4RPHA 5CFQA 5GTDA 3MWEB 4PYNA 2B0CA 2FFJA 1MKYA 3KEGA 1LI7A 1PFUA 5GGXA 3T0FA 3HVKA 2ODPA 2CCKA 3N07A 3H0CA 2EDAA 3RHSA 3CLUC 3ICOA 3T7IA 5K0CA 2HEGA 5BURA 2CZQA 1XVAA 1ONSA 3I92A 4JENA 3TBHA 1JSZA 1EE2A 1X94A 3K1AB 3LTEA 3TCNA 3EVDA 5H8WA 4P0PB 1EZ1A 4HDCA 1ETHA 3E9CA 1SG9A 3CIOA 4PHTA 5AVZA 2FR1A 2YXDA 2XWSA 4Q66C 2HJWA 1SXQA 4LRWA 4X1OA 1EUZA 1NE2A 2V7QA 1GAXA 3I6BA 2ZPTX 4XYMA 1WDWB 13PKA 1TD9A 3AF4A 4X7RA 2VO1A 3R7DA 4PN7A 1ZD5A 3X1MA 4L02A 2J5QA 3AUJB 1P1HA 5AM4A 2H1LA 3HH8A 4GE3A 1UKCA 4A26A 1RJ9B 3A3NA 1DL5A 5JTTA 1D6MA 2ZU6A 4U02A 4K87A 1LDMA 3QMVA 4H7PA 1VZ2A 2B4KA 2CXXA 2W83A 3HKDB 3R76A 1T8YA 3M3PA 3OZSA 1Z0DA 3Q15C 4GPZA 5FNVF 1HE5A 1T2FA 1DWPA 4QBTA 3U9SA 1RQPA 4FKMA 4TKVA 1ZW1A 2J5XA 3P0EA 1DV2A 2CLEB 3L4EA 3U2QA 1OE0A 2C1ZA 4PLHA 1D04A 3CXUA 5LYJA 1IY0A 3EPJA 1QDEA 3T3OA 5I3ZA 1FJXA 3GLGB 3VZSA 4E13A 1PJTA 1AKUA 5IDYA 1GNLA 1FTQA 2AE2A 2VHXA 4R41A 2O4CA 1GPNA 1DCMA 5ENZA 1SVWA 3TCKA 1P4GA 1XNQB 3RJMA 4XGRA 4AKHA 3N3BC 4TWJA 2C4TA 3GA5A 5H4HA 3V4OA 1KO4A 1R7RA 4RK4A 1V1JA 3N6VA 3WAKA 2X42A 3FRJA 4TMTA 1UFRA 1H23A 2XYQA 1ORWA 5F7ZA 1BHJA 1IJKA 3JVVA 3ZXIA 1J5EB 3HU1A 4P84A 3LE8A 4YLYA 3NOVA 3MOSA 5ES4B 4RH0A 5JCJD 1GQRA 2ZSJA 3ODPA 3G68A 3RARA 1QRSA 1JAXA 1N2SA 2ZJ8A 1IY9A 1D6JA 2ZR9A 4MQ6A 3PLRA 1NV9A 2O8NA 3E84A 3GLHA 3KVRA 2NSYA 3D7NA 3LYLA 3WLQA 2AXPA 1NQ5A 1FU7A 1O97D 4QO8A 1TADA 3O7MA 4I55B 4G01B 4EVRA 1V37A 1WM1A 3OE4A 1JIQA 2Z5VA 7GPBA 3D2LA 2QQ5A 2JK0A 3F9CA 3MSCA 1B1AA 3GGGA 2P6PA 3G0DA 1YRBA 2DUNA 4F93B 2G71A 2AN5A 3QG5A 3MTQA 4JOQA 1JLKA 3E9YA 4MVJE 4RD3A 1W96A 3OCVA 5EUCA 2GCPA 4OD0A 3M2TA 1NR5A 2VLBA 5DW3A 4A03A 3NJRA 3ETJA 1X1EA 4HGQA 4RVGA 2OHVA 2V1UA 5KYXA 3O1LA 1U5CA 3G2PA 3QEKA 4RM3A 3ZGNA 4J0KA 5M34A 1A5TA 2COEA 4DILA 2CLMB 4R81A 3VOTA 4K1XA 2HRQA 1EX7A 2R3SA 1NJ2A 5BMVB 1T5IA 2WINI 1T91A 1OREA 7MDHA 4RVCA 1DWOA 4UFPA 1Z7WA 3PXEA 3CE9A 3ORFA 2QWXA 3RAFC 4PO9A 4DTIA 2IU0A 3NEPX 4D8UA 1MA3A 4GKKB 1YQGA 2XSZA 1M2GA 1O6BA 3A70A 3KZKA 1A9PA 1U8UA 5B58T 1QIHA 3HCAA 4XFJA 3ELDA 3V8PA 4J9UE 5HZMA 4D6YA 8MHTA 5ALEA 1Y3IA 3ASUA 3M6IA 3R3ZA 2BL4A 3AINA 2W6NA 4LA4A 1YQTA 5AR1A 3WNVA 1TCCA 3UGKA 1G9TA 4J4TA 5FOQA 2F90A 3CX3A 1CTQA 3FGOA 4MS4A 3CLTD 4IXWA 1NHGA 1BXZA 2O5VA 2PMWB 4CVNA 4OLFA 1PV4A 4AI6A 1NF8A 2ZSBA 3F6CA 1NJSA 5B1DA 5TE9A 2WJVA 1BE0A 3G88A 2R1TB 1G3UA 4WKBA 1D0VA 5ALVA 1BWSA 4W1SA 3D8HA 1AC5A 1W4BA 4ZVSA 4FP9A 2EBFX 3EIHA 1EFVB 3IPXA 1L1EA 3T3GA 4TM8A 3ODGA 5JS1A 4IM7A 3WV5A 1SVUA 1II9A 2C5FA 1WQ3A 1WMDA 4U0JA 4A7PA 2GK3A 3MVEA 1Z7BA 1FFGA 3GRZA 3I9NA 4DHWA 1DJMA 4RK6A 4P08A 1OX4B 1UKYA 2WFLA 1XVUA 3LUAA 5AJVB 4B4WA 4EABA 3H2YA 3PPVA 3JQ7A 4YWHA 1XTPA 4JWKA 4RK5A 5DK6A 3ILVA 5DULA 4TYWA 1YZHA 5BRNA 4DDMA 3BRWA 4RSRA 4HXEB 4ZARA 4OI1A 3V1LA 2HI0A 4XGIA 3I8OA 3QY9A 1CY0A 1L8LA 3EDRA 3OPVA 4JQZA 5TGTA 1SELA 2ACVA 3LHIA 2NUPA 5CH3A 4B2YA 1YB2A 1E0JA 4FK8A 2P4EA 2VQSA 1HUQA 5WRFA 4BJ1A 4UQLA 4LMRA 1OBCA 1EM6A 3TNDA 1OBFO 5HUJA 3L01A 5K7SA 5A1JA 4TUYA 4IGAA 3I5UA 4GICA 2FK7A 1VCIA 2GETA 2E4YA 3R44A 4MKRA 2PT6A 2XADA 3KR2A 5DT2A 1CJSA 3F98A 4KIUA 2VHJA 4BNUA 2QG9A 1MPXA 4MP6A 1N77A 3HYNA 4Y6LA 1NN1A 2QJOA 4CEHA 4F8EA 5IFLA 5E6RA 3WWYA 5IJ9B 2HLDA 3GWZA 1IB0A 1TA0A 2YOHA 4LRSB 1XZDA 3HYLA 5AW3A 4KNWA 3TK1A 3H7AA 4FYPA 4MVJP 4EYEA 3NWJA 4AN4A 1KY2A 3GFTA 4WN9B 4P4UA 5FTKA 4JI3B 2V5VA 1UANA 3HMKA 1ZJ6A 1JU9A 3TLEA 1WZNA 4XQEA 4JI2B 3FCEA 1YIAA 1CZKA 1FVOA 5CDYA 5IT5A 4WZAB 2CVHA 1OFIA 2G04A 3M81A 3USES 3D1VA 2G40A 1A27A 1U3DA 1KSFX 5DHSA 1XMSA 4U7WA 3R7LA 4R7TA 4FGZA 3L46A 1NLUA 4L0CA 4RS3A 4R71A 1M83A 3KD3A 3T9CA 1L7OA 2WIKA 3W6NA 1ZAYA 2GYYA 3BIFA 4IDGA 4LJAA 2LKCA 2VTKA 2O1SA 5GM1A 4DOMA 1JFTA 3D02A 3GF4A 1BS1A 4CR8A 1SXJE 1RXVA 1Z15A 2M6SA 5IBRA 4E6PA 1NR7A 1ADCA 3TG8A 2H06A 2ZSDA 4TSRA 3EFOA 1TMOA 4YQZA 1Y81A 4TRMA 4AECA 3TQQA 3BJZA 2OLJA 2C7PA 1DADA 2YQZA 1A72A 2QW1A 3KYDA 4GAEA 4MZDA 2NPFA 3LVBA 4LW8A 4O4LA 2FFQA 2Q46A 1NI5A 1U7ZA 5KNCH 2IZZA 5J40A 2CNDA 1A50B 1EWTA 1IE3A 1KJIA 1TQ4A 1JWAB 1Z7YA 1KIAA 2IBMA 2KI5A 2R66A 2XCOA 5TQ2B 3TGPA 3WS7A 5BWBA 1KQOA 3R6LA 2EG5A 5E0OA 1Z6QA 1CXZA 1X13A 2C4WA 4L5YA 1QIJA 2I3BA 2I4MA 2QLNA 1JF8A 2R97A 4U6SA 5JMWA 3GJZA 5D86A 2Q0XA 2R7KA 4BE7B 3QX9A 3GGOA 4K6FA 2W2XA 5EEGA 3ENQA 4M8KA 4G5XA 5EUQB 1GFWA 1ISFA 1BDBA 3FFAA 2HSZA 1L6IA 4UBMA 4HT3B 1D1TA 2FMIA 2ZUDA 5FUBA 5K0TA 3LSTA 2IW1A 2OUKA 4RFSA 4OM8A 1LB1B 4MLDA 5DO9A 5H4GA 3DH0A 4NABA 4JHXA 1FXWA 2Z5LA 1IXRC 3KZ1E 5FWDA 4DZZA 3RJ9A 5HJEA 3R23A 1TJPB 1V3VA 4DN6A 4RESA 3GRVA 1GQFA 4QEZA 4KUGA 4EUHA 4LF7B 4KQEA 4L9SA 3ZTWA 1W0KD 1ODLA 3VKHA 5J5CA 1DUIA 4WKGA 4ZHQB 1XEXA 4Q82A 1BN6A 4KBYA 4QYIA 3AGPA 3JQPA 4CKWB 1B15A 1OASA 1WB4A 3AF0A 3K1ZA 4Z4HA 3WMGA 1DUSA 2W6OA 2ZI7A 1XQYA 1V4BA