4G0NA

Crystal structure of wt h-ras-gppnhp bound to the rbd of raf kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
164
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Allosteric Effects of the Oncogenic RasQ61L Mutant on Raf-RBD.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 58
structure length 164
sequence length 166
ec nomenclature
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g0nA00
3JVVA 3WYGA 3KFXA 4AKHA 2QN6A 3KXLA 1RC8A 4P4SB 4M21A 4LYHA 1T0HB 4BLRA 5C18A 3WRXC 2PJZA 1SXJB 4YMSA 3DHWC 2YOFA 2REBA 3L8YA 4JBYA 4JLNA 2AKYA 4PZYA 1PUIA 2OFWA 3QPWA 5FUWA 5FTJA 4RKEA 3VR3A 4H1UA 4RD0A 1TEVA 4QHTA 3ECCA 1KI1A 3LY5A 3TK1A 5HE8A 3CZPA 3M4YA 4LX0A 4TTPA 4PX9A 1E96A 4OHZA 5JWRA 2A7QA 2A3RA 1JEDA 1G4AE 3IHLA 1KO4A 1ONBA 5EE9A 1QVAA 2D74A 5FTNA 2PZGA 1Q3TA 1T4GA 2D4HA 5FPKA 1CLUA 3CO5A 1BKDR 3P20A 5CK5A 2DFKB 5P21A 4WOPA 2ZS9A 1AJEA 2VHCA 3J81k 2KJQA 3FVQA 4PSVA 3K0CC 1F48A 1ZVQA 2CEAA 3UWOA 3AF4A 2ZPTX 2CK3D 3LH5A 1FNMA 5DI3B 4B32A 2FX3A 4DIDA 4QL3A 1AK2A 2RHDA 3SC3A 3KQKA 5HPYB 1IJEA 2AXPA 1JAIA 5LD2B 3MFYA 4JKIA 1VCOA 1LY1A 4QM7A 5FPHA 1E2LA 2ZQ5A 1XX6A 4LJAA 1FP7A 2IK8A 3LQRA 2F7SA 3U3KA 3TH5A 3A4NA 4JSTA 4Q9KA 4ASUD 3BBPA 4KFTA 1DAMA 1WB9A 3CZQA 4W5WA 3V00A 2A5JA 4JKYA 1HT1E 1AGPA 1G17A 3U3RA 1F60A 2K5UA 3BE4A 3S1AA 2P67A 1N0UA 4HZUA 1KI3A 1L4UA 2O8BB 1KNQA 3WRYC 1P6XA 4GP6A 1H65A 1OHHD 1GZSA 2Z0MA 1OV4A 2GWHA 6Q21A 2J0SA 4ITRC 4KFSA 5IHPA 3VHLB 2GXUA 3P27A 5EP2A 1SZPA 3CRVA 2GNOA 4DLSA 2BHRA 2X2EA 2OHFA 1Z06A 2F9LA 2ZVPX 1K6MA 3U3JA 4O0MA 1P2VA 4ZDKA 5F9FA 1JXOA 1D2NA 4IOLA 4TT3D 4M9XA 4EKDA 4C0AC 3W90A 4W9MC 2KI5A 1N5KA 1D8TA 4QNRA 4ARZB 5FL3A 4C0BA 1LVGA 4DDTA 4OHYA 4KLNA 2AHOA 4U5XA 2HLDD 2IUSA 2VP5A 2ZYTX 2MMCA 3CUEF 3ASZA 5KTYA 1JQJC 3AVOA 1KI4A 4N0EA 3EWSA 4LJ4A 1N5JA 3U3MA 1N6KA 2BBTA 3OESA 4JL6A 4OHVA 4PAOA 1E1RA 1Q44A 4Q21A 2ZI7A 5J4KA 4JT2A 2GEVA 1MABB 4M1MA 4ILEA 4O3MA 5TV2A 3UANA 2IW3A 4AY2A 3FHOA 1E9SA 2W00A 1J70A 1Q3HA 4K81B 4KHZA 4II7A 4OKSA 4EQ6A 4EFNA 1BO6A 3AGPA 1KDTA 3QXJA 4NYJQ 5J4VA 3IEUA 2GILA 3PV0A 1XEWX 2ZRLA 4M1YA 4A9AA 4BECA 4PHTA 2PT5A 3AVQA 4TQUS 3GLIE 3FWYA 4NL4H 3FTQA 1XP8A 1A1VA 1ZNZA 1G6HA 3FDIA 1W2GA 5KPDA 5BYKA 5IRCD 1RYFA 1IN6A 5F3WB 3RANA 4Z1MD 1UBEA 4F92B 1R8QA 1OJLA 2XJ4A 1XTSA 1Z0FA 5KU1A 3K0FA 3LX8A 4M8NE 5CB6A 1OXSC 3EPLA 3SFVA 4ZI3A 1T91A 4G5RA 2ZSEA 4E03A 4CEIB 3AVVA 1M7BA 4JVLA 4S2EA 1AS3A 3SYKA 3TUZC 2ZANA 3N70A 2KE5A 5K8LA 1JJVA 2BOVA 2H16A 2IT1A 2P2LA 5FOTA 3IQWA 3MAAC 5AUOB 4IXMA 2ZU6A 1OKKA 4GI7A 1GIAA 2YOHA 2ZM5A 5JJIA 1YZQA 2GK7A 2JDIA 1NI3A 2N1BA 2PEZA 4MGZR 2GA8A 2ZRPA 2BMDA 1GRNA 5FPYA 2OLKA 3OZXA 3FOZA 1E2EA 3ZVNA 1UKYA 3NEJA 3LA6A 4QBIA 3KQLA 3QVUA 2NO1A 1W5TA 2YWGA 1K5GA 4JBWA 2C98A 3DKVA 4MUBA 2HJGA 4FXPA 3EC2A 3VKHA 4MRPA 5HZHA 5FOVA 2R62A 3VNVA 1NIPA 3THYB 3TVDA 3QKRB 3KKOA 3WP0A 2YJTD 4R2IA 4R7ZA 1NVWQ 5FUVA 1Q1ZA 3A58B 2GZDA 4XSGA 4YMUA 1KNXA 1NBMA 3F3YA 2W0MA 2IEYA 1HURA 2YINC 2IS6A 2ZRJA 4XVUA 5AJVB 1OB2A 2JLWA 1Z6AA 4W5JA 1JR3A 1QHXA 4Q1FA 2B6HA 2WSMA 3LW7A 4CZ2A 4IDNA 2ZSFA 5SZKB 1E4YA 4PPFA 3IKJA 3R8CA 4GZMA 1M6NA 1DAFA 1ZD8A 2F55A 1S4QA 3PCRB 4V0MA 4ESHA 4UXIA 2VIIA 4LRWA 3A1TA 5HCNA 1CRPA 1KDOA 1J2JA 5FL7D 4C0HA 4FMCB 3AKEA 4DRZA 1IXZA 3C7KA 3SU8A 4BLTA 1TF5A 4B76A 4ZPXA 2GK6A 1UADA 1C4OA 3LD9A 4Q4JA 2B8WA 4Q4AB 1KMHB 1M2OB 1VHLA 2OFOA 1YRBA 4ZKEA 3MUFA 5AJXA 1X3SA 1XXHB 4L16A 2IXGA 1N6PA 4Q9HA 3EWAA 2JJ2A 2WKRA 5EP4A 5AK0A 1ETUA 2QA5A 3RC8A 2BEKA 2RGDA 4PSAA 2FPKA 2UZIR 4TT3A 1GM5A 4DLTA 5LDDC 4URWR 1W4BA 4NPHA 4DLUA 2V6JA 2W0SA 4WBSA 2XNDA 3A1VA 2NIPA 2J87A 1G6OA 2QI9C 3K0EA 3VR2A 2CLSA 3BB1A 3LV8A 3B78A 1N6RA 1O87A 1XBTA 3G82C 2RB4A 1G7SA 1EX7A 2XSZA 3K09A 4G3XA 3SEAA 2O0JA 5KPJA 3JZAA 1US8B 4MYTA 2VP9A 4DUGA 4XD7A 2ZJ2A 5JS7A 3W8RA 3B2EA 3WMGA 1GG2A 4DT1B 1Z22A 1HY3A 5DHFA 1NJGA 2ATXA 3U5ZB 2OSBA 2P5TB 4Q1EA 1TPZA 4LY6A 3CH5A 3HP1A 2QZ4A 3TAUA 2J45A 1TL7C 3BOSA 2ZI3A 3TR5A 2DFLA 3ZGXA 4QRHA 3D8BA 1DTSA 1EG7A 5GJWC 4IJMA 3LRPA 1VTKA 4A8JA 2GTPA 1W0JD 4P4TA 3L0OA 4DLVA 1B0UA 2GZHA 1ZM4A 3GP8A 1JXMA 1Z5ZA 2FU5C 4BZXA 1EFRA 4IOJA 4R2HA 5B57C 4GSYA 5JEDA 3RNLA 2GVDC 4CF7A 1CKEA 1ZBDA 1BOFA 3PEUA 1R5BA 1CR0A 5FTLA 5IK2A 4D0NA 2O8EA 1Q12A 1GFIA 1X8LA 4JVNA 5EP3A 4AG5A 2P65A 3OIWA 4OQXA 3ETLA 1GP2A 2J9RA 3AKDA 2ZE5A 5BW8A 1F2TA 1ZD1A 3L43A 2J0QA 1MT0A 3MSXA 4U7DA 3C15C 4OQFA 3CX8A 2ORVA 4F91B 4PHHA 4Q7LA 3Q85A 4EJSB 2D62A 3RS4A 1UEIA 3PG5A 5F2EA 4QNMA 4TSFA 5CB8A 1UFQA 4OK3A 4OI1A 1Z0AA 2EWWA 5BN3A 1E9CA 1G19A 2OXCA 4KVGA 4YONB 2O8FA 2H5EA 4C7OA 2ZROA 1RRCA 1E69A 1ESMA 3VX3A 2OXRA 1CJKC 1S9HA 1JALA 4HATA 4CEJB 2Y8EA 3K0AA 1IN5A 2RH5A 2EQBA 1XJQA 2G3YA 2IHYA 3JZMA 4D80A 3K53A 1IBRA 4HAVA 2GBLA 2IF0A 2ZJZA 2NMVA 1DBSA 3QKSB 1LB1B 1MO3A 4HLQB 4CVNA 4EPWA 4JL8A 4Q7JB 2B21A 5FBWB 1NSFA 2C2HA 1BIFA 2QPTA 3ZD6A 1TQ6A 3AVXA 3BB3A 3NDPA 3AVWA 4Y0AA 4OBEA 1J8YF 5D3MA 1XTJA 3TJZA 1S8FA 1U90A 1OLOA 3EA5A 4D0GA 1CEEA 2ZJ5A 4XJXA 1N6HA 3L8ZA 1Z47A 4E07A 3R7WA 4CDGA 2EWVA 3DZDA 4DEXA 3R8FA 1MV5A 2QM7A 1G8GA 3EA0A 3QKUA 1VG9B 1S2MA 3BJIC 3B8HA 1R6BX 2YWHA 5KOYA 2WWHA 4KXFB 3D31A 5KSZA 5DO9A 4LC1A 1EFCA 1D2EA 4TL8A 5JCPA 1W0KD 3K70C 4MUAA 3K9HA 3AV0B 1NIJA 2VSFA 5FL7A 2ZRIA 1E9AA 3RS3A 3FFBA 2W6JD 4A82A 2BBOA 3PJRA 1UF9A 3U4QB 5FUYA 3F5FA 2CLDX 2ZE6A 3SDZA 2WIAA 5CYOA 4LI0A 4XSHA 1JB1A 1KO1A 2H18A 2XOKD 2F43A 4PXAA 4D25A 1U8AA 4OHXA 4B74A 1OXTA 1XTQA 2IC5A 3THXA 4UNSA 1J99A 1G9XA 1N6IA 2A5DA 4XWOA 2G88A 4NBSA 4UNPA 3U3OA 3T1TA 1FMLA 4TTQA 4KCGA 4DB4A 1OFHA 1NMZA 5GJCA 5FPSA 3CLVA 3WMEA 5M04A 3TVTA 3BRWD 3ZS8A 1KK3A 2A30A 2F1JA 3CW2A 4L9SA 1Z6YA 3K9LA 4K8OA 1C1YA 3GLFE 1WE2A 2D2FA 3QIAA 4OK6A 4EPVA 1Z6GA 1OIWA 2AX4A 3KXIA 4TLAA 4KJZA 1OW3B 2MSEB 3CF2A 3HU2A 3KJIA 1P2SA 4US1R 4URVR 1XWIA 3CIOA 5TVKA 4I1OA 2EFDB 5BXQC 1KSJA 2YZ2A 3RWMB 1X8KA 4CT4B 1AS0A 1Q20A 1GTVA 4Q48A 2C78A 2F6RA 2HDNB 3ND8A 3NH9A 3WXMA 5JECA 5KO2A 5IF9A 4IRUB 2WWWA 4PC6A 4BFUA 3TRFA 4A0GA 1T8UA 1A2BA 1DVRA 1LTQA 1Z0IA 2G77B 1R7RA 1OB5A 1Z63A 3FMOB 3T1OA 3K1JA 3GLIA 3ADDA 4FW9A 1B23P 2V1UA 5FBRB 2O8CB 4DZZA 4RCYA 3NBZC 1EFHA 2MSDB 3CONA 3IQXA 2B7BA 2GJ9A 4DB2A 2HYDA 3IBYA 4LBVA 2AR7A 1G8HA 3VR1A 3VX4A 4RVCA 1FQJA 4OI2A 4PPNA 3DMDA 2IF2A 3RVBA 4F38A 1E2IA 1E9EA 2GETA 2KB0A 3KUCA 1KMQA 4TLCA 2JGNA 3CR8A 2RGBA 2EYUA 3QENA 4ZCIA 3B9QA 4E09A 1FZQA 3UMRA 2CJWB 4Z54A 1SHZA 3K9NA 4X8LA 1G7RA 1GILA 2IX3A 3K70D 4P4SA 5AR1A 3Q3JB 3CWZA 4A2PA 2D3WA 1NG1A 2F1RA 3OHMA 2PL3A 4NCJA 2R65A 5CDFA 1ZIOA 2FFBA 4A15A 5JS8A 2QROA 1TAGA 1JPNA 3B7GA 4MRSA 1NBME 4DCNA 3E5HA 4NHOA 2R6CA 3ND9A 4B2LA 1XZQA 1IXSB 2VP2A 1U94A 4WW0A 5B58C 1NKTA 1IN4A 2MMGA 2IWRA 2NPIA 3IUYA 3DKPA 3H0KA 3FMFA 3L0PA 4NCKA 1JR3E 1M1YE 4M1WA 5BYJA 2PX3A 2WIBA 1NKSA 1VG1A 3A6PC 3VR4A 4TLBA 3KJEA 3K8YA 4HUTA 2WAYA 4LHVA 5FBLB 1YQTA 3CNNA 3A1WA 1COWA 4V0ME 4N3NA 4E22A 2DPXA 4TYWA 1A7JA 2C9OA 2PMDA 1YR8A 1ZUIA 2D7CA 2VSXA 1MOZA 2QENA 1ZJ6A 3C5HA 4D6PA 3T5GA 1DAGA 1EESA 1E32A 5JSZA 1NL3A 4IFEA 3A4MA 2QSZA 2XZOA 1XD2B 1JQLB 5DI3A 2ANBA 4Q02A 2FV8A 2OEPA 1YHNA 3GJ5A 3QI2A 1JEEA 4PAMA 2C03A 3SJCA 1GKYA 1TEXA 1MO6A 1G5RA 3RAPR 4EPRA 1GL6A 3DM5A 5TARA 4DBLC 4UNQA 2AXNA 2NO0A 2ZRKA 2OG2A 4U00A 3EARA 4URYR 1UDXA 1R0WA 1SVMA 3FKQA 1Z6XA 2D2EA 2OESA 3V4RA 4EFLA 3G5UA 2QP3A 1BYUA 2NTYC 3AEZA 3PIRA 4LBYA 1R2QA 3WBKA 5E4FA 2ZYVX 4KBFA 4WAUA 1T3LA 4IEEA 2VYFA 1VG0B 3EPJA 5JRJA 4HLCA 3KTAB 1E1RD 4MYCA 4KI0A 2PEYA 2XOKA 5KNBA 1W36B 3I4LA 3AF1A 3RRZA 2HYIC 1YZLA 2J7KA 2YVUA 3A4LA 1R0XA 1GNPA 4YC7A 1DARA 4NZYA 3REGA 4LWZA 3QG1A 1W1WA 3WYFA 3AKCA 1CXZA 5GVSA 5JWOA 1SGWA 2PX0A 4LHWA 2HCBA 3QPVA 2BV3A 4OQLA 1ZP6A 4ZCLA 1KSGA 3D7MA 1T5LA 2ONKA 2OFXA 4LUCA 4TYNA 1VYTA 2A5GA 5JMTA 1TQDA 4C0QC 3CRMA 1F2UB 5C46F 2IYYA 3BORA 1GRQA 3X1WA 2IBMA 5DYIA 3REFA 4MDEA 1MO5A 4JLBA 4MKHA 1WF3A 2ZRGA 4Q47A 3DOFA 3IIJA 3EX7C 4QFMA 3I5YA 3GD7A 3TMKA 4C4PA 4RCZA 1II0A 2F1IA 2FFQA 2ZRBA 3NH6A 1QZXA 2R6FA 1VHTA 4FMCF 421PA 3CNLA 1U99A 2IYWA 4LHYA 4JIMA 2FOLA 3GJ6A 1XEXB 3IIMA 3W6NA 4P3YA 4L15A 1OKKD 4NONA 4LK2A 2VP0A 3QXSA 1OSNA 3GJ3A 3QXXA 2QBYA 3ZZ0A 2AFIE 2JDID 2QGZA 2VEDA 1FX0A 1KI9A 3ICQB 4RD6A 1KHTA 1RRFA 4LPKA 1EWQA 2XAUA 1AGRA 3U6KA 3K09C 2QMHA 3EXAA 2QG6A 1I2DA 2WOJA 4URZR 5KSYA 4EIWA 1VIAA 2KBEA 4J0QA 4JJZA 3Q8XB 5D3QA 4BQSA 3DM9B 2GF0A 4V03A 5CIWA 3B1YA 1Z83A 1XFAA 1CS4C 3SFZA 1M34E 4IOKA 5LB2A 4TMTA 2EFEB 3O8CA 4RZUA 4CEIA 4YMVA 3W6PA 2VHTA 2QAGB 2V7QD 1ZW6A 4PO8A 4KO8A 4G5QA 4BFVA 3DL0A 3RWOA 3V4FA 1XZPA 2VSOA 3HJNA 1OH5A 1NBMD 2JLQA 1VPLA 1W44A 4WVFA 5BN5A 3IBGA 4A8JC 2ZJAA 2D7DA 1SKYE 1QBKC 4PR0A 3B82A 5HR5A 1XB2A 5CM9C 2Z4RA 2WWXA 3AB3A 1JR3D 4LHXA 2ECKA 2GCOA 3U60B 4MITA 3UMFA 1KTVA 2WMNB 3ZVLA 2A9KA 3QXCA 2JCSA 1YZGA 1P72A 5EUQB 5KHOC 4RFVA 1LV7A 1OIXA 2ASEA 2YWEA 1IONA 4GRAA 3TQCA 4DHEA 4IDPA 1G8YA 2BJWA 3GLHB 4GMDA 4GPTA 4NYJR 3PQCA 2V1XA 2CBZA 3ICEA 2XITA 1CJUC 521PA 3OFND 4XTCS 1XF9A 2HEIA 2JEOA 4V02A 5FBQB 3THYA 4F4CA 2LKCA 1P61B 3GQBA 5EQTA 1E94E 3H86A 1G7CA 5H68A 1JJ7A 4HUQB 3QQ5A 4P4UA 4B33A 2IUTA 2WJYA 2JJ2D 3EZFA 1QVRA 2E9SA 4D0LB 3TKLA 4DLRA 1OFUX 2JLRA 3CKLA 4FI3C 3ZLJA 1HE8B 3EPHA 4MRRA 5JI3E 3G0HA 5E7IA 2IHBA 5J47A 3U7FB 2J41A 4IEIA 4AYTA 2XNDD 4ZKDA 2C77A 2QY9A 3PEVA 2ZVQX 4MYUA 5KSOA 1H8EA 2PCLA 3BGWA 4PC1A 2WV9A 3X1DA 4DSUA 3A1UA 4W5HA 2XSZD 3DDCA 2N46A 2XEXA 3MWKA 2GBLC 2WWFA 1KO5A 4BLOA 4HDOB 1TQ4A 2KBFA 4KODA 4DUGD 4FIDA 4XD7D 3U44B 4HAYA 4IVQA 2GXSA 2FE4A 4M0LA 3VHXA 1KDRA 2JLZA 2W2VA 121PA 1E4VA 3KKMA 2G0TA 1FL9A 4HLDA 2FSGA 4GZLA 3T61A 3THWB 1P3JA 2ZTSA 2NPFA 5FH9A 2OAP1 3BD9A 4Q4AA 2Q3HA 1KMHA 5E7JA 4BFXA 1E0AA 3TR0A 4AWXA 4NP6A 1CJTC 2BMJA 1XXHA 1A5TA 4FINA 2ZI9A 3AP1A 3GJXC 2FGKA 1Y63A 3LAWA 2IYUA 2DWQA 3GLFA 4M1TA 4YMWA 2FH5B 2P6UA 2H8KA 1EFRD 3RSOA 2VBCA 4M22A 3ZYCA 2BJVA 2ZITA 3QF4B 4BWYA 3B1XA 3BH6A 3DO6A 2YC2C 1FFHA 2AWOA 3P4YA 1JECA 2GVZC 2QP9X 4PC7A 3I8XA 5IK2D 5L3RA 1AS2A 4X8OA 4DSNA 4DDWA 2ZRMA 4TMVA 3ADBA 1BS1A 3B85A 4UXHA 3PUYA 2FFHA 4R98A 4CW7A 2D06A 1ODFA 3B6EA 5CDFE 1VCNA 1GL9B 4NCNA 4WZBE 1V5WA 2KWIA 4YXWA 3DOEA 5L8VA 4DCUA 2QSYA 1ZYUA 2ZU0C 3MWJA 1R5NA 2H17A 3OE7A 4WZAE 2V9PA 3TSZA 4A6XA 3K70B 4LPSA 2JLXA 2AN9A 1SVOA 4TSFD 3C14C 4JLMA 1O3YA 4ESVA 3B13B 2J46A 1JNYA 3EZ2A 2WM9B 3CF0A 3GMTA 1G5TA 2IYLD 3PEYA 3I8SA 4OHWA 1I4TD 3RS2A 4QJ4A 4C2TA 2XTNA 4BGDA 2PCJA 3ZQ6A 1W4AA 4LHZA 2GRJA 4NU0A 4HLUC 2E87A 3B1ZA 1NSTA 1W2HA 5GJVC 5KDOA 4CEHB 2V7QA 4P33A 1G20E 3LLMA 1ANKA 4KU4A 2ZJOA 3SQWA 2GEUA 2GKSA 2GCPA 1T0JB 1ZD9A 4RKFA 3JVUA 1NMYA 4M4SA 3A8TA 3IPXA 1E0JA 1VMAA 3BFVA 1MO4A 1NVVQ 2X1VA 1E2FA 4IFBA 1XRJA 1OF1A 2CVHA 4MGKR 2GJ8A 2J0UA 2V55B 1LNZA 2FZ4A 2Z5FA 4Z51A 1E9DA 2IL1A 3GEIA 1AKEA 2C5LA 3IDQA 4UJ3A 4RFSB 2QL6A 4EFMA 4TMWA 4G0NA 1NLZA 4O25A 1W7AA 4H1VA 4NDZA 2FSHA 2AD1A 2FEMA 3P4XA 1PUJA 3C41J 2Q0HA 3A36A 3CPHA 3FYHA 4U02A 4YDSA 2ZYUX 2FN4A 3D3QA 1SVSA 1E0KA 3KX2A 3VQTA 2C99A 3RSLA 2RAPA 1Z28A 2O52A 3OFNA 2EFGA 4HSEA 4NYIR 5JJKA 1ZINA 5JCZA 3BS4A 1F3OA 1KY3A 3T12A 3PEWA 3WNBA 4V0LA 1QHIA 1N6NA 2ZR0A 5G3ZA 3TUJC 3T1QA 2FJUA 4MYHA 4DWJA 3N2IA 4Q9LA 4AKEA 3CBQA 1L7VC 1N2CE 2VL7A 2QMUA 3CF6R 1UKEA 1S96A 3ZDQA 4G1UC 1XMVA 1RRPA 4AYWA 3WHKA 4D4JA 3LFUA 4BASA 1RPZA 1KSHA 1Z08A 1XJCA 1WP9A 4EQ6B 1WDTA 2WJHA 4I1UA 1ZUNB 4PQYA 4UNRA 3VKGA 1ZU5A 2AFHE 2NQ2C 3LO5A 1G16A 5FUXA 2V8OA 1IQPA 4GOXA 5DHAA 1UPTA 1QG4A 2NO6A 4K46A 4V0NA 5F9HA 5TXGA 4JLKA 2IYSA 2IXEA 1WA5A 3U4QA 5CJ2A 1KK1A 1RYHA 3LVQE 3PUVA 1UBFA 5JWHA 2B92A 1JAHA 3K0FB 4PANA 3ZS9A 4B6FA 2IYVA 4F93B 5EUMA 2OZEA 2G9NA 3MJHA 5LD2C 4NMMA 4XIGS 1FP6A 3R20A 5C2JB 2W2TA 4QC2A 4OI4A 2CCKA 5EXTA 3GLGB 1AN0A 1G3IA 2GXQA 2V4ZA 3E1SA 3QVVA 4PC3A 1ZIPA 3BK7A 3IIKA 4PQFA 2DBYA 4TMXA 1D9ZA 2IYZA 2A2ZA 3ZJYA 1T9HA 3VU9B 1OFIA 1OXXK 1R4AA 2J59A 4AD8A 5HKKA 5L3SA 1TUEA 3NBYC 1KI6B 5DLQC 4KBGA 3I73A 5FFMA 1HQYE 1YU9A 4YMTA 4JYCA 1Z8FA 4A6PA 2O5VA 3IEVA 1T8TA 2ZRAA 5CJPA 4Q7MB 621PA 4TQ9A 3ONWA 4QKQA 1G4UR 2Q3MA 2CE7A 4PAQA 1KO7A 1D2MA 1QHHA 4QOSA 1RE0A 2VHUA 3NDBB 4AURA 1G3QA 4FN5A 4LV6A 4LV5B 2HT1A 1UJ2A 5LPNA 5JEEA 2OAQ1 2BCJQ 3HWSA 4BZQA 4RJLA 2O8CA 3CPJB 2JLVA 3PITA 3C16C 4LJ7A 2AL7A 4EAQA 2QGNA 4Z8XA 1E2HA 3RC3A 5ELXA 4NKRA 4RD2A 4TN1A 4Q9IA 4F4IA 3CRQA 3W5JA 1A82A 4BE7B 3P32A 5JRZA 3AM1A 1VYUA 3I61A 1WCV1 2G83A 4OQNA 1COWD 2CJWA 1RKBA 2UKDA 2ZEJA 2QUZA 1L4YA 4I1SA 5AJYA 1II8B 4ZI2A 1KJWA 4B47A 2VHQA 1OIVA 2HF9A 4LBWA 4Q1BA 4JLOA 2DHRA 5JJLA 2WZQA 4JLDA 2I1QA 3VNUA 2V54A 3VFDA 3LBHA 4TQAA 4ACBA 4JMPA 1XPUA 1Z3IX 4BFZA 4EDHA 2DY1A 3BB4A 3GJ7A 1P5ZB 1XTKA 4Q4JB 1XPRA 4QG7A 1Q1EA 2HXYA 1XMSA 2NGRA 2Q9AA 1Q57A 4CT5A 2RKOA 2Q9CA 4PO9A 4JBXA 2IXFA 2OILA 1LFDB 4B3XA 1MKYA 1QHNA 1P9WA 3NVAA 2H1LA 3PVSA 3P1JA 1HA3A 1D6JA 3KUDA 4V0OA 2PBRA 1QF9A 3HU3A 4AG6A 4B43A 3UMSA 2EFHB 2DWOA 4PFSA 2JLYA 3C8UA 3HU1A 3WBJA 1N3BA 1HE1C 3PFIA 2ZR9A 3HYTA 3CNOA 4JVSB 4DEYA 2AD5A 3K0SA 1P7CA 1Z0DA 2JJ1D 3OIYA 1E2JA 2RGCA 5G41A 1XTIA 3RRNA 1P2UA 1R0YA 4PHGA 1HEIA 3HR7A 1UBCA 4QBHA 4TLDA 3AP2A 2ZS8A 2YC4C 4FMDB 1XXHE 1HH4A 2QTFA 2BBWA 2DFTA 1S3GA 1XPOA 3QJYA 5KUTA 5KYKA 3MD0A 3L0IB 1YZNA 2P3SA 2KSQA 2ZAOA 3H4MA 3U7HB 4PC2A 1CU1A 2BKEA 3P26A 2VRWA 3KJHA 1G7TA 3A1SA 4M53A 1YJ5A 4M1OA 5SZIA 2RGXA 3SHWA 2O0HA 1NLYA 4BEJA 3UXMA 4JZKA 3TBKA 1M7GA 4X8MA 3TW4A 4A8JB 3PUWA 2ZI5A 4FWIB 4QHYA 5C4MA 4HLUA 3MMPA 4CGZA 2JATA 2EYQA 4JS0A 3L0SA 4P32A 3BERA 4HI0E 3PXGA 3SHFA 3TIFA 4DSTA 3KTAA 1GKIA 2ANCA 4ZIRA 1G18A 1Z07A 4Q4HA 4AI6A 5AUQA 1M7HA 3KL4A 4A36A 2JA1A 4I1VA 1G8FA 1KI8A 2WHXA 4B2IA 1KI7A 3UIEA 4LJ5A 5JBQA 5HE9A 1VCIA 3OAAD 3EC1A 5EE3A 3Q5DA 4B34A 4OI0A 3QKTA 4R9UC 4C0LA 4D4LA 5FR1A 2ZE8A 1ZNYA 2EFCB 2PZFA 2ZUCA 1CULC 4NTZA 2FDCA 2VQSA 4W7SA 3VMFA 1KYIA 5IT5A 1XD8A 2PLFA 1FMJA 1F2UA 1Z0KA 3HPRA 5DIFA 4A4DA 4DIEA 1MRNA 4MRNA 1CR1A 2OCAA 2QEQA 1CP2A 1SQ5A 2OV2A 4JT4A 5FI1B 1E1QD 3THOA 1F6BA 2F3RA 1VIYA 1RJ9B 2CNWA 2XGJA 1IJFA 4PTLA 3NKVA 1KIMA 4GDFA 3ZVMA 4GNKA 2GAAA 1KJYA 3EG5A 3B60A 3VAAA 2OE2A 2G1JA 4UKDA 1UAAA 3TSWA 4D2IA 3AVUA 2HT6A 1SXJA 4XH9B 1AZSC 2JJ8A 2QE7A 1DS6A 2REOA 3K0AB 4IXNA 4AYXA 4UJ5A 4L9WA 4DLYA 1ZM2A 5AUNB 2GAOA 1NRJB 5J5CA 3RS5A 3QG5A 1S9DA 4L4UA 1GWNA 5DGXA 2YYZA 1XEXA 4QBGB 4BRWA 3KB1A 1PLJA 2JAQA 3NBFA 4H9GA 2JIZA 4KITB 2FEOA 3NXSA 4DC9A 3B5JA 721PA 3AH8A 3BWDD 1N25A 221PA 3I62A 2IUUA 3W8NA 3AQ4A 2Z4SA 4LSGA 2WJJA 2JASA 4KLZA 3NHAA 2DWPA 3PUXA 2R2AA 1GSIA 1ELOA 1G1MA 3RYTC 3CM0A 4IVPA 2CCJA 5H1YA 3UK6A 1PVOA 2XNSA 1AQYA 4Q01A 2X8AA 2GJSA 5JFGA 1E79A 1IOZA 1XMIA 1MR3F 1SVKA 4HYYA 1Z2CA 1U2RA 4URXR 5EXPA 3EZ6A 1K8RA 1X8JA 3TQFA 4D4MA 5EJEA 1WMSA 1WXQA 5AUPB 3W6OA 1IHUA 2C9YA 4RZ2A 2QNRA 2ZXUA 1DELA 3SNHA 2ZS7A 2CHVA 1U0LA 2IS4A 3DZ8A 5HZKA 2F43B 1NVXQ 2HXSA 4RSGA 4QGFA 5UKDA 4G5OA 1H8ED 3BFXA 1Q22A 1ZAKA 4PPQA 4ON9A 1CRQA 4PZLA 4AIIA 1FTNA 5DN6A 2IYQA 4MH0R 1DADA 1P62B 3TUIC 3SR0A 3MCAA 3GLHA 4DLWA 1DG3A 1U8ZA 2O8BA 1GOTA 1KK0A 1UKVY 4QJ3A 2BMEA 2IYTA 2JJ1A 3AUXA 4LYAA 4B48A 1GRRA 4BFWA 1OYWA 2WOOA 4A0RA 1XTRA 3ZH9B 3OEHA 1KDPA 3I3SR 2FSFA 3F0TA 4MKIA 2ODWA 4ZDWA 4JJKA 1QHGA 3IGFA 4FD2A 2WWGA 4HUQA 2GZAA 3FE2A 3UG6A 1TQ2A 2Z43A 1R0ZA 1X1RA 3PENA 1T6NA 5TY0A 4US0R 2WTUA 4Z8YA 2HCJB 3O8BA 1E2PA 2UZ3A 4US2R 1LF0A 2F9MA 4MA4A 1YR9A 2ODBA 4QJ5A 2R6DA 4Q1DA 5E7MA 1TX4B 1XEFA 4O2LA 1T3HA 2XX3A 4ARZA 1R10A 5K8IA 3D6TB 1D9XA 2ZRFA 3GLIB 1E2QA 2IWHA 1QDEA 4NE2A 4IVRA 1DO0A 1U0HC 1Z6TA 1W49A 5IDVA 4EUNA 2WKQA 1XJ0A 1T5IA 1ZMXA 1V43A 3U44A 1OPXA 2FNAA 1MABA 4JLAA 1EXMA 3THWA 2VLIA 1OYYA 4Q18A 1IY1A 4YXWD 1SULA 3O8RA 2DB3A 1OH7A 4R71A 1VYVA 1L8QA 3OE7D 3OAAA 5L3QB 4Q4LA 2NO7A 4HAWA 2XXAB 3UG7A 4MKFA 3KKPA 4JSYA 4G5GA 5KDDA 1GVNB 4KVAA 4RD4A 2GEDA 1AQUA 1QG2A 2GESA 1UEJA 2DR3A 5CLQA 2YV5A 1ESNA 2W6IA 1E1QA 3QF4A 1ZRHA 4NYMQ 3SYLA 2FFAA 4KAXA 4DXAA 5CM8B 3OEEA 4DCTA 3B9PA 4XWKA 2ZREA 2WPDA 1GAJA 4G01B 2Q6TA 1U81A 1VDZA 3LWNA 1OH8A 4TWZA 2PT7A 3ZIAA 1KKMA 3X1ZA 2I1VB 1N0WA 3NG1A 4I4LA 2ZR7A 5L3VA 1QRAA 1CBUA 1EX6A 2ZUBA 2CCGA 4C2UA 1CR2A 4FWTA 1NN3A 3OIUA 3SE0A 3HR8A 4PSKA 3W34A 5FTMA 4TL6A 3WNDA 1J7KA 5AJWA 3UWKA 5A4JA 3X1YA 5JSZB 1OE0A 2UVQA 2Q9BA 4RD3A 3GFOA 3BFKA 1MRSA 3F8TA 1N0VC 1Q1QA 4HAXA 2AWNA 4C0JA 3KB2A 1GL7A 2OBLA 1NMXA 3DVLA 2P6RA 5CLLA 1DOAA 2X19A 4XVQA 3C5CA 3AVTA 3T35A 1Y3AA 3QKRA 3W3AA 4CEHA 2FWRA 3EASA 4TTRA 4DSOA 4HAZA 1TTTA 2XTZA 2XTMA 5A5GA 2WJGA 2RGGA 4HEJA 1P2TA 2J7PA 1CJMA 4A2WA 1KJZA 3FFAA 4TL9A 1P9NA 1F5NA 3RS7A 4Q66C 1W46A 2ERYA 5EP1A 3RS0A 2J1LA 2BM0A 3BH7A 4ZCMA 2WSSA 2N42A 1I4LD 3QSYA 1EK0A 2OCBA 1E3MA 1G3MA 5J4YA 2WICA 1E9FA 1G21E 1G8PA 2PLRA 3B1WA 4RFSA 4HB2A 2IEZA 4XTRA 1G5PA 4AC9A 1CTQA 1U9IA 5FPTA 2W83A 2JLUA 1X1SA 4Q1AA 1U0JA 3H84A 2O8DB 3QY0A 2G6BA 1OT3A 4WA7A 1LS6A 4JLPA 5FOWA 3QOFA 1E2KA 5TMPA 3T1VA 3KQHA 4HB0A 3X2SA 1YZUA 2FPMA 3RHFA 2CE2X 5FR2A 3FB4A 1NVUQ 1AA9A 2NO9A 2WKPA 2QTVB 4LCBA 3SJAA 3W9YA 2GDJA 3SJBA 4BRUA 5C1BA 1ZCAA 4S35A 1DG1G 2WBLC 3Q9LA 4HDCA 5DI9A 4B73A 3AVYA 2BM1A 4QM6A 3WP1B 2I4IA 1H8HA 1BH2A 4DCVA 2JLSA 4B6EA 3GFTA 3KDSE 4XOIA 2VA8A 2C9CA 3EW9A 2BWJA 3ADCA 2O0KA 2BC9A 5CITA 2Q21A 5K8TA 4IKEA 1YR7A 1ZU4A 1PZNA 3FKSA 3GEEA 4Q9JA 1L2TA 2G0NA 1AM4D 3LQQA 3SBDA 4TL7A 4B3DA 2ZJYA 5HKKD 2W2XA 1BMFA 5FOSA 1E9RA 1NY6A 1ZM3A 1US8A 1TUIA 3AGQA 2C04A 3EZ7A 2QBYB 2CVFA 1RVDA 3GJ4A 2VP6A 2QPAA 1FX0B 1NVVR 2EW1A 1FQKA 2B8TA 1XEWY 4IHQA 4KV9A 4DT1A 1E99A 4ZO4A 4YLGA 3NEYA 3BXZA 4JLVA 5FBVB 4EPTA 1XCGB 3B1VA 1SHKA 1SXJE 2QPOA 1IN8A 1E2DA 2AK3A 1KAGA 3NIBA 5DISB 1FUUA 4DLXA 5H8WA 2FF7A 2FPLA 3GJ0A 4AKGA 4LOAA 3GLGA 4FMDF 3EIHA 2ZRCA 5SZHB 1KSFX 4JL5A 3LNCA 3I32A 3VU9A 1VKJA 4A0HA 3HYRA 4ZDJA 1KI6A 4HAUA 2QAJA 3Q5EA 4ERNA 2FMXA 5EZ6B 2GCOB 3TE6A 1W36C 2BDTA 2FG5A 1ZUHA 4X8HA 1NG9A 4QGAA 2CL0X 1JR6A 4D81A 3S1AB 2QM8A 3FMPB 4HZUB 1TADA 1EGAA 2P6NA 4EJSA 2J0VA 2QMOA 4BLPA 4WXPA 3GCGA 2CDNA 2CLCX 2CK3A 1LW7A 1ZC3A 3HDTA 1EFTA 2LKDA 4GOKA 4FCWA 2QQEA 1E2NA 3MJRA 2R9VA 2YHSA 3NC0C 1VECA 4BLQA 2FSIA 1GDDA 1OXUA 2QTHA 4KYIB 4CEJA 1G3RA 4NCHA 2J5XA 5AJZA 5KSPA 2RGNA 3UPUA 1XCPA 2GHIA 5HCIA 3IILA 4LJ6A 3BAFA 4LJYA 3O8DA 3WMFA 4B3CA 2REXB 3AUYA 4EPXA 3GLHE 1Z29A 4F4JA 3QKSA 2ZI6A 1SXJC 4LYJA 4AK9A 1II8A 4JLJA 2IS2A 4LJ9A 2ZJ8A 2XB4A 4DLZA 4ASUA 3EPKA 3TGPA 3RABA 1YR6A 2GXAA 4PHFA 1E2GA 3LLUA 3C4JA 4DVGA 2A5YB 1NLFA 3EAQA 3LW8A 3ZQJA 1G291 3W5IA 3ZZUA 4ZDIA 5BWMA 2YKGA 1YZTA 2XZLA 3CH4B 3EIEA 2ATVA 4D26A 1OHHA 4BFYA 4IDOA 5TDHA 3IO5A 2C95A 4YDHB 2G1KA 2SHKA 4GL2A 2DCUA 2ODEA 4B3FX 1LF5A 1NP6A 2RGAA 2VF7A 2X77A 3QNUA 4HB3A 3VR5A 3WHLA 2WWIA 4PO1A 1E6CA 4B44A 5GADl 4WZ6A 4FCTA 4OYHA 1IY2A 4PQRA 4D82A 1U98A 2DYKA 2Z83A 3IHWA 3GLFB 4O2RA 1UKZA 1DAKA 1RZ3A 2QU8A 2QQ0A 4MGIR 2QAGC 1YVDA 3I72A 4WIAA 1GNRA 1W36D 1JI0A 4OJQA 1SVIA 1R5OA 2HLDA 5J4LA 1WQ1R 1W4CA 3MGCA 2ODNA 3R9IA 2YNMA 1FOEB 1KK2A 1KI2A 3LXXA 4KFUA 3GEHA 5KDLA 4OK5A 1NY5A 3AF0A 2NZ8A 4JVMA 1NNEA 3K0CA 2C8VA 3VR6A 2PZEA 2CXXA 4MRVA 2GJAA 3CX6A 4N0DA 3FHTA 1J90A 2R6GA 3RRYA 1RIFA 1GUAA 3TW8B 1DE0A 3W3ZB 4TYYA 4NYIQ 1NN1A 3KJGA 2HV8A 4IDHA 3MRSA 2CNWD 4B3BA 2I3BA 2H92A 2MSCB 2NOAA 3LXRA 3MWYW 4LJ8A 1A4RA 2OUKA 5LBIA 5KNCA 3ZD7A 5FTKA 1AZTA 3SOPA 1P73A 1Q21A 1SXJD 4Z1MA 1DO2A 3DMNA 3KKQA 3TAHA 4CYMA 2PMKA 2QE7D 3NBXX 4IDQA 1N5LA 4KFRA 2ERXA 4XVRA 2RHMA 3L82B 2IYXA 4TLEA 2Z6VA 1ZC4A 2R6AA 2ORWA 4Q19A 2ZRHA 4M1KA 4Q03A 1ZCBA 2ZETA 3KQUA 4I99A 5EE5B 1OH6A 2WJIA 4MDFA 2JIZD 4B3GA 1RW4A 3FHCB 3LBIA 3U2QA 4KYUA 4QXAA 5FI0B 3AKYA 1JPJA 1FUKA 3AF2A 2CMKA 4EPYA 1EFUA 2VP4A 2ZSAA 3CWQA 4BLSA 4LV8B 5CK4A 1D5CA 1DAEA 2J0UB 2GJKA 3IO3A 4LGMA 4C30A 4B35A 2QP4A 1RJ9A 4PZZA 4DDUA 1E9BA 5B64A 1E79D 1WRBA 3KQNA 2RCNA 2ONJA 4KSCA 1G41A 3LDAA 3LVRE 4POAA 2ZRDA 5DE3A 3CB4A 3FMIA 5JZVA 4G5SA 2ZYWX 3QPUA 4GFDA 5CIQA 4C0SA 1P75A 3U6BA 3VKWA 1DAHA 4A2QA 1W4RA 2OBNA 2EU8A 3BC1A 1TMKA 2Q3FA 4D4KA 1RFLA 1XDBA 4NH0A 2BBSA 821PA 2OLJA 1KGDA 1GKUB 4CRWB 1XD9A 4MQBA 1KY2A 5JHHB 2LWIA 3SI7A 2QT1A 1K5DA 1GITA 3LX5A 1VCMA 3CPEA 3SJZA 1A2KC 1ZM7A 3WYAA 2OM2A 5EZ5A 5DN6D 3V9PA 3K9GA 1Z2AA 3MLEA 4PPGA 3RDPA 2R8RA 2ZJBA 3U61B 4L8GA 4DDVA 1CF4A 3ZZTA 3E70C 4TZ6A 3AF3A 1MH1A 3U7EB 2HUPA 2QMEA 2WMOB 3NTUA 2NG1A 1KO8A 2EVWX 1KOFA 3CX7A 3QUSA 4QGHA 1CJVC 3OEHD 1E2MA 2BMFA 1KZ7B 4P0TA 3O47A 1XD2A 2XJ9A 1ZNWA 5LB4A 3GPLA 5C4GB 1XNJA 4YQFA 5KNDA 3QEOA 3RRMA 8OHMA 2WAXA 4CIDA 3I5XA 3SQXA 2YOGA 4KSBA 3M0EA 3R9WA 3TNFA 1TNDA 1YE8A 4M9ZA 5E3HA 2V3CC 2P5SA 4LDJA 1TF2A 2P0EA 5G53C 2LCFA 4I81A 5J4HA 1S0UA 5HTKA 2RMKA 3SBEA 2BCGY 3T34A 5GJBA 2PJRA 1KKLA 3H2YA 3M1IA 2WVJA 4QBFA 3TSOA 2VH5R 3QF7A 1E0SA 1W48A 1U8YA 3IPYA 3CRRA 1HV8A 2AKAB 3WY9A 1KZGB 2J3EA 3Q72A 2BIFA 4LC0A 3PR1A 4A0FA 1PLLA 5SZJA 1AKYA 1DEKA 3MG9A 4TMZA 4C0KA 2ZI4A 4GOJA 4RZXA 2FGJA 3H1TA 3QBVA 1S1MA 3VTKA 3DPUA 2CL6X 1IY0A 1NJFA 1FTSA 1P9RA 5L3SB 3N2EA 3UKDA 2IYRA 5FOUA 1I2MA 2O8EB 4DKXA 1FNNA 1W47A 4E5UA 1II9A 1X6VA 2XZPA 2OO7A 2GF9A 3OIVA 4OJKA 2QORA 3CR7A 4BFTA 4IOMA 1YKSA 2VTKA 5K8UA 1XU4A 2IS1A 1F2TB 1TF7A 4BUJA 3GLGE 1GNQA 1U9IC 5EE1A 3SN6A 1QHHB 1PLKA 2GCNA 1P4SA 5JHGB 2B7CA 1OFTA 4Q7KA 4QHSA 2BEJA 5CYPA 1EWRA 2VO1A 2W6ID 2YWFA 2F1HA 1W0JA 2QRZA 3GJ8A 4GMXA 3GFPA 2O8FB 4Q5IA 1DPFA 4C7OB 2FA9A 2ORIA 1WBDA 5AWFC 1NN0A 3OEED 3LBNA 4B2PA 4TYPA 5JI2E 2WPDD 2ZSBA 5B2ZA 2FZLA 3KFVA 1ZNXA 2E1RA 1N6LA 4F7WA 4TZ0A 4FMBB 1N6OA 4BPBA 2C96A 3SZRA 2BVNA 2OCPA 3L2OB 3ZIAD 4A1FA 2CL7X 4N1AA 3T15A 3NWJA 3M6AA 1HTWA 4MGYR 4IW3B 1Q1BA 5L3QA 4RY2A 1CR4A 1I4DD 4M9QA 3AP3A 1UM8A 3BH0A 3PUZA 5TB5A 2ZE7A 4WXRA 4B75A 5G3YA 5JLJA 5G40A 3QXHA 2ZIAA 2V6IA 2AK2A 3KKNA 2ZAMA 4TMKA 4Y0VA 2XXAA 1SVLA 4TYQA 4L5BA 4AKIA 5DYGA 1SKYB 2F3TA 1OXVA 1NN5A 5D3MB 4OQMA 4M1SA 1VG8A 1PV4A 4M2LA 3R7WB 3DEFA 1SVWA 4NCIA 3OF5A 1CIPA 2OBMA 2XB2A 4Q00A 1W5SA 2TMKA 4HZIA 4Q1CA 2PH1A 1UDWA 2QAGA 4ABYA 1Q0UA 3CRW1 4UNNA 2HJVA 4GBMA 1PJRA 2A5FA 1HYQA 2VPPA 4GT1A 3ASYA 2J7PD 2NZJA 4MKGA 2W58A 3QEJA 3QBTA 2A78A 1JBKA 1YRAA 2VF8A 3WNCA 3KXKA 1TU4A 2CHGA 4JYBA 1YZKA 1SKQA 2L0XA 3E2IA 1E98A 2WSSD 3THXB 5EXXA 1P60A 2DFNA 2HF8A 3ADKA 2ZSDA 4UXJA 2QRNA 1HQCA 2BKUA 2H57A 5GVRA 1X86B 4ACAA 1C9KA 3HPQA 1IM2A 3QE0A 1BYIA 3A37A 1LS1A 3Q7PA 5F98A 5DH9A 5BQ5A 4BFSA 3AVPA 3KZ1E 1FPMA 4P31A 3T5DA 1G64A 3T06B 4V0KA 4LBZA 1G3UA 4BZPA 4XWAA 1T3SA 1N5IA 2IA5A 3Q7QA 3UATA 4UQOA 2WWYA 4URUR 2ZRNA 5FOXA 3X1XA 2OT3B 4LZZA 2VHJA 4OL0A 5B30A 3U7GA 3NC1C 4DJTA 4ZV4A 4EJSC 2OCYC 3N5CA 1FW6A 1XCMA 1W0KA 3MWLA 3SYNA 2CHQA 3SS8A 2H7VA 3R9XA 1IN7A 3ZVRA 1H8HD 2W6JA 4FCVA 1RRGA 5DSZA 1M74A 4HDQB 3NHBA 4LYFA 2ZUDA 5H70A 1S1CA 1KAOA 3FPAA 2QT0A 4C3ZA 4C9BA 5BN4A 2X2FA 3EIQA 4NYMR 4BEBA 4ZIRB 5E95A 4A92A 1QHSA 4Q4HB 3FKSD 1TU3A 1QHYA 1AIPA 1HT2E 4DCSA 1IAQA 2RGNC 1WBBA 4RZ3A 1M8PA 3I92A 4B71A 1BMFD 4RD1A 1DAIA 5A0FA 4M9SA 2O8DA 1J8MF 4GP7A 5EE0A 1NF3A 3TLXA 5EXSA 3FGNA 1ZM9A 4HB4A 2R44A 2RGEA 5DNYB 4QGGA 3EZ9A 1HUQA 1UBGA 1IXRC 1R8SA 1S3SA 5ANRB 5J40A 3RLFA 3BIFA 1Z0JA 2WJVA 3I1FA 1XMJA
chains in the Genus database with same CATH superfamily
3ENZA 1EE2A 3JVVA 4WPGA 4A5OA 3KXLA 3PHLA 4MDHA 5BR4A 2ALJA 5KKCA 1KBOA 4DW8A 1XA0A 3GAMA 1KJIA 4M21A 4LYHA 1T0HB 1GADO 1PGQA 1Y9AA 3WRXC 2PJZA 5E6SB 4L6CA 4YMSA 3MHPA 4OUDA 4PG8A 3L8YA 3FGZA 1C8LA 4WZAB 1Q16A 5ALOA 2DWCA 2OFWA 2ZIXA 3I2JA 5FUWA 5MFPA 1P9OA 1ITZA 4S1TA 2WDZA 4M0DA 4RKEA 4RD0A 1BFUA 4QHTA 4UE2A 3JYOA 4Z53A 4DQDA 4DJDC 4L57A 4LX0A 2ENUA 2O23A 1E96A 4PX9A 4OHZA 2P91A 2A7QA 1ADFA 4HH1A 4LYYA 4CV0A 1V7CA 5EE9A 3LKDA 3UQZA 1L4HA 1GAEO 5FTNA 3TD6A 4CFSA 2RAFA 4HZGA 1OLSA 4H7IA 2D4HA 4CKYA 1CLUA 2YNMC 3CO5A 3KKZA 3P20A 3SQDA 3H5RA 5CNKA 5P21A 5TQJA 4WOPA 2C2WA 5DX8A 4BY9E 1AJEA 1ID1A 5F4BA 1Q2XA 1T43A 5K4GA 4L2IB 3GD5A 3SC2A 4M6WB 3K8QA 3ZY3A 4F2DA 1RZVA 3V3KA 5DCUA 1SCAA 3UWOA 2H65A 1KH3A 2ZPTX 4IDEA 1JWBB 3INTA 4Q39A 2WJAA 4YRGA 4GO1A 1JJIA 4NATA 3D5EA 4WKOA 1YI0A 4QL3A 3RS9A 4LXUA 1NAHA 1FBTA 1FPQA 1PQWA 1B2LA 2W2KB 4D8YA 3WLHA 2RHDA 2YVQA 2P62A 1FSSA 3AHDA 1IJEA 2C9BA 5HPYB 4D43A 5TQ2B 1LY1A 3OJ0A 5G0UA 1KOJA 4RKYA 2Q8QA 3A9VA 3JAWA 4NS1A 1Y9DA 4JXZA 5LXTB 3H1EA 1C81A 1H2EA 4GMGA 2IK8A 1U80A 2DCMA 3U3KA 1SKBA 2M6SA 3HRHA 4B7AA 2GCEA 3A4NA 1NLUA 2RH9B 1ESCA 4Q9KA 3WL3A 3BQ9A 4ASUD 3E3OA 4QU9A 2IOFK 3CF4A 1PRYA 1YIAA 1WCIA 3F9CA 1VJRA 1N5OX 1SXGA 2QYTA 2PGAA 3QPDA 5HIIA 3H87A 4DXDA 1B2RA 2H5IA 1F60A 1NQUA 2K5UA 2Z2ZA 3PGLA 3BE4A 4IMIB 1HWYA 4OOFA 3LECA 5EXEA 5A0VA 4Z7OB 4MV7A 2HD4A 3OA0A 4TRNA 1QRTA 3GT0A 4GP6A 1XQWA 5A9TA 2ID7A 4YIKA 1YS9A 3BXEA 3U56A 3PIIA 5IHPA 1K7EB 3SVZA 1LU9A 1HPLA 1N2CB 3BMOA 1SZPA 2OP1A 2GNOA 3ZGLA 1E4OA 5TX7A 3FUCA 1YH3A 2X2EA 3HNRA 2OHFA 2JK1A 3EF0A 4UDNA 4ZVRA 4AJLA 4WWHA 3GRUA 2YFQA 1K6MA 2WF9A 3U3JA 5KTOA 1IBCA 1I94B 4O0MA 4F71A 4UM9D 1IPFA 1G0NA 1JXOA 2C1XA 2X3UA 4D9BA 1THZA 2QD1A 2QQFA 4M9XA 1U0SY 1KIFA 1NDHA 1ZK2A 2JGJA 4KGXA 4AO7A 5IUJC 4POOA 1NWHA 2H3EA 3C4QA 3T4PA 2KI5A 1HSZA 1TGYA 4MPPA 4QNRA 5T7BA 4TTSA 4FFSA 2YJ3A 1B4DA 5FL3A 4OHYA 4FWBA 2FPIA 3EZNA 2WSIA 1K27A 2VJPA 3ETEA 4U5XA 4TS1A 1V37A 3KIPA 2PKEA 5I8WA 4EQZA 1PT9A 5CDHA 3G7NA 2PRIA 2QWXA 3GO4A 4B4WA 1WUHS 1N7HA 4NH4A 3OESA 3T5AA 4JL6A 3T54A 1Q44A 2HHLA 1T1SA 2JAPA 6ADHA 4RH0A 4AY2A 3AV3A 5B7GA 3M6WA 3ZY4A 1YDGA 2W8BA 5IARA 4CL2A 2O7NA 3MF4A 2P9CA 3QXJA 3ZK8A 1T0UA 1VJDA 2VCYA 2C82A 1KFBB 2GILA 3VISA 5IZCC 1XEWX 3KOOA 2MWMA 2AMFA 3VNAA 3CHYA 1O7JA 1QH9A 1O08A 1BXRA 1SC1A 4RHUA 2CLLB 1BEUB 1S2OA 3WIBA 1A1VA 5LWHA 3FDIA 3U17A 1W2GA 1Z8HA 5KPDA 3E27A 5CVJA 2X4DA 5KNCD 4YPVA 5LQKA 4PG5A 1IN6A 5F3WB 4GPIB 3UHFA 3OY7A 3NHPA 4HWPA 4IFIA 1UBEA 2FWJA 3FUTA 2XJ4A 4ZCQA 1Z0FA 4BKMA 3Q10A 5FT9A 2Q6LA 1KVSA 4RK0A 4F86A 1UC8A 1IH8A 1OXSC 3EPLA 1ZXXA 2FHSA 2K87A 4MVJE 3F47A 3T8YA 3C7CB 2G9VA 3TLJA 4CEIB 1FFEA 2FXVA 1M7BA 1KTIA 1AS3A 1EEXB 3N2GB 5D8DA 3SYKA 1A9YA 1TJ5A 1VLVA 2XA2A 4UCFA 3ZWYA 3N70A 1EFPA 2VZLA 4DYDA 1NJ8A 4OX9B 1A4UA 4M0EA 1NUAA 2A9FA 3L3BA 3NOOA 4PZ0A 3TLZA 1QRSA 4GKJB 2IT1A 1TW3A 4OIFA 3N1UA 3MAAC 4MTCA 4QFDA 4XJVA 3WYDA 2EJBA 3WOVA 1NM5A 1GIAA 2WU0A 3MB5A 3SMQA 1QX3A 1X7ZA 4MO2A 2LTAA 2JDIA 2VJDA 3TZCA 3B6KA 4IHJB 2N1BA 3S2FA 2JKVA 3N59A 1GRNA 4P0QB 3LKVA 2IYEA 4EB6A 3OZXA 1MENA 4CKCB 2BRUC 1E2EA 3DV2A 3OO1A 3KDAA 3QLVA 3NEJA 4ENUA 3KQLA 5C81A 1N5RA 2NO1A 5LKAA 1T9GS 4X3PA 3OZEA 4NQZA 1ADYA 2YWGA 5AKEA 3V42A 1DFGA 3ZWXA 4QUAA 4W6ZA 4L02A 3R4CA 2EWMA 2G9QA 3EC2A 3QVKA 3VKHA 1H2WA 5E0KB 1PHRA 3RBZA 3EPRA 3TNLA 2G8LA 2JGMA 3JWHA 1NIPA 1YFKA 3DP9A 5E1MA 3QKRB 4YAOA 1XXLA 3E3AA 4Y30A 3TVDA 2A86A 1D2CA 3WLNA 2CN1A 4ZO7A 3RYCA 1RXSA 1UMDA 3H9UA 2P9JA 2V59A 1Q1ZA 3F3YA 2W0MA 1EWYA 3JQPA 2O7QA 1YASA 4LWQA 2GAJA 3ANNA 4HYEA 4ZOLF 1HURA 5D5HA 1WL8A 3T38A 3QELA 4BGIA 1YDMA 3M2TA 1Z4KA 4MWSA 5AJVB 4XVUA 1SB9A 2EP8A 4M76B 1OB2A 3HGTA 2GRUA 3FNHA 4W5JA 1QBGA 5ADHA 1CUGA 2PBZA 1CS0A 1VFPA 5B36A 1PZXA 4Q1FA 2I4LA 2ET6A 4NSNA 2WSMA 3NRBA 4TTJA 4W7HA 5F1KA 4UVHA 3D3NA 4CKZA 3HJHA 3SHOA 3DD5A 3IXMA 3VPFA 5CT8A 1F8XA 2LR0A 4PPFA 3BTVA 2AI2A 3IKJA 3R8CA 2DPHA 5M2QA 4ZYYA 1DAFA 4P2GA 4Q3AA 4F45A 3PCRB 4LE0A 5CA1F 1D4FA 3VHXB 4B6JA 4F5EA 4BXOB 1KDOA 3N87A 1J2JA 2QVZX 4OSPA 3KQMA 4C7KA 3AKEA 3K2IA 1NXWA 3C7KA 3P5SA 5K2MA 1R8JA 3WGUA 4D9FA 3V8NA 3PNVA 3PF9A 1VHLA 2BKAA 1B1AA 1KEPA 3DMRA 1Z26A 2K6GA 5D5QA 5ILOA 3OCJA 2VRBA 4MV6A 3TL6A 3ZWWA 3MUFA 4DQLA 2VTBA 1R0CA 1DAPA 5GM1A 1USKA 4Q9HA 1N6PA 5EP4A 3T3PB 1Q1NA 1WPRA 2NVWA 5KB3A 3F71A 3AZPA 3TZQA 1FJ2A 1VFNA 2VC2B 4DYHA 4TT3A 1C1DB 2WABA 3COVA 4M1QA 4OSOA 5GV7A 4Z3KA 4DLTA 1W4BA 3K1YA 4YRRA 5KAPA 1POXA 3A1VA 4PZDA 1G6OA 1F8YA 3FAKA 3VR2A 4CM7A 4B45A 2G76A 2OHJA 2QMYA 3AKZA 1OA0A 1RWMA 3DWIA 2QVBA 2PU7A 5LQDA 3K09A 4FYIA 1VLQA 4EZIA 2VYVA 2A9VA 2O0JA 4CLHA 1GG5A 1D04A 4MYTA 2WUWE 1NFFA 1V4NA 1DEOA 4JP1A 1IRXA 2ZJ2A 4AN0A 1MH9A 4JOBA 2P0AA 5JS7A 3V1LA 4D5EA 1JXQA 5IXSA 2H3HA 1EX1A 1HY3A 1Z22A 1NJGA 5DHFA 2CBXA 3S8MA 2ZWAA 4C88A 2P5TB 4KUEA 2HBZA 3EHDA 3TD2A 5LLTA 5LCXA 1O9HA 5LQJA 1I01A 1XK7A 2N9UA 3C1AA 4DR1B 3M4NA 2D1QA 1SHLA 4P81A 1E1MA 4AJHA 3AHFA 7REQA 4CQJA 1PJ4A 1EG7A 2PSHA 3FBWA 5FIUA 4PLZA 5FFFA 4DNFA 2QUHA 4P4TA 2C61A 5I9LA 3GIDA 3WGNA 4OXKA 2C07A 4YRZA 3G5LA 2Q0SA 1VSTA 4GPEA 4JBIA 5K3CA 3VYVA 4EY7A 4EW1A 5I9SA 3DL4A 5IN4A 3GLVA 2AUTA 2VDVE 2CXQA 1T3TA 3GB9A 5E9QA 3PWKA 3S1SA 3NYIA 3B51X 3QVLA 2WAAA 1NF2A 4MVJD 1MB4A 1CR0A 1R5BA 4ZAXA 3UWPA 4RPCA 4YYEA 4DJAA 5FTLA 4W63A 1JT2A 2F1OA 4D0NA 4E14A 2O8EA 2NO4A 1NX6A 1PJ2A 1GFIA 1X8LA 1LPBB 2CDAA 2YJGA 1DIBA 1RI3A 1CHNA 4R83A 4CMEC 2P65A 3T5PA 3EC7A 3SS9X 1OYOA 1FLAA 4QSMA 1ISJA 2PGJA 2ZE5A 1GQFA 3N8NA 1F2TA 2J0QA 3CF4G 4EL0A 4U7DA 3V9AA 3MQ4A 3VC1A 3UUWA 4JP2A 2RHRA 4NE7A 1VPWA 4EJSB 2REQA 1PGNA 3QYJA 1UEIA 2HIGA 3I52A 3PG5A 4MR9A 4QNMA 3K1TA 4R8VA 5SICE 2YFHA 1NATA 1UFQA 4OK3A 4OI1A 5I9TA 4IFTA 1Z0AA 3LIIA 4G6ZA 2RD2A 3RC9A 2JFWA 3PQEA 2C58A 4FYPA 4G89A 1YK0A 5JAZA 2ZROA 5CXXA 1RRCA 2ID9A 1YDFA 1HTTA 4P4GA 2BHSA 4IIGA 1YU6A 4HATA 2YCBA 2HPVA 5C9ZA 1L7XA 4U9HS 4CG1A 3V7FA 5JY1A 1N8NA 2IHKA 1IBRA 3PD0A 1G63A 2GBLA 2X86A 4D5GA 2FK8A 4RUKA 1TMGE 4M0CA 2A35A 3D3KA 3KT8A 2NMVA 3QKSB 3N74A 2ZTLA 5EWLA 4CG3A 5J59A 4E6PA 2B21A 3PHHA 5FBWB 1JDPA 1BIFA 1FP2A 2BMAA 2GTHA 2H4JA 2QPTA 2A9OA 4TKVB 3JRWA 5TPWA 2FG7C 2OK7A 3V2UA 2R6HA 3PBKA 1S8FA 5EZYB 3FB1A 4TS4A 3EZLA 1TI7A 3FTEA 3L8ZA 2FSUA 3UOWA 3R7WA 1H22A 3PYLA 2Y0DA 5HJEA 5JQGF 2JIBA 1FTGA 1ZSNA 3R8FA 1G8GA 1EVQA 1USIA 1VG9B 1YD7A 2WSBA 4Q7QA 3BJIC 1PZHA 2GHTA 3AWIA 3DFZA 3GVCA 4MUGA 4U2FA 4W8HA 3UH0A 4BO9A 4KXFB 2Q6OA 3D31A 3DAPA 3OECA 5IAEA 5JJ5A 3OQHA 3GMSA 3OC6A 5LC1A 3NWOA 1QIGA 1QWSA 4OQEA 1D2EA 5CVCA 5KWJA 1IXKA 2XWJI 2LZ0A 1G8MA 1NU8A 3BIOA 3K9HA 2AG0A 2HI0A 2VSFA 4N3GA 3MGBA 1WVMA 4RIEA 4W5TA 3OG9A 2W6JD 4DR6B 1QYWA 3U4QB 2HA6A 3GGGA 3QKWA 1MO2A 1VRWA 2CLDX 5FUYA 1OA1A 2ZE6A 5LMCA 3U1VA 1B6SA 4LI0A 1CZOA 2F43A 3GT3A 3R5JA 4OHXA 4HJRA 1OXTA 3H9GA 4K1XA 2HU7A 3GCZA 4G8BA 4IHAA 4GYWA 4YS6A 4UNPA 2QN9A 3W2TA 1UBLS 1ORTA 4AZTA 5REQA 3RYIB 2AG5A 3M3HA 5JH7A 1NYLA 1NMZA 4LGYA 5GJCA 1R9GA 3ORRA 4B6SA 5M04A 4XQ9A 4XUGB 2YIVX 3IPLA 4EJMA 1NHGA 4NV1A 1XQ9A 2D2FA 1FDRA 2YY5A 3M8KA 1U11A 4OK6A 3ZKWA 5AVQA 2Q6IA 1OIWA 1LX6A 2AX4A 2OECA 2PL9A 3OKPA 4KJZA 4US1R 3KJIA 5TS3A 5EKTA 5THQA 3CIOA 3I58A 3T9AA 1KSJA 3RWMB 1E3JA 1AS0A 5FOQA 2DHEA 3DHYA 1GTVA 2IP4A 1I7PA 3GFGA 3ZW9A 1W93A 1XJWA 3ND8A 1XA4A 3PNYA 5JECA 2XUGA 3GROA 4R81A 5KQPA 4I4IA 4FZ3A 5KO2A 2J9ZB 4KQFA 3R5XA 2CDCA 3T7AA 4BFUA 4G67A 1BHSA 4A0GA 3R0IA 4QUEA 1T6ZA 4ZCTA 1LTQA 3MQ2A 3TEFA 1Z63A 1BMQA 1Y81A 1XRQA 2C3OA 1V41E 5EZQA 3RJTA 3MJVA 4FW9A 2ZWOA 4HRYA 4IM7A 3WGLA 2V1UA 1B23P 2XXBA 4RCYA 3IQXA 3D0KA 4OU5A 1Q7CA 1YK1A 1ULUA 4RPJA 1M0SA 1J4AA 2WA1A 1L5HB 1EP9A 4JENA 4HVCA 1OLUA 3C4VA 3PC3A 2A14A 2IU0A 3SYTA 3VX4A 1A8IA 3OT1A 4RVCA 4F11A 4OI2A 3OHPA 3ZZMA 2IF2A 3GG9A 4WFKA 1E9EA 2GETA 1JMKC 3KUCA 1KMQA 2L82A 3OZRA 2JJMA 4Q3NA 4L6AA 4QBKA 3TYXA 4D56A 2DR2A 2EYUA 3WKCA 1Z2NX 3AG5A 3OMXA 4Z7NB 4ZCIA 2QQ5A 4B1FA 1SHZA 4L28A 4PIPA 3I45A 1F9AA 4LDRA 2XRZA 3EFBA 1K9SA 5KIAA 4RXTA 3QFSA 1RZRA 3IT0A 2ZZNA 3CCCA 1SD2A 1YB2A 4WZBA 2ZT6A 3VGJA 1Y3DE 2C5BA 4HDNB 3RJ5A 3VYSB 4EHHA 1JPNA 4KN6A 1P4AA 1PZFA 1KAHA 3E5HA 4NHOA 4JX9A 1OAOC 1XZQA 1Z56C 2NU6B 2VP2A 3G9ZA 3D9QX 4EEZA 1Y98A 7REQB 5B4VA 4FZRA 4HNTA 1BTOA 1EM8A 4QDXA 1R0LA 4PGHA 3UYLA 2I6TA 3ZBQA 3S2EA 1K97A 2J9GA 1R3UA 5HQTA 4EYOA 3ELDA 2GOYA 4CI9A 3R5FA 5BYJA 5JSKA 3AU8A 4Y1RA 4Y6GB 3WWCA 3VR4A 4E08A 3KPWA 3OFVA 1WBJB 5FI3A 3T1HB 1SKUA 3TQHA 4MV8A 3IVAA 3PFWO 1U2SA 3P2EA 4YAFA 3SPXA 3GVHA 2E6UX 5F1OA 4MR7B 3DEZA 4DLAA 1U0GA 2AEEA 5CHYA 2D7CA 1G20A 4F46A 3IP1A 4WCDA 4QUJA 3U1TA 4CQLA 2PA3A 2YVKA 3S8YA 1B0ZA 5D3KA 1MOZA 3QFCA 1QTRA 1JIKA 4IIXA 2RHBA 2AI3A 1WW8A 5DBOA 5SYAA 2WT4A 3BIXA 4IFEA 1E3DA 1P0FA 3R3XA 1XD2B 2YZGA 3KWFA 2ANBA 4FYHA 2FV8A 3QUQA 2OEPA 1UBOS 1YHNA 2XF8A 4Q02A 4TZTA 1KR5A 1CNEA 3JZFA 4GWLA 1Y6GA 4PAMA 2C03A 2QRMA 3L6EA 5BWBA 1G5RA 1NE7A 5HKOA 4YQZA 3B6JA 3G2PA 3GY0A 4G56A 4J0KA 2DKNA 4O4HA 1G21B 1TM4E 3A70A 2JB9A 2PUDA 4DBLC 5JCXA 4F12A 4A8PA 3JYNA 4QYSA 2B34A 3LBFA 3IT3A 3BCUA 2ABWA 3TF5A 1KHHA 5MHTA 1UDXA 2AX3A 2OAGA 2D2EA 3CZ4A 5B55A 4LXXA 2XCSB 1V6CA 4FC6A 1LFAA 2ZW9A 3KKLA 4LMBA 1SC6A 3O1JC 5KHAA 2NTYC 1G9SA 3TTUA 1OGYA 1KERA 1LVHA 2O1EA 1DMRA 1KMIY 1O6FA 4F5WA 3T3NA 3OO0A 1ABEA 1LJUA 2DKOA 1YC2A 3EOZA 1ZMOA 4BMYA 2D6FA 4PXYA 1FRQA 1YHYA 2CJXA 2J48A 3ENQA 3HYNA 3NASA 4UD6A 4FFVA 4DNQA 2XOKA 1GYQA 2HZ7A 1RQNA 2FI1A 3L93A 1X74A 3AF1A 3I4LA 3RRZA 4NENA 1EDOA 2ZUUA 1YZLA 3BHJA 1V1RB 3MPOA 1R0XA 4NZYA 3IA2A 1KPIA 3QG1A 4LTMA 4LWZA 1VHQA 3HABA 3RW9A 5MGNA 2PWBA 3UXHA 2B6NA 2WKWA 3OZVA 4DM7A 1CXZA 4JEIA 4X61A 1WIWA 1AQIA 3FZQA 3FZNA 3H0EA 4YAGA 2PK3A 4Q3BA 3WKDA 3BRWA 4FFBB 4LHWA 2HCBA 5LZ9A 3E5MA 4XB1A 1TAUA 2G82A 3MT7A 3KTFA 1IU9A 1KSGA 4DUYB 2B2XA 3CVJA 4NMLA 5AW1A 1VYTA 3B70A 5JMTA 1SU6A 2AFHA 2B4TO 3F97A 3VYTB 3BORA 3GA5A 1KKUA 1NR1A 1W88B 1GRQA 1X70A 3NDIA 3WLQA 3AOEC 3REFA 2DETA 4NPHA 4LF8B 2IVFA 4WD3A 4ZT6A 3UPDA 3VKUA 4BP1A 1J1UA 1WXIA 2ZK7A 2O2GA 3HCAA 4YT8A 5FQOA 4QFMA 1ST2A 3ILHA 3GD7A 4H59A 3VVBA 5E0OA 3CUWA 4ND5A 4NV3A 1XQYA 3VBCA 1II0A 4C4PA 2HIMA 4E31A 3BSWA 4IIYA 2BGGA 1T0IA 1PS8A 4U8HA 5AQEA 3UHPA 1ZZEA 2IYWA 5JAPA 2CVOA 1X1EA 4PZEA 2AOWA 5EJGA 3GJ6A 2I33A 1UOOA 5KTRA 3GFFA 3W6NA 3ZDAA 2GK4A 4EZBA 5KOHA 4KI7A 2UUAB 4LK2A 4DV1B 2M1ZA 2VEDA 2JDID 3HYLA 3RG8A 3HLYA 5YASA 4TRMA 4RD6A 4YN3A 1AZWA 1KHTA 2IP2A 2J3KA 2JAXA 2GX6A 3KHKA 2XAUA 3U6KA 3EXAA 1J2RA 1QIHA 2QG6A 3TM5A 5FWXB 3KZKA 3QBJA 2OGSA 2C3MA 1B8OA 4EIWA 5ER9A 1VIAA 1SUFA 4FT2A 2KBEA 1DWQA 4J0QA 4P3XA 4MI6A 1FDWA 4JJZA 5KX5F 4JN6B 4BQSA 3OZUA 2VJCA 5C8YA 3RASA 2IVZA 3B1YA 3RV4A 3GF4A 5B6JA 3KXPA 1XFAA 1T0BA 2BZ0A 1A96A 4B8ZA 3G02A 4NQRA 1ENOA 2PDAA 1V95A 2EFEB 2X0IA 4RZUA 4TMTA 5LNK1 1OX4A 3A9RA 1QF6A 2EP7A 3H83A 4B8YA 4NEHB 4F8JA 2V7EA 4YWHA 4DTCA 4I3FA 1V26A 3DL0A 1QDUA 3JQ9A 2E2WA 3RWOA 1F0KA 1VSQA 1XCOA 3A6HA 2O2CA 1OWMA 1W44A 1V4VA 4Y2GA 1O5TA 2ADOA 2VDWA 4L7VA 4FFRA 2ZJAA 2D7DA 2YTZA 3A7EA 3DMPA 4PZ9A 2CNDA 1SKYE 4CKEB 3P71T 1PNVA 1EBBA 4OB8A 2GNPA 4F6RA 2WWXA 4IDBA 4YRFA 1JSRA 1YC5A 2FZVA 4S04A 1MFZA 1KTVA 3E61A 2Q7DA 3M6MD 1IAVA 3C87A 3LPCA 2A9KA 2JCSA 1J0XO 2EP5A 5EUQB 1PQPA 1DJQA 1OIXA 4NBVA 2P27A 1IONA 3E1GA 4J07A 4PCUA 4X7PA 4DHEA 2UUCB 3EVTA 4IDPA 3JZIA 4G0VA 1G8YA 3GLHB 4G36A 4GMDA 2RGUA 4GPTA 3PQCA 4NYJR 5FRDA 3UAOA 1HYGA 2CBZA 2XMGA 3KXDA 4G9EA 4HDMB 1CJUC 5EVJA 4IYRA 2UUPA 3X43A 1XTVA 3I42A 1YO6A 3BMNB 4IV0A 4MIKA 5G4KA 1K68A 2VPYA 3EG9B 4TUYA 3Q9NA 1EMDA 4FEYA 4ARIA 1P61B 5EQTA 2AW3A 3RAEC 4R40A 2B4QA 1YBMA 2R7AA 3WYBA 1EK1A 1JJ7A 2WU4A 1H2ZA 4IJVA 3GNSA 1N2SA 4V3BA 4OHUA 3EZFA 1QVRA 5IDXA 1O96A 4ZV9A 4FI3C 2OQVA 5I7SA 2OORA 4K05A 1ZN7A 4DBVO 5JI3E 4J16C 5KYNA 3EPHA 4XGQA 3NXKA 4IEIA 2R2GA 1JRLA 1Q95A 3E7PA 1UK6A 3PEVA 2ZVQX 3VR2D 1V25A 4MYUA 5KSOA 4OF4A 1PAUA 4RKWA 2B94A 3A1UA 2IDMA 3OU6A 4G0OA 4W5HA 4ITVA 3D2AA 2NSDA 2VYVD 2XEXA 3QWHA 5ECWA 4RSMA 3L9WA 1THGA 2WWFA 3E48A 2HMTA 3PNBA 2KBFA 3VJRA 4KODA 4FIDA 4AF6A 4HAYA 5BNFA 3L06A 8GPBA 3NR2A 4LJSA 4RMNA 1E4VA 5LQCA 3H2SA 4EG1A 2RFLA 2C2ZA 1HZZA 4R2JA 2R5FA 2P6PA 3GFSA 1EWKA 3EIXA 2PUFA 1P3JA 2IEIA 1Z4LA 3BD9A 1GLVA 1WR8A 2Q3HA 5K0LA 3BF8A 4Y9DA 3LBAA 3X2FA 1VKZA 3VZSA 1WX1A 2VTVA 5H3HA 1FRZA 4U9UA 1IHPA 3E22A 2CFOA 1Z6PA 1A5TA 2XMQA 4HTFA 3GUYA 3QYAA 4MVYA 4M8SA 4CIAA 1OAOA 1WMFA 5LYJB 3I1YA 1CJCA 2A7XA 2PA0A 3K16A 4DREA 3CKMA 2OUIA 1LSOA 1C1HA 2WT9A 3M5CA 2H8KA 4ND1A 4IAOA 1ESEA 4B4VA 3DNPA 3DZHA 3FVRA 3NPMA 1SQ0A 2I71A 2BJVA 3D5QA 2PTGA 3BH6A 2AG6A 2F62A 1FFHA 3DO6A 2FHPA 1DZ3A 4PC7A 4EVIA 3L7AA 4MP6A 1P1IA 3PWSA 3L79A 3PUJA 4UXHA 4NBUA 2PTHA 1QYCA 2FFHA 2Y05A 3GUVA 3PUYA 5KWVA 4WLOA 5K8CA 2IZ7A 5EOVA 1ZSVA 4UFPA 1ODFA 1UFRA 1U7ZA 1V1MA 2B30A 5CH3A 2Q2NA 1V5WA 2HNAA 2KWIA 4LYGA 1Q6YA 4WZBE 2BF4A 5L8VA 3H2IA 5TJHA 4BN4A 4IIJB 1L1RA 3CVOA 2ZU0C 1EQUA 3IEXA 3JALA 2QL9A 5FBZA 3JRXA 3D7LA 4OXXA 4EI2A 4UHFA 4G1CA 2GO1A 4LPSA 4MVJP 3LVFO 1DB3A 1DC7A 1SVOA 2V7GA 3HCBA 4ZQIA 4EUEA 1GD1O 2PN1A 3ZV7A 3WWPA 3WGIA 2HHHB 4F0JA 4NCBA 4BQFA 4ESVA 1XZBA 2Z8ZA 2J46A 4FNMA 3UOGA 2R0QC 3EZ2A 1ISMA 1FK8A 3G9TA 2CUNA 4DEVA 4YP9A 3NJRA 2PD4A 4YRNA 5I48A 5CH5A 4OHWA 2VDMB 3RS2A 3PRJA 1CUZA 2C7QA 1DGQA 1B3RA 4NU0A 4PTZA 2CDRA 4PS1A 2GD6A 2VJYA 2FPUA 4F96A 1KBQA 4MI3A 2V7QA 4P33A 3DWGA 1G20E 4P83A 4D3YA 1OOEA 5F5XA 4KU4A 4O4IF 1SG6A 1U2ZA 3FBTA 2GCPA 4MINA 2ZJ7A 1X9GA 1YNOA 1ZD9A 4RKFA 5KOJB 4FQ7A 4YACA 4M4SA 4QEKA 2IEAA 2O4CA 3QRWA 3P9NA 1KC1A 1SOUA 4DMFA 2WTAA 4RK5A 1YRLA 3WSWA 1E2FA 2CUTA 3I53A 3EGIA 2VZ8A 3O92A 3OJLA 3LHDA 4GKVA 4HDRA 4IZOA 4MGKR 2Z5FA 4S1WA 1J0DA 1O9GA 2C5LA 4NG4A 3IDQA 2BPOA 5A03A 3B1KA 3K6KA 4NV0A 4REQA 4XRRA 4G8DA 1WVIA 4MARA 4NDZA 4X1IB 2FEMA 2PAAA 2XTAA 4PEVA 4BNZA 3DHNA 1L4LA 2A88A 4PFJA 1QPGA 3P4XA 4E3ZA 5K6AC 2X6TA 1MW8X 1YB4A 2O0MA 4FEAA 1XVVA 2ZYUX 3AOEA 1PWYE 3AEXA 3I6BA 4OBWA 3RH0A 3E8MA 3ICCA 2ECPA 3IAAA 3WQSB 3STHA 1W30A 3C8HA 2I4TA 1MHTA 1YRQA 5CGZA 3OFNA 2EFGA 5JJKA 4LOKA 1ISGA 2EBUA 4JJFA 3BS4A 2CJFA 3JATA 1RXIA 4YP6A 3PEWA 1A50B 4X3OA 4EFDA 1P7VA 5CFNA 2ZR0A 2FPPA 1P1JA 1DKNA 4Q9LA 3V2GA 4OLHA 3OQIB 4OYLA 1L7VC 1XTUA 2Q1WA 2ZLBA 2OQRA 5CFOA 1DBIA 3EGVA 4C3VA 1SOAA 5ALQA 4ISBA 3ZHUA 5BYAA 2NM0A 3VR0A 5F78A 3K35A 5F51A 4BASA 4P7KA 3DWFA 3STVA 1WP9A 4EQ6B 3JWGA 2FUG6 1IHYA 1CERA 2XYVA 1M72A 3FXAA 4I1UA 1Z82A 4N7MA 3UICA 1ZU5A 2AFHE 4H16A 5J2UA 1Q0QA 4R51A 2EJTA 3R7LA 1AK9A 2P4SA 5DHAA 4B79A 2ECOA 1L5OA 1WPQA 2H7YA 3MCZA 2NO6A 4K46A 3B52X 2B98A 4V0NA 2PSJA 4J4TA 4JMLA 3SM9A 3HCRA 3ONEA 2O6LA 3BCRA 1RHUA 5IJAA 1EZ4A 3T41A 4AX4A 1JB9A 2IXEA 2V4MA 1HNXB 4AJ2A 4GXNA 2PZJA 3IDAA 1H1LB 2XHZA 3QX7A 4PPYA 4AY4A 1GGFA 1L3IA 2RK3A 1OWPA 1YAHA 4Q3LA 3PDJA 4RVSA 2VWQA 2ONCA 3K0FB 4I66A 1QONA 3IV7A 2YIDA 4B6FA 1D2GA 1CUFA 2JGAA 4M36A 3IRVA 2OZPA 5I9MA 1I3MA 4RPLA 3ZV4A 5ES4B 3IJRA 5I6DA 5JXHA 1XZIA 1LPAB 1U7WA 5C2JB 5CG2A 3OEWA 1PBTA 5FFNA 3R7AA 2GXQA 1G3IA 2O4UX 4B6QA 1OD6A 3FPGA 1KYQA 3H42B 3QVVA 3UB3A 3RRBA 1CUWA 1C4WA 3BK7A 3IIKA 3NWEA 2HCRA 4PQFA 5FO1A 2DBYA 2CHFA 1DWUA 2IYZA 4W9NC 5EWMA 4BAUA 2OMEA 2VPIA 2XUZA 1T9HA 3WK8A 3F6RA 4JDPA 3OCXA 5AFSA 4HKTA 1OXXK 4BB5A 1R4AA 2J59A 4AD8A 2OZKA 5HKKA 2PRZA 3T4UA 4R2XA 3SX0A 3KEMA 4O1MA 5AYVA 1YZYA 2DRIA 3HB7A 1IUNA 1L8AA 2J4CA 2ZIFA 3MS4A 5FFMA 5KYUA 3SF8B 4G09A 4AO8A 2QL5A 2HLPA 3K5IA 1CFZA 4YMTA 1Z8FA 2QHXA 2O5VA 4A6PA 1QAOA 3OFJA 3CEPB 3IEVA 2SBTA 3I28A 4HCJA 2JZOA 2ZCUA 2KQUA 3L4EA 4IDCA 4WXMA 5BSGA 621PA 1RZRD 4H7PA 4HQFA 1UP7A 4QKQA 5K4HA 4YALA 1QORA 4FNOA 1AZLA 3ER6A 1QHHA 3MGGA 4I50B 3BWCA 1JYSA 1E6MA 3GT4A 1JWLA 2H0RA 2G28A 1N3IA 2PZKA 4AN4A 2OAQ1 3LP8A 4BZQA 5JR3A 4RJLA 3ETGA 3G59A 3KQOA 1WZNA 4KRYA 3WNZA 1XU7A 5DHTA 2AJTA 4LJ7A 1NT4A 2AL7A 3JS5A 4CI0B 3KUKA 2QGNA 5CT5A 3MB8A 2AS0A 4DHWA 3D6MA 3WLAA 5ELXA 2SKDA 5TR9A 5EYPB 1DBWA 3VR4D 3KZMA 4FJ0A 3OPYI 4Y9SA 2V0NA 1W85B 5IVHA 3HEAA 4DQUA 3AR9A 3C6ZA 3DPSA 1TJ4A 3F3MA 4JWTA 4DMHA 2G83A 1F9EA 3FDZA 1V5EA 3ESBA 4LI3X 2CJWA 4MO9A 4BO4A 3EEFA 1YL5A 1L4YA 4I1SA 3HZOA 1II8B 4H3SA 1XKXA 3CZRA 1CQWA 3HG7A 4B47A 2VHQA 4O5OA 3PA6A 1UT5A 4EY3A 2JAHA 4QXQA 3VRHA 2HDOA 1TECE 1ZQ9A 4AROA 4BJHB 2R5WA 3MTGA 2XECA 1U5BB 4F06A 3DV0B 2JH3A 3E9CA 2AYXA 4UTPA 3DZBA 2IOQA 3LBHA 4IJUA 4LSZA 1IFXA 4OQYA 4TQAA 2O19A 3MC1A 1JH9A 1Z3IX 1QH8B 2XY4A 3I4FA 1BU8A 3IESA 4EDHA 5J58A 1Z16A 2VPTA 3BB4A 1QB7A 4GWGA 5BT8A 3LBYA 1SVNA 3PTLA 4HYQA 2QLBA 2HSDA 2QTCA 3AJ9A 4QG7A 4FGWA 1CIVA 3W5AA 4WK4B 5FULA 2G7MC 2GZMA 4JBXA 2OILA 5C8DA 2EKPA 3QFRA 3IVMA 4ZKDA 5KNDA 4AG6A 4I5DA 3AU9A 5B3JC 3HU3A 2EFHB 2XMSA 3BD6A 4N5MA 4PFSA 4DWOA 2JLYA 3WBJA 4QTZA 2W6PA 1A8HA 3REOA 2QUKA 3VO2A 3I37X 1K6XA 1LPSA 3CNOA 1JL3A 2AD5A 2R1ZA 1HDIA 3EZGA 3DBIA 4FGSA 4P3NA 2H1FA 2G09A 1AKNA 4OLFA 1E2JA 2OV3A 3KWMA 5DVZA 4ARSA 4CMHA 5FCDA 5ITVA 2GBPA 2J09A 4FHEA 2PKWA 5LYYA 3MT0A 1J09A 1XTIA 1EHCA 2OPBA 3OTQA 2QG9A 4G0QA 2QTRA 2M32A 3CUVA 2ZS8A 2UVPA 2YC4C 1BAPA 3F5DA 4FMDB 4KGZA 4N5HX 1S7GA 3G85A 1WMDA 3QM1A 3QJYA 4XYGA 5DBHX 3W7AA 1YZNA 1KARA 3DE1X 3ID6C 2GEKA 1M8JA 1JW9B 1DC6A 1Y1LA 4LCEA 3VAZA 4V1CA 5SZIA 2RGXA 2R1VA 1DCMA 3VR5H 1K06A 1NLYA 4BEJA 2B0JA 1FLVA 4C1BA 3SQLA 2Q2QA 1M7GA 1WOYA 3EWNA 4IR7A 3TW4A 5JJBA 5KYGA 3PUWA 2INGX 1Z73A 4KMOA 1PO7A 1Y6FA 2G80A 4RTOA 2DULA 3MMPA 5TMEA 1H2BA 1LK7A 1SOMA 3MMNA 2VSQA 2I99A 5HW0A 4P32A 3BVPA 3PXGA 4MVXA 5IBQA 2DGDA 3AJ8A 5KVAA 3AMVA 3TIFA 1G8SA 1ZMTA 1PZMA 3HN6A 2G04A 5DNAA 1GKIA 1FX1A 2QT9A 1Z07A 4H35A 1TKRA 1B6TA 4BNHA 5HG0A 2LBPA 1U3GA 2W2NA 2CUKA 3O4FA 5L3ZA 5A3SA 5AVWA 2RI1A 2VF4X 5D6NA 5A9SB 3HJUA 4I1VA 1G8FA 2WHXA 5A7FA 1KI7A 3UIEA 4AJOA 4HNHA 3H3JA 1KMMA 2QXTA 3A9SA 1SOWA 1VCIA 3BEDA 2F67A 4G5FA 4QA9A 2Z9DA 3EC1A 3GNLA 4MX8A 3GZTB 4U9IS 3WDLA 4B34A 1JG7A 2Y2VA 1F7UA 2QRHA 2XGOA 3CC8A 3K96A 3BGDA 2PZFA 1CULC 2VQSA 4FS8A 1K7XB 3PHCA 4MUIA 3A6GA 4YCJA 3ZR4B 4IJKA 1N9GB 1K1EA 5K5EA 1G42A 2FZWA 2PLFA 4OGFA 5DIFA 1JG4A 1Z0KA 3U5TA 3I2FA 5DWDA 5ERYA 1CYEA 1MRNA 4OXRA