4G0NA

Crystal structure of wt h-ras-gppnhp bound to the rbd of raf kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
164
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Effects of the Oncogenic RasQ61L Mutant on Raf-RBD.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords GTPase HRas
total genus 58
structure length 164
sequence length 166
ec nomenclature
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g0nA00
4Q1DA 2Q9BA 4TLBA 2G1JA 1F2UB 3VHLB 1W36C 1KOFA 1IM2A 3ZS9A 2WKPA 4PPGA 1OIVA 5FUXA 4AKIA 1M7BA 3QPUA 3CF2A 2WOJA 2C96A 1G7SA 3LV8A 4IVQA 1QF9A 1E2QA 2ZRGA 4B6FA 3RDPA 2A30A 3RWMB 4B33A 2YOHA 2A78A 3AQ4A 2REXB 1G8FA 2XGJA 3RS0A 5DLQC 4GI7A 2XOKD 4LC1A 3VR1A 1IXZA 3AKYA 3VMFA 3A6PC 3L43A 2O8EA 2PX3A 2A2ZA 1TUIA 5J4YA 1N5LA 3RABA 4B3GA 4J0QA 1W7AA 5JFGA 2MSCB 2IWRA 1A82A 1GP2A 1KI1A 3FTQA 2IA5A 2R6FA 2W6IA 3W9YA 2GEDA 3WBKA 4M9SA 1SKQA 2FZ4A 4X8MA 3H84A 5C46F 5GVSA 2G0TA 3Q5DA 4FW9A 4AWXA 1Z63A 4ILEA 1ODFA 3B2EA 1E9FA 2NZJA 2IC5A 3GFPA 3LW8A 1XTKA 2OSBA 1TEVA 3Q7PA 1P72A 1XTSA 3BC1A 2DFTA 2KBFA 4DLSA 1LNZA 1D6JA 3CNOA 4A2PA 1GRQA 1R8SA 1HE8B 4DRZA 3BB3A 4D4LA 3PUVA 1ZCAA 4DB2A 1TX4B 3NWJA 3L0OA 4HAYA 4M9XA 1BKDR 5H8WA 4ZKEA 1C4OA 1YQTA 1LVGA 1U0HC 2DY1A 5TDHA 3MG9A 5A0FA 1GDDA 1NN3A 3NXSA 4QBGB 5KYKA 3QG5A 2J0VA 2XNDA 2VLIA 1XMIA 1FTSA 2BOVA 3E2IA 3QKTA 3ZS8A 1FOEB 4HZUB 4E22A 5BW8A 4H1UA 5K8UA 2J9RA 4AD8A 2FA9A 4LZZA 3FMPB 1CF4A 4DWJA 1XMJA 4OBEA 4MYTA 1RFLA 2HF9A 1TF2A 2FSFA 2ZRCA 3R7WA 4QM7A 1QVAA 3KTAA 521PA 4Q9KA 1JALA 1E9BA 1HEIA 5EE1A 1SKYE 4TTPA 4K46A 3AP1A 1SXJE 3HU1A 1E4VA 3ZVNA 1ZU5A 2RAPA 1RIFA 1FL9A 5DE3A 3I73A 1KDRA 3RRYA 5L3QB 1QHXA 1XJCA 3AP2A 4DXAA 2A7QA 2YWHA 3U44A 4EJSA 3AB3A 3QUSA 2ONJA 4TT3D 3THXA 4FIDA 2FPMA 1I2MA 1TADA 5GVRA 3ZIAA 1KMQA 1ZMXA 1QRAA 2ZIAA 3KQKA 2AK3A 5M04A 5A4JA 2F43A 2ZRIA 4OHZA 2ERYA 3UXMA 1JQJC 5FUYA 3UWKA 3RS5A 4Q9LA 2ZI3A 3BB4A 1GIAA 1WB9A 3QF7A 4EPTA 4L9WA 5EP2A 3W5JA 1GRRA 3NVAA 1W44A 3ASYA 3QKUA 2R6AA 1OE0A 4BWYA 2CE7A 2Z43A 5P21A 2C95A 3D3QA 5SZKB 3UWOA 3IBYA 4LHVA 2ZSFA 3GEIA 1T3SA 4QL3A 3TW4A 3U60B 2ZRDA 2YYZA 3HR7A 1EFRD 2V1XA 4KFRA 3PUWA 2RGBA 4GSYA 3ZVLA 2BC9A 5B30A 3FMOB 1SULA 5KNCA 1A2KC 4DDVA 2XX3A 2ZUCA 4HAWA 5EP3A 4F93B 5JRZA 4QOSA 4PO8A 2WSSD 1N6IA 4BFTA 1G5PA 5KU1A 1NSTA 2REOA 1M74A 4TMXA 5LPNA 3TGPA 4HYYA 1TQ2A 2IYYA 4Q1AA 5ELXA 5F3WB 1F2TB 3A58B 1P60A 1US8B 4OQNA 1R2QA 1OFUX 4HZUA 3OIWA 3SC3A 4DKXA 2IF2A 3A1VA 1Q0UA 1G19A 4LHZA 1Z6GA 2QMEA 3EIQA 1JJ7A 3EG5A 3U6KA 4D25A 4X8OA 1N5JA 3PXGA 5D3MA 1ZD1A 1KSHA 1OXXK 1ZNXA 3LA6A 5KTYA 3ADBA 3HR8A 4IRUB 2HYIC 2ZS7A 4PZZA 2A5YB 2QE7D 2CDNA 3Q8XB 3DVLA 1TMKA 4D4JA 3ZJYA 2CL6X 5DISB 3TMKA 1XPUA 4I1OA 1EXMA 4TMZA 5FL3A 3N70A 4IOKA 2UZ3A 4BUJA 2R65A 2BBTA 2B6HA 3UPUA 5G41A 3AF4A 3ZH9B 2LKCA 3CRQA 3KQLA 1M1YE 3VKGA 1CS4C 5F9HA 4ON9A 3MWJA 1MABB 1RW4A 1IN6A 2QTFA 4D0LB 1P62B 3O8BA 2ASEA 3L8YA 1Q1EA 3LDAA 2QE7A 3U61B 4XD7A 2OESA 5TV2A 2GCNA 4TSFD 2UZIR 1E32A 5JZVA 2B7BA 3F5FA 5HZHA 3MGCA 4TWZA 4F4IA 5JLJA 1FZQA 1P4SA 3LWNA 5TB5A 1S9HA 4OK5A 1DAGA 2PH1A 1ONBA 2IYTA 2WJJA 4M1SA 4P0TA 4QNRA 4QHSA 1KGDA 2JJ1A 1XF9A 5E7MA 3GJ5A 1UKEA 4Q7KA 2W2VA 3T35A 4AKHA 1J7KA 1HV8A 4LV8B 2J7PA 2VHUA 1DG3A 3H2YA 4GDFA 221PA 2GJAA 2GKSA 1G5RA 3HDTA 421PA 4Q9HA 5FTJA 4B73A 4JJZA 5JI2E 1LS1A 2EWVA 4DHEA 5BQ5A 4E09A 5CM8B 4P4SB 3LQRA 1XRJA 1T3LA 4R98A 2L0XA 3TK1A 3K0SA 1QHNA 4M22A 2WWYA 1PLJA 2IYZA 5KHOC 2ORIA 2IK8A 1N6OA 1TU3A 1HQYE 2C04A 3WHLA 3GEEA 4F91B 2ZRKA 1IXRC 4P3YA 2A5FA 4YXWD 3NHAA 4DIEA 1EFCA 2HV8A 3SN6A 2NO1A 4JLOA 1II8A 4HLUA 3QXCA 1OH8A 5KO2A 1OH7A 2W6ID 3JZMA 2W2XA 1E9SA 1ZUIA 2H8KA 2NIPA 4ASUD 1OT3A 4UNQA 3TKLA 4I1UA 3D6TB 3W5IA 3G5UA 2Z5FA 1IJEA 5FOSA 1SXJB 1Z22A 4ZDIA 3PR1A 3MCAA 1NL3A 2JLRA 1ELOA 2H7VA 4C0AC 5KSZA 3LX5A 3UG7A 4R2IA 1B0UA 5G3YA 4UXHA 3ASZA 3BBPA 1Z6AA 4EDHA 1DEKA 1DVRA 4JVNA 5G53C 2ZUBA 4I81A 2C8VA 2GNOA 2OHFA 1OF1A 1ESMA 3LXXA 3T5GA 3D8BA 1UFQA 4DLUA 4JLDA 3SI7A 4DLTA 1JAHA 2EW1A 2NO0A 3CUEF 4ZCLA 2ZRAA 3RSLA 5KOYA 3GLFB 5EJEA 1OFTA 2IYRA 3LVRE 4V0ME 4BEBA 1Z29A 1UPTA 2CHQA 1DAIA 4UQOA 4M2LA 4A15A 1G7CA 1JNYA 1RJ9B 4Q01A 4Q4JB 4TMVA 3RAPR 4DT1B 4BGDA 1NP6A 1RE0A 2DCUA 2VP6A 3BRWD 1KJWA 3WRXC 3CR7A 3A4NA 3W8NA 1KO5A 4ZPXA 5FOVA 3MWLA 4WZ6A 4MH0R 4GBMA 1H8HA 2IHBA 1W47A 4KYUA 3AGQA 3AVVA 3EWSA 2ZROA 4TMKA 1E1QA 4ZDWA 4Q4AB 1N6PA 4WXPA 2QZ4A 1TPZA 4TL9A 4L9SA 1II8B 1DPFA 5H70A 1K5DA 3B8HA 1Z0AA 4URZR 2LWIA 3J81k 3KKPA 1GVNB 1OHHA 4M1KA 2CL0X 3PITA 1R0XA 4DLWA 3K9GA 3BFKA 3QVUA 4KAXA 2PEZA 2FV8A 2O0JA 2FFQA 5DI3A 4D81A 2ORVA 1DOAA 1F48A 1MRNA 3LAWA 5LD2C 3EZ7A 4K8OA 5FOUA 4XJXA 1AS2A 1OJLA 1OXSC 4MGZR 2O8FB 2ZS8A 1S96A 3IIKA 3KJEA 4HDOB 1RYFA 4MUAA 1AGPA 4M4SA 1OHHD 1ZM3A 3QPVA 2OG2A 3LW7A 2X2FA 3K9NA 1UKZA 2QN6A 3MLEA 4LJ4A 3GLFA 1ZNYA 2VF8A 4TTQA 5CITA 1E9RA 2KE5A 1QHHB 1P2TA 3SBEA 4JVMA 3QEJA 2AXNA 1T8TA 1XTJA 2XXAA 2O5VA 4HB3A 1PLKA 3LRPA 1OV4A 2ZJ5A 4ITRC 1MR3F 2CMKA 4NONA 4B71A 4BFZA 5KUTA 1VKJA 1AZTA 5DHFA 5DNYB 3PUZA 3A1SA 1XD2A 4OK6A 4HUTA 3AF2A 1LS6A 3RS4A 4G5GA 4DJTA 2G9NA 3FYHA 5DI9A 1WMSA 1XCGB 1P2SA 1UKYA 1Z83A 3K53A 4D82A 3EPLA 2W2TA 1NVXQ 3WP0A 4ARZA 4ZI3A 3SYNA 2HJVA 3OZXA 5EQTA 2C03A 2YJTD 1KHTA 3SHWA 1VCIA 4MRPA 2JLZA 4P4UA 4US1R 3G82C 4A36A 2W83A 2PEYA 3CWZA 5L3QA 4JYCA 3CR8A 3TSOA 2O0KA 4GMXA 1NBME 2F3RA 2OAP1 1GRNA 2NPIA 3TBKA 5JBQA 1EK0A 4PPQA 2IS6A 1OKKD 4JL5A 4KI0A 1OW3B 2P65A 2CNWD 5AK0A 2JJ2A 1VDZA 1BO6A 4LRWA 4BLQA 1W0KD 4ZO4A 1R7RA 2J46A 5AJVB 5JMTA 1AM4D 4LHYA 2WIAA 2IL1A 2DFLA 1OKKA 5HCNA 2OZEA 3WP1B 4EPWA 1YZLA 3X1YA 5AUOB 3DM9B 4C30A 1NLZA 4YMWA 1OIXA 1EX6A 2V6IA 4BRWA 2V7QD 3RS7A 1IN4A 4PHFA 3K0CC 1PVOA 2DYKA 2GXQA 2BBOA 4PSKA 4EFNA 2ZRJA 2GHIA 4GOXA 3BFVA 3CRRA 3VKHA 3A37A 1Q1QA 2IS4A 3FGNA 1KK3A 4R2HA 5KSYA 3K70C 3I8XA 4DDTA 2J87A 1JR3A 3FPAA 4TYQA 2KWIA 5GJWC 1GFIA 1JBKA 3EXAA 1E99A 5KDOA 3CNNA 1X8JA 1W4RA 1E9DA 1KO4A 2V1UA 2CVHA 4LWZA 1XEXA 1N6LA 4BECA 4FN5A 4AYTA 2WWXA 5CK4A 2VHCA 3VR2A 3LD9A 1COWA 1A7JA 1GG2A 2CCJA 4B32A 3PEYA 1NLYA 4RJLA 1Z0IA 3B85A 4LHWA 4RD6A 5HKKA 4Z8XA 5B57C 1AN0A 3NC1C 1G3UA 3C16C 3QXSA 4RD4A 3ECCA 4XH9B 5JJKA 5F9FA 1U81A 2IUSA 3GJ3A 4MGKR 1QHIA 4W5WA 3TJZA 3QQ5A 4B2IA 4IXNA 4JKYA 4TLAA 1W0JD 5H68A 4AURA 4BFUA 1DBSA 1R8QA 3R8CA 1LV7A 5CLLA 3RWOA 2HYDA 3TQFA 2IXEA 3B6EA 4YMVA 5AUNB 3QF4A 4XSGA 5C2JB 3DOEA 3FFBA 3BD9A 1E2KA 4ZCIA 4CW7A 4PTLA 1P9RA 1UBEA 3KZ1E 2HF8A 1T91A 3EC1A 1UADA 5BYJA 3WYFA 4LK2A 3C7KA 5DSZA 2O0HA 1KI3A 5FBQB 3UMFA 5A5GA 3LBIA 2HT1A 3SQXA 2CJWB 3CO5A 1QHYA 3SDZA 4TL7A 4IDNA 1RRGA 4C0KA 4DCTA 1NJFA 4NYIQ 4TQUS 1IY1A 1D5CA 3LH5A 4NL4H 3VX3A 3D31A 2EFDB 4QBHA 2OFWA 1KMHB 1KIMA 1KKMA 1W4BA 1GNQA 1X86B 4A8JA 1I4DD 2EWWA 1HT1E 4AC9A 2KSQA 3DKVA 4JZKA 1NLFA 2CLCX 2RH5A 1FNNA 3IQXA 1BOFA 3MWYW 1FPMA 1M7HA 4PQRA 3O8RA 2V7QA 3I1FA 1KYIA 3IQWA 4O0MA 2XJ4A 2BMJA 3NH9A 1CLUA 3C5HA 1Q21A 3EWAA 3X1DA 5HE9A 4CGZA 1KI8A 1FP6A 4URUR 1N6HA 2REBA 3K0AA 4D2IA 1KK1A 1YZQA 2ONKA 2VHQA 1HE1C 2GRJA 5JI3E 1XXHA 2PT5A 1R10A 1WDTA 4NBSA 2CCGA 4IDPA 1EWQA 3IO5A 1NY6A 4UNRA 2CVFA 5HPYB 2B7CA 4MGYR 4RD1A 1CP2A 3EIHA 3MAAC 3B7GA 3VAAA 4V0OA 1YR9A 3ZZTA 3I8SA 4IDOA 2AN9A 2P5TB 4IDHA 5C1BA 4LJ6A 1W49A 5EE3A 4HAZA 1W2HA 2V8OA 1B23P 5CLQA 4PPNA 2PZGA 2VRWA 2F1HA 5FUVA 3IUYA 4MQBA 1QHGA 3I4LA 2AFIE 2G0NA 2QM8A 3P32A 5JCZA 4A92A 3L0SA 4BFSA 4H1VA 1MABA 5LBIA 1KI7A 3CONA 1T0JB 2E1RA 3W3AA 2JATA 3LXRA 4Q7LA 3RRZA 4FMDF 1GKUB 1MO6A 1Q44A 3ZZUA 4Q1FA 1LY1A 3IEVA 3K09C 3BGWA 4U5XA 2I4IA 1N6NA 3GJ7A 4JL8A 3SQWA 3WMGA 1X1RA 1HYQA 3BH7A 5CYPA 4NCNA 2YVUA 3Q5EA 4PC3A 3K0EA 4HB0A 1K6MA 2VEDA 4U02A 4EPRA 1XCMA 1WF3A 2WICA 2FPKA 2IUTA 3SJBA 2WSSA 1F60A 3THYB 4CEIA 4FI3C 1CIPA 3TNFA 4A0FA 3TSWA 4QJ3A 1YR6A 3TVDA 2IYVA 1W36D 3TLXA 1JXMA 1WRBA 2VF7A 1SVOA 1QDEA 1YRBA 1AZSC 4JBXA 3KKNA 5JWOA 1K5GA 4YLGA 2GK6A 1JAIA 2H57A 2CBZA 5J5CA 2FWRA 4A9AA 1G5TA 3BB1A 3HJNA 1RRCA 5D3MB 5FPTA 3RSOA 4TL6A 1ZCBA 1YRAA 2J0UA 1D9ZA 4O3MA 4JVLA 2AX4A 4QXAA 3LY5A 1IBRA 2YNMA 3DMNA 3OHMA 4HDQB 2Q3MA 2NGRA 3ZQ6A 5E7IA 1SVIA 2GDJA 1M2OB 3IDQA 3MWKA 4POAA 3EX7C 1SXJC 3ZIAD 2HXYA 3BS4A 2BMEA 2QRNA 4F4JA 2QORA 1RC8A 2F7SA 1SVSA 4PO1A 1NN1A 4A0GA 1XD9A 5DYIA 2O8CB 4GOJA 3ZZ0A 4DEXA 4MKGA 3B9PA 4G3XA 1QVRA 4LUCA 3VR4A 4JSTA 3TR0A 1P7CA 5JEEA 5JJLA 3GLIA 3FMIA 1PUIA 3BXZA 4RD0A 4G5SA 1Q22A 1CBUA 1EGAA 1H8HD 1E94E 2JAQA 3NTUA 3QY0A 4MKHA 3GP8A 2FSHA 1AIPA 3GLGA 4IVRA 4QGAA 3KDSE 3M1IA 4JLBA 2CCKA 5JECA 1E1RD 4GOKA 2JEOA 1IONA 1XZQA 3BH6A 2YWFA 3WNBA 4O25A 4D80A 4OYHA 2QSYA 4QC2A 1E2NA 2BBSA 4LJ5A 3RRNA 3KJGA 2ZVPX 3LLMA 4NDZA 4W5HA 3CF6R 4B3XA 3FVQA 1XEWY 4A1FA 2JASA 2E87A 621PA 4CEIB 2Q3HA 2ODWA 2EFGA 4QKQA 2BEKA 2XXAB 4CDGA 1GTVA 3GLHA 2FNAA 4XWAA 4M53A 8OHMA 1KZ7B 2F9LA 3AP3A 4A8JB 3NKVA 2R9VA 2CNWA 2OLKA 2XZLA 2FMXA 2JCSA 1G8PA 2VYFA 1KY3A 5JSZB 2V3CC 2ODBA 4KYIB 4GZLA 3EZFA 1H8EA 1VECA 3H0KA 3CF0A 4UJ5A 1E2GA 1E9AA 1KJYA 1TNDA 1NMXA 1FX0B 4NYMQ 1EX7A 2RGDA 5AUPB 3ND9A 3C4JA 4B44A 2OO7A 3S1AB 3CH5A 1YHNA 1E2IA 3THOA 3B1XA 4PSAA 5EE9A 1CJMA 4CEJA 1YR8A 3U44B 1OB2A 1QZXA 2A5GA 1Y63A 3NEJA 1GITA 3OFNA 1GAJA 3PIRA 1TF5A 4Q21A 3GLIE 2WJVA 4PZYA 1MO4A 4XVUA 3KKQA 1XDBA 1E9CA 4ZV4A 3JVVA 1ZAKA 4KHZA 4M9ZA 1G7RA 4L8GA 4KSBA 2QTVB 2VL7A 3C8UA 5F2EA 1OYWA 2D4HA 2NG1A 1KZGB 4PAMA 2N1BA 4B3FX 3KL4A 2D2FA 5JHHB 2VA8A 4PHTA 5EXSA 1S3GA 1D8TA 2WOOA 4JT2A 3K9HA 1IY2A 3GEHA 1TL7C 2FGKA 2ZYWX 2B8WA 3W6OA 2X8AA 1QHSA 3U7GA 3OIYA 4V02A 1AS3A 1X1SA 3QOFA 4KXFB 3NG1A 1DE0A 3BH0A 3T1TA 3RS2A 2BCGY 3KXKA 1COWD 2HT6A 5E4FA 4NYJR 4BLOA 3A8TA 1CXZA 3MRSA 3QKSA 4IOMA 3R9XA 4DCSA 1JEDA 4OI0A 1SVMA 5BN4A 5FOTA 3B5JA 2GETA 1EFTA 2ZEJA 1JQLB 1JJVA 1WP9A 1NY5A 3BJIC 3AVWA 3QNUA 1NMYA 5HCIA 1R0ZA 1ZM9A 4L4UA 3PFIA 4JIMA 4CEJB 4V03A 4TT3A 4ZI2A 3I92A 2X2EA 3KJIA 1UKVY 3VR5A 1Z2CA 4PHGA 3AH8A 3WY9A 1TF7A 1GL6A 2AKYA 2JDID 2X77A 4DLRA 2XITA 2ZAOA 4IOJA 4BQSA 1XXHE 4XSHA 1L2TA 3QKRA 2HUPA 3EW9A 4B76A 2AKAB 3TUJC 2F43B 1E3MA 2ZTSA 2D62A 2QAGC 1E79A 1L8QA 1ZM7A 3BE4A 3U5ZB 2OUKA 3TR5A 2J45A 2B21A 3H1TA 3QF4B 5AJWA 3UG6A 3PEWA 3T34A 4OL0A 2Q0HA 5FTNA 2PZEA 5CDFA 5DH9A 4LDJA 3CBQA 3K1JA 1DAFA 1VPLA 4IJMA 1EG7A 4QGGA 4MDEA 3WBJA 4BLRA 4Z1MD 2F1JA 1GM5A 4HUQA 1JECA 4AK9A 2ZE6A 1U8YA 4BZQA 2GZHA 2GF0A 4R7ZA 4ZDKA 2K5UA 5CJPA 3OEHA 4Q00A 2C9CA 4YDHB 2OV2A 4HLCA 2BBWA 1Z47A 5LB2A 5D3QA 1D2EA 1NG1A 1XBTA 2WKQA 4KO8A 3UK6A 1F2UA 2LKDA 4PX9A 2WZQA 3IIMA 3C15C 1ZIOA 3W90A 2KJQA 4Q03A 1KDPA 1X8KA 1W4AA 2WMNB 2VSFA 3X1WA 1ZIPA 2W0SA 2UKDA 1ZW6A 2ZRHA 1OFIA 1E0KA 2C2HA 1U8ZA 1Z3IX 2IYLD 2QAGB 3GFOA 3NBXX 1NVUQ 4QHTA 1OFHA 4PSVA 4ACAA 1G7TA 2V54A 2JIZA 2GEUA 4QJ5A 3NEYA 1X3SA 5BYKA 4WW0A 1KSJA 3HPRA 2G83A 5E3HA 4KODA 1LB1B 4NZYA 3QXXA 2GBLC 4C3ZA 2ATXA 1W2GA 2DB3A 3TE6A 4LYHA 3UANA 4C2TA 2BWJA 5K8TA 5CB6A 2Q9AA 3W6PA 1GOTA 3K8YA 5JSZA 2NO7A 3QXJA 3I5XA 1JPJA 4FWTA 3IIJA 4OHXA 3AVUA 4Q9JA 4LYJA 2W6JD 1A1VA 2FFHA 2OAQ1 1ZC3A 2C77A 2A3RA 1LTQA 4TMWA 2FZLA 4IKEA 1FTNA 4M1OA 3KFXA 3SYLA 3ZLJA 2HCBA 2RGGA 4BE7B 5FPYA 3DZDA 1FQJA 4JBWA 4N0EA 1ZUNB 2DFKB 4P33A 1FQKA 1DARA 2C9OA 4TLEA 2ZYVX 2MSDB 3CRW1 4URXR 2O8BB 4A0HA 1Z0KA 2ODEA 2RGEA 2CEAA 2GA8A 1Z07A 4URWR 2NZ8A 2W0MA 4UXJA 4OI1A 4A82A 1XPOA 2ZQ5A 4GNKA 2V4ZA 1L7VC 3RVBA 1VG0B 4LV6A 4TQAA 4DCNA 1HY3A 3LLUA 2ZVQX 2QG6A 1CR1A 2OLJA 1VG9B 1E0AA 3VKWA 4QNMA 1IN8A 1HA3A 3EC2A 2V6JA 5DIFA 5L8VA 4CZ2A 5BWMA 4QHYA 1U94A 3OIVA 3B78A 2FSIA 3FDIA 2RGCA 1Z0DA 1US8A 2XSZA 2P5SA 1T9HA 4OI2A 1Y3AA 2PBRA 3W6NA 1XNJA 2AHOA 1C9KA 2IXGA 1KKLA 1XEXB 4FCWA 2WHXA 1KI6A 3ONWA 1XMSA 2FPLA 4WBSA 5L3SB 3Q3JB 5IK2D 2F9MA 4G5QA 2Q3FA 2ANBA 5LDDC 2YKGA 4HI0E 1AQUA 1J90A 4YC7A 3FKSD 3JZAA 2QY9A 4RFSA 1ZYUA 2YZ2A 3KUCA 2JLUA 2OM2A 1R5NA 4OQXA 1VYTA 2OT3B 3R20A 2G1KA 4LC0A 2IT1A 2WV9A 1AJEA 3EA5A 3VU9A 1JR6A 3N2IA 1NVVQ 2J3EA 3LFUA 2IXFA 2FU5C 4BPBA 2J41A 1ZU4A 3SYKA 3W8RA 2NTYC 2QPTA 3CX8A 2WWHA 3HP1A 4US0R 3FKSA 2AD5A 1SXJD 2XNSA 2NO6A 3UMSA 4U00A 3BORA 2WBLC 5IK2A 2IHYA 2QROA 3BK7A 1J2JA 4Q4JA 4OK3A 2QPAA 4V0KA 2FOLA 1D9XA 1SHKA 3TUZC 3U6BA 1NF3A 1G18A 1UAAA 2QUZA 4BASA 4RCYA 3K9LA 5HE8A 3A1UA 1OSNA 1DAEA 4DT1A 4DUGA 1XTRA 1U99A 5KPDA 3R7WB 3FWYA 2GJSA 2WWIA 4MYCA 3SFZA 1G17A 2ZR9A 4Q1EA 2EYQA 3IO3A 2TMKA 1HUQA 4DSTA 3CB4A 1XPRA 3V4RA 1MKYA 2N46A 1ZUHA 4TYNA 4Q4AA 2XNDD 2XTNA 3QSYA 2J0QA 1UEIA 4NU0A 2ZRBA 1U2RA 3P4XA 2F55A 2A9KA 3A4LA 2GVDC 2P67A 4OKSA 4C0BA 4IVPA 1G291 1OPXA 1X6VA 3B1ZA 1FNMA 3VFDA 2BJVA 2ANCA 1IN5A 2D7CA 4DVGA 3RC8A 4L16A 3CX6A 1BIFA 2R6CA 4CIDA 1VIYA 5EUQB 3B60A 2RGNC 4JLPA 4LX0A 3U3JA 4I99A 5BN3A 1VCOA 2F6RA 5CM9C 4QM6A 3T5DA 3V9PA 3IPXA 3BWDD 4W7SA 5KNBA 3PUYA 3THWA 4TLDA 4LJYA 1BYUA 1PLLA 3SE0A 1OH5A 1CR4A 1KI4A 1M6NA 2OCYC 1RPZA 3WNCA 4HAUA 3F0TA 1KK2A 3WMEA 2ZSEA 4PHHA 2ZJOA 3AEZA 4KJZA 3KFVA 4O2RA 3SFVA 3UKDA 1NIJA 3MMPA 4PFSA 3CKLA 5CK5A 4JLVA 3DEFA 2FEMA 1PV4A 4RCZA 1AKEA 3GJ4A 2UVQA 2PL3A 3GLFE 2FJUA 3GLHB 3O47A 3OEEA 3Q85A 3FHTA 4LJ8A 4Q4LA 1NMZA 3EZ9A 4TN1A 3PUXA 1T0HB 4Z8YA 3R9WA 4GL2A 2ZRNA 4IDQA 1G4UR 2ODNA 1VHLA 3QIAA 1G3RA 1XB2A 5FTKA 5K8LA 2HDNB 2RGAA 4NP6A 3NBYC 3OF5A 1MV5A 1UBCA 3AM1A 3WHKA 4E07A 1TUEA 2QT1A 2Z83A 1IOZA 4MA4A 4MYHA 4FWIB 2BCJQ 4UXIA 1SVWA 1TU4A 4HAXA 1FX0A 4BLTA 2PLRA 1ANKA 3CX7A 3MJRA 4WVFA 1YZTA 2JDIA 4HB4A 2O52A 5J4VA 4LBVA 1GNPA 3SR0A 3OE7A 4N0DA 1XWIA 4KLZA 4DZZA 1P9NA 4UNPA 2OBLA 3LBNA 4N3NA 2IW3A 2Q21A 5E7JA 2DWQA 2JLQA 3PV0A 2EFCB 3F8TA 4US2R 2JJ1D 3UIEA 1DO2A 2CLDX 5JRJA 4DSUA 2E9SA 4MKIA 4EKDA 4LBYA 1N0WA 4C7OA 4HSEA 2P2LA 1Q12A 3GD7A 4RFVA 3ICQB 2OXCA 4DLXA 4B47A 2VBCA 5AJYA 3AVPA 5C4MA 3DPUA 1LF5A 1HT2E 3B9QA 4DLVA 3RYTC 4TZ0A 1BMFA 1CJVC 1DG1G 2WWWA 1I4TD 4YQFA 5HZKA 1KMHA 3Q7QA 4PC2A 1CKEA 5AJXA 2WPDD 1VCNA 1IN7A 2RKOA 3PEVA 4Q7MB 4Q1BA 4RKEA 3V4FA 4UNSA 2VP5A 4D0NA 4EUNA 1GNRA 2GXSA 5IRCD 1CRPA 4MKFA 3SZRA 1TQ6A 1U9IC 4NYIR 4S35A 4DBLC 2RHMA 3IILA 2EYUA 4JBYA 4LOAA 4Q4HB 2F1IA 2ZYTX 4XD7D 1XJ0A 3U7EB 3U3MA 3AF1A 4KLNA 1C1YA 3HYRA 5DHAA 1GUAA 3SS8A 3CM0A 3QJYA 4JVSB 1F5NA 3M4YA 4P32A 2WIBA 2G3YA 3N2EA 1U98A 1ZBDA 3T1VA 1E2PA 1BH2A 3H4MA 1NRJB 1ESNA 1SZPA 2CK3A 1Z0FA 2J0UB 3IPYA 2BM0A 721PA 5DGXA 2MMGA 1KSGA 3ND8A 4MUBA 2V9PA 2QP4A 1CJTC 2BVNA 1AK2A 4OJQA 2H5EA 2FFAA 5KDDA 2IX3A 1RRFA 4LBZA 2GCPA 1A5TA 4XTRA 3EPJA 3S1AA 5AJZA 4B2PA 2CK3D 1G8GA 2H92A 2I1QA 1NJGA 4EQ6A 3AVTA 4PC6A 1G1MA 4V0MA 4Y0VA 4BFVA 4Q1CA 3GFTA 2DPXA 1U8AA 3TQCA 2RGNA 1G9XA 2BMFA 3IHLA 1H65A 2AWNA 3ICEA 2QI9C 1ETUA 3CRMA 3KKOA 2EVWX 1ZNZA 3AKDA 1P3JA 2QGNA 1N6RA 2XSZD 5FPHA 2BHRA 4H9GA 1HTWA 3GLGB 4URVR 2JLVA 5L3RA 2VSXA 1XFAA 4A8JC 1Z5ZA 2HXSA 4PZLA 5FTMA 3AVYA 1IQPA 4KBGA 1RZ3A 4MRRA 4OJKA 5EE5B 2VP2A 4BFYA 2BM1A 3DO6A 3QEOA 1SVLA 3T61A 3GLGE 3FFAA 2YWGA 1RRPA 5B58C 3KQHA 1QG2A 2Q9CA 2VSOA 5DN6A 4MYUA 4EJSC 4M21A 3QKSB 4GMDA 3P1JA 1VG1A 2DHRA 3AV0B 1Z28A 2NO9A 4HLUC 2VP4A 5E95A 4B3DA 2FE4A 4NMMA 4Z1MA 2IF0A 3TAUA 3X1ZA 2FX3A 3MSXA 3WYAA 4ESVA 1P6XA 1DADA 2QRZA 1E9EA 3QE0A 3O8CA 1OXUA 2ZU6A 2QP3A 3FHOA 2IUUA 2XEXA 2ZRMA 4EFMA 3F3YA 4NHOA 2QA5A 4KFUA 1GSIA 2WJHA 1EESA 2FN4A 4D0GA 4Z51A 3TSZA 4IEIA 2ZE5A 3E1SA 4B34A 3A1TA 4JLNA 1R4AA 2HLDD 1R6BX 5K8IA 2VP0A 2IS1A 5JWHA 1NBMA 4DLYA 1TQ4A 2VHJA 1GL9B 4RZUA 5CIWA 3PVSA 2NMVA 1RVDA 1G8YA 1G64A 1YJ5A 1ZNWA 3K0FA 1XX6A 4C0SA 3IHWA 2G77B 2WMOB 4EFLA 1LFDB 5JCPA 2ZRPA 2DWOA 1I4LD 1II0A 2IEYA 2IYQA 3K0FB 2Q6TA 2ZR0A 3ZVMA 3K09A 2W00A 3L2OB 4NYJQ 2XZPA 1ZD8A 3C5CA 4FINA 2GWHA 1XXHB 4EIWA 1KK0A 1T6NA 4KBFA 5SZJA 1KO1A 3AVXA 2N42A 4OQFA 3K70B 1W5SA 2WJGA 5TY0A 1OLOA 4LYAA 2PLFA 2ZRLA 3A1WA 3KXIA 4NCKA 2YC2C 2WJYA 2ZI9A 4PC7A 1WA5A 2LCFA 4QJ4A 2FG5A 3LQQA 1S9DA 2QENA 5EP1A 1E0SA 4TYWA 4B3BA 1E2EA 1Q1ZA 821PA 3KUDA 3W3ZB 4FMBB 2ZJBA 3U7FB 1JI0A 1G41A 3RHFA 4P4SA 2KI5A 4LHXA 1Z08A 3U4QA 1Z6YA 1Z6XA 4DSOA 2H1LA 3GLIB 1A2BA 1W46A 1DELA 5FOXA 4Q47A 2MSEB 4WXRA 5KDLA 3U7HB 3NDBB 3VU9B 2Y8EA 1ZC4A 1XMVA 2R62A 1Z06A 3REFA 4YMUA 3SOPA 4OHVA 4HLQB 4Q48A 5J4LA 4JLJA 4TLCA 5FPKA 4F38A 4YXWA 1KSFX 1ZINA 5TARA 1FMJA 3V00A 2ZJAA 4M1TA 1S4QA 2ZI5A 1V43A 4DUGD 4AI6A 2RGXA 1E2MA 3I72A 3FE2A 3SJZA 2FH5B 4TL8A 2MMCA 1Q57A 2HCJB 4W9MC 3G0HA 4LY6A 4EPYA 2DFNA 3ADKA 3FKQA 3ZDQA 2EFEB 4KVGA 2BDTA 2R2AA 1WXQA 3TH5A 3ZD6A 2J1LA 1RKBA 4URYR 2C9YA 4GRAA 1E2HA 2AXPA 5IT5A 5C4GB 1R5OA 2A5JA 3N5CA 4C9BA 4ESHA 2IYXA 1PJRA 2PZFA 4JMPA 2QEQA 2CXXA 3AUYA 2JJ2D 1U0JA 4IOLA 5FOWA 3KQUA 3DKPA 3LNCA 4JS0A 1XD2B 4MRSA 1NIPA 4PAQA 4UNNA 4CT5A 5BXQC 2R8RA 4UKDA 2O8BA 3PJRA 1VYVA 2Z4SA 1E0JA 2WJIA 5AUQA 5J4KA 2QNRA 3HPQA 3LBHA 1U90A 3WMFA 1CRQA 4G5RA 4DDUA 2GXUA 3NH6A 2ZRFA 4M9QA 4MRNA 5FL7D 1F6BA 2GTPA 1E69A 5FH9A 2AR7A 3NHBA 3QPWA 4Q9IA 5J4HA 2P6RA 1ZP6A 2GJ9A 3PENA 4HDCA 1E2LA 1MO3A 1SXJA 3QG1A 3U3RA 1NN0A 4B43A 2WWFA 5FI1B 3AF3A 2X19A 3OIUA 1T4GA 3I3SR 4F92B 3QKRB 3FB4A 1EWRA 1VTKA 3OEED 5DI3B 5EP4A 2BMDA 3RNLA 1Z6TA 1P2UA 2IBMA 2WAYA 1GWNA 1ZM4A 2XB4A 1UDXA 2J7PD 4HEJA 3ZGXA 4C0JA 5SZHB 3K0CA 3I62A 1R0YA 2FSGA 1W1WA 1R5BA 3M0EA 2QGZA 2J7KA 1QHHA 2IYSA 1JR3D 1SQ5A 2J5XA 4E03A 1SGWA 4KSCA 2HJGA 3SJAA 3L8ZA 2P6UA 1UJ2A 4RZXA 4LV5B 4M1MA 1E2FA 3CPEA 2W6JA 3CIOA 2WVJA 3OFND 4RD3A 5F98A 5KSPA 4R71A 2VHTA 4JLKA 1BS1A 1WCV1 3WYGA 1W5TA 2DR3A 1TTTA 3AVQA 4JLMA 3AGPA 4ZIRA 1M8PA 1YZGA 3C41J 1YZKA 5B2ZA 2P3SA 4DSNA 3H86A 4CEHB 2HLDA 2VIIA 4TQ9A 3THXB 4GZMA 2QBYA 2JLYA 1XEWX 1N25A 5FI0B 1Q20A 2I1VB 1K8RA 1W4CA 5AR1A 2OILA 5J40A 4B6EA 1TEXA 1X8LA 2ERXA 3MUFA 4QBFA 5CDFE 2KBEA 4G1UC 2AD1A 1LW7A 3MD0A 1NKSA 3R8FA 3EIEA 1XP8A 4RSGA 2QAJA 2JLSA 2ZYUX 4QBIA 6Q21A 1E6CA 2XAUA 4HUQB 1DAHA 2VQSA 4XWKA 3EA0A 4GFDA 1PUJA 2YC4C 4M1WA 4RZ2A 4XIGS 4LYFA 1M7GA 2ZJ2A 4G0NA 4AG6A 4O2LA 1NBMD 3PG5A 3FHCB 1MH1A 4A6XA 4GP6A 1IAQA 4UJ3A 4AYWA 3BFXA 1UM8A 5DN6D 1E4YA 3IBGA 5KNDA 1NI3A 1ZVQA 4WZAE 2JLXA 1W36B 2YV5A 3DZ8A 4P4TA 1SHZA 3TVTA 1HQCA 1J70A 2GAAA 4PC1A 3THWB 3HU2A 2PCLA 2GCOA 1G16A 3GLHE 1KNXA 2B8TA 2OE2A 4NCHA 4FMCB 1SKYB 4YMTA 4Z54A 2BKUA 2QP9X 4CVNA 4CEHA 3P4YA 1KY2A 4AKGA 2PMDA 2VPPA 4JLAA 3T06B 1OH6A 1S3SA 1DAMA 3M6AA 5FBWB 4B3CA 3EPHA 3ZYCA 4ZDJA 2GEVA 4PQYA 2QMOA 1XTIA 1MRSA 2QL6A 2VH5R 1ZRHA 1AGRA 1QG4A 2D06A 3T1QA 3BOSA 2AL7A 3CPHA 1G6OA 4C4PA 3NC0C 1JEEA 4F4CA 4AG5A 2GF9A 3OAAD 3DHWC 4L15A 1D2MA 2GZDA 4B2LA 1O3YA 2WM9B 5GADl 4PANA 3EZ2A 3ADCA 3GPLA 1BYIA 2NOAA 3JVUA 4QRHA 4RY2A 4BZPA 4LI0A 4BLSA 2QTHA 1VIAA 2Z6VA 1G3IA 3T12A 2O8CA 1MO5A 5EXPA 2ZJZA 4EJSB 5CB8A 4PXAA 2Z4RA 3TIFA 1KAOA 4MGIR 2QQEA 5FPSA 4D4KA 1CTQA 4IHQA 1UF9A 1CULC 5J47A 1AA9A 5FBLB 2C5LA 3QI2A 2DWPA 1NKTA 5JHGB 2WTUA 5JJIA 2GXAA 4AYXA 2V55B 5JS7A 5AWFC 2ZPTX 1J8MF 4LSGA 3SHFA 1S0UA 1XCPA 2CHGA 5IHPA 1FUUA 1EFUA 5CJ2A 2ZAMA 2SHKA 4TZ6A 4RKFA 5FR1A 3ETLA 4NPHA 3CH4B 2PMKA 4QG7A 1UBFA 1TQDA 3VR3A 4YDSA 3ADDA 2CL7X 4I1VA 4BEJA 3VTKA 3QBVA 5ANRB 3O8DA 4C0HA 5DYGA 1VCMA 4TYYA 3QVVA 4OI4A 3CPJB 1YZNA 4RD2A 1FMLA 4IEEA 2C99A 2GILA 1Z0JA 1CU1A 1E1QD 4KITB 1R0WA 4MITA 4M0LA 3EAQA 3HU3A 3ZD7A 3RLFA 5DO9A 3LX8A 2OCAA 4LPKA 4NH0A 1NVVR 3NBZC 4FCTA 2OBMA 3CZPA 1I2DA 1AKYA 3KXLA 1YKSA 4OHWA 5FBVB 3VNUA 1QBKC 5KSOA 3EZ6A 2F1RA 5EXXA 4KV9A 4A2QA 2YWEA 4DIDA 2GESA 5FFMA 1FFHA 2GAOA 4FCVA 2EQBA 1IJFA 2YINC 4K81B 4NKRA 5CYOA 3P26A 2PX0A 1GKIA 3RRMA 1AQYA 1P75A 1YVDA 1G8HA 5JS8A 2ZM5A 4G5OA 3A36A 3K70D 3WNDA 5EZ6B 2ZETA 3WXMA 4DLZA 1N0VC 2XB2A 4CYMA 1JPNA 2ZU0C 4PQFA 1GKYA 1JXOA 3CW2A 3DDCA 3GMTA 1NNEA 1WBDA 3FOZA 3U4QB 3W34A 1UEJA 3P20A 3QENA 4Q66C 4TSFA 3UMRA 4JYBA 4C0QC 3L0IB 5G3ZA 1P5ZB 3RC3A 3VX4A 5C18A 2D74A 3GQBA 4Q7JB 4JSYA 1E1RA 2C98A 3GJ6A 1UDWA 4WA7A 1NSFA 4ERNA 1N6KA 2F3TA 2J59A 4C7OB 4FXPA 2ZITA 1EFRA 1V5WA 1O87A 4E5UA 4BLPA 4F7WA 2JA1A 2OEPA 2WKRA 4OQMA 4AKEA 3CZQA 5FUWA 3CRVA 3KQNA 2GJ8A 4MDFA 2GJKA 3U3KA 1JB1A 2ZI4A 3EARA 4TMTA 5FTLA 2FDCA 2ZUDA 3A4MA 1OB5A 1CJKC 1S8FA 2NPFA 2VTKA 1HH4A 1SVKA 4CF7A 1IXSB 2PT7A 4LJ9A 3DM5A 2BIFA 1CR0A 3B82A 3THYA 2WAXA 1KI2A 2J0SA 3B13B 2ECKA 4JL6A 4WOPA 2PJRA 2FGJA 1H8ED 3L0PA 4MRVA 3NIBA 5LB4A 4TYPA 2QT0A 2P6NA 2R44A 2GK7A 4OHYA 2VP9A 5EE0A 1OYYA 1IY0A 5JEDA 3LO5A 5EUMA 2D3WA 4JJKA 3SNHA 3IEUA 2FEOA 3MFYA 2G88A 5CIQA 4L5BA 3B1YA 2ZE8A 3UATA 2ZXUA 3AKCA 2O8EB 3AF0A 4DCVA 2QM7A 3L82B 2GZAA 2XZOA 2IS2A 2IYUA 2OFOA 2O8DB 3AUXA 3FMFA 1Q3TA 3BAFA 1YR7A 4IW3B 1T3HA 2GVZC 4RFSB 5LD2B 1GL7A 3ZQJA 5GJCA 3AVOA 4G01B 1A4RA 2D2EA 4NCJA 2BJWA 4IXMA 4DDWA 1FW6A 2ZANA 1XD8A 4B75A 3KKMA 2QU8A 3TW8B 1DAKA 3SJCA 1FUKA 2GCOB 2IEZA 5EZ5A 3BIFA 2PJZA 3NBFA 1N5KA 1J8YF 2ORWA 5KPJA 3PEUA 4NCIA 1MT0A 4QGFA 1G6HA 1W0JA 4QFMA 2X1VA 1FP7A 3IKJA 1OIWA 3K0AB 2OCPA 1E2JA 3GJ8A 4XOIA 2D7DA 5HKKD 1ZD9A 3REGA 2QPOA 4LCBA 4YONB 1VG8A 4PR0A 3IGFA 4Q02A 2OBNA 3SEAA 4ARZB 4S2EA 3KJHA 5TVKA 1Z2AA 1KDTA 4IFBA 4D26A 2ATVA 4EPVA 3T1OA 1J99A 2WSMA 2H18A 5H1YA 2O8DA 4C2UA 3OAAA 3OESA 4FMDB 3B1VA 2XOKA 3D7MA 1E98A 4M8NE 4Q5IA 5GJBA 2YOGA 2ZREA 3QXHA 5EXTA 1NVWQ 2G6BA 2RCNA 4AIIA 3RS3A 1U0LA 2ZR7A 2RHDA 1N0UA 2QQ0A 4V0NA 4HB2A 1P73A 4GT1A 5IF9A 5BN5A 4U7DA 3NDPA 2ZJ8A 3OE7D 4RVCA 3EASA 3R9IA 3I32A 2FF7A 3LVQE 1KDOA 1WE2A 2H16A 3OEHD 4YMSA 4XWOA 4EAQA 4IFEA 5L3SA 2O8FA 3AKEA 1G20E 2QSZA 4CT4B 1ZJ6A 4V0LA 2OCBA 2OFXA 1S2MA 4Q18A 4C0LA 4GPTA 4AY2A 3E70C 3GJXC 1KTVA 2AFHE 4KFTA 4X8HA 1CEEA 2Z0MA 3TRFA 3CLVA 1G3QA 5SZIA 2WPDA 1GZSA 1E79D 2BV3A 3TUIC 1WBBA 3VNVA 1Q1BA 1UBGA 4ZIRB 3HYTA 3TAHA 4Q4HA 4XVQA 4ACBA 1DTSA 2EU8A 2ZS9A 1MOZA 5JWRA 1S1MA 4RZ3A 3P27A 1M34E 1RYHA 1VHTA 2PCJA 5TXGA 2W58A 4OQLA 3C14C 4HATA 5IDVA 3GCGA 4QGHA 4II7A 4D6PA 2WWGA 1II9A 1VYUA 2R6DA 2A5DA 1G3MA 4ABYA 4DEYA 1W0KA 4BFXA 1XEFA 3E5HA 2QMHA 1F2TA 4W5JA 4DC9A 2IYWA 1VMAA 1KNQA 1TAGA 1Z8FA 2ZJYA 1U9IA 1XTQA 1BMFD 4WIAA 2ZI6A 1CR2A 2VO1A 4KVAA 5UKDA 4R9UC 3KX2A 5FR2A 3CNLA 2XTMA 4KFSA 4N1AA 3VHXA 1KI9A 1G4AE 1Q3HA 3CWQA 1D2NA 5G40A 1T5LA 5B64A 2IWHA 2P0EA 1AS0A 3HWSA 2BKEA 4A6PA 4LGMA 2BEJA 3PQCA 1KO8A 2ZI7A 3U2QA 4BFWA 2CJWA 3WRYC 4NYMR 3T15A 4DB4A 4HAVA 1NN5A 4A0RA 1YE8A 1HURA 2CHVA 4LBWA 2DBYA 1KAGA 4LJ7A 4ZKDA 1IHUA 4PPFA 2AK2A 3GJ0A 2H17A 2JIZD 2XJ9A 4KU4A 3RANA 3I61A 4JT4A 1KO7A 3QBTA 121PA 5GJVC 1JR3E 2NQ2C 1L4UA 4CRWB 2ZSDA 3SBDA 1P9WA 3X1XA 2FFBA 3EPKA 3KB1A 3DOFA 4GP7A 1LF0A 4FD2A 2R6GA 4HLDA 4PAOA 2CE2X 1OXTA 2YHSA 5HTKA 2JJ8A 4ASUA 3ZVRA 2YOFA 1RJ9A 2KB0A 4WAUA 4D4MA 2JLWA 3KTAB 4P31A 1KJZA 1WQ1R 2XTZA 4ZCMA 5FBRB 3B1WA 3VR6A 3DMDA 4WZBE 4A2WA 5FL7A 1EFHA 1CJUC 1N5IA 2ZSAA 3Q9LA 4XVRA 3MJHA 2HEIA 4Y0AA 4Q19A 4BZXA 2QBYB 2QMUA 4I1SA 1XU4A 2B92A 1E2DA 4FMCF 4LPSA 2ZE7A 2EFHB 3SU8A 4LJAA 4NTZA 1GILA 1KI6B 5L3VA 4KCGA 2RMKA 3VQTA 2QAGA 3I5YA 1ZM2A 1NG9A 3BERA 2C78A 2I3BA 4EPXA 1N2CE 2CLSA 1F3OA 2AWOA 4NE2A 5TMPA 2GBLA 2OXRA 1DO0A 1YZUA 2JGNA 4A4DA 4DCUA 1T8UA 5HR5A 1PZNA 1DS6A 4JKIA 4X8LA 1E96A 1XZPA 1P61B 1S1CA 3PCRB 1L4YA 3X2SA 4B48A 4XTCS 3DL0A 4B35A 3KB2A 4B74A 4BRUA 1P2VA 3U3OA 4I4LA 1OXVA 1YU9A 1T5IA 4EQ6B 4PO9A 3Q72A 1G21E 1N3BA 2RB4A 2ZSBA 4TTRA 4M1YA 1XJQA 4HZIA 1W48A
chains in the Genus database with same CATH superfamily
4TLBA 4NPAA 1RJEA 3LOPA 2W6NA 4MVCA 3AUAA 3LCMA 3L1HA 5AK5A 1RM3A 3SIPA 5KYUB 1PFVA 4P92A 4EGJA 2V4UA 3CF2A 1NUPA 1QE5A 2A1UA 4TKUA 5ER9A 3SHQA 1HDIA 5IBQA 2IHVA 2FUG1 4NNJA 5EJFA 2XF8A 3SX0A 2P41A 4MW0A 1GYPA 3C97A 4DNOA 4G4SO 2REXB 3A14A 3OUUA 5K9ZA 1J5EB 1E5XA 1ADYA 1BVYF 5DLQC 4F11A 2V45A 3BRQA 4HX2A 4G1MB 3ZU6A 4CKWB 4TTJA 1IXZA 2D7JA 3VMFA 1DC8A 3DKRA 4ICIA 3WMRA 1YS4A 4CQMD 4TTIA 1DXYA 3QFTA 3C3DA 3RABA 2XRYA 3LYLA 2QTMA 4JYZA 2Y6VA 1A82A 2CLMB 1GP2A 3OF3A 2IA5A 2QZJA 2O8NA 4N3GA 4ISCA 2P62A 3NQ41 4HV4A 3CX4A 2BEWA 3A6JA 3DYVA 3H84A 4X8MA 2G0TA 3I6IA 3LI2A 3N8KA 5DLPA 1U3UA 2GD0A 4WVLA 3U4DA 2C4MA 2BL4A 4ILEA 3ZWVA 3H7IA 1WB4A 2HKIA 3B2EA 2IFTA 1H4SA 1E9FA 2NZJA 4WGFA 2F3SA 1R0CA 2OSBA 4INPA 1P72A 4J1SA 1T6BY 1PX2A 4PRLA 3LX4A 5EKXA 1T36A 1HDOA 1XVTA 2Y1DA 1D6JA 1J97A 5LIPA 3EXIB 2WM3A 2H1IA 3N6RA 1IC6A 1PKXA 4DRZA 2NYAA 1NZFA 3B3GA 1XOIA 4LVCA 3ZWYA 4YUWA 1P18A 1TX4B 4HAYA 2OV6A 4CL0A 1BKDR 5H8WA 1YQTA 3ZQUA 3FGOA 2JCGA 4KGVA 3UQYS 1BHQ1 4NU6A 3TDNA 2ZJ3A 3HBFA 1U0HC 3KR1A 3FGZA 2QVCA 3UKOA 3T52A 1O9GA 1Z7BA 5TDHA 4YT4A 1JWAB 3MG9A 5JMPA 3S2FA 1NN3A 1JUDA 5JNSA 3EIXA 4N5DA 2P35A 3OEYA 4QBGB 3E48A 4UHJA 2X1LA 3GNTA 1VL0A 3C6KA 1BE0A 3BBLA 4KQ9A 4X62B 3GG9A 3F5SA 2BOVA 3GA7A 4AZTA 1S3FA 3TVYA 3Q6IA 3WK8A 1RTTA 3HQ4O 4DV5B 2ZSIA 5ALLA 4CM3A 4ER6A 3K5IA 1CDOA 2FA9A 3A10A 3FJYA 3DOIA 2RH4A 1IHPA 3JPYA 4AU1A 4YV0A 1RFLA 3MTAA 2ZRCA 1JGTA 1I6WA 3PHBE 4INJA 2JANA 5DEIA 521PA 4DG9A 2PGAA 1RCUA 2LCQA 5AVZA 3EVEA 3FSGD 2HWUA 2JIRA 3RTGA 1C4XA 1ZU5A 4KO4S 3NLLA 4GSKA 5ITZB 3AJEA 1FL9A 5IXSA 5K0EA 3M6LA 1BGWA 1MOPA 2IXDA 3EXHA 3B6MA 4GQAA 3RRYA 4QYMA 1PJLA 3VOBA 1E9VA 1XJCA 2RBKA 2C5FA 2TRSB 2YWJA 2A7QA 5JD4A 5ITZA 2VJLA 1JU3A 5KEIA 2D8MA 1Z7YA 2CXNA 2MINB 2PMFA 3AB3A 3OQBA 3FNIA 3THXA 4TT3D 4RSMA 1NNI1 4DXDA 3EIOA 1TADA 3KLBA 5GVRA 2X2PA 3R41A 3UYLA 3FTEA 3OOEA 1QRAA 1Y1RA 2C5HA 3DULA 4H18A 3VZSA 2IH5A 4CTNA 3FA2A 1FRZA 3DE2X 1RWKA 1N2CB 1DAPA 2D2IA 2ERYA 3UXMA 3UWKA 2YJ4A 5JRZA 1KWKA 3WK7A 1E3TA 4I5GA 1BX3A 1EMDA 3BB4A 3EWIA 3F9CA 3FPHA 3PCTA 4YTEA 3VSDA 4BE9A 4L9WA 2JGAA 4J0JA 2YRXA 1COZA 1GRRA 2WFAA 1D0VA 2VHVA 4G5HA 3RJ9A 5ENVA 1W44A 3CFYA 4KTTE 2R6AA 5IAEA 2CE7A 3HKCB 5KYWA 4HNQA 3S4YA 3DB2A 1XLUA 1P0PA 4C7KA 4RVSA 4O2AB 5J2TF 1JHPA 4QL3A 2IOHA 2ZRDA 4JB0A 2YYZA 2A1IA 3HR7A 3KP1A 4KFRA 1I30A 5A6VA 2VPTA 4IQ0A 1GGKA 2ETXA 5B30A 1SULA 1A2KC 3NHRA 3GX1A 1ECBA 3G8DA 3STUA 4AXBA 1W30A 1JBEA 1NSTA 2JVIA 3O3CA 1EM6A 4C07A 5A5FA 2NO4A 4HYYA 3MUEA 4M8LA 2H7XA 4E46A 1F2TB 3A58B 1P60A 5B6IA 3SLRA 5J1SB 4IUDS 4HZUA 4UUNA 4ENWA 3AJAA 2IF2A 1XG5A 4CG3A 2X7HA 4G65A 2EHJA 1TJ3A 1BJTA 5KKCA 4LHZA 1Z6GA 1ULSA 4D9MA 2O5CA 2R3SA 3DOOA 4L28A 2C31A 3NBAA 3M3PA 1PJ2A 1VOTA 1Z8DA 5BQFA 2RHHA 1ZD1A 3ICCA 3LA6A 2CDRA 1NJ1A 3WFJA 3SLKA 4IRUB 3GJYA 4BUCA 3WLFA 4QYWA 3ADBA 2HYIC 1C3OB 2W4IA 1QP4A 2Y92A 1VJDA 1UJCA 3PNVA 2QE7D 2RI6A 3Q8XB 5JSKA 5BWNA 2PZBA 1JJBA 5FO1A 5JPCA 1ESDA 4PCUA 3IUNA 1RBZA 3TMKA 4I1OA 1PEAA 1K1EA 3AINA 1R6XA 1GTG1 2UZ3A 2MSKA 2E48A 4BUJA 7ABPA 3PDCA 1SUAA 4BJHB 3UPUA 3I76A 4OVKA 3OTWA 1CS4C 2Q1XA 1CUSA 3U48A 3C85A 4UEOA 4Q12A 3MWJA 1H23A 1MABB 5KREA 3U5TA 3VVMA 1VI2A 2HHLA 1P62B 4BVEA 5A4FS 2QE7A 1TQ8A 3G7NA 1IL0A 2WTAA 2UZIR 3KELA 3T3HA 4TS1A 4QU0A 1ABFA 1J7JA 5HZHA 4JY7A 4MOWA 1MOQA 2XLBA 3NOQA 2PUTA 1FZQA 1P4SA 3LWNA 4JENA 4B0OA 3MLBA 4L75A 5EJ9A 3S2SA 1QU3A 4QYIA 3H65A 4FSDA 1OBCA 4MNTA 5CLJA 1EK2A 2PH1A 3DGEC 1EVJA 4DQ0A 3TR6A 4KZKA 4ZI7A 3GPDG 1M1ZA 3TLZA 3QU7A 1O6BA 1EDBA 2JD1A 2OHOA 2QK4A 1VPVA 2I7XA 5GGYA 3GBPA 3T35A 4AKHA 1PJ3A 3A3PA 2EL9A 2J7PA 5IAJA 3USES 2FPGA 2YWBA 5B37A 1EDZA 3EUFA 221PA 2GJAA 3HDTA 4HFJA 1TD9A 3I0ZA 3SHOA 5J2UA 4MUFA 4DHEA 3ZHSA 5BQ5A 5GOTA 2JNWA 5K4GA 3EUWA 2X8JA 3I1JA 4KOAA 4R98A 3BIWA 4QSHA 2R4QA 5IH3A 2HHJA 1PLJA 2IYZA 4D3FA 1N6OA 3WHLA 1NOIA 2D54A 1ILEA 3F6BX 2JFZA 2VJDA 4J43A 3RHSA 2O8VA 4YXWD 4K9MA 1QSGA 4ZXPA 1Z5WA 1OH8A 1II8A 4HLUA 3QXCA 5IT4A 1ACLA 2J9YB 3ZDBA 1K06A 4ZOLA 2NIPA 1BMDA 4O4LF 3Q8WA 3OE4A 4J0FA 1IATA 1OLUA 2FWBA 5FAKA 2AC7A 1VLLA 2YZGA 4L78A 1FDVA 4EHDA 3PE4A 1DC3A 3QJ5A 3IX7A 2Q4BA 1KVQA 4WGGA 3N2ZB 2GF2A 1L7AA 3HNOA 5DZSA 1KJ9A 5C31A 1THZA 3I30X 2JLRA 3IAHA 1ELOA 4IFTA 3UO8B 2F3UA 2PKXA 3AUJB 3RHTA 3TRIA 1T2EA 4C0AC 3S8MA 3A6FA 3UK7A 1UPFA 1Z25A 3OX3A 2GEJA 4G2TA 2YIVX 1B0UA 4R2IA 5G3YA 3ZE1B 3SIWA 1Y9AA 4ZZ1A 3AONB 4MWOA 2HIAA 4R41A 1DVRA 5G53C 4QTYA 1E6MA 2C8VA 4I81A 3E15A 1OF1A 3FTCA 4N8EA 1ESMA 2AOUA 1K98A 3LXXA 1MAWA 3D8BA 4DLUA 4LS3A 4DLTA 3IS3A 2HSEA 4QXQA 4WCVA 3RSLA 4ZCLA 4F2GA 1YOVB 2O19A 1REQA 1SQ6A 3BQ9A 1OFTA 1JR2A 3C87A 3H2ZA 4TV8A 3WLOA 2E0IA 1DAIA 1XZIA 2I3DA 3JY6A 4PZPA 1CWUA 1KXJA 1CVRA 2FEXA 4PLTA 4O4JB 2FVXA 3RRFA 4TMVA 1I8TA 2HDWA 4S3MA 3RAPR 1JEQA 5B3JA 1NP6A 4NF2A 1RE0A 4DT1B 5DTQA 4W1QA 2XY4A 3ZTWA 4EO7A 1VGQA 3AIOA 4M87A 1C9YA 3E18A 5CA0A 5AVTA 2SICE 4UTXA 4WEQA 4AY5A 4ZEMA 1KO5A 4ZPXA 2ORED 5FOVA 1H6AA 2NU7B 4ZYXA 1QOPB 2K7ZA 1Y42X 3G2QA 4FP9A 4BGIA 5ALUA 1PJAA 4MH0R 4XIFA 2BGRA 4HNVA 1H8HA 1V95A 1W47A 2ZWVA 3AIKA 2FN7A 2UZ0A 3AGQA 3ITKA 3EWSA 5C1IA 3T3PB 2CNOA 2DSTA 1RQPA 3ROXA 3SZLA 1XKTA 1B1AA 3HM2A 1FVHA 4ZDWA 3FWZA 4Q4AB 5TPZA 3UHPA 5C3MA 5I7SA 4TL9A 1YE5A 4L9SA 2JCBA 2DRIA 1RDFA 4URZR 3J81k 2PWZA 3WGLA 1GVNB 3OP1A 3BXEA 4M1KA 4P53A 2CL0X 5K7SA 3MYYA 3T0IA 1XLTC 4D3XA 4JI2B 4X3CA 4KAXA 2PEZA 4OJMX 4S1TA 4RLQA 3EGEA 3NHZA 4WFQA 4EM6A 4EYEA 1QTIA 2O0JA 5L4NA 3JQBA 5TIIA 2FFQA 1RXWA 5FB3A 1V8BA 4DVJA 3LAWA 5CFMA 2EKZA 5FOUA 1IOVA 3EBPA 1O4VA 3WIBA 4R8MA 1FLDA 4AIRA 1AS2A 4TM8A 2PU7A 4M7RA 3U62A 5HG0A 2DSNA 3GLQA 3NS7A 2PGXA 3KEMA 5EJ5A 2VHZA 2PFSA 4MUAA 1AGPA 2C00A 1OHHD 2CLLB 3B2QA 1CB0A 1J22A 2OG2A 1OILA 3GH3A 4OH1A 4RMIA 4UM5A 5AVWA 3IVRA 1T1GA 1Y4DE 4IQGA 4DLBA 2YMPA 4LJ4A 1A9OA 2WIFA 4MLDA 4TTQA 5K3FB 3W3AD 4QTZA 4CM8A 3GLFA 3CF4G 5KYYB 4X1IB 5IF3A 1AXGA 4JVMA 2W2NA 3QEJA 4N5HX 1E3WA 4HB3A 2BFDA 3FG9A 2CFRA 1T1EA 4KIGA 2OORC 2JFYA 2Y9MB 2FPPB 2ZJ5A 1HSZA 4ITRC 3VO2A 2C42A 3PGMA 1GQRA 3WV4A 5JNWA 1OOEA 2XE8A 2EQ5A 2QGFA 4RE6A 4RY9A 3D5EA 3TPCA 1VKJA 3RK1A 3OPNA 5DNYB 5KQMA 2RHLA 4JA2A 4WXHA 1LS6A 3I1YA 1AVTA 1JPUA 3OFVA 5IM5A 2G9NA 3UV7A 1WMSA 4D82A 1KP9A 1P2SA 1PD0A 1UKYA 2ILVA 3FTDA 1LUAA 3I37X 4Q6WA 5FT9A 3TKYA 5JAMA 3FX2A 1WD7A 1VBNA 3TNYA 4AJNA 1UMCA 4W9RA 3OZXA 3S6JA 2ZTUA 5ILOA 5J9FA 1FU7A 4MCAA 1KHTA 1NXQA 1IMOA 4PHCA 5KSWB 1VI6A 4X54A 4PLZA 5BVHB 2D0IA 4GI1A 1DI0A 2VH1A 3TIGA 2QRVB 2XVAA 1G59A 4UM8B 4A36A 3CR8A 2VJPA 4GMXA 1NBME 4Y9SA 3ZZ0A 1EFVA 1YFLA 3GR6A 2NPIA 3TBKA 1H2HA 3FVVA 2J3LA 1Y5IA 4HNHA 1Y82A 4J4HA 4JL5A 4KI0A 2P65A 1UH5A 3BWYA 1DDOA 1EEXB 1H2YA 2YY7A 2DFVA 2F64A 3W8FA 3N6VA 4LRWA 4PYIA 4B6OA 1W88A 4WKNA 2P4SA 4ARAA 4DA7A 1NDQA 1AM4D 3IMGA 5CA0F 1GQYA 1KDYA 3IP9A 2WIAA 3UUEA 5TGDA 2IL1A 2E4WA 1H1DA 1J9GA 1TB4A 5HCNA 2WSLA 4JKOA 1CY7A 1YZLA 2RHTA 4TLLB 1EWTA 3QWIA 1TKAA 2CXPA 4X95A 3ZK7A 5KINB 1QH1A 4I46A 5IWAB 2RAVA 1NLZA 4ZVMA 4R7TA 1KVRA 2XZTA 3FI0A 4Z5XA 1Q91A 1E6KA 2VDNB 4IO0A 1QR6A 4MINA 5JCOA 4C5AA 1JFFB 3HN6A 4IHJF 3MWGA 1XALA 4PSKA 4PZCA 4DILA 1R4NA 3EIFA 1YA8A 2GO1A 1L5WA 1M6YA 2DUJA 3GLTA 2W2LD 4HRXA 4NV3A 4WK4B 4AF6A 2PFGA 4EELA 2DLNA 4BRSA 2R8XA 2I3ZA 1KK3A 1TLLA 3JVDA 3PLAE 4N5MA 1Q7BA 4MP8A 1MV8A 1MBZA 2IGBA 3G79A 3I8XA 4MVYA 5KSYA 1R4MB 5GWXA 4UU8A 2KWIA 2YUIA 3ZGYA 3AR9A 3JZFA 3H4VA 1LBHA 1GU1A 3LQ4A 5EHQA 2IH2A 4ZGWA 4KSYA 3L4SO 1W4RA 5FFMA 1KO4A 1PK7A 1ZGGA 2CKDA 3AEQB 3IQFA 4FQ5A 1E1LA 2O59A 2YHUA 5CK4A 4LRYA 2VHCA 1IUNA 2ID9A 2YBEA 2P8JA 3D8NA 4GX5A 2Q6LA 3G1WA 5K3BA 3SZ3A 3SMVA 4CM9D 4OBWA 1OFGA 4TM7A 2VPQA 1NLYA 2FN3A 4LHWA 5HKKA 2X0KA 1AN0A 4XWWA 1G3UA 1R9MA 2ICAA 2O0LA 4GRDA 1ADJA 1LK5A 4L8FA 4XH9B 5JJKA 4P2BA 1CVIA 2EARA 4MGKR 1QHIA 4LE1A 3HMQA 3QQ5A 4AURA 4ZI5A 4JKYA 5TPWA 4PLGA 3RS8A 4E1VA 2XNJA 3KT3A 4MCJA 5F1PA 4YMVA 2YIDA 3QF4A 5U4XA 3UAWA 4XSGA 1ZH6A 3M1YA 4DV2B 3VYUB 5DXFA 3W1EA 2VTBA 2FMHA 3DLIA 3BD9A 3R6GA 5CRIA 2P6MA 1YS1X 2Y3IA 3SD7A 3VJRA 1SOMA 1XDDA 2BJHA 1CIJA 2HF8A 4JZYA 4YBZA 1GPJA 1LLCA 2M1ZA 3BILA 2ZIUB 3C7KA 13PKA 2P9BA 4GYYA 5DSZA 5AO9A 4LXUA 4O4IA 3CUWA 1B2LA 4N7RA 3KYIB 1D7OA 3ILYA 2CJWB 1BRMA 1G55A 4W1SA 4DFDA 4QFCA 3TLGB 1Y33E 4DCTA 5D5HA 1NJFA 4NOJA 4UTNA 5K20A 4QBHA 1R0RE 3Q7EA 1KMHB 3VHRA 1E92A 3ELBA 1XQYA 3H83A 4N3BA 4PWYA 1RI5A 2H59A 4Z0HO 5DM70 2W2OA 1SH7A 2Q4TA 4MR7B 5C53B 2KSQA 3ZW8A 5IJ0B 2CLCX 4WOBA 3EMDA 4BNMA 4BFLA 4KPFC 4M36A 4Q1VA 5JD3A 4DC1A 1GLVA 4JOSA 1CSEE 3BWXA 3VV2A 4LZPA 4ZZ0A 1I5RA 3E3NA 3IQWA 4REQB 1P0IA 1Z2EA 1CLUA 1JEAA 5HE9A 4CGZA 3OHPA 4GVLA 1ICEA 1KK1A 1YZQA 3AX6A 2VHQA 2ZAYA 2GRJA 3MCUA 4FHCA 4DA6A 4NBSA 4JJ8A 4PNZA 2PMEA 4JYAB 3FZYA 3MCZA 1EWQA 3T7KA 1YRQA 3DJFA 4GEKA 2CVFA 2V8BA 3WB9A 4MGYR 1I7DA 2QD2A 3ND5A 1U1CA 4M0MA 5HQTA 3I8SA 3ADOA 4REMA 1RBYA 2JHPA 2P5TB 3GROA 5CH5A 1CVLA 1W49A 1L1QA 3FNFA 2DERA 2PPLA 5EE3A 3AG5A 2YNMC 3TZHA 4PPNA 3KLNA 4YRNA 3MC1A 4JEIA 4ZVKA 4GH5A 1C29B 4D1YA 2F1HA 4PXSA 2BMWA 1GZ3A 1QGOA 3D3EA 3N8GA 5EG5A 4FKBA 5EMHA 3TOCA 4MQBA 2C2KA 2WHPB 2MTBA 2HH9A 3L0SA 4LZWA 4GU5A 2WUVA 5IVHA 4JXZA 1EM8A 2Y1KA 1H05A 2NUTB 3CR3C 3IVCA 1T0JB 3OURA 4E5DA 2JATA 2L69A 2B2XA 3LXRA 2A35A 3QOYA 1E3QA 3QWAA 4MQMA 3RRZA 3HCFA 4W63A 1UODA 4X6LA 3WOVA 1MO6A 3BREA 1Q44A 4JAVC 4JYMA 3ZZUA 1F20A 1FTWA 3IEVA 2BPOA 4XD2A 5JAUA 1J56A 1C1XA 4B7ZA 1M6EX 1P9OA 2OD2A 1N6NA 1Y9EA 3GJ7A 3JASB 3N0TA 4CI9A 1HYQA 2P27A 1I33A 3HDVA 4FKZA 1U2DC 4QUBA 5DX0A 1EH5A 4OATA 4MMYB 4NCNA 5K6RA 1RWQA 3ES9A 2EHDA 4PC3A 3K0EA 1ZGAA 1K6MA 2D1QA 2I1LA 4U02A 4XXHA 4YEDA 2XE6A 2WICA 5TT0A 2FPKA 3SJBA 2XCTB 3OT1A 4CEIA 2J6BA 2WFMA 1D5WA 3A4TA 3BYZA 1CIPA 3LNTA 1N1EA 3E3LA 3FFTA 3GGDA 4OHUA 1RFGE 2IYVA 4P5PA 1JQDA 3RVDA 4LMBA 4NH4A 3DBVO 5JRDS 3IV7A 3EDOA 1ZA1A 3VR3D 2VF7A 1QGUB 1QDEA 5DX1A 1YRBA 4M46A 2TSYB 4OB8A 3TB6A 1K5GA 1VE1A 2B99A 1E7WA 3EDYA 1DIRA 1IHOA 2GK6A 3KRTA 1JAIA 2Q29A 3JQAB 4FOTA 3WLAA 3U0VA 5J5CA 4DMCA 4A9AA 3KOWA 1P3DA 1NW5A 2MYPA 5FPTA 4ZGGA 2PRIA 4PY2A 2J0UA 2C8LA 2J3MA 1D9ZA 3CF4A 4O3MA 2CXOA 4QXAA 1IBRA 3E9ZA 4NLLA 3A1FA 4JASB 5LC1A 4JI4B 1MX9A 2PLNA 1O89A 2G07A 2NGRA 3B5IA 4LNHA 5DHTA 1SVIA 5E7IA 3RTBA 3L8FA 4DABA 5F21A 1JKJA 4Q05A 5DSTA 5AIBA 5KC8A 4RPCA 2Z8YM 3IDQA 4LTMA 3IBFA 2I2WA 4TRMA 1EUCB 1C7ZA 1SXJC 1ISMA 3ZIAD 2BMEA 1DLIA 1VPTA 1CYDA 2H1RA 4UE2A 1EX1A 4F4JA 4CLRA 2BUBA 4K3VA 3SF8B 1FSFA 2QX4A 4MW9A 5LFAA 5LL6P 2JD2A 1M2JA 2C4TA 1NN1A 1O6ZA 4RU1A 4JOQA 2XUGA 3DMFA 3GVPA 5FD8A 1Y34E 4FNGA 4GOJA 4PX2A 4MV3A 5ESDA 4LJKA 4MKGA 2B37A 4HGOA 1QVRA 3UV6A 2DJIA 4OKIA 1Z4JA 2PWBA 3H3JA 4R6XA 5BSHA 5JEEA 3GLIA 4YRFA 2VNJA 3ECSA 2JAQA 5C37A 3NTUA 5J1TB 2GH1A 3LY9A 3MINA 3GLGA 1OLXB 4QGAA 4FKMA 4JLBA 1NP7A 2O3JA 1E1RD 4C5BA 2B9EA 3WNBA 1FDIA 3A1CA 2YWFA 3BH6A 4WINA 4BAZA 2XNCA 4BL5A 4BNXA 1GUDA 2QE6A 4LJ5A 1GQSA 2CDAA 3I4CA 3RKRA 1D4AA 1KJJA 4J16C 5JAHA 4B3XA 2PX6A 2ZDQA 2Q5QA 4TV8B 5FYQA 4CR6A 4JC8A 3DQZA 4P58A 2I55A 3MMSA 1ECGA 2XXAB 1PHRA 2FNAA 2BZ0A 8OHMA 4EKNB 2NUPB 3ANSA 3AP3A 3ZW9A 3NKVA 3UQZA 1V47A 3BXGA 4PEVA 1G8PA 1P4RA 2VYFA 5JSZB 2ODBA 4EG3A 1G8MA 1H8EA 4OSPA 4HDKB 4C04A 4C0WA 5I51A 1E9AA 2FMKA 1NUUA 3AJRA 1S2DA 2D5CA 3MT8A 5AOVA 4EZEA 3ND9A 3C4JA 2D0OB 1WLYA 3OMWA 4LFCB 3TLYA 5DM4A 5T3UA 4BKOA 3THOA 1N9ZA 3TD2A 2N1MA 4CEJA 3F5DA 1YR8A 5EC8A 3RJZA 1Y63A 4LDAA 1GITA 1F12A 1GAJA 4LIPD 3OKPA 4BV9A 3HXQA 3NWOA 2FUNB 2HHHB 1L5HA 2WJVA 4QUHA 3DHYA 3I5MA 1E8DA 4OHKA 3JYQA 3GQVA 4BMPB 1TKCA 3MBKA 4QLAA 4D9NA 2GBIA 1IZ7A 1Z0ZA 3JVVA 4F12A 4ER5A 2N0SA 2I67A 3BJEA 3C45A 4BGUA 3HB4X 4RKWA 2JW5A 5HF6A 3BGSA 2E37A 3VH4A 2VA8A 5AM3A 4KAFA 4NE9A 5K2MA 1D8TA 4RPIA 2PKQO 5LQCA 4BQEA 3GEHA 1PT9A 1N77A 2GWRA 3WAGA 1ULAA 4LRXA 5KU7A 4UEQA 3U4GA 1AS3A 3GNQA 3EQ2A 2O3UA 4KXFB 3BH0A 4E08A 1ISSA 3AUTA 4BNUA 4BRZA 5A62A 1HX7A 2Y0EA 3P9XA 1XRQA 1IY9A 1FX1A 2RH9B 3BM5A 3EYAA 3M4ZA 2QZPA 3ASUA 3BWBA 1CZKA 1CXZA 1JHRA 3QKSA 4WH0A 1RXUA 4YJGB 4W8HA 5DGTA 3SBOA 1UXKA 5FOTA 5BN4A 4D3ZA 1EFTA 2ZEJA 3UMGA 4K6OA 1C2TA 2I2DA 1UZLA 1R0KA 2A67A 3AVWA 1F7UA 5KOJA 1GZ4A 1NMYA 1MXHA 2X3UA 3ISTA 5JPIA 5E9JA 1ZM9A 2Q28A 3K4QA 2QXUA 2QD3A 2FUG6 4PSUA 3BICA 3PHLA 3I92A 4XR9A 2R66A 4NQZA 2P1ZA 3KJIA 1UKVY 2H5JA 1Z2CA 2C3MA 2EX0A 3B7WA 4J3FA 4PHGA 4MJ7A 1TC1A 2AKYA 3FNRA 4N0QA 1NF2A 3HP4A 3MIZA 1I9GA 4U7JA 3MK31 1KJIA 4QDXA 2X77A 4YB8A 4DLRA 2A3NA 3HY4A 1G2PA 4UBLA 3VZCA 2O2SA 2CFSA 4UULA 3N6XA 1WIWA 3NUGA 1DFHA 4GM4A 4LWQA 4RV5A 2HUPA 3EW9A 4LSZA 1UOOA 2O7RA 4B76A 2ZTSA 1DEAA 2PWPA 2D62A 2XHZA 3M6IA 4DGQA 1ESZA 3E5NA 3BE4A 1NUQA 3VTFA 1XLVA 1G0OA 3EEIA 3HKEB 5KYVA 2J45A 3MNFA 4KNVA 3REQB 3V33A 4KRYA 5HFAA 2Q0HA 3MJDA 2PZEA 2CYAA 3LDUA 2OHVA 3P9PA 4M9CA 4EBBA 1AH2A 1HLFA 1J09A 1OZFA 2XMQA 3K1JA 1EG7A 1U7WA 2GS9A 4JROA 4QGGA 4EP1A 1C3VA 4LHSA 1B8VA 3T7IA 1EE2A 1SOVA 2A8YA 1GM5A 4PS0A 4CFSA 2DAPA 2MR5A 4NU5A 5JS6A 1W5FA 2PJUA 4E0BA 4QG3A 1MGOA 4H16A 4OHBA 1TCUA 3S44A 1V9CA 3E22A 1M0TA 5K0JA 4CF5A 1EVZA 2QYOA 3E4CA 1Z47A 4BX3A 5LB2A 3UK6A 3H9EO 1GTZA 4POOA 3VC7A 3FNBA 4ZK2A 2LKDA 4I6EA 2WZQA 1ZIOA 3DBHA 3IULA 3W90A 5ALNA 3KEOA 4BO7A 5L51A 2OV3A 1ONNA 1V7PC 4ZTZB 1X8KA 2WD7B 4QQKA 3OLXA 1W4AA 1ORDA 4IMRA 3T4PA 3WBFA 2DU8A 2O7QA 3WWYA 1OFIA 2IYLD 1LK0A 2QAGB 2RGUA 3GFOA 5DP2A 4H17A 3UJ6A 1Y8CA 4PNPA 4OP1A 1OFHA 4RJTA 4PSVA 1Z6QA 1VLJA 5CX1B 5F7OA 4BB5A 5J2TA 2GEUA 4CCAA 3OQ6A 4QJ5A 3T9FA 1M34A 1JAXA 3BAZA 1YV9A 4WW0A 1BDHA 1P2BA 4AX4A 2UYYA 2Q3BA 5E3HA 1PTJC 4MYDA 4QELA 2CUKA 3OPQA 3QXXA 3PTAA 3OCCA 2EJVA 2OV1A 1AMNA 2AUTA 3UANA 1VMEA 2AB0A 3WR5A 1ZVVA 2WSIA 3ELWA 3T9CA 5JSZA 1GZ6A 5IYZF 3RF7A 1UBLS 3UMVA 3ZDXB 5ARCA 5LMNB 3RYCA 2ODQA 4LTDA 4OHXA 2VDRB 3I9FA 1QQTA 2W6JD 1RAHA 1A1VA 1RQLA 1XYGA 2A3RA 1E89A 2PSDA 5A4IS 1YQ9A 2IOQA 5LYJF 2FZLA 2J5QA 2W90A 2F00A 3IEXA 5I5EA 4IMIB 1J0XO 3K05A 3SYLA 4C4YA 4EUHA 1V48A 3PQ7A 4TSKA 1CR6A 1H0RA 5FPYA 2J85A 2H11A 5GM1A 3MTQA 4P33A 3LUKA 4PS1A 1XZLA 4D97A 1A8PA 3AU8A 4EVIA 4A0HA 1Z0KA 2CEKA 1C7RA 2CEAA 2GA8A 2RGEA 4MW7A 3D8HA 3UJCA 1P5JA 2HREA 3L79A 4FZRA 4KH0A 5E4YA 2WQ7A 1L7VC 1LDBA 4DEVA 4EVSA 1N5OX 2OZKA 3RVBA 4WN9B 5CXUA 2AW5A 3DDHA 3M2PA 2C20A 1IDN1 2FLVA 4GGMX 1Z5GA 3L8GA 3LG2A 1EQAA 5DNWA 1VG9B 2V03A 4OGLA 3M6MD 2XNHA 5KYXA 5DK4A 3EC2A 1J23A 4C3OB 4D43A 3O4FA 4CZ2A 4OXYA 1M2EA 4YAUA 3VZPA 4R1LA 4J4TA 5DB4A 2IDKA 4KUEA 3TS1A 3UY4A 3B78A 2W70A 3FDIA 1CEXA 3OLYA 3MOIA 5KWEA 1US8A 4YP1A 2HNAA 2P5SA 3H16A 4O2AF 3ETGA 2PBRA 1FC0A 3JRXA 4UW9A 5F1OA 2O2GA 3DPIA 1KKLA 1XEXB 4OHMA 1RR6A 4TGLA 2PFKA 1KI6A 3D8RA 1PAUA 4RMNA 2FPLA 2XUPA 4PONA 4QA9A 4WX2B 4EHAA 3PGVA 5L3SB 1PWXA 3AHHA 2C57A 3DV0A 3Q3JB 4LMPA 3UJPA 3SAJA 5LDDC 3FI9A 3HZZA 4CQJA 1RXVA 1MQAA 5FDFA 1DOHA 3ILSA 1JBQA 2VRNA 4WT7A 5C7LO 2QY9A 4RFSA 2P2SA 4G4IA 2WLTA 2X76A 5B7NA 3TIVA 1R3DA 3KUCA 2NAFA 3IESA 5IN5A 4C89A 1TAUA 1JLRA 2IZ7A 1NKVA 4AAYA 1KOGA 2ZT8A 4P7JA 5A9SB 4QDTA 4ZHQB 2I78A 4IG4A 2I3GA 3V4VB 1YZ3A 1AJEA 1QF7A 3EA5A 3FVWA 2ZYRA 3VU9A 3E05A 2PUCA 4AS1A 3W6UA 3I12A 1U0EA 2IXFA 2FU5C 2J07A 2ZTHA 3C7CB 4P3XA 4TQGA 3CX8A 2BF4A 3CUTA 5IMBA 1RPJA 2WWHA 3HP1A 3I6YA 4QOHA 5EMLA 1DO8A 4JUFA 3PYMA 1SXJD 1NM5C 3AUKA 4L57A 4KE6A 4ARVA 1JDBB 2GNPA 4BO2A 4MV9A 4GUAA 4C6TB 3IUEA 3UENA 2OYCA 2D5IA 3QYFA 2IHYA 1MIOA 2QROA 3B1JA 3KE9A 4B5KA 2QLMA 2QPAA 4V0KA 4X97A 1YI8A 3IIEA 1F6DA 1TJNA 5IEBA 3B51X 4LRQA 3T5MA 1PNVA 2G5PA 2O4UX 4FFPA 3I2JA 3VUEA 2Q2VA 3C3AA 2QRKA 4OGFA 5KNBH 1RWBA 2H54A 1OAOA 4Y67A 3K9LA 5A04A 1A8IA 2X8LA 3ZWDA 4Z3OA 1K8YB 4BKUA 3ESBA 3U3ZA 2C61A 1HYBA 3RBXA 9ABPA 3ESYA 2CJFA 1X39A 2C3YA 2ZYHA 5DRYA 4I4TF 2GLXA 4WA8A 4ZREA 1FVOA 1ISGA 2WWIA 4M0DA 3BMQA 1QYRA 1KERA 2ZR9A 1QQAA 3IO3A 1HUQA 3LBAA 3CB4A 4K8RB 1EINA 4YI3A 4J91A 4IXDA 2C7PA 4LKOA 4MJXA 3NWEA 5JYDA 3P2MA 4NU0A 4JBHA 1I3LA 1U2RA 5B7GA 2F55A 1X7ZB 2GVDC 2ZM6B 4IVPA 2VJAA 1OPXA 1X6VA 1U8FO 1Y48E 1FNMA 1VGVA 3C8DA 3CNHA 3CUVA 1T0UA 1SXHA 3OMLA 2QZSA 2J6CA 4K9KA 4QUAA 4W6ZA 5H82A 5LVAA 1VBFA 2I6UA 5I7UA 1BIFA 3HBMA 2NUAA 4FQ8A 2WQ6A 4CIDA 3FWHA 1TK9A 2LTAA 2SECE 1UXGA 3B60A 1Q0ZA 4FR2A 5B6JA 1DT5A 2XUZA 4KXLA 1AC5A 3GP3A 4GX0A 5LM3A 4YA6A 4RX1A 1Z7EA 3MCWA 3EPPA 5TF4A 3RREA 4S1VA 3BWDD 2BFBB 5HDQA 3R0QA 1ENPA 1SO8A 1E6LA 2JAOA 4HWPA 1FLNA 3PUYA 3UT6A 3WIOA 1FDSA 4EABA 3I9OA 1PYGA 4FBGA 5T64A 2ECFA 2IPOA 3BWEA 1KI4A 2OCYC 1RPZA 5AW3A 1NBHA 1U7UA 3EVAA 4MTLA 1KK2A 2H5IA 5E4JA 3WMEA 4D9KA 1ZI9A 4RMGA 2ZSEA 4OOEA 3OM0A 4JQYA 1J1IA 4PHHA 2IYNA 5JAQA 1ORTA 1PJBA 1QGDA 3GEDA 1X42A 4KJZA 2CVQA 4ZO8A 4ZQEA 1J0CA 1THMA 2CW5A 3MB8A 4ED9A 4O2RA 1TAQA 3SFVA 1CUBA 1NE7A 1NIJA 5CK5A 1HDXA 4JLVA 4A91A 3HADA 3SM3A 5C34B 4YRJA 4B3RB 4WESA 2UVQA 3Q6NA 5HKOA 4F8EA 1YKFA 3CSUA 3GLHB 3CNBA 3OEEA 2IU6A 2GMWA 1FSSA 2OBYA 2YYYA 3CVVA 2HD4A 3B9BA 1NMZA 3QOWA 4TN1A 5ADHA 5JJ5A 3JVEA 4RIHA 3R9WA 3OICA 2CXHA 4KXYA 2XKKA 3LHFA 3KOUA 2I71A 2ODNA 1VHLA 3AZQA 3QIAA 1NVFA 1O6FA 1ZH8A 1XB2A 5K8LA 3ROPA 2R25B 1NVGA 3ZD8A 4B85A 4MQ4A 4MW4A 5D1NA 3ESXA 4KXQA 2PX8A 3WYDA 2JIMA 1SUWA 2R00A 4MK4A 1OWMA 4BS9A 1FY2A 2Z83A 4UXIA 4FWIB 5AKLA 1YH3A 5ENZA 1SG9A 2R2GA 3KQOA 4MSUA 1WTAA 1CYEA 1VKNA 1VRWA 3V1LA 1EK5A 2KLHA 3BQMB 2X14A 2OK8A 3D6UA 2F1KA 2JDIA 2XF2A 3FUUA 4G0VA 2VUTA 2BFCA 2PKEA 2QY6A 5LCXA 2IIQA 4KR6A 3CTPA 4MQFB 1CQWA 2YMQA 3MHPA 4FC7A 1MW9X 3H3FA 1M54A 5DHSA 1GNPA 2AVDA 4A23A 4K9OA 1XCOA 1K8QA 1XWIA 5COQA 3P9RA 4IIJB 4UNPA 5DNCA 3ZV4A 3I9V6 2IW3A 2Q21A 4GE3A 1ZOPA 4N3NA 4XEUA 5C8VA 1CPYA 3NT2A 2J0EA 2RK6A 4I4CA 4LXYA 3M6VA 5JCJA 3OT5A 4FN4A 4GC5A 3NHMA 3PWKA 4FU0A 1N0WA 5HOQA 2UVPA 4YDRA 3IPAA 2VBCA 4LCEA 4EMBA 4ZVQA 3TQSA 1BHO1 5ICMA 3DPUA 5C3UA 1LF5A 2V74B 1HT2E 4GR9A 3B9QA 4DLVA 3IH5A 3IQDB 2D1SA 1DG1G 5IARA 3NOVA 4YQFA 1I4TD 4L4ZA 5HZKA 1Z5OA 2JAXA 1VCNA 1IN7A 4MIYA 1UK6A 1QGED 1ND6A 5LYJA 4D0NA 2YJ6A 4MWSA 3X43A 4YMLA 1QUFA 3I9V1 2QR2A 3P4UA 1GDTA 2GN1A 2RHMA 3O9MA 1VPWA 3HUEA 3ZI4A 4MGHA 4Q4HB 2FWMX 4LKRA 4Z9AA 3WDSA 2BEWB 1ZGCA 3C98A 1XJ0A 3JSXA 3U7EB 1BHJA 3NKFA 1PK8A