4G0NA

Crystal structure of wt h-ras-gppnhp bound to the rbd of raf kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
164
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Effects of the Oncogenic RasQ61L Mutant on Raf-RBD.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords GTPase HRas
total genus 58
structure length 164
sequence length 166
ec nomenclature
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g0nA00
5CDFA 4EPTA 1KMQA 2D62A 2QM8A 3M6AA 4W9MC 1AKYA 2ZRKA 2VEDA 3CZPA 4JYBA 4HAYA 4JLNA 5H70A 2VP6A 5G3YA 3BBPA 5EP3A 2FDCA 3BK7A 2ATVA 3NXSA 3QG1A 3SFVA 4CYMA 1JNYA 3SQWA 4RZUA 4TLCA 2ZSEA 3OIUA 2O5VA 1OIVA 1E4YA 1K6MA 4RD0A 4B3CA 4EJSA 1XZPA 2FH5B 2H57A 2EW1A 2ZRFA 2IXFA 1G64A 3BFVA 2JLUA 1B0UA 1FUKA 1G3RA 4BECA 3LA6A 3O8CA 4XWAA 5CYOA 3FFBA 4GMDA 2XNDD 2NIPA 1UBFA 2UVQA 3W6NA 2WIBA 2O8BB 2V7QA 5JJLA 3GFOA 4HUQB 1Z0IA 2F3TA 2ZRAA 5EXXA 1CJTC 1M34E 3C5CA 1AQUA 4D4KA 2XGJA 1NJFA 3CKLA 2R44A 1N3BA 3LVRE 1NY6A 4EFLA 1B23P 1BOFA 1SXJA 1BMFD 5IF9A 4TYNA 4QM6A 1NJGA 4QGFA 3TMKA 2QEQA 3VKWA 1S8FA 4JLKA 3G5UA 1XTQA 2P6NA 2QORA 2ZS7A 4ZPXA 1FZQA 3RS3A 2RKOA 1J8MF 5HE8A 3KQKA 2ZI6A 4C30A 4LBZA 1YZLA 1UF9A 3UATA 3W5JA 1ZU5A 3CR7A 2B8WA 2XTZA 1E6CA 2RMKA 5EE5B 5FPYA 4DLZA 1ZP6A 1W36B 1E9EA 3MAAC 2KBFA 3VX4A 1E2KA 5CYPA 1W2HA 4C0JA 1NLZA 1XCMA 2BM0A 3WYFA 1Q1EA 2IS6A 2SHKA 1CF4A 1T0HB 4HSEA 3H0KA 3AUXA 2PCLA 1N5JA 1IHUA 1IONA 1TF2A 1G3QA 1G7TA 3D6TB 2IWRA 2ZVPX 2IC5A 4HAZA 4W7SA 2PZFA 3BD9A 4Q5IA 4I1UA 2GF0A 2NO1A 2REBA 1J8YF 2JJ8A 4ESHA 1E9BA 1YZKA 4BEJA 1AK2A 3MD0A 4PSKA 4UXHA 1IOZA 2P6RA 4JT2A 2WJYA 5JMTA 3MUFA 1WB9A 1ZNYA 1NBMD 4RD6A 4Z51A 4LGMA 2N42A 4QBHA 3EZFA 3PVSA 4YDHB 3BRWD 1HA3A 2Q6TA 1Q1QA 1MH1A 3ZZUA 2BEKA 2WMNB 2ZSAA 4AK9A 2IEZA 3R9XA 5AUOB 3C8UA 5EXPA 3VHXA 2O8EB 4KSBA 4M9XA 3OFND 1XTKA 3AH8A 3DEFA 3A1UA 5A0FA 1NN5A 4FMBB 3A58B 3RHFA 4JSTA 1E1QA 2UZIR 2WZQA 1MO4A 5J40A 4BWYA 4Q9JA 3P27A 3SQXA 2ZI9A 2AL7A 1Z6YA 1G21E 1AN0A 2Z6VA 1HEIA 3K8YA 1R6BX 3CUEF 1AS2A 3QXSA 4JLVA 4L15A 3QKSA 3T1OA 3ZIAA 5GADl 1DE0A 5DNYB 3QF7A 3B5JA 4QNRA 4ASUA 2O8CB 3OAAD 2EYQA 4I99A 2C99A 2P5TB 5FPTA 3CX8A 4LZZA 4OL0A 1XDBA 1ZYUA 5AJZA 1KK0A 1OKKA 2ZRDA 3LRPA 4TYYA 1T5LA 2QBYB 4R2IA 4DLXA 4BZXA 3RAPR 3AF1A 5FBQB 4D82A 4OQXA 1MV5A 3K0FA 1R4AA 4M9ZA 4B3FX 2ZM5A 1Z6AA 1E1RD 1OPXA 2G83A 2YINC 3FPAA 2FV8A 1OXSC 4LPSA 4ZDIA 1QHNA 2PZGA 1FUUA 1V5WA 3LBHA 2WJJA 2RGAA 3HR8A 1OF1A 4JKYA 3MGCA 5HPYB 4DRZA 3UG7A 4TN1A 1E99A 4MYCA 2Z5FA 4PAQA 3O8BA 4TYPA 2O0JA 1HQCA 3UANA 1DAHA 3AVVA 2P5SA 1CR1A 3HU2A 4RFSA 3K1JA 1WP9A 3MLEA 2VP9A 4A0HA 2W58A 3WYGA 1TMKA 3ASZA 3CBQA 4LY6A 1N5LA 4QKQA 2HYIC 4YLGA 3K70B 4JVLA 3IEUA 1U8AA 1U94A 1X1RA 3LW7A 2IUTA 4BGDA 3NHBA 2ZI7A 3R8CA 3EAQA 2JJ1A 1LW7A 4JLPA 1JJVA 1XEWX 3U7EB 4B47A 1E0KA 1GOTA 1VG0B 4M21A 4XD7D 1PUJA 4PZLA 4B75A 5TXGA 3MMPA 2J87A 3MJRA 5J4YA 4MA4A 4BFVA 5F3WB 2EWWA 2ZE7A 2FEOA 3N2EA 1TF7A 3I5YA 4DDTA 4LJYA 2RGEA 3UPUA 3VNUA 1ZINA 5JECA 2HV8A 5EZ6B 1XD9A 1E9CA 4YMUA 4BUJA 1Z83A 4AKIA 1BS1A 1GRQA 3U6BA 3AP1A 2VSOA 4HZUA 4GOXA 1ZM2A 2XB4A 3CRMA 5KNDA 2FX3A 3BH6A 1Z07A 3W8RA 1ZU4A 3R9IA 1E2EA 4ARZB 1L4YA 3WBKA 1N5IA 4I4LA 4M1SA 5B2ZA 4DLTA 1Q1BA 2IXGA 2C03A 2CL7X 1TQDA 2FOLA 4JLJA 5CM8B 1XD8A 4Q03A 2IF2A 3AP2A 5CM9C 2ANCA 2BCGY 1G20E 1U9IC 2VIIA 3LBIA 3B1WA 3U3JA 4A2PA 2AD5A 4AG5A 721PA 5BYKA 1ZIOA 1PLKA 4U5XA 1QVAA 4US2R 4L9SA 2CJWB 5LD2B 3FE2A 2PMKA 1L2TA 2CLDX 3NVAA 3QF4B 4Q02A 3WP0A 4ARZA 1A4RA 1ELOA 4LV5B 4MYTA 1KI1A 2A2ZA 1EXMA 1JXOA 2V4ZA 3IQWA 3LO5A 3SHFA 1Q44A 5KPJA 1F2UA 4NPHA 4ZCMA 3T06B 4GFDA 2C9OA 2BVNA 1XEXA 3U7GA 1D6JA 5G3ZA 1GNQA 3IQXA 3TUIC 4P0TA 5HZKA 2Q9CA 4BFXA 2AR7A 1P60A 1SKYE 1DPFA 3KXIA 3ZLJA 1VCOA 3ZD6A 4LHYA 4I1SA 2A5JA 4Q7JB 2GXUA 3RNLA 3ZVLA 1ZNXA 2QP3A 1N6PA 3B60A 3FKSD 2GVDC 3A1VA 2HXYA 4PFSA 2CVHA 2FA9A 4IEIA 4AYXA 2WJGA 2CLCX 3GJ4A 4RKEA 1I4LD 4XVRA 3QOFA 2FEMA 4OYHA 4OI2A 5DO9A 5ANRB 3IDQA 4B33A 2VTKA 4HB2A 3RSLA 3L0OA 3KXLA 1SVMA 4PZYA 4C7OB 4Q9LA 5HZHA 4DCVA 4FINA 4HYYA 1YKSA 4HI0E 1OHHA 2WPDA 1R5BA 3AVOA 4Q4JB 4EJSB 4A4DA 4P31A 5EE3A 4IOJA 3H1TA 1UDWA 4KFRA 2GRJA 4OHVA 4BLOA 1N6RA 2C78A 2W0SA 5FTKA 2ZR0A 2FFAA 4DLVA 3KTAB 2D4HA 2F7SA 1CJKC 2P65A 4BASA 5FUYA 4P32A 3REGA 4G1UC 2ZRPA 3IILA 3ICEA 1E2JA 1M6NA 4DSOA 2ZSDA 1G17A 1GNRA 4JLOA 3BH7A 3FWYA 2FG5A 2PLRA 2QY9A 3HJNA 3GLHE 5CJPA 4DLSA 4B2PA 4HATA 1VMAA 1C4OA 5JS7A 3GJ8A 3ZJYA 3SJBA 4GSYA 1FP7A 1JI0A 3AVYA 1KOFA 2YWFA 4D25A 1KGDA 1II8A 4MH0R 3R7WB 4URUR 2GJSA 4A9AA 2OAQ1 1YQTA 4LCBA 1UADA 1XPOA 2FMXA 5BW8A 3GLIA 1AS0A 2PZEA 3CRQA 4TT3A 2JEOA 4WA7A 4DB2A 2HF8A 4PTLA 5KHOC 2IF0A 3AF0A 3LAWA 3PITA 2O8FB 1OFIA 4CF7A 1ZW6A 5C46F 1EFHA 4HAUA 5DYIA 1RE0A 1OW3B 3VR3A 3LNCA 1QHIA 3TKLA 5CITA 3VR4A 1GFIA 3PEWA 2NO9A 2F1JA 3OIWA 4DXAA 4C9BA 5JRJA 1T6NA 1TL7C 2ONJA 3B2EA 1JB1A 1N0VC 1T3LA 1DARA 5GJWC 3CNLA 2HCBA 2WM9B 4MGYR 2VF8A 1YZQA 2FNAA 2BC9A 2QPAA 3ND8A 4G5GA 2ZYWX 2A9KA 4JVNA 3CRW1 3VU9A 5H68A 1G8FA 4LHWA 4HLQB 4DLYA 4ASUD 1MO6A 5EE9A 1CP2A 2AN9A 2OEPA 3NEJA 1UBCA 2IK8A 4IEEA 5C4MA 3P32A 4MKIA 1G16A 3PUYA 4OK6A 1MRNA 5HCNA 3U3KA 2ZRLA 2W2VA 3WMFA 2HYDA 2E9SA 2OLKA 3VU9B 1W49A 2MMGA 3U3MA 2QMOA 4RCYA 3IBGA 4RCZA 3EA0A 1J90A 2AKYA 1RW4A 3RWOA 3I8SA 4UKDA 4DDUA 4B34A 2NOAA 1E0JA 1QHSA 1S9DA 1UEJA 2GJ9A 1W36C 1RZ3A 3SE0A 3GCGA 3THWB 1L4UA 1J2JA 3KKNA 2G1JA 2PJRA 2J7PD 1EWQA 3FHCB 2GCOA 2WAYA 2ZJ8A 3EC2A 1CRPA 4XTRA 3GJ0A 4TMZA 3CF0A 4US1R 1XTRA 1E2NA 4OI4A 2GEDA 2GWHA 1OJLA 1G4AE 1FQKA 1CR0A 2F6RA 3OF5A 3QPWA 1BH2A 1Z3IX 3D8BA 2IL1A 2RGDA 2MSEB 4Q4AA 5EJEA 2W00A 4ACAA 1CKEA 5E4FA 3AF4A 3RS2A 3RLFA 2GAAA 3NBXX 5TARA 5FR1A 2VHTA 1Z0KA 2IW3A 5JEEA 1A82A 4XSGA 4MRNA 4XVQA 2BEJA 1SKYB 5EP1A 1W36D 1OSNA 1XD2A 4NHOA 4QXAA 5JBQA 4IKEA 3FYHA 3KX2A 1Q20A 2JAQA 3NBFA 4CEJB 3N70A 1R0WA 4GP6A 1CR4A 1G3UA 2IUSA 2EFDB 2J5XA 5E7MA 1QF9A 1E79A 3FGNA 1LY1A 1SQ5A 3I8XA 1EFRA 5BN3A 4BFSA 3RSOA 1E4VA 4AKHA 4JIMA 2JDID 1S9HA 1CTQA 4P4TA 3CF2A 1NN0A 1GL9B 3R20A 2GBLA 4V0OA 4C4PA 3KQUA 1OH5A 2FSFA 2V7QD 2WOOA 1IN5A 4G3XA 1JR3A 3U60B 4MKFA 3AUYA 1KNQA 1KK3A 1XTSA 4MRVA 1QG2A 3VAAA 1W0JD 3IUYA 3WHKA 4ZKDA 4GPTA 1GRRA 3AB3A 4NP6A 5AUNB 4EPYA 2OFWA 2GTPA 2R6AA 3NIBA 3NH9A 1E69A 3C5HA 5AWFC 4D81A 2EWVA 4FMCF 1ZIPA 3U4QB 1HQYE 5LB2A 1S3SA 1OXVA 1G5RA 2ZITA 2P6UA 2HEIA 1NVUQ 2IYXA 2J0VA 1CJVC 4ZKEA 3A1TA 3TUZC 3CRRA 4MITA 2A78A 4LJ7A 1DAIA 5DISB 1EFUA 3OEEA 2D74A 3KL4A 1FMJA 3RS7A 2GCOB 1UBEA 5FBVB 4Q1CA 1NIJA 2CBZA 2GBLC 4HDCA 2QAGC 4QGHA 2OXCA 2ONKA 2QT0A 2Z83A 4MRRA 2A7QA 1OB5A 1UFQA 3CWQA 3BWDD 1IN8A 3P4YA 3QKTA 2FZLA 4LJ5A 1O87A 2IYZA 2XTMA 5GJBA 2WJVA 3M0EA 1JEDA 3BB1A 4V0KA 4XTCS 4V02A 4E22A 2OAP1 3TBKA 4AKGA 2IS2A 4MUAA 1NSFA 1J70A 1YVDA 1KO1A 1NVVQ 1UDXA 3IIMA 2IHYA 3IKJA 1RRPA 2ZRNA 4TQAA 1YR7A 1JPJA 4TL7A 1RRGA 1M8PA 1P9RA 2NQ2C 2OO7A 1R0YA 4PSAA 2IT1A 3DO6A 3FFAA 5P21A 5FUWA 4PAOA 1OFTA 5F9HA 3I3SR 5B58C 1ZM7A 4Q4HB 1H8ED 5A4JA 3TSZA 4BQSA 4MDFA 4U02A 3SOPA 2GJ8A 3NEYA 4Q9IA 3FHTA 1WQ1R 3W6OA 3CZQA 1IY1A 4ZCLA 1G7RA 3TK1A 1T9HA 2WSSA 4LJ9A 4NYMQ 3CR8A 1RYFA 2AWOA 1ZM3A 4MYHA 1R10A 2EFGA 1DELA 3MG9A 1NVWQ 2QMHA 1AA9A 4D4LA 2P3SA 1AQYA 3QG5A 5CB8A 5KSOA 2PEYA 4M2LA 4KITB 2XJ9A 2ZAMA 1JR3E 3CF6R 1IBRA 4DKXA 2BM1A 1OXXK 1P2TA 4GDFA 2W6IA 2WWFA 1W0KA 5LPNA 2ATXA 1P2VA 1OH8A 3X1WA 2REXB 5J4HA 1U81A 1Z29A 1E2FA 3DHWC 5FL7D 2ZVQX 1KDRA 2QZ4A 4ZI3A 4DBLC 1F60A 4QJ3A 1WMSA 4MYUA 1Z8FA 3DZDA 1QHGA 4LYAA 3QSYA 3OAAA 2BMFA 2I4IA 2JJ2D 4Q4LA 5DN6D 4QGAA 1F3OA 4L9WA 4B2IA 2ZI5A 1ZM4A 1P62B 5EE0A 4WZ6A 2IYUA 3IHWA 4QBFA 1RFLA 3LD9A 4YXWA 4GRAA 3B9QA 5F2EA 1I2DA 2YNMA 2ZQ5A 4PZZA 1EK0A 2HT6A 3PEYA 1EX6A 2D7CA 3AM1A 2OUKA 2BBWA 2NO6A 5BN4A 4JYCA 4DZZA 2ZPTX 4IW3B 4KI0A 4BLTA 4I81A 4NMMA 4A0RA 5JLJA 2J59A 2JLXA 3LXXA 5FOTA 3ZVRA 1FX0A 4C0BA 4XWOA 3PUZA 5K8LA 2OILA 1JAHA 2A5DA 1S2MA 5KDOA 4I1VA 3HR7A 4KV9A 4N0EA 4W5JA 1W4RA 4HLCA 5SZIA 2ZETA 4D6PA 4KYUA 1D9XA 1XRJA 3KQHA 1S3GA 3RC8A 1MKYA 1GKUB 1D2EA 4G01B 2B8TA 4IXMA 2H7VA 4AG6A 1SULA 3WYAA 1MO3A 1PUIA 4DT1B 3AGQA 4Y0AA 2FF7A 2C2HA 1FW6A 4CDGA 3H86A 1KMHA 4IOLA 5EUMA 3CNNA 3PUWA 4KLNA 2R2AA 4PPGA 1NMZA 4PQFA 4TMTA 2KBEA 3C14C 4XOIA 3QUSA 3SYLA 1WE2A 1XXHE 1O3YA 4R9UC 4DEXA 4O0MA 2XXAB 3BH0A 4HB0A 3M1IA 5EXSA 3SJZA 3SZRA 4C0QC 2GJAA 1WDTA 4IDNA 5FFMA 2BKUA 4BFUA 2DFKB 2EFCB 3B1XA 2W0MA 4F7WA 3SR0A 3CW2A 2YKGA 1OIXA 4W5HA 1KJZA 4BRWA 1IJFA 2AX4A 4FCWA 3TSOA 3JZAA 2F1HA 1E2MA 3CNOA 2C96A 2L0XA 3DPUA 3CWZA 3F5FA 4ZDKA 3WNBA 4JJZA 3GLHA 3A8TA 5HKKA 3IPXA 3GPLA 4DUGD 2PH1A 5H8WA 3L0IB 4F91B 4D26A 1XEXB 3CX7A 2FPLA 1JECA 1G291 4CIDA 2X1VA 4A82A 1WCV1 4KBFA 1IQPA 5FBRB 4C0HA 1VCMA 2OCBA 3LV8A 4MKHA 2BBOA 4B2LA 5SZJA 1JJ7A 1MR3F 3QPVA 4TWZA 4XSHA 2XSZD 3K09A 3FVQA 2OHFA 2BOVA 1F2TB 2ZR9A 2YVUA 2YYZA 5DH9A 3QKRB 2J46A 4M1MA 1Z63A 1KJWA 3CPHA 5E7JA 2F9MA 5AUPB 4QHSA 2R6DA 1PVOA 3QF4A 1Z6XA 3A4LA 4FWIB 1UBGA 4HEJA 5CIQA 4PQYA 1F2TA 4F4JA 4PPQA 4Q19A 3VKGA 4PX9A 2G88A 1LS1A 1HUQA 1KI6B 1F2UB 2CCKA 2OBLA 1DG1G 4PHHA 4MRPA 3A1WA 3TUJC 3FMOB 4Z1MD 1AKEA 4YMSA 1KDPA 3IGFA 1RIFA 1IN4A 3AF2A 4GZMA 1ZCBA 1H8HA 1SXJB 5FPSA 2OXRA 5G41A 1KO5A 1N6OA 4ITRC 4TSFA 3I5XA 2H1LA 3I73A 2BMDA 1GL6A 3L0SA 2QENA 2EU8A 5EXTA 1VYVA 1Z2AA 4LV6A 3ZQJA 1Q21A 2FZ4A 2OM2A 2XNDA 3V4RA 1E9DA 4PC7A 3RANA 3B13B 3E1SA 4G5RA 1QDEA 1TNDA 4QBGB 4EPRA 1D2MA 2VHQA 3C15C 2WVJA 2WWIA 1AIPA 3EPJA 3IO5A 4S35A 2FFHA 2R9VA 3WMEA 4LC1A 4RZ3A 3Q72A 1CIPA 4JL5A 5KOYA 4QRHA 2JJ2A 2BMEA 4MGIR 3SBEA 4G5SA 5BQ5A 4OHZA 4B43A 3P20A 2F1RA 3O47A 1VIYA 3GJ7A 1QG4A 1NLFA 2J0UA 2W6JA 3PV0A 1T5IA 3OEHA 4HB4A 5AUQA 1GZSA 1I2MA 3HPRA 1DEKA 2FGJA 4NDZA 1VKJA 3P1JA 2Y8EA 3I4LA 4YC7A 1FP6A 3W9YA 5KUTA 1SKQA 1X8JA 2ZE6A 4LHVA 4Q7MB 1UJ2A 3OEED 3B6EA 4R2HA 3D7MA 4B76A 4C0AC 4RD1A 1E9FA 1EWRA 2C5LA 2R62A 4AWXA 2HF9A 3VKHA 3IO3A 2ZRGA 2VSXA 4RD2A 4ZIRB 1RVDA 3KFVA 3T5DA 2WWYA 3OE7A 5L3SB 1QHXA 3LH5A 4MGKR 4Y0VA 3LX5A 5DYGA 2HJVA 4MQBA 4F38A 4AC9A 1YZGA 3KJIA 2ERYA 4LSGA 4BRUA 4B3XA 2XOKD 3CIOA 1U8YA 2P67A 4FN5A 3W90A 3PFIA 1KHTA 1G8YA 3KB2A 1Z0JA 2KI5A 3UWOA 5L8VA 1XNJA 3RABA 1KIMA 1JR3D 4ZO4A 4O2RA 1W0JA 1XMIA 4DIDA 5TY0A 1FNNA 3HYRA 5EQTA 3V9PA 2PEZA 4Q7LA 4JLBA 3BC1A 2KB0A 3RRMA 5KNBA 2HJGA 4KVGA 1E9AA 1KKMA 4OKSA 1ZUNB 2QROA 2ZXUA 1DAFA 1PLLA 1US8B 1XJ0A 1Z28A 2WWGA 2Q0HA 4DEYA 2JA1A 2OT3B 2X8AA 5K8UA 3I32A 1R5OA 1NL3A 3HU1A 3KXKA 4C0KA 2WOJA 4YMWA 3U7HB 221PA 1M7BA 1YJ5A 3QEJA 4UQOA 4OHYA 1IN6A 3AKYA 5GVSA 3RRNA 4URYR 4LV8B 3EXAA 3UK6A 5HCIA 1T91A 3WHLA 3WNDA 3TE6A 4LK2A 3GLGB 1XMSA 3FOZA 121PA 4M1OA 3V00A 5GJVC 1NF3A 2ZS9A 5IRCD 1TX4B 2YOGA 3WBJA 1NMXA 5IT5A 3BERA 2GXSA 3QXCA 1KI4A 4WXRA 2NO7A 4NE2A 4PC1A 5FI0B 4A2QA 1WF3A 5HR5A 3AP3A 1VECA 2VF7A 1FOEB 2YV5A 4P4UA 3HU3A 1TU4A 1N6IA 5CLQA 2I3BA 3QEOA 2IYWA 2ZJ2A 3DM5A 3THXA 2J9RA 1BYUA 1D5CA 1P2SA 2GCPA 4TL9A 5DGXA 1R8QA 5AR1A 1YU9A 3TVDA 3QXHA 3PQCA 1JXMA 1DO2A 1G3IA 2N46A 5EP4A 4GT1A 5AJXA 4E03A 1K8RA 1R5NA 1ZM9A 1NVVR 2OCPA 5DHAA 4FD2A 4D0LB 4IDPA 2NTYC 3PUVA 3RS5A 2GEVA 3K53A 1QBKC 4NZYA 2H17A 1Z0FA 4NKRA 3W3ZB 4PPNA 1CU1A 2FJUA 2QI9C 1JQJC 4GI7A 4LUCA 1W4CA 4CEHB 1R0ZA 2JDIA 2CVFA 3QIAA 4QFMA 3UKDA 5TB5A 3UMSA 2F55A 1MT0A 4OQNA 3MRSA 3KKMA 2QN6A 3A6PC 3K0EA 4B6FA 2QTFA 4JLMA 5FOWA 4UNQA 2B7BA 2W6ID 4KYIB 5DIFA 4UNPA 1M7HA 3K9GA 3QBTA 4LI0A 4MKGA 2DFLA 2GVZC 3BB3A 3KKOA 3K70C 2QG6A 3B85A 2QMEA 4PANA 3FKQA 5BWMA 2IWHA 3B1ZA 3I62A 1JPNA 4Q9KA 1W44A 2MMCA 4OHWA 4L5BA 1E94E 5C4GB 1XPUA 2GAOA 1G8HA 5C1BA 2F1IA 4DJTA 1OXTA 1DVRA 1FTSA 1A2BA 3THOA 4IDOA 3EASA 3I61A 1N5KA 3EARA 5DSZA 5UKDA 5HTKA 1FQJA 4FMCB 1BMFA 2OFXA 2W6JD 3GLIB 1IXRC 4QM7A 2XSZA 1TPZA 2V6IA 2WV9A 3PIRA 4JL8A 2ORVA 2IYTA 2O8FA 2EQBA 2RAPA 3QQ5A 3F0TA 1S1MA 2FU5C 2G0NA 4MRSA 4DB4A 3NDBB 3VR6A 1GITA 1W7AA 2CLSA 3NH6A 3SYNA 3U4QA 2MSDB 3U6KA 4WBSA 1Q3HA 5JSZA 5CDFE 4X8LA 2F9LA 3DMDA 3GQBA 2XZLA 2OZEA 1ESMA 2IHBA 1AGRA 1YR8A 3ADKA 1M2OB 2ZTSA 5JRZA 5DLQC 4KAXA 3KDSE 4PC3A 1CXZA 4TMVA 3ADCA 3QBVA 2JLQA 3Q5DA 4KODA 3TR5A 4JMPA 1VIAA 2CNWD 3OESA 3SN6A 2XOKA 3F3YA 1KYIA 2YC4C 2HT1A 4XJXA 4KXFB 4TZ0A 1KI2A 2AKAB 4Q00A 3U7FB 4KSCA 1G18A 3NBZC 4URXR 3MFYA 5JWHA 4N3NA 1JQLB 4Q1FA 1BO6A 2P2LA 4DCNA 3EPLA 1LFDB 1W48A 1E2QA 4DLRA 1F48A 3LFUA 3WRXC 4QGGA 2BWJA 3AVXA 5G40A 2ZE8A 2ZJBA 4HZUB 4TLBA 3RRZA 5K8TA 4IXNA 4UXJA 5CIWA 4QOSA 4QJ5A 3BFKA 2YZ2A 4HLUC 1S0UA 2ZI4A 4Q1DA 1Q12A 4RJLA 2H92A 2OE2A 2ZRCA 4MGZR 4F93B 5K8IA 1W5SA 2QP9X 2BJVA 1GWNA 3PEUA 3ZD7A 1BIFA 4DDWA 1VDZA 2UZ3A 1LF5A 2PLFA 2ZUCA 4OBEA 2JLZA 2DWOA 4G5QA 2DWPA 1U0LA 4Q66C 4ACBA 2V55B 3TNFA 4LJ8A 1OE0A 2IYRA 2DY1A 3FDIA 5GJCA 2GZDA 5FPKA 4IRUB 2HCJB 4L16A 1BKDR 3MWJA 3SS8A 4CZ2A 1U0HC 4I1OA 1XJCA 3AVTA 3L0PA 3W3AA 4EPWA 2ZEJA 1X3SA 3FTQA 5HKKD 2YOHA 3WMGA 2R6FA 4M1YA 3H4MA 5FTMA 4EJSC 2ZJOA 3DMNA 1TEXA 1IAQA 1X6VA 4FIDA 3FMFA 1EESA 2PX0A 2GK7A 1E9SA 1OFHA 1ZJ6A 1HT1E 4Q47A 1FPMA 3RRYA 1NLYA 3MWYW 4ILEA 1A1VA 1DS6A 1KI8A 1KY3A 1P7CA 4JLAA 2DR3A 1DADA 1YR6A 3NBYC 4LPKA 4PQRA 1Z47A 1DAEA 1QRAA 2W83A 4X8OA 1XXHA 1T3HA 2QM7A 3BAFA 2WSMA 3QVVA 3K0FB 3ZGXA 5GVRA 2G9NA 3T1VA 2AK3A 4RD3A 1GTVA 1ODFA 4FXPA 2F3RA 4BZPA 1KAOA 821PA 4KO8A 1TQ4A 1CBUA 1SXJC 1VG8A 4DSUA 1G7SA 1OH6A 2CJWA 1TF5A 4LHXA 5FPHA 1N6NA 1DG3A 1PJRA 2CL6X 2OV2A 1KDOA 2QT1A 3QE0A 3SNHA 4R71A 2Z4RA 4OJKA 2CE2X 4PSVA 1E0AA 2C04A 1OYWA 3L43A 3T1TA 2WAXA 5JI2E 1NRJB 4GNKA 4X8HA 4NBSA 2CEAA 1P72A 5TDHA 3JVUA 4M8NE 4HUTA 4ESVA 4DT1A 1UAAA 5JCPA 1P6XA 5FTLA 5LBIA 1ZCAA 4RD4A 5JWRA 1KK2A 4NYIQ 1XEWY 4ZDWA 3K0CC 3ECCA 4V0ME 2C98A 2WJHA 3B78A 3ADBA 3OIVA 4AY2A 2P0EA 5KO2A 4B32A 5FOSA 1SVIA 2GEUA 1XP8A 1I4DD 2V54A 1Z6TA 3THXB 3NTUA 4M53A 3TH5A 5AJYA 1Q22A 1IY2A 2KE5A 5EUQB 4TTPA 3AEZA 5KSPA 5D3QA 4YMTA 1GP2A 4KFTA 4W5WA 4LBVA 3OFNA 2IX3A 1TAGA 3WY9A 4QHYA 1FNMA 1HYQA 2Q3FA 1GIAA 1TUIA 2FFQA 2OG2A 2VSFA 2O8BA 2TMKA 2ZU6A 3K09C 1EGAA 2DPXA 4QG7A 5IK2A 1TTTA 2V3CC 1GM5A 4YQFA 1QHHA 4UNSA 3RYTC 1H8EA 3RS0A 3SJAA 1RPZA 1NN1A 2QTHA 1X8LA 1ANKA 5J5CA 4H1VA 4ON9A 4PXAA 1G6OA 2G1KA 2J41A 1T4GA 1OB2A 3KTAA 1YHNA 2IA5A 1P73A 2JGNA 5DI3A 3PEVA 4LRWA 3W8NA 2VP4A 1BYIA 4C0LA 1RJ9A 4JVSB 1KSJA 1U2RA 4K8OA 1GKIA 4D0GA 5LDDC 1A7JA 1WA5A 2VHJA 1XEFA 4A92A 2RGXA 2XX3A 3IBYA 3IPYA 3KB1A 4RFVA 3VQTA 3R8FA 1ZD8A 3QJYA 2FGKA 4M4SA 4BEBA 2JCSA 2ZRBA 5KPDA 1ZNWA 2B92A 2C8VA 1NMYA 4LC0A 2XEXA 2QPOA 2B6HA 1XMVA 5B57C 2YC2C 4H9GA 1N25A 3MSXA 4EQ6A 3VR5A 1P2UA 1P75A 2ZRHA 2ZS8A 1XCGB 3C4JA 4IDHA 4EIWA 3SC3A 421PA 2KSQA 3DKVA 1AM4D 4DCUA 1GSIA 1NI3A 2ZRMA 3QNUA 4C3ZA 1GUAA 2DFTA 4A0FA 4F92B 2BDTA 3ZDQA 2PL3A 4AYWA 3OEHD 1KO8A 4QL3A 3S1AB 4E07A 5KTYA 2EVWX 3TSWA 4LBYA 3EZ2A 3O8RA 4TMKA 5JCZA 5FUXA 2RGNC 1NG1A 3QY0A 2WKRA 5G53C 1GDDA 1N0WA 1A2KC 2FSHA 1XZQA 3DKPA 2VPPA 4WZBE 4CT5A 5IHPA 1E79D 1NVXQ 3IHLA 1XCPA 3NG1A 2V1UA 4M22A 4HLUA 2BKEA 1E1RA 4EKDA 3U44B 3THYA 4PO1A 1CR2A 2DBYA 1DAGA 3BJIC 2EFEB 4EDHA 1P9NA 4DLUA 2X77A 1SXJE 1G4UR 5J4VA 2CDNA 5FH9A 2J0UB 2LKDA 1TADA 2WWWA 1A5TA 2FPMA 3EWAA 3NHAA 1JR6A 2G6BA 4LDJA 2BBSA 4NYMR 1UPTA 1N6LA 3AVPA 2YJTD 3OE7D 5D3MB 3TR0A 1SVWA 1GILA 2VO1A 1YE8A 4GMXA 4TT3D 2Z4SA 3PCRB 2ZUBA 1IXZA 4EFMA 2EFHB 1Z22A 4LX0A 3RVBA 3LQRA 3UXMA 3GEEA 5JI3E 1KI9A 2ZANA 4A6PA 2JJ1D 3AVWA 5EZ5A 5H1YA 1ZC3A 1W2GA 3Q5EA 3KZ1E 2A3RA 4JBXA 1MOZA 1I4TD 1XU4A 4F4IA 4OI0A 3MJHA 4WVFA 2NO0A 4B35A 4TTRA 1YRBA 2GXAA 2GHIA 2CE7A 2PT7A 5EE1A 3EIQA 1U0JA 4V0LA 3VFDA 1HURA 1XJQA 2QAGA 3KUDA 2R6GA 2B7CA 3EZ9A 4PR0A 2CNWA 1UKEA 1KO4A 2DB3A 3SHWA 1IY0A 3CRVA 1W46A 2QE7D 2J0QA 2VP5A 4D4JA 1EX7A 4IVPA 4KJZA 2VRWA 1KZGB 1DAMA 3QKRA 3T1QA 1M74A 1K5DA 1E98A 2JLSA 3ADDA 1XXHB 1HE1C 4B74A 3UMFA 1F5NA 1N6HA 2ZE5A 1E2LA 4KHZA 1D2NA 2IS4A 4BFTA 1L8QA 4DWJA 1P4SA 4B3BA 4OQFA 1OHHD 2WPDD 3KJGA 2WWXA 2LCFA 3A37A 2YHSA 1T8TA 4NCNA 2G3YA 2O0KA 4EPVA 4QJ4A 1KKLA 4ZDJA 3HYTA 4UJ3A 3ZS9A 5KDDA 3KUCA 4X8MA 5FL7A 4JBWA 5L3QA 3GLFE 2IYQA 5ELXA 1UKYA 3K0AA 4RZXA 3KJEA 2ZR7A 1CS4C 5A5GA 1JEEA 1P61B 5AJVB 1N6KA 4AI6A 2VHCA 1LS6A 2IYVA 3EC1A 2AFIE 4PHFA 3EIEA 5DI9A 4BFYA 3PR1A 5D3MA 1LB1B 4OQLA 4R98A 4YXWD 1HH4A 1HV8A 3DZ8A 4FCVA 4D4MA 2JATA 5JJIA 2C9YA 4Q48A 4AD8A 1Y3AA 3JVVA 2RGGA 2X2FA 3A4MA 5J4LA 5FL3A 2AXNA 4FCTA 3GMTA 2OESA 3DVLA 2HLDD 4QC2A 3SFZA 1PV4A 1ESNA 4H1UA 5B30A 3R9WA 1XMJA 3HDTA 3CH4B 3T15A 4RKFA 2Z43A 4WW0A 2KJQA 2ODEA 1YRAA 1M7GA 4Z8YA 4URVR 3PG5A 4A15A 5JFGA 2PT5A 3W6PA 3W34A 2PX3A 4K46A 4FWTA 1IN7A 2I1QA 4KFUA 1EFRD 4UNRA 1UKVY 4UJ5A 1Z0DA 2CK3A 2NPFA 1U90A 2GCNA 3QENA 2QGZA 3RC3A 5C2JB 4TLDA 3UWKA 2X2EA 3L82B 4NCHA 2BBTA 1M1YE 4TMWA 5FI1B 1S4QA 3BB4A 4NTZA 2WIAA 3PJRA 2HDNB 4C0SA 1NP6A 2BMJA 4JSYA 3X1ZA 3TAHA 2ZRJA 3LBNA 4AYTA 3BXZA 2Q9BA 3LX8A 3GJXC 2ZYUX 1G41A 4Q7KA 1WRBA 2FFBA 3R7WA 2WMOB 3UMRA 4B3DA 3TW8B 2O0HA 1R8SA 1CRQA 2Z0MA 2LWIA 1K5GA 2WICA 1KO7A 1OYYA 2V9PA 5CJ2A 3VR1A 3ETLA 4U7DA 3EPKA 4IJMA 1GVNB 2QU8A 1VYUA 4DVGA 4E5UA 2XZPA 1L7VC 1KY2A 4EQ6B 4MDEA 2W2TA 4QBIA 2RH5A 3I92A 1ZBDA 2DWQA 5C18A 4WAUA 6Q21A 1US8A 1XFAA 1SVSA 1MO5A 3LXRA 4OHXA 3RDPA 2H8KA 3Q3JB 1G8GA 1T3SA 1AS3A 3I72A 4CRWB 4CEHA 2GK6A 3CM0A 2CHGA 4KVAA 1R2QA 1ETUA 2NZ8A 5DI3B 2ZJAA 4TL6A 2QMUA 5SZHB 3KKPA 4DUGA 2CCJA 4CVNA 1RJ9B 1NN3A 4GL2A 1WXQA 4KCGA 3GEIA 4BFWA 2C9CA 1KNXA 4DHEA 1KSFX 2FSGA 1GG2A 1ONBA 1VHTA 3U44A 2JLVA 2PMDA 3H84A 1S96A 4UXIA 1JAIA 1LV7A 3LDAA 2VBCA 2A5YB 2ORIA 5F9FA 2ODWA 1ZD1A 2VH5R 4TQUS 4DIEA 2AD1A 1KI3A 1AGPA 4R7ZA 1OH7A 2F43A 3P26A 3E70C 4LOAA 2QL6A 3THYB 4CGZA 2FSIA 2GZAA 1LNZA 1EFTA 4M9QA 1G3MA 4DCSA 2NMVA 2OFOA 2ZAOA 4EPXA 2FPKA 3TVTA 4DCTA 1G9XA 3DL0A 3AKDA 3BGWA 3QVUA 2XITA 4OQMA 2I1VB 2YOFA 1DO0A 1G5TA 1AJEA 5JWOA 1U99A 4GZLA 1MABB 3S1AA 3ZZTA 2FN4A 5FUVA 4HAXA 1E9RA 1EG7A 4LJ6A 3E5HA 3J81k 2ECKA 3HPQA 3V4FA 2R6CA 1ZNZA 1X86B 4P4SB 3MWLA 5TV2A 3CB4A 3Q9LA 3WXMA 1KJYA 4EFNA 5JJKA 1Q3TA 4M9SA 1E3MA 3LLMA 1ZC4A 2NGRA 3QKUA 2WWHA 2J7PA 3CPJB 3U3OA 2QBYA 1D8TA 2YWGA 1P3JA 1JBKA 1FX0B 5BXQC 1UM8A 2CMKA 4Q18A 2WJIA 1WBBA 1E2IA 1DAKA 4HLDA 4II7A 2VYFA 2RB4A 4B44A 1SXJD 5IK2D 3EZ6A 1OFUX 3T12A 5CK4A 1T8UA 4AKEA 5TVKA 2RGCA 3ND9A 4A0GA 2NPIA 5FTNA 2Q3HA 3NC0C 1P5ZB 4XD7A 1NY5A 2D2EA 2ZI3A 3T5GA 2QA5A 3KJHA 5E7IA 1OV4A 4Z1MA 3GLFB 3ZZ0A 1G8PA 1ZUHA 3K9HA 3X1XA 1YZTA 1GRNA 3L2OB 4ZI2A 4B6EA 3ZVNA 2VHUA 4WXPA 3Q85A 1QHHB 3ZYCA 1AZSC 4CT4B 4CEIA 3DDCA 2E87A 5TMPA 1SHZA 3X1DA 3T34A 3VR2A 2AHOA 2DFNA 2CCGA 4NU0A 2OCYC 4A8JA 3SBDA 4Q4AB 2FWRA 2CL0X 3F8TA 4V0NA 1NKSA 2GETA 3K0CA 3K70D 1YZUA 3GFTA 4HAVA 2GJKA 2JLYA 3TW4A 1W47A 2A5GA 4O25A 2Q3MA 3HP1A 2XB2A 1VCIA 1Z6GA 3QKSB 4B71A 2QQEA 1SGWA 2AK2A 5CB6A 4GOKA 4NCKA 2AFHE 4PO8A 5JSZB 5JS8A 4V03A 1J7KA 2PCJA 2HXSA 4Z8XA 1E2HA 4AURA 3B1VA 4POAA 3L8ZA 4PHGA 3AF3A 2JLRA 2ODNA 3ASYA 3ZH9B 2ZSBA 3C7KA 2QAJA 4OJQA 2GXQA 3T35A 4DDVA 4RSGA 5KU1A 3CONA 3LW8A 3B7GA 4URZR 5BN5A 2ZJZA 3GLGA 3KKQA 1P9WA 1Z0AA 1PZNA 3A36A 4C7OA 4A8JC 1G5PA 3CH5A 2A5FA 1F6BA 5IDVA 3SU8A 2H16A 4Q4JA 1SVKA 1IM2A 3W5IA 4IOKA 4Q1EA 2IYSA 4LBWA 1D9ZA 4A1FA 2IYLD 2WHXA 4URWR 4RVCA 4Z54A 5KSYA 1OT3A 1VTKA 2ZU0C 3UG6A 4RFSB 4BLQA 1G1MA 2Q21A 1H8HD 1EFCA 2J3EA 621PA 1HY3A 1UKZA 2OBMA 1OLOA 3K0AB 2ERXA 2EYUA 1U9IA 4BZQA 1QVRA 4LJ4A 3D3QA 3EPHA 1W0KD 4B73A 4WZAE 5FOXA 1TUEA 4M1WA 1XTJA 1ZVQA 4EAQA 3RWMB 4NONA 3K0SA 2XXAA 3ONWA 2X19A 4D0NA 4C2UA 5DE3A 3ZIAD 1C9KA 1SZPA 2QTVB 3GJ6A 4DLWA 3B82A 2GKSA 3B8HA 2K5UA 1LF0A 3AVQA 4HB3A 1CJUC 4K81B 1TEVA 2R8RA 2YWEA 1IXSB 3NKVA 3EIHA 2J45A 4NCJA 1ZD9A 5L3SA 4JL6A 2D7DA 1DBSA 1RKBA 1XWIA 4IVQA 1WBDA 2IBMA 2O52A 3M4YA 2PJZA 3KFXA 4NL4H 2XNSA 3EW9A 4GOJA 2B21A 3SDZA 2JIZD 1ZMXA 4TQ9A 2J0SA 1FMLA 3AKCA 2A30A 2CHQA 1Y63A 2OLJA 5CK5A 4LJAA 2VP2A 2HLDA 3ZQ6A 2QE7A 1KTVA 4OK5A 4PO9A 1XBTA 4PPFA 4BLPA 521PA 1U98A 3AGPA 4ZV4A 2CHVA 4JJKA 1ZRHA 4TYQA 1OIWA 1XB2A 5F98A 1G19A 1RRFA 4BLSA 3DM9B 2QAGB 1NBMA 3FMIA 2JLWA 1GKYA 4CEIB 4J0QA 4TL8A 3PENA 1NKTA 3K9NA 4CEJA 4HDQB 3CX6A 1E2DA 2VQSA 3BS4A 5E95A 4WOPA 2V1XA 2IYYA 4ABYA 4GBMA 5JHGB 4TTQA 3GJ5A 4XWKA 3KQNA 3P4XA 3AQ4A 1II8B 2REOA 1VYTA 2J7KA 2ZJ5A 2R65A 1CLUA 1KDTA 3GD7A 5DN6A 1FTNA 3K9LA 2QRZA 2VL7A 3TAUA 2BCJQ 1NNEA 4ERNA 4FMDB 4HDOB 3U5ZB 2IXEA 2QPTA 4A6XA 2CXXA 1VHLA 2GDJA 3O8DA 1E32A 3QPUA 3EA5A 3EWSA 2DYKA 1TQ6A 1V43A 1Q0UA 4FW9A 1TU3A 3GFPA 4JBYA 2QRNA 2RCNA 3TJZA 2KWIA 4P33A 4BE7B 1N2CE 5KYKA 4P4SA 5KDLA 1ZUIA 5B64A 3N5CA 4PC2A 2XTNA 4MUBA 3VHLB 5LB4A 2H5EA 3IIJA 3JZMA 2AXPA 1COWD 3Q7QA 3AKEA 1RYHA 2Q9AA 2WBLC 4KLZA 4M1KA 5FOUA 1NIPA 5L3VA 4AIIA 1ZAKA 1W1WA 2DCUA 2DHRA 2QNRA 2JASA 3C16C 1AZTA 2WSSD 2VA8A 3GJ3A 4FI3C 1W4AA 4IFBA 5FR2A 2QSZA 3SI7A 2ANBA 2QP4A 4M0LA 1XF9A 3BE4A 1KZ7B 3PXGA 4G5OA 1QZXA 4LWZA 3LLUA 2O8DB 3NC1C 3U3RA 2ZYTX 4Q9HA 4E09A 4O3MA 2PBRA 4Q1AA 3EX7C 1DTSA 4TSFD 3GLFA 4NYIR 1VG9B 1VPLA 2OBNA 2ZSFA 3WP1B 2BV3A 2W2XA 4JLDA 3RS4A 4U00A 3DOEA 2ASEA 1S1CA 3IIKA 3LY5A 4NH0A 5JEDA 2GESA 3VTKA 3QXJA 4WIAA 4OK3A 1IJEA 4KU4A 2VLIA 4P3YA 4ZIRA 2XJ4A 3SEAA 2C77A 1Q57A 3EZ7A 4TLEA 3FMPB 2V8OA 2GF9A 4PAMA 3U2QA 2XZOA 3B9PA 1Q1ZA 3FHOA 2BHRA 5BYJA 4DSNA 4IVRA 3UIEA 3GP8A 4JT4A 2GNOA 3OIYA 1OKKD 3EG5A 3BFXA 3GLHB 2O8EA 4JVMA 8OHMA 1CULC 4NYJQ 1MRSA 1YZNA 2ZRIA 4D80A 2GILA 4Q4HA 4O2LA 3FB4A 1H65A 5FBWB 4Q1BA 1W5TA 3FKSA 3E2IA 3X2SA 5J4KA 1E2PA 2ZROA 5CLLA 4QHTA 3REFA 3GEHA 5L3RA 2HUPA 1VG1A 2UKDA 4KFSA 2O8CA 3A1SA 1PLJA 4Q01A 4A2WA 1CJMA 1LVGA 1C1YA 5J47A 4BPBA 3D31A 4M1TA 3CO5A 2D06A 5FTJA 4LHZA 4IDQA 1HE8B 1KSHA 1NSTA 1R7RA 3GLGE 2QUZA 1GNPA 1X8KA 3BOSA 5FOVA 5JHHB 2CK3D 2F43B 4TZ6A 3BIFA 2WTUA 4YMVA 4BFZA 4YDSA 3CPEA 4DC9A 3SJCA 2QGNA 3HWSA 2LKCA 1DOAA 2ODBA 1LTQA 3VX3A 4N1AA 2NG1A 4NCIA 3OZXA 4TLAA 4XH9B 5SZKB 4FMDF 2N1BA 4GP7A 2D3WA 2ZYVX 4XIGS 1RC8A 1E96A 3ICQB 3AVUA 1W4BA 4RY2A 2G77B 1Z2CA 4QNMA 2E1RA 3Q8XB 3OHMA 2ZJYA 3I1FA 4EUNA 3BORA 3TLXA 1FFHA 4A36A 2OCAA 1XTIA 3TQFA 1KAGA 2O8DA 2J1LA 3NDPA 1JALA 4S2EA 1CEEA 1MABA 5LD2C 4G0NA 4PC6A 1YR9A 3KQLA 2IS1A 5FBLB 4HUQA 3B1YA 3Q7PA 1KSGA 2MSCB 3LQQA 1X1SA 3VMFA 1UEIA 4C2TA 2OSBA 2VP0A 1NBME 4CW7A 5M04A 4JZKA 1G7CA 2C95A 2QSYA 4LYFA 2G0TA 4TMXA 4DSTA 3G0HA 4LYJA 3SYKA 5KSZA 3VNVA 1U8ZA 2QQ0A 3PUXA 2XAUA 4RZ2A 2AWNA 3CLVA 4N0DA 4BLRA 3ZS8A 3MCAA 1Z08A 2RGBA 4B3GA 1KI6A 3U61B 3H2YA 5DHFA 1XX6A 2V6JA 4US0R 1II9A 2ZREA 3TIFA 2ZUDA 3QI2A 1RRCA 4NYJR 1E1QD 1KI7A 1VCNA 4L8GA 3T61A 1GL7A 1HT2E 2GZHA 3WRYC 1E0SA 4Q21A 1HTWA 3MWKA 5AK0A 2GA8A 2NZJA 5E3HA 1T0JB 4F4CA 5AJWA 2IUUA 3ZVMA 1TQ2A 1XD2B 3DOFA 4LYHA 1GAJA 2BJWA 3C41J 1E2GA 4JKIA 3TQCA 1KMHB 2H18A 3THWA 1II0A 4IFEA 1G6HA 2ORWA 4JS0A 5KNCA 4HZIA 4D2IA 1KK1A 5EP2A 3LWNA 3TGPA 4B48A 4YONB 4KBGA 3GLIE 4HAWA 4TYWA 1XPRA 3N2IA 4XVUA 1COWA 2WKPA 1NG9A 2RHDA 2JIZA 4ZCIA 2ZIAA 2D2FA 3NWJA 5JZVA 4PHTA 2RGNA 3L8YA 5L3QB 2YWHA 5HE9A 4L4UA 3LVQE 1R0XA 1N0UA 3X1YA 1Z5ZA 3G82C 3WNCA 4IHQA 2WKQA 2FE4A 1SHKA 4IOMA 2IEYA 3AV0B 4UNNA 2RHMA 3A4NA 1SVLA 4OI1A 1QHYA 1OXUA 1SVOA 4V0MA 4A8JB 2BIFA 3TRFA 3IEVA 1FL9A 1J99A 3QXXA 1Z06A
chains in the Genus database with same CATH superfamily
1SU4A 3L7BA 5T3YA 1KQPA 4F6RA 4DMRA 2ADOA 4A91A 3FTFA 1Y9JA 3V55A 2IYEA 3R09A 1TZMA 3CZPA 2ZRKA 4XYBA 2PAFA 2AG6A 3U4GA 5EA2A 1C3EA 1V11A 4PQGA 5DI3B 2VA9A 2BGTA 2FDCA 2ATVA 3F4KA 3TTUA 3QHAA 3TQQA 2AXQA 4IV8A 3TEJA 3I4CA 5JNLA 4BO7A 4GX0A 2ZSEA 3OIUA 2O5VA 3VNBA 3A28A 3FNHA 1Y3FE 5GZ3A 4B3CA 5CVUA 1XZPA 1X1TA 1GU1A 2ZRFA 1AK9A 5REQA 1KMMA 2H29A 3I2KA 4EYQA 1G64A 5AJTA 2JLUA 1MDBA 2XXJA 1FUKA 4MO9A 3O4HA 1Z74A 3I2JA 3RH0A 3OZRA 1LRLA 2CUNA 3MQFA 3O8CA 4M6WA 1VM6A 1FTWA 4GMDA 1E5DA 2WV7A 2XNDD 3HC7A 5F73A 1L4LA 2WIBA 4LE0A 1RWWA 4EAAA 1ZOLA 4NJEB 3RAJA 3R44A 1IPEA 4KUHA 3SVLA 2WHQA 4NAVA 3G13A 3KLBA 3HY6A 3K0BA 2EBUA 2ZRAA 2ODQA 4XWGA 5IUKC 5JAIA 5LYJF 1LK0A 1ZK4A 3FNEA 1AQUA 5HM8A 1YDMA 2WHPA 3K1AA 3PQ6A 3GRUA 1N3BA 1SBIA 3IBSA 1WCIA 4WXEA 2QD3A 3OCCA 2C2YA 2O1XA 3WZMA 1AKQA 1BOFA 1E6UA 1SXJA 3O4FA 3ZNOA 4QM6A 4UQPA 4XD7A 1ZD2P 3LJKA 3VKWA 4DV4B 2B8NA 3OZVA 4KEAA 1ORTA 1W9HA 3RAFC 1SOVA 2HRDA 2QORA 3LCMA 3NV7A 1RWMA 5HE8A 1J8MF 1V16B 1W1IA 3JZFA 2C8KA 3PD1A 4RDXA 2LXNA 1UJNA 2ZI6A 4XZ3A 3TEMA 3UPDA 5ADVA 1C1XA 2WF7A 4KLAA 5IBQA 3UATA 1W85A 2IOYA 5TX7A 2VPQA 3RW9A 5HBRA 5EC8A 2WF9A 5EE5B 3ESXA 4DLZA 5I6DA 4DV1B 1ULSA 5ALUA 1W36B 1NJ5A 1U2QA 3MAAC 3VX4A 2Q9UA 3IQZA 2B25A 3UK1A 3VJMA 1GN8A 1XCMA 3A11A 2BH2A 2IS6A 3V32A 4JY7A 1T0HB 1A9PA 2CJFA 2Q29A 2ZFUA 4ML3A 4TT8A 4ZQFA 3ONNA 3RG8A 2P1ZA 3VR2D 1SVNA 3W78A 1IONA 1OWMA 3WL5A 1F4PA 1NF8A 2E4XA 2WIKA 1JJFA 1TF2A 4R68A 2IWRA 4OG2A 1PWHA 1PR1A 2AZDA 2CKDA 1N2GA 2IC5A 2PZFA 4HAZA 4FI3F 4IHJB 4ZVSA 3T1NA 3U3ZA 2GF0A 1ORDA 1G5FA 3INNA 4C6TB 2WF8A 1YZKA 4ESHA 5HUJA 1YAHA 4R1SA 4GI5A 5AVUA 2ZCJA 3MD0A 1O8BA 4LDRA 3C48A 1XYVA 3EJ6A 1KZYC 3HJAA 4UXHA 5HIIA 4JT2A 5JMTA 2GPNA 1BWRA 4Z51A 1WV0A 1PQYA 2YRXA 3PVSA 1SH7A 4YDHB 1E8DA 1K6JA 4MJ3A 2Q6TA 3ZV3A 1LQTA 2IHKA 2PX2A 3D0RA 3ZZUA 4AK9A 5L7YA 4CBVA 1SM4A 4UVGA 4YREA 1CS0A 3I76A 4FFDA 2O8EB 4GKAA 3SXJA 3LIPA 4L5JA 1XTKA 4GXQA 3G8CA 2J31A 3GZJA 5A0FA 4COKA 4JSTA 4CTOA 5IULC 2WU8A 3JVIA 3OOJA 3P27A 4LRTB 2ZI9A 4Z9YA 3C1TA 1G21E 3GFGA 3S28A 3Q2KA 2BZSA 2X9NA 3B5IA 3GZNA 2IZOA 3QKSA 4FGSA 4IGKA 4UE3S 1UT6A 3JASB 3T1OA 3ZIAA 1IHPA 3PNMA 5DNYB 3B5JA 4QNRA 3WFIA 1DJQA 4P92A 2OCLA 4KMSA 3C3DA 4AZ3B 1TT5B 2JCBA 5CVDA 5ALLA 4MW2A 4EHFA 4I99A 2C99A 1SY7A 4G5FA 3PQDA 3WR5A 3AFIA 2JFFA 4X6UA 4LZZA 3LCJA 4IXTA 4NV0A 4OL0A 4RK6A 2IDJA 1DU4A 1OKKA 1DQPA 2ZRDA 1PWEA 3GJRA 2ETXA 3LRPA 3PUJA 4TYYA 4A2QA 1N78A 4DLXA 2BFCB 4HGNA 4BZXA 3P71T 4FGKA 3H5OA 3L7MA 4J1TA 1MV5A 3GFQA 4Y2JA 1R4AA 4OHUA 5G4KB 4B3FX 3GJTA 4LJSA 4LFBB 4II3A 5BN5B 1BHJA 1VGRA 5KWIA 2IH5A 4DGQA 2HU2A 1H0RA 2G1AA 2IZ5A 1NQVA 2FV8A 1T9KA 3QU5A 4LPSA 4YROA 1EPUA 1ZHFA 4P9NA 4C22A 1QHNA 1UMBA 4RS4A 4ZDIA 1DC5A 1V5WA 4M8SA 4BNIA 4JEMA 3NHKA 2A59A 3RVRA 2O19A 3Q15C 2FWBA 2A1UB 4N39A 3UG7A 4TN1A 5E4TA 4GS5A 4MYCA 1PZEA 3IODA 1KU0A 4PAQA 1UMDA 2O0JA 1HQCA 3UANA 1DAHA 2DETA 2P5SA 3AVVA 3DS8A 2AR0A 1YVEI 3MLEA 2VP9A 3USES 3TI9A 4A0HA 4GSKA 4FB4A 3WYGA 1TMKA 3CBQA 4N5DA 1L5OA 2PGOA 1E5XA 5AVJA 2J6BA 2B35A 3WLTA 5JC1A 3K70B 2I4TA 1MCZA 1KPIA 3T7JA 5BSVA 3GMIA 5JDCC 4QG3A 1DXHA 1JHXA 3I58A 1T2VA 3A06A 2W2MA 4ZAXA 3RG2A 4EO4A 3NHBA 4BS9A 2JJ1A 2NVUB 2AEMA 1XEWX 4R9SA 4A7PA 1TYEB 5IT0A 1GTSA 1PX0A 1GOTA 1MJHA 4QULA 4HWTA 4G9GA 3TQHA 5TXGA 5BMVF 4FFVA 1PHRA 5FWYB 4YGYA 4HVAA 4MA4A 2HRCA 3LTEA 1X87A 3GLKA 2FEOA 4QU8A 4UHEA 3I5YA 4DDTA 3WK9A 4Z2AA 5JISA 2VK4A 2M2IA 5AM0A 2AG0A 5JECA 3F78A 4LCEA 1K8ZB 4BUJA 4AKIA 3I6YA 2I6GA 2QD4A 1M66A 4HF7A 3AP1A 3U6BA 8AT1A 3MS2A 5CCEA 4HZUA 5AVQA 1AQNA 4BTEA 1ZM2A 2FDRA 5KNDA 3DE4X 3G68A 5TQJA 3HLYA 3TTTA 4D74A 1I1OA 1ZU4A 1E2EA 2J9YB 3DMYA 3G0IA 3U4IA 3QV1A 4I4LA 1SB8A 1JDBB 1JT2A 5B2ZA 3ZQUA 4DLTA 1D2GA 2X7JA 3MAGA 4PS1A 1NP7A 2FOLA 5JH7B 3DYVA 3GIDA 1NASA 5JANA 1A2OA 4R31A 3EB9A 1ICEA 2BI8A 2G7MC 3ABRB 2QRMA 3AP2A 2BCGY 4GYJA 4IRXA 3REQA 3KKEA 5FXMA 4DRXA 2QM3A 2PD6A 1KZ1A 1ZIOA 2O3QA 4K6CA 1R9JA 3FDZB 3IUEA 2CJWB 4J7XA 3FE2A 2WJPA 4E2ZA 3LZCA 1RLTA 3NVAA 4MV5A 2W6CX 3Q0EA 4Q02A 3WP0A 4BKQA 1BRTA 4UTVA 3DVAA 1UJMA 3R6TA 5KJFA 1ELOA 1RQPA 4LV5B 4IGIA 3O75A 1EI9A 3WDMA 4EA8A 1HRDA 2HFKA 1Q44A 2JGIA 3DJFA 1F2UA 2GRUA 1BU5A 4Y98A 3HNRA 1VB3A 3REOA 1QJ4A 2AVDA 3T06B 4GFDA 3U7GA 2BVNA 2XUJA 4QTTB 5BSFA 1D6JA 3VTZA 3IQXA 3IALA 3RVSA 2Q9CA 3CLTC 3IMEA 2AR7A 1ITZA 1C7FA 4LF9B 1JMKC 3FCOA 1OWLA 1YU6A 3KXIA 3AESB 3V1LA 3FIJA 3NAGA 5T4HA 3S2UA 1L8OA 2QTRA 3E82A 4UHHA 1EZ1A 3IFSA 3L4SO 2CNOA 4QX6A 3RNLA 1XQ9A 4BV9A 3ZVLA 4DJ5X 1EVKA 1QM5A 4J0IA 2QP3A 1N6PA 3AC0A 3DW1X 3KHTA 3FKSD 4G5HA 5CFRA 5K99A 4NXMB 1XRQA 5BNTA 2OZVA 2ISQA 2Z6QA 4J0JA 5K0GA 1MXFA 4PFSA 4AYXA 2CVHA 1H2XA 2FA9A 1TZKA 2C9BA 2NTEA 4HQ6A 3JWHA 2CLCX 1Z25A 2JJQA 3WX0A 4B7AA 2E5LB 3C0KA 3RREA 3ITEA 1AHPA 4B33A 2UVDA 3RM3A 2FWNA 1QRSA 2OQIA 3AJDA 3VZBA 4CMCA 5BVGA 1SVMA 2I7XA 4PZYA 2WHYA 5HZHA 1IUNA 3AETB 3DG9A 3P2MA 5JFOA 1K6XA 4HYYA 1Z2DA 1ULBA 1YKSA 3OU2A 1OHHA 1WXXA 3AVOA 4FDUA 4FFOA 5A9SB 3HXKA 1ULZA 1ZI9A 1W5FA 1A8PA 3E3LA 3HCWA 1W6UA 4B4KA 2A35A 1D7OA 4KK3A 3OZDA 3O94A 4CHTA 1UDWA 4BLOA 2I1LA 1EYZA 5FTKA 2W0SA 3A6DA 4XLLA 5DSTA 4RLHA 2NT3A 4QXMA 5HRAA 1GARA 2HWKA 3KEGA 2NP7A 3OZCA 2P65A 4U7HA 2ONCA 1KC3A 1D03A 4MPPA 5DXJA 1E4EB 3VZPA 4HEHA 3M6XA 1KETA 5JD4A 4G1UC 4YRTA 3DEAA 3ADOA 1SCUA 5BPFA 5A9RA 2ZSDA 1G17A 1QR6A 3DAFA 4H7KA 3BH7A 3HFSA 3BICA 3RTCA 4ED9A 3FWYA 2R6R1 1AHHA 1E66A 3DBVO 3R9XB 2FG5A 2PLRA 2QY9A 2HHCA 1YO6A 1SCQA 4FK8A 4FC6A 3U40A 5CA1F 1RP1A 1ONOA 2HJSA 1UMCB 3GLHE 1HEUA 4NZOA 1STOA 4O4IA 1XTVA 2J9GA 3IMCA 4DPKA 1B3RA 1M6WA 2FW0A 4I50A 5DCUA 5A3JA 1FP7A 1JI0A 1R0SA 3VPXA 2YWFA 3MWDB 3O0DA 1AHNA 4F0JA 4TM7A 1TKAA 2GJSA 1C3JA 4B79A 2OAQ1 4LCBA 2L42A 1UADA 4QSMA 1MDFA 3FUWA 5EMKA 5IVPA 4LIPD 4RWEA 4J3NA 5BW8A 1AS0A 4JI2B 2Q3CA 1AZWA 2HF8A 2HMYB 4MCAA 2IF0A 3F7TA 4R51A 3C7AA 4ZRMA 1RM0A 1XZBA 2C9ZA 2ZCVA 4C7BA 4YP7A 2O8FB 5SICE 4YCCA 1E1DA 1LLQA 3I0NA 1LBEA 3S2ZA 5J58A 1OX6A 2EJUA 2G07A 1ZUNA 3FRIA 4H6VA 4UHDA 4JI4B 2ZIFA 5EGNA 3M2PA 1PKEA 2D3TA 5DYIA 4I66A 2JFPA 1E1MA 3DCYA 2O1SA 4CV0A 2I6FA 3PNBA 3JZDA 3RT9A 4RIHA 4BJ5A 1D3AA 4YVFA 3HZHA 1IHXA 3JD4A 4UAJA 3CX3A 3PEWA 3OIWA 4M0EA 4DXAA 5HQ3B 5FNVF 4EEKA 5JRJA 5FNVB 1RYNA 3OPYA 2YXPX 4Y2RA 4Y6OA 3PR2B 1EUDB 4JR2A 5TJ9A 2ZGVA 3GH3A 1KZ4A 1TVKB 1N0VC 1K4MA 3WO0A 4RNCA 5GJWC 3CNLA 2HCBA 4UDXX 1G8JA 4IIJF 1ABBA 1F8YA 1TJ3A 1OXKB 3CRW1 1L4EA 3Q6IA 2SBTA 4PCLA 4YRFA 3LPDA 3Q8MA 3F9CA 4KYTA 2TSYB 4XGKA 2I2AA 4ASUD 3WG9A 1AB5A 3FFXA 2AN9A 4G0QA 1UBCA 2IK8A 1FEZA 1M2WA 3F67A 3P32A 3PUYA 2W98A 4G5YA 4OK6A 3U3KA 2WINI 2YJ5A 1PJAA 3H2BA 3A0RB 2ZRLA 3ILVA 2OTCA 1K7CA 2ZZNA 3AR5A 3V5NA 2FFJA 1S8NA 3F9RA 3VU9B 1QRUA 3WLKX 4U2GA 2F48A 4L27A 3U4AA 1X39A 4BTLA 3OC6A 5AVYA 1H1LA 1XYYA 1G55A 1RWXA 2MMGA 2QMOA 4GNRA 4EHAA 3C5WP 1JFLA 1NC3A 4QWMA 4RCYA 3SC4A 5AO9A 2AKYA 5TMBA 1QG6A 1P17A 3BRWA 3GLQA 1MAAA 1EBFA 2VSNA 4P3NA 4RY8A 4B34A 4DIUA 4EGFA 4RYLA 2P9ZA 2WT4A 2K2QB 4HAIA 2PXAA 3VKVA 3UN1A 3AILA 3THWB 1U7UA 1L4UA 1B3BA 3M4XA 3GDWA 5KMGB 1C9NA 4AMUA 1OWPA 3E03A 2TMYA 3H5NA 1OLXB 4OY3A 2XCLA 5KJEA 4PINA 3AM5A 2VJAA 3ROGA 2XCUA 5DMXA 2JH9A 4NECA 4PXYA 1CRPA 2HX1A 2C4WA 1EP3B 1T0UA 3GJ0A 3AOEC 4BMPB 5JZOA 3U7QB 3JAMA 1EDEA 1XTRA 1E2NA 4K9OA 4US1R 3O4GA 1UMBB 5AOCA 4BBZA 1WW3A 2GEDA 2GWHA 2OSVA 3EUAA 3OF5A 3QP9A 4BV8A 4F96A 5KTOA 3D8BA 2G5TA 4KR7A 2D1QA 4MO2A 2C9MA 4HXEB 1O5IA 2DLNA 2GBFA 2IP4A 3DD1A 4BO9A 4WK2B 2B8JA 4CV3A 4MW0A 5E2IA 5E4FA 1DQRA 4I5FA 3KJQA 4X65B 3F98A 3UHFA 4AX4A 2IW3A 4BV2A 4EY5A 2CHEA 3ROMA 1A82A 5T6MA 4IY1A 2O4UX 3ZXUB 3K0HA 2XE4A 5KAMA 2ICAA 4R0VA 1V8OA 4NHOA 3KEFA 4BC1A 5JH7A 4CEJB 3HM9A 1Q20A 1LRJA 3NBFA 1MIHA 3ZDDA 3HDGA 3PL5A 2POQX 2ODAA 3U31A 4CDMA 1QF9A 2Y1OA 1U2ZA 3BJZA 1ISJA 3KJNA 3UK2A 3KD2A 1JVNA 4ZVRA 1RYYA 2Y2VA 4OH7A 1ID1A 3A9CA 5C1IA 4OB6A 1S9HA 5CDTA 1N3YA 1UXOA 3QFFA 3JWIA 2GBLA 3MC1A 3OU7A 4C4PA 3KQUA 1R15A 2V7QD 1L5LA 3BREA 4G3XA 4LVCA 4IYJA 4BE9A 4V0RA 5CBPB 3WHKA 1KK3A 3CSDA 1ZOPA 2PUFA 4N18A 1FRZA 4B3MB 2B4AA 2QZ9A 5EJ5A 4I8DA 3OVMA 2AI1A 1Q0RA 3RJZA 5AUNB 2VBFA 1CZHA 2GTPA 4ZK2A 3C3CA 1ZOOA 2GZMA 3HL0A 3C5HA 4M6WB 5AWFC 4BX3A 4FMCF 1ZIPA 3X43A 1HQYE 4D81A 5C8XA 1NQUA 1S3SA 2WUGA 1RYDA 3E3NA 1OXVA 2W6ZA 4G36A 2YY7A 3H4TA 2OFFA 3TB6A 5FLKA 1B15A 1ULTA 4MS3A 5ADHA 1W87A 2TYSB 1FRQA 1CJVC 2NUBA 3FTPA 1E8NA 3UJPA 5AW0A 4MITA 4X84A 1U04A 1M8KA 2A78A 1UJ5A 5F35A 2W8BB 4HGOA 5DISB 1L5KA 1P7YA 3F97A 2HA3A 1VL0A 5GIOE 3LTNC 3GN1A 1U8TA 1Z75A 1Y3HA 2WSIA 2XQIA 3KL4A 4OQEA 5KCZA 1N7HA 3EQ7A 2C2XA 3N2KA 5IMBA 3UOAB 1WR8A 1T8WA 2OV3A 3QFHA 1SA0B 4G2NA 4HQRA 1KOLA 4Q1CA 1ZMOA 4WMLA 2YHAA 2QF7A 3FA2A 5F5LA 2NQTA 2G5PA 3I04M 3TZKA 4MRRA 2C5SA 1HE2A 4UAGA 1PW5A 4KOEC 2A7QA 1KEPA 1UFQA 3CWQA 1IDOA 4G4JA 4A23A 1WMAA 3TTSA 3P4YA 5D2CA 3KZNA 1ZEMA 1R6VA 5LP6F 4F4DA 1V7PC 1F4LA 2CVQA 4H6PA 2QX8A 3AL2A 5LB2A 2G8NA 1GZ6A 4Y0NA 5BSUA 4E22A 5KIAA 5B1HA 3TBKA 3OHPA 1WNTA 3KT3A 3MOSA 1H2HA 2ZT8A 4P6VF 4EG8A 1KO1A 2X23A 4YJ3A 2C84A 3EGEA 2X8WA 3BD6A 1HDGO 2CDAA 2LPMA 1RRPA 2YRFA 5JXHA 1VJTA 3DNMA 2PTGA 2XKAA 5D5PA 3HKEA 2G1UA 3L8CA 2IITA 1X3LA 3E0QA 2IT1A 2VXOA 4GXNA 4TLMB 2ZTVA 2WJZB 3AHJA 1RXEA 3L4EA 2AUTA 4BCBA 4F5EA 3LUCA 4ZT3A 1J42A 2B78A 3MOIA 1H8ED 5TS2A 3TSZA 5A4JA 1I13A 3RGWS 1Z5WA 3QU7A 4MR8A 2GJ8A 3CV3A 3KYJB 5F76A 1CWUA 3PGKA 4EHLA 1SOMA 1KFKB 2G40A 5CEFA 4AROA 3FHTA 1JDZA 1WQ1R 2HTEA 1ZCJA 2G17A 2BONA 2ZBQA 3G2IA 1C1XB 2P3OA 4JLUA 1BMQA 1D4AA 1Y7TA 1CYEA 2WSSA 1X8XA 2WZDA 1YL5A 4IWYA 4U2FA 5K3CA 3UJ9A 2PFGA 1DELA 1T2CA 1J1ZA 1A9OA 2I78A 1WY7A 2P3SA 5FKJA 4YWJA 5KSOA 3R40A 3CUUA 3MTIA 1H3NA 4E4YA 4EG6A 4OB7A 2ZAMA 4LF7B 3OPYI 4JZYA 4WN9B 4DKXA 1SPBS 3KYCB 3MINA 1P2TA 3BBLA 4HTFA 3R7DA 3CUVA 5CFQA 3Q8LA 3WQRA 2Q99A 2ATXA 1P2VA 1JI3A 2I2XB 5LA6B 4R69A 1XK7A 2CLEB 4R16A 1W0CA 1CERA 3L7OA 1GKLA 4LY3A 3C7DB 1Y4SA 2AOXA 3FCUB 1U81A 3WV5A 4CIXA 1G42A 3DHWC 1CY0A 2PMWB 1ZISA 4DBLC 3QX3A 1NUQA 3N2KB 3QSYA 2Q5JA 4G09A 5CYFA 2QD2A 1X1BA 4RKYA 2I4IA 5EJIA 2XUHA 2EEPA 3S29A 2WF5A 4QGAA 1PTJC 1LV8A 1XMXA 4N3GA 1S2LA 2QV7A 3CEJA 5JZ9A 6GPBA 1P62B 4ZMSA 1XTTA 2G8LA 3D1VA 5KTKA 5JSQA 1RFLA 1UBLS 3KPYA 1DPGA 3G2LA 1KE2A 4NABA 3IQIX 3B9QA 5DT2A 5F2EA 1I2DA 1OLSA 1V8FA 1UKCA 2VNKA 4GZ6A 4INPA 4LQDA 1K88A 4ZVTA 3DVRX 3OQOA 1ZS9A 5B1EA 3Q2OA 3IBTA 3WRYA 1CJCA 2NSYA 3AM1A 3D1LA 5L51A 3ZE0B 1L5MA 2B9EA 2NO6A 4FW8A 3V3TA 4MS4A 4C4ZA 3SSMA 2H00A 4ZOLF 4QDTA 2QN9A 2GM9A 1R9GA 3D2LA 4IW3B 1XROA 3ZWPA 3DOIA 3U3DA 2YXNA 2J59A 3BUSA 4A0RA 4E2XA 3VKFA 5GOZA 3TCNA 3WWPA 2C92A 1JAHA 2A5DA 4QTYA 4QUKA 5KDOA 2NSLA 2O8NA 3H83A 4ARBA 5SZIA 4D42A 2QTMA 2B20A 2ZETA 4V1CB 4JCCA 4ZEVA 3RC8A 1MKYA 2QNBA 2JEYA 1NZDA 2VZEA 2CDCA 3KO8A 2H7VA 1G0OA 2H07A 4BGUA 1AMOA 3EG9B 2Y0BA 3GRYA 5BN4B 2OV4A 4UM5A 3H9UA 3OHSX 1KH3A 1PT9A 2CLMB 1FW6A 3RYFB 4ZO8A 3EUWA 2DBZA 3L5OA 4UUPA 4IOLA 5DGCA 3A26A 1T24A 5LZ9A 4DREA 4WI1A 1DKUA 3PUWA 2FEKA 4OHKA 1FP4B 5A5DA 4PPGA 3W2HA 4U0JA 5D7BA 3SC2B 2H1RA 4L5IA 5JXGA 4TMTA 2RHLA 2GPAA 4C07A 3VUEA 2HW8A 1IC6A 2FMIA 3FOCA 3WLHA 3DV0A 4RH1A 4XLTA 4EY6A 3RIHA 1CUYA 2N47A 4WFQA 4ZFNA 2Y1WA 2CVPA 3SJZA 3SZRA 4C0QC 2Z57A 1IUKA 1ZG3A 4IDNA 4FM9A 2FETA 2DFKB 2EFCB 4ZVOA 1DJMA 1OLXA 3OOYA 1VA5A 5ARCA 1KGSA 1T15A 3Q6MA 3VA7A 5IDYA 2YKGA 1OIXA 3EIXA 5LR6A 1NW4A 1T2EA 5TEWA 2ACVA 4DAOA 1E2MA 1A77A 2L0XA 3VR0A 3MBIA 3JQGB 5IANA 2VNSA 2WKWA 3CE9A 3CUSA 1A8HA 3QU4A 4JJZA 3WNBA 4DNXA 1FVFA 1L7DA 1S7GA 3VVMA 3GPLA 4E5MA 4IDAA 2I2WA 1UJ6A 4L0DA 4CLOB 2PUJA 3BXGA 2Q8PA 3NHSA 1XEXB 3PHIA 5BNZA 2FPLA 1JECA 1S3FA 1G291 2X1VA 1U65A 4QRDA 5B1DA 4A82A 4IZHA 5CDUA 4KBFA 4C0HA 4S2UA 2Z8XA 2V65A 2OCBA 3BMCB 3LV8A 1LA2A 2IZ1A 4MI6A 3ZXSA 3IP5A 4BRSA 1QWSA 3N6XA 3U1TA 1GPH1 5C81A 2A1TS 4XSHA 5JD5A 3I9KA 1M2FA 2IYPA 2BOVA 4DUPA 2IW1A 2ZR9A 4J1QA 4N3AA 3IAAA 3T94A 1HFKA 5ITSA 1E3IA 2EHJA 2J46A 2JI7A 3QVTA 1E59A 4I3HA 5E7JA 4QOIA 5KUTA 4P7FA 4ZAZA 4B4OA 5AUPB 4E08A 4E7PA 3LKDA 3LC1O 2ZIUB 2P2NA 1MIOB 1GPWB 5CIQA 4FWIB 3VYRB 1FMCA 3ZTWA 4DR7B 3RNOA 1AGNA 1TA4A 4PPQA 3IT0A 5IX8A 3VKGA 1Q0PA 5KWJA 1DFGA 4PLHA 2YYSA 2Y9MB 4DBLE 1GNTA 1PNVA 2OBLA 1C7ZA 2RC5A 5K03A 4MRPA 3IV6A 3DXYA 5I48A 1AKEA 4DG8A 4X66B 1ZCBA 5LZ2A 1A98A 4PVDA 3ZGYA 2OY0A 4QUAA 1N6OA 5ITZA 5CFZA 3I5XA 5KOJA 3ZIUA 3WMWA 1XQ6A 1E4EA 2VF5X 4QSHA 5EXTA 1AXEA 1Z5VA 1VYVA 1Z2AA 2AF3C 3JR7A 3JW8A 1GYRA 2VK2A 4M60A 4RDCA 4BYGA 2PUAA 4QAQA 4TTIA 3D7RA 1M1NA 1E9DA 3SOZA 2XQKA 3B13B 3R3ZA 1DQYA 3HCRA 1JMVA 1TNDA 4QBGB 4L6IA 4EPRA 4TTTS 1UBRS 1DCFA 5TT0A 4FQ8A 2JVJA 3IMKA 1TRKA 4C4YA 2EF0A 4HOYA 4RZ3A 3VYVA 5KOYA 4WKGA 4OHZA 3EDOA 1QZZA 4E21A 2G1PA 1HG0A 3E8MA 3B2QA 1U5BA 1N2CB 5L45A 2ZYDA 1NLFA 5ES4B 3V7UA 5HMMA 3BSYA 2CBGA 5HIJA 1I2MA 3G02A 1DEKA 3GHHA 3LHIA 4CMBA 4Y2HA 2ZBGA 4J29A 3G2QA 2QPLA 3I4LA 4YC7A 2QLNA 2PBLA 4RM3A 4YUYA 2C4UA 1QIHA 4LHVA 4Q7MB 4QFBA 3VO2A 3OEED 3V9AA 4R2HA 4JNCA 2GSDA 3D7MA 4BATA 2QTVA 1OGYA 2C7BA 4KIUA 4N48A 3H3FA 4BMDA 2FPPA 2R62A 1XWFA 1PRYA 1K8XB 3VKHA 3IO3A 5IFLA 2VYND 5JYEA 5KNDD 1PFYA 4N65A 2QUIA 2JRLA 2SKCA 2VWQA 3RQIA 3VPSA 1J2TA 1H6DA 1QHXA 4MUYA 2JFBA 3MHPA 4XEUA 2HJVA 2Q49A 5DYGA 4X00A 1IM8A 4GPBA 5K3FA 3V3KA 1HQKA 3QLUC 5LXTB 4KNWA 4ND5A 4B3XA 5LWHA 1DTWA 4L1KA 3TIVA 1Z0JA 5AI9A 4YMIA 1KIMA 1D0IA 1JR3D 4RX1A 3V1KA 1KC1A 1CUGA 1P1RA 3EUEA 3K9CA 4O2RA 4P4NA 1EXWA 5EQJB 5TY0A 5KVAA 3HYRA 4ZU3A 4DQVA 4TV9F 2PEZA 1CFZA 4LQLA 4PLYA 4JLBA 3BC1A 2Q2VA 3DHVA 4OIFA 3TGWA 2F8LA 3R9XA 5LC1A 2NACA 2HJGA 5B4UA 1ZL2A 1ATZA 3TPCA 2ZYSA 3Q3GE 5CA1B 1PLLA 3W7VA 3ZWOA 2C5GA 2CSUA 4EHKA 5KYWA 4IUBS 2PX8A 2WWGA 4FXOA 4XOUA 2ALJA 2OT3B 5H3LA 3C1OA 1SUDA 4RV4A 4D3XA 1SMKA 1G20B 2GPSA 4DOMA 3KXKA 2WOJA 3F74A 5IC4A 4LW8A 3ZQ4A 1L4GA 4L72A 5ALSA 4ZO6A 4UTRA 3L8HA 1ADJA 4GI3A 3BMQA 4OHYA 2R00A 1QIMA 2DQKA 2JFYA 4AY3A 4F3YA 5AFSA 2C3UA 2XUIA 1JQDA 4XJSA 3EXAA 2Q6IA 3CLSC 3FPLA 4B83A 1T91A 2MJLA 3UH1A 2JC3A 3TE6A 3WWYA 2JBAB 4HX2A 1F2VA 4BP8A 4D9CA 3I2IA 5ICCA 1XZMA 4ER3A 4BBAA 121PA 2O07A 1TD9A 2HNBA 2Y1CA 1BN7A 1CHDA 2ZS9A 1BFUA 4G0OA 5B3KA 5IRCD 2O3JA 5ALFA 4L3VA 3H1EA 4MYRA 4WXRA 5ICSA 1E3TA 2HHJA 4FDAA 5D5QA 1R9NA 2EIHA 1Q7EA 1WF3A 2VUHB 3I2HA 4RK5A 3NFYA 3ZLUA 1A97A 4TVBA 1SUWA 5HR5A 2B69A 2VF7A 1IPHA 1I1NA 1OI4A 3LIIA 1UWKA 3TD9A 4CKYA 3JVDA 2HHLA 2AI2A 3B6IA 5FWAA 3ZHZA 4LXIA 2X2OA 3QEOA 3C98A 4M9CA 2WT9A 3D4LA 1KZHA 4Z4IA 4AZTA 1FC0A 2ZJ2A 1W29A 2FQXA 3DM5A 4G4IA 4CCSA 5FUQA 4GLOA 5KKNB 4BIIA 3IDSA 3Q4GA 1P2SA 4ESOA 1MNQA 3R7LA 3U4HA 5AR1A 2HU5A 1MTOA 2WC1A 4C0WA 1YU9A 3TVDA 3PQCA 1XJWA 4Z9XA 1JXMA 1M83A 1MB4A 1EVQA 4R9RA 3KTDA 4F46A 1K8RA 3U19A 4LRYA 1EDBA 1T8PA 1XA3A 2FVXA 2WU3A 3L5KA 2OCPA 4PY2A 3S4YA 3LP8A 1T1JA 2OZKA 4DLKA 2XA1A 4ZYVA 1N32B 1UFVA 4K87A 2F8MA 2K4MA 2GEVA 1ESZA 2YNMD 4L73A 4MA5A 2Z9BA 3PTAA 3TRKA 4NZYA 1Z0FA 2H2GA 3DD5A 1VJCA 2Z5LA 4INOA 2O5EA 2CC2A 2EV9A 1CU1A 4ZMRA 3PVCA 2WNHA 4DR3B 4OMCA 2CLIB 4GI7A 2PV7A 4RELA 2HMVA 3HYSA 4NFYA 2R751 1R0ZA 3PC4A 1F8GA 2IXTA 5TB5A 4GEGA 4R8MA 1MT0A 1P3Y1 4OQNA 2P2CA 3MRSA 4JXXA 1AQLA 1BD3A 4P0PB 2AMLA 1JYEA 2QTFA 3RBZA 1LSUA 2B7BA 5EY5B 2HK8A 2YW2A 4BO6A 1G8KA 3DAPA 1SUCA 1M7HA 3K9GA 3QBTA 4UNPA 3ZBUA 1DUSA 5KNLA 3V6LA 2Q4DA 2XRFA 3BDAA 2GVZC 1LZKA 1A88A 2HLHA 3CO0S 4AMYA 3K70C 3B85A 2WT8A 2WPNA 3S5UA 5BWMA 5DGTA 4XR9A 2H9YA 4IAOA 2YXLA 4O1IA 4Q9KA 3MYYA 1VKZA 3DE2X 4PYQA 4BCDA 5FUBA 5C1BA 4UNIA 4XGQA 3OEWA 1P2FA 2Q5QA 1XZCA 1ZH0A 1JDVA 3N0VA 1BX3A 4LI3X 4EO7A 2QYHA 1H1DA 4YR7A 4IDOA 1S2NA 1N5KA 1NTRA 1FQJA 4FZRA 4FMCB 3CYFA 3RPEA 3DEZA 2CV1A 1Y9ZA 1ZJWA 5H3HA 5KSWB 1SHJA 1ACLA 3PIRA 5FPQA 1WPGA 2RAPA 2EX0A 2P9JA 3EEBA 3F0TA 1JFVA 2O2HA 3PCTA 2G0NA 1DX4A 2VAWA 1FU4A 1WMBA 4MRSA 5IAOA 1WSDA 1UWLA 2XUAA 1SG0A 1W7AA 3FYTA 2ZJ6A 3NH6A 3OO0A 3SWWA 5KNCD 2VCEA 4DQLA 1HF3A 4X1OA 4BO2A 2DUUA 4IDCA 2X1LA 5C8YB 4WY5A 3PGLA 1SBCA 1SOUA 2CFCA 2RHWA 3QE9Y 2OZEA 1Z2NX 2QK4A 2IHBA 3FETA 1YR8A 4KAJA 3HNOA 4RPCA 2PH3A 1VHDA 1Y1TA 2WG1A 4O4HA 5CNKA 4MA0A 5JRZA 3I9NA 3U81A 2JAHA 4PC3A 5EWLB 1BWQA 1K27A 5D86A 4LE2A 1WCWA 3BULA 3RHZA 1GDTA 1QYDA 2FLWA 4TKLA 2HK7A 4BUZA 3QNMA 1OTHA 4YBRA 1DIAA 4AQDA 5BSHA 1IIRA 1KYIA 4CF4A 4WFJA 4TZ0A 1KI2A 2AKAB 2QD5A 3FSRA 3RVQA 2BHLA 3W04A 1G18A 3NBZC 4URXR 1UANA 1EKXA 3MFYA 2VDPB 4LOHA 2FPXA 1BEEA 4MV4A 2IPNA 5E1DA 1KOGA 1BO6A 1TAQA 4G1VA 3KCNA 3QEBZ 3SDBA 1F48A 3LFUA 2ZT5A 1QH0A 3WRXC 4HKTA 4ZOAA 3HJFA 4EF6A 3AVXA 5G40A 2X15A 4J16C 3K72B 3SMQA 1YC5A 1G9SA 3G6WA 3QVSA 1NXWA 4DCCA 5HDBB 3UJ7A 2ZJBA 4HZUB 3OWXA 4GP9A 4RAOA 5EZYB 2VJOA 3D5TA 3HADA 2CW5A 3KZCA 1J7JA 1UDAA 3CLRD 3IMFA 3OZIA 4QJ5A 4QOSA 5F4ZA 4DA6A 4LJRA 4O59O 2ZI4A 4X7RA 4EENA 4RJLA 3M83A 1MT3A 3EOZA 4F93B 2ZRCA 1M1YA 2WHPB 4CV2A 1GWNA 3WLOA 2X3YA 1BIFA 3U9TA 3ZD7A 1NQAO 1JIJA 2FOIA 3W7BA 4DDWA 1VDZA 3L0BA 4M7PA 3VDMA 1LF5A 3D8RA 3JYNA 4UBNA 1ZNQO 2ZQYA 1HKUA 1S3IA 1SKBA 4G5QA 5TNXA 2GCGA 1XCLA 1U0LA 2BFBB 3D59A 1YRWA 1I0ZA 2IYRA 5FX2A 2DTEA 4LHSA 3FDIA 3OD1A 5I8WA 4CMIA 1X42A 2E89A 1RI4A 2ZYIA 4J0GA 2FR0A 1GCGA 3H13A 4I1OA 1J2UA 1XJCA 2Z58A 3DHEA 3I0ZA 3L0PA 2EW2A 5J5VA 3FVWA 4DG5A 5I5GA 2MSWA 4DMHA 3PGXA 3H4MA 2R79A 2JHFA 3N0XA 1XRRA 2C83A 2ZJOA 3DMNA 3GJZA 1PS8A 3BHJA 1IAQA 1X6VA 4X44A 3RHSA 2XB6A 2GK7A 3S6JA 3T3PB 1RWBA 1FPMA 3G23A 4E6EA 1ZIDA 3OMLA 3LDGA 4XUDA 1KY3A 4G1FA 4EB3A 4JENA 5H7XA 2DR3A 1PL8A 5IKOA 5M04A 1P31A 4XJTA 4K1XA 3MB5A 3WI7A 4QQFA 5AQEA 4PSUA 3INRA 2W83A 3I5MA 4X8OA 1XXHA 4L2IB 1T3HA 1GGKA 4E70A 2COUA 3A6LA 3BAFA 3LPCA 2BZ1A 2WFLB 3O95A 3QVVA 4O8CA 5GVRA 3RADC 1GTRA 4N5LA 4CIAA 2AK3A 2UUOA 3BF8A 3JATB 2GZ1A 4X6LA 4W1QA 4ONEA 5EINA 1GTVA 5I9BA 1ODFA 2R84A 4FXPA 4AMBA 1KAOA 1JKMA 4ZVMA 3JYHA 5A3SA 1CBUA 2FUNB 4Q7EA 1G7SA 2HD4A 4HQ0A 5FPHA 2OV2A 4R8LA 3QE0A 1KDOA 4DIKA 1YB5A 1NYRA 4FYMA 2Z4RA 1MX9A 3O91A 1CUAA 1KE1A 2PUDA 3WK6A 1T29A 1E0AA 1HYHA 3DE7X 2PH7A 2Y93A 5CBKA 1RM5A 1YS9A 2W6QA 1JBEA 1L7NA 1RJEA 2HSEA 3TLGA 1LDMA 1KEWA 4G8DA 1VLVA 4RY0A 1IH8A 3F2VA 4C3VA 4INZA 4HUTA 4R1NA 2PGXA