4G12A

Crystal structure of putative tetr family transcriptional regulator, fad35r, from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
b'SDRRFQLLAAAERLFAERGFLAVRLEDIGAAAGVSGPAIYRHFPNKESLLVELLVGVSARLLAGARDVTTRSANLAAALDGLIEFHLDFALGEADLIRIQDRDLAHLPAVAERQVRKAQRQYVEVWVGVLRELNPGLAEADARLMAHAVFGLLNSTPHSMKAADSKPARTVRARAVLRAMTVAALSAADRCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable transcriptional regulatory protein (Probably TETR-F
publication title Crystal structure of putative TetR family transcriptional regulator, Fad35R, from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 63
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4g12A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4g12A02
3TEDA 4V2FA 3HGGA 1I6HJ 2EQRA 5D18A 4GCLA 4QTRA 5EYRA 4BBRJ 1JT0A 1JUMA 4DYRA 1S7EA 1AHDP 4A3DJ 2LTPA 2G7LA 5IYDJ 1Y1VJ 4L62A 5IYCJ 4DYQA 4ME9A 1MH4A 2WAQN 2WV1A 2REKA 2M8GX 3T6NA 1P7JA 2Y9ZA 1BW6A 2E2IJ 2HI3A 3DEWA 2XPVA 4S0HB 2QOPA 5IP6A 3QBMA 3BG9A 5J1RA 1JKPC 3HB9A 5IP7J 5HODA 5J3LA 4X6AJ 2E2JJ 2QTQA 3BQZA 1A6IA 2NVTJ 2XPWA 3L1PA 2YVEA 3F1BA 1A5JA 3OOUA 3AQSA 1ITYA 3B81A 3HGYA 2NP3A 4M3EA 4I6ZA 1WH7A 3SDGA 2X6OA 5HBUA 1Z0XA 1I50J 4IHWA 4A69C 2R5ZB 2DN0A 4PXIA 3GTQJ 2L7MP 1OCPA 2AO9A 2L0KA 2LLKA 1GV2A 3VW0A 4GCKA 4RBOA 3VOKA 5FKKA 3QKXA 1ETKA 2UXPA 5C4XJ 2M2EA 3TP0A 1FJLA 3BR0A 1B72A 3BTCA 4V2GA 1LFBA 5F27A 3JRIA 1TC3C 2EH3A 3I4NJ 2JA7J 3QPSA 3EGQA 3GTGJ 3M3YJ 5HAWA 1RKTA 3Q3SA 4G12A 2W48A 2DMPA 5IOZA 3BR5A 3KKDA 5EDNA 3PM1A 2HDDA 3ZQGA 3BTLA 1RETA 3VPRA 1PUFA 5M3MJ 3ZQIA 4NN1A 2GFNA 4JX4A 2QF7A 2LVSA 1XS9A 3LSJA 3LSGA 3W6VA 2PZ9A 3VW2A 3G1OA 1DU6A 1YRNA 2XGCA 2HXIA 1ZKGA 2RHAA 4C3IJ 1OFCX 2YUSA 4BKXA 5EZGA 2IU5A 3K2AA 2FX0A 2LKXA 3KZ9A 1JUSA 2CRGA 3JRCA 5EFYA 1UMQA 2WGBA 1VFCA 2RAEA 3S5RA 3OIOA 3HOVJ 1ZR4A 2OPTA 2QKOA 3G7RA 3H0GJ 1IJWC 4M3FA 2O7TA 1O4XA 3NI7A 4DYCA 4YZEA 5F0HA 3FK6A 2K9SA 5K7FA 5E3OA 2WUIA 2H1KA 2DA5A 4AC6A 1U9OA 3D1NI 3JRAA 1K61A 5J1UA 3BNIA 3B6CA 1H8AC 4LOCA 5DS9A 2M34A 1UI5A 1E3OC 4MFEA 1X2MA 3HTJA 2ELKA 3S16J 1DU0A 2L9RA 5IOYA 1JUPA 2NVYJ 1U9NA 2K9QA 4M6VA 3ZQCA 1APLC 4JKZA 3JRBA 1BW5A 4B4CA 2YS9A 1GT0C 3C07A 1MH3A 2CUFA 5CXGA 4AYBN 3BR1A 4QSHA 2LK2A 1MBFA 2NS8A 2TCTA 5E3LA 4D5CA 1ETOA 5FKOA 4IHXA 1HF0A 1WGXA 4FE7A 2EZLA 2QCOA 2ID6A 1P7IA 4B3AA 2GLOA 5FLMJ 4BY7J 4JX6A 1ZR2A 2D5VA 2KDZA 3S1QJ 3BR3A 3BT9A 2FBQA 4A3FJ 4ABZA 5AQCA 1FTZA 3GTPJ 1QPIA 3KNWA 4MO7A 5FJ8J 3O8GA 3PO2J 1ZK8A 1NK3P 5F0CA 2VKEA 3CRJA 2AHQA 2XDNA 1I3QJ 2COBA 2GBYA 2CUEA 3FRQA 3NRGA 3COLA 1BJZA 3Q0VA 5IPAA 4GFKA 3PO3J 1ZQ3P 1JTYA 3HM5A 2HYTA 1TWAJ 3C2BA 4JP0A 3VVZA 5M3FJ 4ACIA 4AC0A 3S2DJ 3S15J 2VI6A 4BBSJ 3BG5A 2I10A 2OERA 3GZIA 2O9LA 4GCTA 2UXIA 1QRYA 1VF9A 2R7ZJ 4B1RA 3HOZJ 1MSFC 4AUXA 1HLVA 1XG1A 4W1UA 1LE8A 3E7LA 1AU7A 2JA6J 2G7SA 2TRTA 3IUVA 2HYJA 3O60A 5FHPA 5EG0A 1F36A 1TWHJ 3LOCA 3NXCA 3RQIA 2W53A 2DA4A 3JR9A 2DA2A 4DZJA 4D7MA 1ETYA 3HEFA 1B72B 1GVDA 4MIMA 4XRSA 4AF5A 3DCFA 5F08A 3ZQFA 4MLOA 4KWAA 4ICHA 4CYCA 4A3LJ 4A3IJ 2PMZN 1ORKA 4CYCB 1MNMC 2NX4A 3A01A 3RZOJ 3CJDA 2FJ1A 5F0FA 4Y7NJ 2XPUA 4W97A 3VW1A 1ETWA 5FGLA 2XB0X 1TWGJ 5EEAA 4JNNA 5H9TA 3AQTA 3IH3A 5F04A 3CMYA 3QQAA 1IC8A 3TP3A 2X48A 5IYBJ 5EZHA 1PUFB 4Y52J 2IAIA 1IRZA 3ON2A 2ZOYA 1GDTA 3FIWA 1IG7A 1UHSA 1IDYA 3ON4A 1YRNB 3IV5A 1MSEC 1ETQA 1IV6A 3EUPA 3LJLA 2DTZA 1FIAA 1U78A 2L7ZA 4XRMA 3K7AJ 3JREA 2UXHA 2N8GA 3JRDA 2VPRA 2XSDC 1JKQC 1HDDC 5FKNA 5J1YA 1H88C 2NVQJ 1Q1VA 1JTXA 4J19A 1BA5A 2DMNA 1JJ6C 3ANGA 2EZKA 3HKZN 3MNLA 3GTMJ 1MBGA 2JJ7A 4UDSA 4C2MJ 3RKQA 1AKHA 2IEKA 5E3NA 3BTIA 4C3JJ 1MBEA 5GP9A 4MK6A 3H3VK 3LWJA 5K7HA 3HDDA 1FEXA 3RH2A 5D19A 5K58A 3HTIA 1TWFJ 4DW6A 2UXOA 3G1MA 3BRUA 3GEUA 2R5YA 1JKOC 4EEFG 4A93J 2HOAA 3MN2A 2CQQA 3BG3A 5C4YA 1ZGWA 2LFBA 3GTOJ 2JMWA 4X1EA 2KT0A 5GPCA 4BXXJ 1RESA 3G1LA 1MBKA 1WH5A 3OSGA 3HOYJ 3S1MJ 4C3HJ 3LSPA 3V78A 4FE4A 3MKLA 5JLXA 4D7NA 3Q0WA 3VIBA 2MG4A 1JT6A 1H89C 1GUUA 2HOTA 3HOWJ 1UI6A 3ZOBA 2Q24A 1POGA 1XC5A 2E19A 4UUSA 3BJBA 4UUSB 2HKUA 4HKUA 2G7GA 3I4MJ 5FKLA 1MBHA 2YVHA 3SJMA 4M3GA 2Y0SN 1JJ8C 3HIMA 3JRGA 2G3BA 1VI0A 3UKGA 2MSYA 3ZQHA 2PBXA 2DJNA 3OSFA 3PPBA 3S2HJ 1HCRA 3GTKJ 1CQTA 2JWTA 1ZTRA 4JYKA 3BR6A 3DPJA 1HOMA 3S14J 1OCTC 3TW6A 1B8IA 2YU9J 4XK4A 5GPAA 2O8KA 3B6AA 5BNGA 1B8IB 1ETVA 4A3GJ 3P9TA 2O7OA 4M3DA 5D1RA 3TW7A 1ENHA 5IP9J 1SANA 3BQYA 3JRHA 2CQXA 1LE8B 2G0EA 4NDLA 2CJJA 3BR2A 1SFOJ 1JKRC 3VOXA 3HBLA 4M3BA 2M9HA 5FMPA 3CWRA 2ME6A 5EG0B 2MW8A 1HDPA 2F07A 3S1NJ 5CW8A 2QWTA 3BCGA 2DG7A 3E7QA 1MBJA 2CU7A 1WI3A 2RASA 3M4OJ 2NP5A 5EF6A 2R93J 3HOXJ 1F43A 5FKMA 2V57A 3JSJA 3NPIA 2Y30A 2JK3A 3A01B 2ZCNA 4MFDA 2FD5A 3WHCA 2LY9A 1X58A 2DA3A 4A3EJ 3MVPA 2R5ZA 3KKCA 2HXOA 3Q0UA 2DMTA 2UXUA 2XGDA 3VUQA 3HTAA 1GV5A 1RR7A 3G56A 4A3KJ 2LR8A 3RD3A 4D5FA 2NOGA 3FISA 3VP5A 2DMUA 3ZQLA 4IHYA 3RZDJ 4XRSG 3LHQA 4XIDA 1Y1WJ 4A3BJ 3FKIJ 4UUTA 2Y31A 3HTHA 3SFIA 3HOUJ 3S1RJ 5EGOA 5EGOB 3V6GA 4IEJA 2VUMJ 2DA6A 3GTLJ 2VKVA 2ZOZA 2DMQA 1IDZA 2LP0A 1T33A 4GFBA 2E1OA 2ECBA 3A03A 1IGNA 2K9NA 1QVTA 4NELA 2NVXJ 1OJLA 2R0QC 3BTJA 2OI8A 5M5XJ 5E3MA 2JN6A 4JL3A 3IH2A 2GUHA 2L7FP 2ME0A 1UG2A 2WB1N 3FK7A 3IH4A 4A3MJ 3GBGA 4L5EA 3ANPA 2Y9YA 1LFUP 1RPWA 2GM4A 3F0CA 5M5YJ 5M5WJ 4JX5A 1W0TA 4QIWN 2EZIA 1AKHB 4GFLA 2NS7A 4A3JJ 2R92J 3NARA 2K40A 4HNVA 4FISA 1FIPA 5F1JA 2ZB9A 1EF4A 3NNRA 2HQ5A 1NTCA 2GENA 2Y2ZA 5C3EJ 1W0UA 1NK2P 4BY1J 2OF7A 2P81A 4DZPA 2R5YB 4IHVA 2LD5A 5C44J 4MXMA 1WPKA 3VVYA 3JRFA 3GTJJ 2ID3A 1G2HA 2B63J 2FQ4A 2ZCXA 1QVUA 2DA7A 2DA1A 1R9TJ 3S17J 5JLWA 5HSZA 1VNDA 1FTTA 1K83J 1Z77A 4A3CJ 1JGGA 2ZCMA 1IUFA 3O8HA 1T56A 5C4JJ 2M0CA 3HE0A 4RDUA 3PASA 5CXIA 2XRLA 1D5YA 2H8RA 4I76A 2IBDA 4FTHA 4XICA 2HOSA 1X2NA 4CGRA 3CQZJ 2DG8A 2ECCA 3BHQA 2X9DA 2QIBA 2D6YA 3NAUA 1WCMJ 5DTDA 2JA8J 1TWCJ 2EBIA 4FCYA 3QPLA 5K7ZA 2MGQA 1ETXA 3LSRA 3A02A 1BL0A 2JA5J 3VVXA 5DAJA 2EZHA 5FLVA 2E2HJ 2XB5A 1SGMA 1RKWA 2XGEA 9ANTA 3LNQA 3WHBA 3CDLA 3CCYA 1U8BA
chains in the Genus database with same CATH superfamily
4V2FA 1XMAA 1O57A 2E34A 2KRHA 2V9VA 4EM2A 2VKHA 3LA7A 5CVJA 1A35A 4A3DJ 1S7EA 4MHGA 5IYDJ 1Y1VJ 2WA0A 3LSKA 3OYCA 4F92B 1S7OA 3HYIA 4G6TB 4I01A 1ZG1A 4XLAA 2L5QA 1BW6A 2Q2EB 2CS3A 1HSJA 2ZC2A 3F9KA 5DCMB 3N97A 4IOAF 2QTQA 3BQZA 4YFKF 2CW8A 2KZVA 2XC7A 2NVTJ 2YVXA 1L0OC 1SD6A 1QNTA 3CF2A 3AQSA 4EGYA 3KEOA 1T6SA 4G7HF 1OQYA 1WH7A 3SDGA 2Z2SB 1Z0XA 4IHWA 3PSFA 4CICA 1XDUA 1JI8A 4IKFA 1D5VA 2LLKA 1GV2A 3BZ6A 4G6DA 1T0FA 1EJ9A 1LFPA 1IRXA 1SAXA 1B72A 2JSCA 2IS6A 1CGPA 4GDFA 5E1WA 3FF5A 1T2KA 1TC3C 2FOKA 2QM3A 3F22A 2EH3A 3QPSA 5HAWA 2PFVA 4RS8A 2HDDA 3WE3A 3BTLA 3CTAA 3VPRA 4BL0B 5TGTA 2KIUA 4UHTA 3LSJA 4M74A 1YJWI 1O3TA 2HXIA 1SFEA 3I64A 4LB5A 1JGSA 5DCFA 2DDAA 4IF4A 2IU5A 2FX0A 1YFHA 3I58A 1EH6A 3TDZC 3EPZA 2Q1ZB 2ZCWA 1JUSA 2CRGA 3GZNB 2CW0F 2E1NA 5JVTA 3S5RA 2A69F 3HOVJ 2QKOA 1IJWC 1O4XA 2QKLB 4XL9A 2PMHA 4DYCA 3NI7A 2HGCA 3L2WA 3W6JB 2K9SA 5JHUA 2VBWA 1XGSA 5B1AH 2WUIA 1K79A 1F9NA 4OD4A 3LFKA 2K7LA 2KQRA 1XN7A 5HDKA 2X6XA 1SD7A 3K70C 4L9VA 3BNIA 5J1UA 4LG0A 1DGRM 2I5UA 5DS9A 1UI5A 1XSVA 2M34A 1E3OC 3PNVA 3Q9SA 3TOAA 3GYHX 2GQQA 3WGGA 4RB2C 2CG4A 2V6CA 4CDGA 5IOYA 4XBFA 1W5TA 2A6HF 3E6MA 1ULYA 3IAM2 3V8LA 5L3BA 2HQAA 2XAHA 2Z99A 1EH8A 3LWFA 2K85A 1MH3A 1U3EM 2X6YA 3C07A 2CFOA 1IUYA 4AYBN 3BR1A 2LK2A 1MBFA 2TCTA 4D5CA 3GFLA 3GLLA 4D0PA 4C2MA 4FE7A 3F8BA 1NG6A 1OPCA 3E3VA 4BHPA 4WCGA 4KMFA 2GLOA 4BHBA 3RDIA 3ZMZA 3VYRB 5GTIC 1XD7A 5LHIA 1A31A 1ZR2A 3S1QJ 2Y48A 2FBQA 1XGOA 2A68F 2GA2A 3KYLA 2VBZA 3KNWA 4ZDPA 2QSFX 2YU3A 3ISPA 1IXRC 3O8GA 4KNYA 1HKQA 4HLXA 2DTRA 4IZZA 3AL0C 2AHQA 1N77A 2V1NA 3ABUA 3TKYA 1OYYA 2V6EA 2OJED 5IPAA 4DGWB 2LC2A 1ZQ3P 2HYTA 1TWAJ 4ENKA 4PFOA 3NQOA 3L00A 2QENA 3S15J 2VI6A 2I10A 4IRGA 2OERA 4HOBA 2UXIA 1VF9A 2DFIA 1Y8RB 4CO8A 3BY6A 4W1UA 1LE8A 2DODA 2TRTA 2HYJA 3O60A 3OL4A 5FHPA 1TWHJ 1IAWA 3U21A 3T8TA 1IN8A 2H94A 2W53A 5DDGA 2LBFB 2QSHX 2F5DA 3ZMUA 4D7MA 3DPLC 2B3WA 2W1OA 4GRIA 1YS6A 4MLOA 4KWAA 1ORKA 2UWMA 2NX4A 3A01A 1G3TA 1R22A 4HW0A 4Y7NJ 1BR1A 4BEHB 2DYSH 4BE0A 1R6RA 2BOLA 2IA2A 1VQMI 1TWGJ 1Z7UA 3GWZA 2K02A 2WAQA 2LH9A 2L9VA 3IH3A 4F91B 1IC8A 2Z33A 3GFIA 2X48A 3OYBA 5IYBJ 1BIAA 5EZHA 1IF1A 1SAUA 3E6BA 2EFNA 4PJ0C 1TT0A 1GDTA 1IG7A 1YRNB 3W6KB 2LOOA 3WTSC 3LJLA 1WQ2A 4EATA 4BQAA 2P6SA 4XRMA 4HQEA 4IHTA 3PNYA 3RKWA 5K5OA 2VPRA 3JRDA 4B8XA 3WTZA 5IY5H 2R7DA 5FKNA 1VQ6I 3B02A 2NVQJ 3AAFA 3CC4I 3DFGA 4LITA 2EA4A 2K3FA 4QLCU 2KP6A 3MZHA 2DU9A 1WRJA 1XDSA 1ZGJA 2W84A 4LIUA 3GTMJ 2JJ7A 3MNLA 4UDSA 1STZA 4DJAA 4C2MJ 1D1BA 2O0YA 1OCRH 3I0TA 1I1GA 1KONA 3BTIA 3N05A 1OYWA 4C3JJ 5GP9A 3RH2A 3K4LA 5D19A 3REOA 2J5OA 1LDDA 2ZNYA 3ZR8X 4M6XA 1MNDA 2V9KA 3TOBA 1FSHA 3BRUA 3ELKA 4A93J 3MN2A 4BDYA 3E97A 3BG3A 1SD5A 5C4YA 4HLYA 2IA0A 3GEZA 1ZGWA 1YJNI 3KP3A 4EJVA 2D2WA 3A0HC 4OOIA 2KMUA 4X1EA 3W3CA 2ELJA 4P9FA 4KT5C 4OINF 2M4KA 1FT9A 1V54H 2JRTA 4PSWA 4RGUA 4O6JA 5HNFA 5J47A 4LLNA 2ZO4A 2KISA 5E1XA 1GUUA 2ISYA 4MQVA 1FC3A 1KU2A 2E19A 4LLGF 3BJBA 5LGUA 5D4SA 1YQAA 2QQ9A 4XOTA 4HKUA 5D8KB 2Z5UA 2WADA 2XIGA 2JSPA 1FMWA 3S3MA 2HKXA 1SVOA 3QP6A 4ETSA 2G3BA 4II2A 3UKGA 2MSYA 1MMSA 4XKBA 2DJNA 1HCRA 2E5ZA 4KIGA 2QVOA 2STWA 2OA4A 2H1LA 2AXLA 1KU9A 4PJMA 1G59A 4BE2A 1KYZA 1D1AA 1ZTRA 1HBXG 3IKVA 5KAIC 3ZCOA 2VOPA 1PP8F 2KRFA 2BHYA 2O8KA 5B66C 1ETVA 2W57A 1MNEA 3TW7A 3OIPA 4U0YA 4UUVA 1D8JA 2GA1A 2XUBA 5IP9J 3F21A 4A12A 1ZG3A 2YSRA 2PN6A 3TL4X 4UNOA 3MKWB 3BJOA 2HEOA 1VQPI 1G3YA 5GAEJ 4BGDA 3IC7A 2D1HA 2FMYA 1UCRA 3U9GA 3EUKL 3DLAA 5CW8A 4RB0A 1MBJA 3GVAA 1YG2A 2L9NA 4PJNA 4HDVA 5EF6A 3SEQA 1PP7U 1F43A 3QODA 2P6TA 4OAZA 2M3AA 4GGGA 3R4KA 2EINH 2ZCNA 2G9WA 3WHCA 4XRFA 1X58A 4A3EJ 2UXUA 3OYLA 2XGDA 1OR7A 2BY3A 3R60A 4WF2A 3D0SA 2WAFA 4KA4A 1M1EB 4A3KJ 3KP2A 1FYMA 3VP5A 4PCQA 1Y1WJ 4A3BJ 1GLNA 2E1MB 2A07F 4ZTJA 2NNNA 4XKVA 2OAZA 3K4NA 1ZRCA 2PJPA 3S1RJ 1UZCA 5HLIA 5DM6F 3S3NA 4IEJA 2VUMJ 4BH9A 2DQRA 1T33A 3P9IA 2E1OA 1FLIA 2ECBA 2K9NA 3OIQA 4XKWA 1OJLA 1TT5B 3BTJA 1KU3A 2VE9A 5M5XJ 4E7JA 3TO6A 3CCRI 4U88A 2EV6A 4ENJA 3J81Z 4JL3A 3IRQA 2GUHA 2GOMA 2ME0A 3BLYA 5CQEA 1U5TB 3FXRA 1ZRFA 5M5YJ 2GM4A 3UNGC 4OIPF 3OY9A 4QIWN 4DOZA 1AKHB 2NS7A 3GFMA 3HRSA 3A0BC 1FSEA 5L3DA 4B3XA 3NARA 1RUNA 3V7RA 1VQNI 2YU9J 3LL7A 1GVJA 1EV7A 3I5UA 1NK2P 1UFMA 2YX7A 3OV8A 2XVCA 5E17F 2LD5A 5HVQC 2JUGA 3VSKA 5DD4A 3VVYA 3JRFA 1BI3A 2DA1A 2DA7A 2IW5A 3KEYA 5IT9K 2MD0A 3KP7A 1F5TA 1K83J 4G6QA 1JGGA 4I0AA 1UHMA 2DYRH 3L7WA 4ON0A 1BI1A 4NHJA 2ZCMA 2M0CA 4IRVA 2LRDA 4RGSA 2H8WA 2IBDA 3KP4A 3LQRA 2QBYB 2DG8A 4HX7A 1W7PA 3JAMK 2ECCA 2X9DA 3OOPA 3NAUA 1DQUA 5DTDA 4IL6C 4RM3A 1WHUA 1ZG5A 1KZHA 2BV6A 3QPLA 4Z2YA 4PUSA 4LD5A 5K7ZA 3OYAA 3MAJA 2F5FA 3G4SI 1S29A 1A36A 1ETXA 3LSRA 3A02A 2JA5J 2E2HJ 4KN7X 1YIOA 1SD4A 2OBPA 2RN7A 1MJBA 1TP4A 2XF6A 1X1CA 3J80K 3CCYA 2CUJA 4G8XA 3TO9A 2LF7A 4C2TA 1H9GA 2HTSA 2MBFA 4BJ6C 3HRMA 5EYRA 3OYDA 5CVUA 4DYRA 1AHDP 4L62A 3MKZA 3K4BA 1I1SA 4LG3A 1T98A 5ICCA 4EV0A 2CW7A 2Q8KA 1RR8C 5BPDA 5IYCJ 4DYQA 4YIIA 2FNPA 4WIBA 2ZJQF 4GYIA 4Y13A 2EFQA 1MH4A 1E2XA 4C30A 3CCMI 2WAQN 2WV1A 2BYVE 1P7JA 2Y9ZA 2HI3A 2XPVA 1UJ8A 1LEBA 2CUZA 3KFWX 3BG9A 3KX2A 3HB9A 2ZNZA 5IP7J 3AG4H 1CF7B 1A6IA 2XPWA 3I56I 3I71A 2V1UA 2P8TA 3F1BA 4XLCA 1NH3A 2DI3A 2NNYA 1ON1A 3ONQA 5BOXA 2RREA 2NP3A 4KMUX 3FZVA 4L9TA 3BZKA 2NRAC 4I6ZA 1YLFA 5FB2A 2FRHA 5LGNA 3VSLA 3CF5F 3HRUA 3RYRA 2DN0A 3J7AO 1WJEA 4AM3A 2PFBA 2F4OB 2WV0A 3EQLF 4U0WA 3VW0A 3WTTC 2R7TA 5C4XJ 2QLZA 3BR0A 2LY1A 1HW1A 2XV4S 1VQLI 5HNHA 3OS1A 3T1BA 5ED4A 2P5KA 3EYYA 3J7YJ 3JRIA 1SVLA 2LF8A 1X4OA 4IO9F 4ZYDA 3EGQA 3M3YJ 2F5EA 4N9HA 4G12A 2F48A 2W48A 4P9UA 3CJQB 3KKDA 3HOSA 3RPUD 4ENMA 3W2AA 2HKOA 3L2RA 4M9SA 3K1NA 2OU2A 3ZQIA 1WVRA 2ISZA 4NQWB 2L2OA 4LGWA 2QF7A 1J59A 2XAQA 4XSXF 1SMTA 1Z3XA 1ODDA 3H5NA 2QQBA 3M9AA 3W6VA 3G1OA 1FZPB 2W25A 2RHAA 3BPXA 2YUSA 1G3WA 3BJ6A 2P5VA 2QGUA 1B9NA 3FMSA 4M71A 3G73A 1ZLJA 1VZ0A 1LNWA 3TMOA 5TRDA 3CC2I 3BOQA 3KZ9A 3JRCA 2MABA 2MLKA 4UV9A 5CLSA 1A04A 3CUQB 4IJAA 2OPTA 4E7HA 4S05A 2BW3B 1R4NB 2O7TA 3PUBA 3VYSB 2ZJRF 4B47A 3B73A 4FHTA 1SFXA 2LSOA 1G8XA 3FXMA 3IWZA 2HDCA 1SMYF 2OV7A 4J00A 3IAS2 2R4GA 3D1NI 1MKMA 3ABMH 3JRAA 2D45A 2KJBA 1HKSA 2XKPA 4IX7A 1YO5C 1K61A 2ZXHA 1K78A 4LG0B 3FXKA 4LOCA 2PI0A 5A2QK 2NXNB 4AWXB 5ILUA 2DCEA 2L9RA 1LPQA 4IRHA 3N4MA 1JUPA 1U9NA 3VDXA 3DV8A 1X1BA 1APLC 1P92A 2OTLI 3JRBA 3WTVC 2WB1A 3CJTB 5AIPA 3U1KA 3HL2A 3NS4A 1D1CA 4E7SA 4PJJA 1ZGAA 3CP2A 1GT0C 2L9SA 5CXGA 5L3FA 3T8RA 4EGZA 4QSHA 3GMEA 1ZREA 1R23A 3HOTA 3KCCA 1R5GA 1V55H 3F8NA 5D5UB 1VQ8I 3SQNA 5H6RA 4IHXA 2EZLA 3SFZA 4U9NA 5IT3A 1R4MB 2VJ5A 5EEHA 4BY7J 4JX6A 1USSA 5J4VA 3VEPA 3EYIA 3L2UA 1W5SA 1PDNC 1FTZA 4A6EA 1QPIA 2FMLA 5FJ8J 3V7SA 2IPQX 4CCNA 4FX4A 1MDMB 4FX0A 1GHCA 1YTYA 1I3QJ 4JBAA 2E1MC 2COBA 3V7CA 1U8RA 3COLA 3Q0VA 3I4PA 3Q5FA 3S3OA 1PUEE 3SHFA 3T5XA 1JTYA 1QZEA 3Q9VA 3S2DJ 2FBKA 3PFYA 3FXQA 2LREA 2O9LA 4HBLA 1QRYA 1XGNA 4B1RA 3HOZJ 1MSFC 1J7KA 1XG1A 1AU7A 5KVRA 2OZUA 2ETHA 3C2GA 2BVLA 2G7SA 2ZY9A 3QU3A 1MW7A 1MMGA 4L9JA 3FXUA 2VONA 1DPUA 1U5TC 1F36A 1XCVA 3LOCA 2HOEA 3DKYA 1N75A 3QYBA 3MFKA 3JR9A 1V3FA 4I0BA 3RKYA 3ZN0A 3HSRA 4DQ2A 5CKTA 3DCFA 5F08A 2CMPA 5D4RA 2H09A 1SFKA 4CYCA 4A3LJ 1BOAA 2UV1A 1MNMC 4ICHA 3EETA 2R7XA 3RZOJ 4MQ9F 2FJ1A 2GIVA 2UXXA 4W97A 1ETWA 4L9NA 4FASD 4IQJA 3HPGA 5FGLA 3E5XA 2VPLA 4ZZDA 1TQIA 4KN4X 1KU7A 2WWYA 4JNNA 5H9TA 1XMXA 2KIQA 5F04A 3TDUC 1XPXA 2B0LA 2Y69H 2PJRB 1PUFB 4Y52J 2HQNA 1ACIA 2RQQA 1IRZA 2DT7B 4C9YA 2XKOA 3ZMVA 3GLXA 4ZYGA 2E36A 1UHSA 2EPFA 2K4JA 1MSEC 2HNHA 1OKRA 2QYOA 5JR3A 2GWRA 2DTZA 1FIAA 1R71A 2HYFA 1K7AA 1FWZA 1O7LA 1YIJI 3K7AJ 3JREA 3CLQA 2N8GA 1C0WA 2QEXI 2XSDC 1Z3YA 5J1YA 4RB3C 3O6BB 3JSOA 1B4AA 1JTXA 2MLGA 4J19A 4CUGA 1ZRDA 2DMNA 2DFEA 3OS0A 5FD5A 3ANGA 2P0WA 4BE1A 5GADJ 4LFUA 3VB2A 3AFHA 2K4BA 2H27A 4WXDA 4AU7A 1TNSA 4NB5A 1WJDA 3EUHA 2ZJ2A 4MGRA 3H3VK 1BI2A 2F4MB 5K7HA 3HDDA 3OWTA 1JXSA 5K58A 2HTJA 5AIQA 4DW6A 4C2UA 3K6GA 3G1MA 3GEUA 2DW4A 3LSHA 2O03A 2RGVA 4EEFG 4ESFA 3F8MA 3LAJA 2XRNA 4KT6A 3H0DA 3SWHA 2KRCA 2A6EF 2K3PA 2XAUA 5FLXK 4BXXJ 1RESA 4PDKA 2MH9A 4OIOF 3HOYJ 3RTRA 4C3HJ 4FE4A 3MKLA 3C1DA 3Q0WA 3VIBA 2MG4A 1JT6A 3RKXA 1Y6IA 4BDZA 4UUSA 2HKUA 3I4MJ 3OYNA 2DOFA 1WFXA 4M3GA 1J2XA 3MMYB 1S72I 2CV0A 3HIFA 1BN5A 2FQ3A 3DTKA 3DEUA 2IGOA 1O7FA 3OSFA 2QZ8A 3S2HJ 4XLFA 3GTKJ 3IRRA 3ZMSA 2MA3A 1FPQA 2OUMA 2VJIA 1CQTA 1P4XA 5H2FC 4EMSA 1WJFA 3S14J 4F55A 3TW6A 3BZCA 1IN4A 1BR4A 4XK4A 4XOPA 5GPAA 5J8CA 1LJ9A 3LA2A 3WGIA 1B8IA 1DDNA 4RAYA 3GW2A 2O7OA 3PIOF 1MZBA 4M3DA 2HYGD 3L2VA 4BUPA 3IKTA 2EIKH 1SANA 3HPHA 2RVCA 3WTXC 1FX7A 2X4HA 2R3SA 3E6CC 4Y15A 2CJJA 2EIJH 2ESNA 1T08B 2Q2EA 3BR2A 1XMKA 4UVCA 1SFOJ 3I3LA 3HBLA 4M3BA 3GX4X 5FMPA 2ME6A 5EG0B 2MW8A 2F07A 3SDBA 4KJZA 3S1NJ 5HS9A 4HF2A 2X85A 5BPIA 2QWTA 3BCGA 4QPOA 1L3LA 4CCOA 1WI3A 3ZPLA 2RASA 3H5RA 3M4OJ 3OYJA 1BJAA 1MGTA 2I8DA 2OC6A 1QA6A 4WWCA 3HOXJ 3CMMA 5FKMA 2V57A 3JSJA 3NPIA 2L7KA 3EDPA 3CUQC 1OCZH 4II3A 4MFDA 2FD5A 3LAPA 2DA3A 2HXOA 2RNJA 2DMTA 3Q0UA 2O6GE 3WGHA 3DLLF 2QKMB 4I2OA 1GV5A 1WJBA 4IQ4A 4LK1F 4UB8C 4XKCA 4RGRA 4LLLA 3RD3A 5E8IA 2FSWA 2NOGA 1S9HA 4M9ZA 4IHYA 1UELB 3RZDJ 3FXJA 4UUTA 3M1EA 2Y31A 4GCVA 3DBLB 3HTHA 3SFIA 1J75A 3HOUJ 4IRIA 3UR3C 2W24A 3OS2A 4UXNA 3BCBA 1I6XA 2HS5A 2VKVA 3GTLJ 4I02A 3BDDA 1IDZA 3HXLA 2KKOA 1S5LC 1D0ZA 2VC0A 1QVTA 2V4JC 2RC4A 1HW2A 2R0QC 1IGNA 4NELA 1W36C 3CO7C 3IHUA 2Z16A 3SYTA 2E7WA 5E3MA 5CVIA 2XAJA 5LGTA 1QZYA 3JW4A 3CCUI 1Y0NA 4A3MJ 2WB1N 1TBXA 3IH4A 1N25A 3GBGA 2FE3A 4JK1X 3X2QH 2HPMA 1P2FA 2K86A 2Y9YA 1LFUP 2OD5A 4WXHA 3F0CA 1W0TA 4JX5A 3HG9A 2HR3A 1BBYA 2O3FA 1OISA 3HUGB 1U2WA 2EIMH 5CPRB 4N0BA 5J40A 5HS8A 3W2VA 3FMRA 4R8HA 4HNVA 3CCLI 5F1JA 2VQHA 1XCBA 1NTCA 2LMDA 2JVGA 2GENA 4YEJA 4EM0B 2M7BA 2OF7A 2P81A 3DTIA 3PUFA 3CDHA 2R5YB 4BY1J 3QOEA 4HAMA 2AXTC 1R49A 4J01A 1WPKA 4HF1A 1QU3A 1LB2A 3GF2A 1G2HA 2ZCXA 2H6BA 1BC7C 5ICEA 1FOWA 4HV6A 4BXUA 1VQ9I 4CYDA 2FBIA 1VNDA 5JLWA 3KYCB 4E7KA 5HSZA 1QGPA 1IUFA 1T56A 2JUCA 3HE0A 1P9QC 3QPTA 3WU1B 3PASA 2XRLA 5LRSA 1IZ1A 1D5YA 3GCMA 2L3DA 2CGPA 2IXSA 2HOSA 5E79C 2HDWA 4CGRA 3CQZJ 1B59A 2NYXA 2HQRA 2HZDA 2D6YA 5K5RA 1TWCJ 1DPRA 4K2EA 4FCYA 1MJAA 2BZTA 1MJ9A 1R00A 5FGMA 5BS6A 2OCEA 3CCJI 3HKZA 1BL0A 1LEAA 1WJCA 1T8IA 5FLVA 1X1DA 3P7NA 2ZMEB 3WHBA 5ILVA 5JI6A 5HLTA 3TEDA 4BJTA 4HSTA 3HTUA 2EQRA 4XONA 4GCLA 1LVKA 2XGXA 4QTRA 3QPHA 3ZGKA 1LDKB 1WKMA 1Z67A 4HG2A 1Z05A 2RKHA 5KAFC 3T6NA 2VT2A 2E2IJ 1BI0A 1OMIA 3K4JA 2L01A 2E1CA 4AVPA 1YI2I 4S0HB 2QOPA 5IP6A 3QBMA 5J1RA 1JKPC 1ZYRF 5HODA 4X6AJ 2E2JJ 2JPBA 2GXGA 1QPMA 1W5CC 4OD5A 4YG2F 4WX9A 3ERMA 2UXNA 3J7ZI 4IOCF 2IA1A 3OOUA 1ITYA 1W4MA 3OYMA 3HGYA 2IT0A 4M3EA 1SVMA 5L3EA 2EFWA 4V19K 2Y0SA 1W1WE 4PSXA 4ASNA 4ZTFA 1I50J 4AVZA 4A69C 3CCVI 2R5ZB 1F1ZA 1JHHA 4PXIA 3GTQJ 3K70D 3C3WA 1OCPA 2A5WA 2AO9A 2E60A 2L0KA 3WU2C 4GCKA 4RBOA 3VOKA 5FKKA 3QKXA 3VODA 4ZYEA 2UXPA 3R61A 1KQ8A 1FBSA 1VQOI 2DAOA 1O3RA 1J0RA 1XSXA 3P9KA 5F27A 1BR2A 4KITB 4O5VA 2VOOA 3I4NJ 2VQLA 4BEHA 2EB7A 3BR5A 3CCEI 3QP5A 1GXQA 1QQIA 2VBXA 2RDPA 1Z9CA 4L5IA 4NN1A 4DVYP 3MKYB 4JX4A 4GXOA 2NS0A 2VB6A 4JQFA 3CCQI 2MC4A 3M7GA 3VW2A 1YRNA 2HVSA 1ZKGA 3DPUA 3NWTA 1OFCX 4BKXA 5EZGA 3ECHA 4BNCA 1PYVA 3K2AA 1X1AA 3K4KA 5GAHJ 2A6TA 3FM3A 3OYHA 2OTJI 5EFYA 3IWFA 1VFCA 1TQMA 4XQFA 2WAEA 2LNBA 2VXDA 1ZR4A 1YE9A 3H0GJ 4M3FA 2A5YB 2D1VA 4AD9A 2MC3A 3RPQA 3HSEA 5L3CA 4YZEA 3FK6A 4N4OB 5K7FA 3LQQA 4XLNF 4JOMA 2DA5A 2IVMA 3DKXA 2RQPA 5HDGA 3FXOA 3L09A 1YOVB 1HW5A 2W4SA 1IRFA 2L4AA 2F4IA 3B6CA 3VYUB 1K78B 1H8AC 3JCUC 4DBQA 1RC9A 4MFEA 1X1PA 4PZJA 2UZKA 1X2MA 3PQKA 3M1CA 3HTJA 2ELKA 1DU0A 4B09A 3ABTA 5BQTA 1DP7P 1JE8A 1LKXA 2LDUA 5JVGF 1I3AA 1ZHFA 4B44A 1BW5A 4B4CA 4F93B 4A5MA 1HSTA 1V4RA 2JA2A 2V1DA 3ERED 3I59A 5KCMA 1XGMA 3KIOA 2VT3A 5E3LA 2FA5A 2FXAA 4P5OA 5H20A 1ETOA 5FKOA 3VYTB 4E70A 2FEZA 5TJJA 4B3AA 2HWVA 5D5XB 4CZCA 5DV5A 5GAGJ 1ZLKA 3O3KA 2D5VA 2KDZA 3BR3A 3BT9A 5BMZA 1MD0A 4A3FJ 1B9MA 2P4WA 2P7CB 4MO7A 2G7HA 4OMZA 2PX9A 2ZBKA 3PO2J 1ZK8A 2IS1A 1NK3P 3CRJA 1XTAA 5IT9Z 2HZTA 2GBYA 2CUEA 3NRGA 4CCKA 2BE5F 4BXFA 3RQ4A 3I55I 1AWCA 4ACIA 2M30A 3VVZA 4JP0A 5M3FJ 1FBQA 4KDPA 4I7HA 3HHGA 5LEJA 3JAMZ 1LQ1A 2A3SA 2CWEA 2R7ZJ 2DJIA 2M0MA 3PFIA 5F6FA 4AUXA 2A2FX 3KEQA 3VWBA 3CMEI 1ZELA 3BG6A 2MH2A 1EKEA 1ZARA 1ON2A 4IXAA 2B9SA 3NXCA 1BC8C 1KQ0A 1TLHB 4Q48A 1E0EA 4FQGA 3KP6A 2DA4A 3J80Z 2CV2A 3OYEA 1B72B 2JT1A 1GVDA 4MIMA 1D0XA 4F3QA 1YITI 2DO7A 1YS7A 4CHUA 4A3IJ 3M8EA 5H6QA 4CYCB 1SEUA 2X1CA 2BBYA 5F0FA 2EV5A 2XPUA 3E1SA 4XMYA 5EEGA 3RIRA 1XB4A 3H3UA 3OYFA 2IGNA 2VE8A 4XN0A 3O2PE 5EEAA 2WTEA 3RSNA 3R0AA 3V4GA 3CMYA 3QQAA 3TP3A 3FHZA 1S7AA 4YFXF 3I53A 4AIHA 4EJOA 3DBHB 3WE2A 4KICA 3VFZA 1X3ZB 3K4MA 1IDYA 1XSDA 1SFUA 2GXAA 2X51A 3IV5A 1ETQA 2BY2A 2FBHA 1IV6A 5J6XA 2QQAA 1DGWY 3L2QA 2KHMA 4E7IA 3ZRGA 2BXYA 5K5QA 4XR6A 5EJCA 4M9XA 2KL4A 3H1CA 1JKQC 1HDDC 2IGMA 1H88C 4ENNA 3CLOA 4P1WA 1O3SA 2K27A 2XAFA 2M4GA 3ZXSA 2VQGA 1V5EA 3PIPF 2ZMEC 2IS4A 2EZKA 3D5RC 3HKZN 2NAZA 2RNGA 2YR2A 1G3SA 4I99C 3RKQA 1AKHA 5E20A 2VASA 1ERDA 3S32A 1X3UA 3QAHA 1S8NA 5E3NA 3QYFA 4P96A 4YRVA 4NUBA 4MK6A 3LWJA 4BAYA 1Y8QB 3ROUA 3L2CA 3SXYA 1K4SA 1TWFJ 2HVQA 4MTEA 2DLLA 4TV7A 2XAGA 4NBQA 2OQGA 1JKOC 2HOAA 4KFCA 2NVUB 1Z1DA 3LSTA 1E17A 1HA8A 2CQQA 4UVAA 3ZMTA 2BHZA 2LFBA 1RIOH 4EVIA 1WH5A 4KYWA 2ZXIA 4LJZF 3KP5A 2M5WA 1IW7F 1FMVA 3ZQQA 3ABKH 3FBNB 3KPHA 2K9LA 3OYKA 2WBMA 2WC2A 4XLEA 1GXPA 2QBYA 2HOTA 5FD6A 2Q24A 4RAZA 1POGA 1XC5A 2G7UA 3WU0A 4UUSB 2GXBA 3FX3A 1MBHA 4U7BA 2YVHA 2Y0SN 1JJ8C 2FJI1 3JRGA 3HIMA 3DP7A 1VI0A 2P7VB 1R5HA 3ZQHA 2PBXA 2XF5A 4I09A 3E5UA 5ERIA 2JQ7A 2V79A 3VTIA 2ZFUA 3A1YA 4JYKA 3PNTA 3DPJA 3MZYA 5KHDA 1OCTC 2M8EA 2O8XA 1FBUA 4BQQA 1B8IB 1DUXC 2ZKZA 1NHAA 1B1BA 5A2QZ 3P9TA 1UG0A 2Y75A 3ULQB 4DNCA 1Z91A 2Z9OA 1ENHA 5HOOA 1R5ID 1FY7A 2FOWA 3MQ0A 4X0GA 3JRHA 5E1ZB 2CQXA 1R1VA 1LE8B 2G0EA 1X4PA 4NDLA 3VOXA 5LEKA 2M9HA 4QWQA 1K4TA 3CWRA 1HDPA 2FUG2 1KQ9A 5CJ9A 4YFNF 1XX5A 1CF7A 3E7QA 1R58A 3TBIA 3ESWB 2A61A 2CU7A 2Z3YA 4EJWA 1ZN2A 2PMUA 2VODA 5DD8A 2KPMA 3WTWC 2Y30A 4MEXF 2JK3A 4WK8F 3A01B 4I98B 3LMMA 4HEA2 4HF0A 2HU9A 3K10A 3MVPA 1VQKI 1ZH5A 3KKCA 1X3WB 2ESHA 1E3PA 1O3QA 1J5YA 3G3ZA 4OAYA 3HTAA 2COMA 3LSIA 3G56A 2KFDA 4M73A 1IV8A 1RNLA 2L02A 5KNLA 3ZQLA 4XRSG 5FO5A 4XIDA 5DM7F 2PBIA 2F5CA 2W7NA 4CCJA 1FNNA 4G9YA 2DOEA 4RLQA 4F52A 3CJRB 5EGOA 1T38A 5LLQA 1I27A 2ZOZA 1IN6A 5JHFA 2LP0A 3CDIA 3D5LA 4GFBA 3A03A 1AA7A 1MIJA 5B5EC 2OI8A 1BIBA 4R1HA 4NQWA 3E6DA 1D0YA 4HPQA 3CP8A 1RRJA 3HZJA 2L7FP 4RAGA 1UG2A 1P4AA 4PGGA 3ANPA 3M8FA 2ZSIB 1KYWA 1YW8A 1RPWA 3V8KA 3S8PA 1KA8A 2K5CA 4E4HA 3WODF 4GFLA 2PMZA 3IL2A 5F64A 3H36A 2QSGX 4PGHA 4AIKA 3PQJA 5LBQA 4EM1A 1YW7A 4FISA 3NNRA 2CYYA 2EFOA 2ZB9A 3ECOA 1EF4A 2HQ5A 3GUDA 2IRFG 5C3EJ 1W0UA 3CUQA 1IN5A 1TQPA 4L18B 5D6FA 5C44J 2F5VA 3EUAA 2BW3A 3G6EI 3K9TA 5LHHA 3GTJJ 2IS2A 1OLTA 1R9TJ 1H9TA 1FTTA 1Z77A 3C18A 5B3SH 4KUMA 4A3CJ 5C4JJ 1MMAA 5CXIA 4Y17A 3HJEA 3PSIA 2H8RA 2MD5A 2LYCA 4FTHA 2BY0A 2DK5A 2XHKA 5FRMA 1QO0D 2QUFA 4Q4ZF 1BM9A 2E5NA 4OIQF 2CH0A 2R7OA 3ZP5A 3BHQA 1A6QA 4HQMA 2HVRA 1H0MA 2ELHA 2JA8J 2HFHA 1Y39A 1HQCA 2EBIA 3DKWA 1OCOH 1T0FC 5FRNA 2MGQA 3M07A 3ABLH 2DK8A 1W7PD 2EZHA 4U87A 4Q47A 4HNTA 4L0YB 1SGMA 5ICFA 1RKWA 2XGEA 9ANTA 3K4CA 4BACA 3CDLA 2XDVA 1U8BA 3VOEA 4U7DA 3HC7A 3F6OA 3HGGA 1I6HJ 4HDUA 3CZ6A 4R79A 5D18A 3G2BA 5E8GA 1LUJB 4BBRJ 3LSMA 1JT0A 1JUMA 3G71I 4L0ZB 2G7LA 2LTPA 2B1EA 3FWEA 3BJAA 5D5VB 4MTDA 2R7WA 1J09A 4HSRA 3H3ZA 4ME9A 2M45A 3V8JA 3OYIA 1MDMA 5FLXZ 2REKA 2M8GX 3NWSA 1YHQI 3OYGA 1J9IA 2QWWA 3DEWA 4CA0A 3K1PA 2EWNA 2EILH 5DCMA 5J3LA 3KETA 2DBBA 3L9FA 3L1PA 2YVEA 4A5NA 1A5JA 1FYKA 3BWGA 2GAUA 3B81A 2ACJA 1FYLA 2EV0A 4HX4A 3KE2A 3SZPA 2X6OA 2PEXA 3BG7A 5HBUA 1MMNA 2OZ6A 3MWMA 5HDNA 4A2UA 5CQGA 2L7MP 6PAXA 3F8CA 2RV8A 4BJ5C 2PG4A 2R7UA 1ETKA 3FM5A 2M2EA 2Q0OA 4XLHA 3TP0A 1FJLA 3BTCA 3NRVA 4V2GA 3RPUA 4ESBA 3EUHC 1LFBA 2EA2A 2E7XA 1QHGA 3DPTA 4ZC3A 4CCMA 3DQVC 1FOKA 2JA7J 3AG2H 3GTGJ 3K69A 4CGZA 1RKTA 2LKSA 3Q3SA 5IOZA 2DMPA 4E7LA 3FBIB 3F23A 3GZ5A 5EDNA 1U0JA 3F3XA 3F6VA 3PM1A 2JTVA 3ZQGA 3K8PC 2LG4A 1WJ5A 4N9IA 3WTYC 2ZJPF 1RETA 2PJRA 1PUFA 5M3MJ 2PQ8A 3PL8A 4LB6B 4DBRA 5J8FA 3J7AY 2GFNA 4MNUA 2LVSA 3HSFA 1G4DA 4BQOA 1XS9A 4ZDLA 3LSGA 1VQ5I 2PZ9A 1DU6A 2CO5A 2XGCA 1IXSB 1E3HA 1WSUA 4C3IJ 3CJNA 3TQNA 3T0YA 5B1BH 2VC1A 1WWXA 2M7AA 4Z6YA 4Y3OA 3ASOH 4NC7A 2LKXA 1IN7A 3CD6I 4RM2A 2XROA 2X1DA 3K1MA 1VTNC 1WJAA 1UMQA 2WGBA 2RAEA 3DXJF 3OIOA 3G7RA 2M87A 5F0HA 4A6DA 1S6LA 3GO5A 2L4MA 1TL8A 4ZH4F 5E3OA 2H1KA 1Z6RA 4AC6A 3WG7H 1U9OA 3R0JA 3DWLE 3S93A 5HS7A 4UV8A 1P4WA 1IXCA 1N78A 2CV1A 1D3YA 3S2WA 2ZXJA 4YIRX 1TNTA 1W7PB 3S16J 2CQNA 3HTSB 3ZQ7A 2UUZA 4ITVA 4PFPA 5D5WB 2NVYJ 2K9QA 4M6VA 5CVVA 3ZQCA 4Y33A 2O5RA 4JKZA 1X19A 1Y0UA 3TO7A 2CSOA 2ICWG 3DF8A 2YS9A 1DP3A 2IP2A 2STTA 2CUFA 2H6CA 3I59B 2BXZA 2NS8A 1G6NA 2DFHA 3QU6A 2R7FA 3WTUC 5DUIA 4XM3A 1WGXA 1HF0A 2VJ4A 2QCOA 2ID6A 1P7IA 5FLMJ 2DFFA 5GTHC 1LDJA 4M72A 4CSWA 1WI9A 1V5FA 2AQEA 4ABZA 3QWLA 4U0VA 5AQCA 5ILSA 3GTPJ 4U9LA 4KISA 5E18F 2GZWA 2BGCA 2GOXB 2BVMA 2VKEA 5F0CA 2XDNA 2Y0MA 1TTYA 5TISC 3FRQA 4HZFA 3CC7I 1BJZA 5LRRA 2YPRA 2FU4A 5KK1A 5LFAA 4GFKA 3PO3J 3K2ZA 3HM5A 5J4YA 3C2BA 4AC0A 4G7ZF 2OQRA 4BBSJ 2A05A 2ADUA 2BEOA 3BG5A 4XLPF 4BS9A 3H9GA 3GZIA 2W82A 4GCTA 4BQNA 1OCCH 2DXIA 3SEZA 2XASA 1HLVA 3E7LA 3BP8A 3F72A 3C7JA 3H35A 2JA6J 5LHGA 3IUVA 3J81K 2E35A 2CFXA 3MZ8A 5EG0A 5CVRA 1JHFA 4CXFA 2Z1DA 3RQIA 1I39A 4OIRF 2KZGA 2LBFA 4ESJA 2ZXWH 1YYVA 2DA2A 4YELA 4DZJA 1ETYA 2KDOA 3HEFA 2XSJC 3MEXA 4XRSA 4AF5A 3ZQFA 3AG3H 5D8LB 3HRTA 3RCOA 2PMZN 4UVBA 4FETA 3CJDA 3MCZA 3E5QA 3KLOA 3VW1A 3M8JA 2R7QA 1R36A 1I5ZA 1USTA 3CESA 2XB0X 2V9PA 5DYMA 4QPQA 1VQ4I 2DT6A 3AQTA 1R1TA 2V26A 3R6SA 4B48A 5DUKA 1K6OA 4EQQA 4HX8A 2VBYA 3D5SC 2IAIA 2FNAA 1FP2A 5FFXA 2VN2A 3COAC 4HRIA 2ZOYA 3ON2A 3DU6A 3FIWA 1QHHD 4DIQA 2DT5A 3CMAI 4NC6A 4ZYHA 1Z7LA 3ON4A 4EJTA 2GIZA 3EUPA 1Q1HA 3OR1C 2YX4A 1U78A 3KZIC 3WG9A 2B7EA 2DQLA 4XNFA 2L7ZA 3W2WA 3U2RA 2VJJA 3CCSI 2UXHA 3H9JA 5F1RA 4A0XA 3KYDB 3IP4B 4M6YA 4Q5SF 1S3JA 1U6GA 4ZZLA 3QOPA 5L3GA 3JTGA 3FMQA 1Q1VA 2VL8A 3OR2C 4AIDA 2ZFWA 4N4NB 1BA5A 3H9QA 4WXCA 1JJ6C 4NNJA 3QYEA 3RYPA 4LMYA 1MBGA 2V7FA 3AKZA 2KIMA 2HPIA 3HUGA 2IEKA 4H0EA 1MBEA 3CUOA 3JTHA 1NG7A 1FEXA 3H92A 3HTIA 1REPC 2UXOA 4BU2A 1IRGA 3DBRB 3ZN1A 2R5YA 3RI4A 4XSZF 3A2KA 3V42A 4IHSA 1OYIA 1P6RA 4IPAA 3GTOJ 3IUOA 1RZ4A 2JMWA 4YIFA 3JSPA 1UHWA 2KT0A 1R1UA 5GPCA 3G1LA 1MBKA 3OSGA 3NEUA 3LSPA 3V78A 5JLXA 4D7NA 4D9JA 3HOWJ 1H89C 1UI6A 4UB6C 3ZOBA 4CH7A 4OU0A 2VIXA 4UY8I 3P9CA 3MD2A 2VXZA 2G7GA 4KIFA 5FKLA 4EJUA 1MMDA 1OR7C 3SJMA 3FDYA 1YX5A 1QBJA 5HLGA 4RGXA 4ZYAA 1PJRA 4LIVA 2K9MA 3LFUA 4Y4RA 5FROA 2ZMEA 3PPBA 3DTEA 4RB1A 4AIJA 2PLYA 2CQKA 2X0LA 2JWTA 1W36D 3E0JB 2EJRA 3BR6A 4NC8A 5CYVA 1HOMA 2DDBA 4ZDOA 3I54A 3B6AA 3KZZA 5BNGA 5D6EA 5HLHA 4PK4A 4O3MA 3SZGA 4A3GJ 1ZAOA 1VQ7I 3ASNH 2JZYA 2V1XA 3AG1H 3ML6A 5D1RA 2R7VA 3RJPA 3FXLA 4IVNA 3CO6C 2IGKA 3TGNA 3BQYA 1HXDA 4ZJZA 2F6CA 2VQCA 1AOYA 1LVAA 1JKRC 3ZMDA 4G94A 1K6YA 1V5GA 4AYBA 1FP1D 2FF4A 3HHHA 4XORA 2DG7A 2O61A 2DOAA 2DPDA 2NP5A 1R7JA 2R7RA 5AONA 3GFJA 1TW3A 4HA8A 4F7ZA 1YX3A 2KIFA 4FT8A 1D8KA 4HYEA 1YJ9I 2R93J 1WZ2A 4HV5A 3PJRA 3KLNA 2VLAA 2L54A 3A4CA 1ONVA 3H5AA 2LY9A 2R5ZA 4PJLA 3VUQA 2VKDA 3GZ6A 3K0LA 3P5JA 1Y56A 4CCLA 1RR7A 4OWRB 2OCCH 4GYGA 2LKPA 2LR8A 4HNUA 4G7OF 4D5FA 5DEQA 3FISA 2DMUA 3LHQA 3AL0B 2AS5F 3FKIJ 3FHNA 2BY1A 2X6WA 4ANJA 1HKTA 2MFZA 2WY8Q 2X1EA 3F8FA 4KIBA 4A0ZA 5EGOB 2EFPA 3V6GA 3BPVA 2JVHA 1KGSA 4E6KG 2DA6A 2DMQA 1UB9A 4LK0F 1BOBA 2J5PA 2W00A 4BYYA 2NVXJ 4S04A 1SC7A 5JFRA 2JN6A 3IH2A 4MEYF 2R7SA 2JRMA 1B6AA 2ZSHB 2QA4I 3FK7A 2EK5A 4L5EA 4RAFA 2W85A 1Z21A 1U5TA 3C2HA 3BC8A 5M5WJ 4BHCA 3FKJA 2EZIA 4A3JJ 4RLFA 4P55A 3KZYA 2LY2A 2R92J 3DEEA 2K40A 1FOXA 1FOYA 2TDXA 1FIPA 1RUOA 2NOJB 2Y2ZA 4RA2A 3I9V2 4CZZA 2KJCA 4DZPA 4H4KC 4IHVA 4L5JA 4MXMA 4B43A 3OL3A 4E7ZA 2M1BA 1YW9A 2ID3A 3U1DA 2B63J 2FQ4A 1TZLA 4GO1A 1QVUA 1IO2A 2DPUA 2KLOA 4OMYA 3S17J 2C6YA 1EH7A 1RI7A 1PVEA 1TW2A 3OMYA 3O8HA 2JPCA 1T95A 3BROA 1QZZA 4RDUA 3QRFF 4I76A 4XICA 5FFZA 1X2NA 3BCAA 1UAAA 5LD2C 4RMNA 1Z6TA 2P5LC 2CQ7A 3SZTA 2QIBA 3DU5A 1WCMJ 1T39A 2IJLA 4XN3A 2MYSA 1EA3A 5ICGA 2WY7Q 2QQ8A 3VVXA 5DAJA 2E71A 2F2EA 3GXOA 1HC8A 2XB5A 1F4KA 4A0YA 3LA3A 2XF7A 3LNQA 5K1YA 4D1QA 3S1MJ 2AQFA
chains in the Genus database with same CATH topology
3TEDA 4V2FA 3HGGA 1I6HJ 2EQRA 5D18A 4GCLA 4QTRA 5EYRA 4BBRJ 1JT0A 1JUMA 4DYRA 1S7EA 1AHDP 4A3DJ 2LTPA 2G7LA 5IYDJ 1Y1VJ 4L62A 5IYCJ 4DYQA 4ME9A 1MH4A 2WAQN 2WV1A 2REKA 2M8GX 3T6NA 1P7JA 2Y9ZA 1BW6A 2E2IJ 2HI3A 3DEWA 2XPVA 4S0HB 2QOPA 5IP6A 3QBMA 3BG9A 5J1RA 1JKPC 3HB9A 5IP7J 5HODA 5J3LA 4X6AJ 2E2JJ 2QTQA 3BQZA 1A6IA 2NVTJ 2XPWA 3L1PA 2YVEA 3F1BA 1A5JA 3OOUA 3AQSA 1ITYA 3B81A 3HGYA 2NP3A 4M3EA 4I6ZA 1WH7A 3SDGA 2X6OA 5HBUA 1Z0XA 1I50J 4IHWA 4A69C 2R5ZB 2DN0A 4PXIA 3GTQJ 2L7MP 1OCPA 2AO9A 2L0KA 2LLKA 1GV2A 3VW0A 4GCKA 4RBOA 3VOKA 5FKKA 3QKXA 1ETKA 2UXPA 5C4XJ 2M2EA 3TP0A 1FJLA 3BR0A 1B72A 3BTCA 4V2GA 1LFBA 5F27A 3JRIA 1TC3C 2EH3A 3I4NJ 2JA7J 3QPSA 3EGQA 3GTGJ 3M3YJ 5HAWA 1RKTA 3Q3SA 4G12A 2W48A 2DMPA 5IOZA 3BR5A 3KKDA 5EDNA 3PM1A 2HDDA 3ZQGA 3BTLA 1RETA 3VPRA 1PUFA 5M3MJ 3ZQIA 4NN1A 2GFNA 4JX4A 2QF7A 2LVSA 1XS9A 3LSJA 3LSGA 3W6VA 2PZ9A 3VW2A 3G1OA 1DU6A 1YRNA 2XGCA 2HXIA 1ZKGA 2RHAA 4C3IJ 1OFCX 2YUSA 4BKXA 5EZGA 2IU5A 3K2AA 2FX0A 2LKXA 3KZ9A 1JUSA 2CRGA 3JRCA 5EFYA 1UMQA 2WGBA 1VFCA 2RAEA 3S5RA 3OIOA 3HOVJ 1ZR4A 2OPTA 2QKOA 3G7RA 3H0GJ 1IJWC 4M3FA 2O7TA 1O4XA 3NI7A 4DYCA 4YZEA 5F0HA 3FK6A 2K9SA 5K7FA 5E3OA 2WUIA 2H1KA 2DA5A 4AC6A 1U9OA 3D1NI 3JRAA 1K61A 5J1UA 3BNIA 3B6CA 1H8AC 4LOCA 5DS9A 2M34A 1UI5A 1E3OC 4MFEA 1X2MA 3HTJA 2ELKA 3S16J 1DU0A 2L9RA 5IOYA 1JUPA 2NVYJ 1U9NA 2K9QA 4M6VA 3ZQCA 1APLC 4JKZA 3JRBA 1BW5A 4B4CA 2YS9A 1GT0C 3C07A 1MH3A 2CUFA 5CXGA 4AYBN 3BR1A 4QSHA 2LK2A 1MBFA 2NS8A 2TCTA 5E3LA 4D5CA 1ETOA 5FKOA 4IHXA 1HF0A 1WGXA 4FE7A 2EZLA 2QCOA 2ID6A 1P7IA 4B3AA 2GLOA 5FLMJ 4BY7J 4JX6A 1ZR2A 2D5VA 2KDZA 3S1QJ 3BR3A 3BT9A 2FBQA 4A3FJ 4ABZA 5AQCA 1FTZA 3GTPJ 1QPIA 3KNWA 4MO7A 5FJ8J 3O8GA 3PO2J 1ZK8A 1NK3P 5F0CA 2VKEA 3CRJA 2AHQA 2XDNA 1I3QJ 2COBA 2GBYA 2CUEA 3FRQA 3NRGA 3COLA 1BJZA 3Q0VA 5IPAA 4GFKA 3PO3J 1ZQ3P 1JTYA 3HM5A 2HYTA 1TWAJ 3C2BA 4JP0A 3VVZA 5M3FJ 4ACIA 4AC0A 3S2DJ 3S15J 2VI6A 4BBSJ 3BG5A 2I10A 2OERA 3GZIA 2O9LA 4GCTA 2UXIA 1QRYA 1VF9A 2R7ZJ 4B1RA 3HOZJ 1MSFC 4AUXA 1HLVA 1XG1A 4W1UA 1LE8A 3E7LA 1AU7A 2JA6J 2G7SA 2TRTA 3IUVA 2HYJA 3O60A 5FHPA 5EG0A 1F36A 1TWHJ 3LOCA 3NXCA 3RQIA 2W53A 2DA4A 3JR9A 2DA2A 4DZJA 4D7MA 1ETYA 3HEFA 1B72B 1GVDA 4MIMA 4XRSA 4AF5A 3DCFA 5F08A 3ZQFA 4MLOA 4KWAA 4ICHA 4CYCA 4A3LJ 4A3IJ 2PMZN 1ORKA 4CYCB 1MNMC 2NX4A 3A01A 3RZOJ 3CJDA 2FJ1A 5F0FA 4Y7NJ 2XPUA 4W97A 3VW1A 1ETWA 5FGLA 2XB0X 1TWGJ 5EEAA 4JNNA 5H9TA 3AQTA 3IH3A 5F04A 3CMYA 3QQAA 1IC8A 3TP3A 2X48A 5IYBJ 5EZHA 1PUFB 4Y52J 2IAIA 1IRZA 3ON2A 2ZOYA 1GDTA 3FIWA 1IG7A 1UHSA 1IDYA 3ON4A 1YRNB 3IV5A 1MSEC 1ETQA 1IV6A 3EUPA 3LJLA 2DTZA 1FIAA 1U78A 2L7ZA 4XRMA 3K7AJ 3JREA 2UXHA 2N8GA 3JRDA 2VPRA 2XSDC 1JKQC 1HDDC 5FKNA 5J1YA 1H88C 2NVQJ 1Q1VA 1JTXA 4J19A 1BA5A 2DMNA 1JJ6C 3ANGA 2EZKA 3HKZN 3MNLA 3GTMJ 1MBGA 2JJ7A 4UDSA 4C2MJ 3RKQA 1AKHA 2IEKA 5E3NA 3BTIA 4C3JJ 1MBEA 5GP9A 4MK6A 3H3VK 3LWJA 5K7HA 3HDDA 1FEXA 3RH2A 5D19A 5K58A 3HTIA 1TWFJ 4DW6A 2UXOA 3G1MA 3BRUA 3GEUA 2R5YA 1JKOC 4EEFG 4A93J 2HOAA 3MN2A 2CQQA 3BG3A 5C4YA 1ZGWA 2LFBA 3GTOJ 2JMWA 4X1EA 2KT0A 5GPCA 4BXXJ 1RESA 3G1LA 1MBKA 1WH5A 3OSGA 3HOYJ 3S1MJ 4C3HJ 3LSPA 3V78A 4FE4A 3MKLA 5JLXA 4D7NA 3Q0WA 3VIBA 2MG4A 1JT6A 1H89C 1GUUA 2HOTA 3HOWJ 1UI6A 3ZOBA 2Q24A 1POGA 1XC5A 2E19A 4UUSA 3BJBA 4UUSB 2HKUA 4HKUA 2G7GA 3I4MJ 5FKLA 1MBHA 2YVHA 3SJMA 4M3GA 2Y0SN 1JJ8C 3HIMA 3JRGA 2G3BA 1VI0A 3UKGA 2MSYA 3ZQHA 2PBXA 2DJNA 3OSFA 3PPBA 3S2HJ 1HCRA 3GTKJ 1CQTA 2JWTA 1ZTRA 4JYKA 3BR6A 3DPJA 1HOMA 3S14J 1OCTC 3TW6A 1B8IA 2YU9J 4XK4A 5GPAA 2O8KA 3B6AA 5BNGA 1B8IB 1ETVA 4A3GJ 3P9TA 2O7OA 4M3DA 5D1RA 3TW7A 1ENHA 5IP9J 1SANA 3BQYA 3JRHA 2CQXA 1LE8B 2G0EA 4NDLA 2CJJA 3BR2A 1SFOJ 1JKRC 3VOXA 3HBLA 4M3BA 2M9HA 5FMPA 3CWRA 2ME6A 5EG0B 2MW8A 1HDPA 2F07A 3S1NJ 5CW8A 2QWTA 3BCGA 2DG7A 3E7QA 1MBJA 2CU7A 1WI3A 2RASA 3M4OJ 2NP5A 5EF6A 2R93J 3HOXJ 1F43A 5FKMA 2V57A 3JSJA 3NPIA 2Y30A 2JK3A 3A01B 2ZCNA 4MFDA 2FD5A 3WHCA 2LY9A 1X58A 2DA3A 4A3EJ 3MVPA 2R5ZA 3KKCA 2HXOA 3Q0UA 2DMTA 2UXUA 2XGDA 3VUQA 3HTAA 1GV5A 1RR7A 3G56A 4A3KJ 2LR8A 3RD3A 4D5FA 2NOGA 3FISA 3VP5A 2DMUA 3ZQLA 4IHYA 3RZDJ 4XRSG 3LHQA 4XIDA 1Y1WJ 4A3BJ 3FKIJ 4UUTA 2Y31A 3HTHA 3SFIA 3HOUJ 3S1RJ 5EGOA 5EGOB 3V6GA 4IEJA 2VUMJ 2DA6A 3GTLJ 2VKVA 2ZOZA 2DMQA 1IDZA 2LP0A 1T33A 4GFBA 2E1OA 2ECBA 3A03A 1IGNA 2K9NA 1QVTA 4NELA 2NVXJ 1OJLA 2R0QC 3BTJA 2OI8A 5M5XJ 5E3MA 2JN6A 4JL3A 3IH2A 2GUHA 2L7FP 2ME0A 1UG2A 2WB1N 3FK7A 3IH4A 4A3MJ 3GBGA 4L5EA 3ANPA 2Y9YA 1LFUP 1RPWA 2GM4A 3F0CA 5M5YJ 5M5WJ 4JX5A 1W0TA 4QIWN 2EZIA 1AKHB 4GFLA 2NS7A 4A3JJ 2R92J 3NARA 2K40A 4HNVA 4FISA 1FIPA 5F1JA 2ZB9A 1EF4A 3NNRA 2HQ5A 1NTCA 2GENA 2Y2ZA 5C3EJ 1W0UA 1NK2P 4BY1J 2OF7A 2P81A 4DZPA 2R5YB 4IHVA 2LD5A 5C44J 4MXMA 1WPKA 3VVYA 3JRFA 3GTJJ 2ID3A 1G2HA 2B63J 2FQ4A 2ZCXA 1QVUA 2DA7A 2DA1A 1R9TJ 3S17J 5JLWA 5HSZA 1VNDA 1FTTA 1K83J 1Z77A 4A3CJ 1JGGA 2ZCMA 1IUFA 3O8HA 1T56A 5C4JJ 2M0CA 3HE0A 4RDUA 3PASA 5CXIA 2XRLA 1D5YA 2H8RA 4I76A 2IBDA 4FTHA 4XICA 2HOSA 1X2NA 4CGRA 3CQZJ 2DG8A 2ECCA 3BHQA 2X9DA 2QIBA 2D6YA 3NAUA 1WCMJ 5DTDA 2JA8J 1TWCJ 2EBIA 4FCYA 3QPLA 5K7ZA 2MGQA 1ETXA 3LSRA 3A02A 1BL0A 2JA5J 3VVXA 5DAJA 2EZHA 5FLVA 2E2HJ 2XB5A 1SGMA 1RKWA 2XGEA 9ANTA 3LNQA 3WHBA 3CDLA 3CCYA 1U8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TED A;  4V2F A;  3HGG A;  1I6H J;  2EQR A;  5D18 A;  4GCL A;  4QTR A;  5EYR A;  4BBR J;  1JT0 A;  1JUM A;  4DYR A;  1S7E A;  1AHD P;  4A3D J;  2LTP A;  2G7L A;  5IYD J;  1Y1V J;  4L62 A;  5IYC J;  4DYQ A;  4ME9 A;  1MH4 A;  2WAQ N;  2WV1 A;  2REK A;  2M8G X;  3T6N A;  1P7J A;  2Y9Z A;  1BW6 A;  2E2I J;  2HI3 A;  3DEW A;  2XPV A;  4S0H B;  2QOP A;  5IP6 A;  3QBM A;  3BG9 A;  5J1R A;  1JKP C;  3HB9 A;  5IP7 J;  5HOD A;  5J3L A;  4X6A J;  2E2J J;  2QTQ A;  3BQZ A;  1A6I A;  2NVT J;  2XPW A;  3L1P A;  2YVE A;  3F1B A;  1A5J A;  3OOU A;  3AQS A;  1ITY A;  3B81 A;  3HGY A;  2NP3 A;  4M3E A;  4I6Z A;  1WH7 A;  3SDG A;  2X6O A;  5HBU A;  1Z0X A;  1I50 J;  4IHW A;  4A69 C;  2R5Z B;  2DN0 A;  4PXI A;  3GTQ J;  2L7M P;  1OCP A;  2AO9 A;  2L0K A;  2LLK A;  1GV2 A;  3VW0 A;  4GCK A;  4RBO A;  3VOK A;  5FKK A;  3QKX A;  1ETK A;  2UXP A;  5C4X J;  2M2E A;  3TP0 A;  1FJL A;  3BR0 A;  1B72 A;  3BTC A;  4V2G A;  1LFB A;  5F27 A;  3JRI A;  1TC3 C;  2EH3 A;  3I4N J;  2JA7 J;  3QPS A;  3EGQ A;  3GTG J;  3M3Y J;  5HAW A;  1RKT A;  3Q3S A;  4G12 A;  2W48 A;  2DMP A;  5IOZ A;  3BR5 A;  3KKD A;  5EDN A;  3PM1 A;  2HDD A;  3ZQG A;  3BTL A;  1RET A;  3VPR A;  1PUF A;  5M3M J;  3ZQI A;  4NN1 A;  2GFN A;  4JX4 A;  2QF7 A;  2LVS A;  1XS9 A;  3LSJ A;  3LSG A;  3W6V A;  2PZ9 A;  3VW2 A;  3G1O A;  1DU6 A;  1YRN A;  2XGC A;  2HXI A;  1ZKG A;  2RHA A;  4C3I J;  1OFC X;  2YUS A;  4BKX A;  5EZG A;  2IU5 A;  3K2A A;  2FX0 A;  2LKX A;  3KZ9 A;  1JUS A;  2CRG A;  3JRC A;  5EFY A;  1UMQ A;  2WGB A;  1VFC A;  2RAE A;  3S5R A;  3OIO A;  3HOV J;  1ZR4 A;  2OPT A;  2QKO A;  3G7R A;  3H0G J;  1IJW C;  4M3F A;  2O7T A;  1O4X A;  3NI7 A;  4DYC A;  4YZE A;  5F0H A;  3FK6 A;  2K9S A;  5K7F A;  5E3O A;  2WUI A;  2H1K A;  2DA5 A;  4AC6 A;  1U9O A;  3D1N I;  3JRA A;  1K61 A;  5J1U A;  3BNI A;  3B6C A;  1H8A C;  4LOC A;  5DS9 A;  2M34 A;  1UI5 A;  1E3O C;  4MFE A;  1X2M A;  3HTJ A;  2ELK A;  3S16 J;  1DU0 A;  2L9R A;  5IOY A;  1JUP A;  2NVY J;  1U9N A;  2K9Q A;  4M6V A;  3ZQC A;  1APL C;  4JKZ A;  3JRB A;  1BW5 A;  4B4C A;  2YS9 A;  1GT0 C;  3C07 A;  1MH3 A;  2CUF A;  5CXG A;  4AYB N;  3BR1 A;  4QSH A;  2LK2 A;  1MBF A;  2NS8 A;  2TCT A;  5E3L A;  4D5C A;  1ETO A;  5FKO A;  4IHX A;  1HF0 A;  1WGX A;  4FE7 A;  2EZL A;  2QCO A;  2ID6 A;  1P7I A;  4B3A A;  2GLO A;  5FLM J;  4BY7 J;  4JX6 A;  1ZR2 A;  2D5V A;  2KDZ A;  3S1Q J;  3BR3 A;  3BT9 A;  2FBQ A;  4A3F J;  4ABZ A;  5AQC A;  1FTZ A;  3GTP J;  1QPI A;  3KNW A;  4MO7 A;  5FJ8 J;  3O8G A;  3PO2 J;  1ZK8 A;  1NK3 P;  5F0C A;  2VKE A;  3CRJ A;  2AHQ A;  2XDN A;  1I3Q J;  2COB A;  2GBY A;  2CUE A;  3FRQ A;  3NRG A;  3COL A;  1BJZ A;  3Q0V A;  5IPA A;  4GFK A;  3PO3 J;  1ZQ3 P;  1JTY A;  3HM5 A;  2HYT A;  1TWA J;  3C2B A;  4JP0 A;  3VVZ A;  5M3F J;  4ACI A;  4AC0 A;  3S2D J;  3S15 J;  2VI6 A;  4BBS J;  3BG5 A;  2I10 A;  2OER A;  3GZI A;  2O9L A;  4GCT A;  2UXI A;  1QRY A;  1VF9 A;  2R7Z J;  4B1R A;  3HOZ J;  1MSF C;  4AUX A;  1HLV A;  1XG1 A;  4W1U A;  1LE8 A;  3E7L A;  1AU7 A;  2JA6 J;  2G7S A;  2TRT A;  3IUV A;  2HYJ A;  3O60 A;  5FHP A;  5EG0 A;  1F36 A;  1TWH J;  3LOC A;  3NXC A;  3RQI A;  2W53 A;  2DA4 A;  3JR9 A;  2DA2 A;  4DZJ A;  4D7M A;  1ETY A;  3HEF A;  1B72 B;  1GVD A;  4MIM A;  4XRS A;  4AF5 A;  3DCF A;  5F08 A;  3ZQF A;  4MLO A;  4KWA A;  4ICH A;  4CYC A;  4A3L J;  4A3I J;  2PMZ N;  1ORK A;  4CYC B;  1MNM C;  2NX4 A;  3A01 A;  3RZO J;  3CJD A;  2FJ1 A;  5F0F A;  4Y7N J;  2XPU A;  4W97 A;  3VW1 A;  1ETW A;  5FGL A;  2XB0 X;  1TWG J;  5EEA A;  4JNN A;  5H9T A;  3AQT A;  3IH3 A;  5F04 A;  3CMY A;  3QQA A;  1IC8 A;  3TP3 A;  2X48 A;  5IYB J;  5EZH A;  1PUF B;  4Y52 J;  2IAI A;  1IRZ A;  3ON2 A;  2ZOY A;  1GDT A;  3FIW A;  1IG7 A;  1UHS A;  1IDY A;  3ON4 A;  1YRN B;  3IV5 A;  1MSE C;  1ETQ A;  1IV6 A;  3EUP A;  3LJL A;  2DTZ A;  1FIA A;  1U78 A;  2L7Z A;  4XRM A;  3K7A J;  3JRE A;  2UXH A;  2N8G A;  3JRD A;  2VPR A;  2XSD C;  1JKQ C;  1HDD C;  5FKN A;  5J1Y A;  1H88 C;  2NVQ J;  1Q1V A;  1JTX A;  4J19 A;  1BA5 A;  2DMN A;  1JJ6 C;  3ANG A;  2EZK A;  3HKZ N;  3MNL A;  3GTM J;  1MBG A;  2JJ7 A;  4UDS A;  4C2M J;  3RKQ A;  1AKH A;  2IEK A;  5E3N A;  3BTI A;  4C3J J;  1MBE A;  5GP9 A;  4MK6 A;  3H3V K;  3LWJ A;  5K7H A;  3HDD A;  1FEX A;  3RH2 A;  5D19 A;  5K58 A;  3HTI A;  1TWF J;  4DW6 A;  2UXO A;  3G1M A;  3BRU A;  3GEU A;  2R5Y A;  1JKO C;  4EEF G;  4A93 J;  2HOA A;  3MN2 A;  2CQQ A;  3BG3 A;  5C4Y A;  1ZGW A;  2LFB A;  3GTO J;  2JMW A;  4X1E A;  2KT0 A;  5GPC A;  4BXX J;  1RES A;  3G1L A;  1MBK A;  1WH5 A;  3OSG A;  3HOY J;  3S1M J;  4C3H J;  3LSP A;  3V78 A;  4FE4 A;  3MKL A;  5JLX A;  4D7N A;  3Q0W A;  3VIB A;  2MG4 A;  1JT6 A;  1H89 C;  1GUU A;  2HOT A;  3HOW J;  1UI6 A;  3ZOB A;  2Q24 A;  1POG A;  1XC5 A;  2E19 A;  4UUS A;  3BJB A;  4UUS B;  2HKU A;  4HKU A;  2G7G A;  3I4M J;  5FKL A;  1MBH A;  2YVH A;  3SJM A;  4M3G A;  2Y0S N;  1JJ8 C;  3HIM A;  3JRG A;  2G3B A;  1VI0 A;  3UKG A;  2MSY A;  3ZQH A;  2PBX A;  2DJN A;  3OSF A;  3PPB A;  3S2H J;  1HCR A;  3GTK J;  1CQT A;  2JWT A;  1ZTR A;  4JYK A;  3BR6 A;  3DPJ A;  1HOM A;  3S14 J;  1OCT C;  3TW6 A;  1B8I A;  2YU9 J;  4XK4 A;  5GPA A;  2O8K A;  3B6A A;  5BNG A;  1B8I B;  1ETV A;  4A3G J;  3P9T A;  2O7O A;  4M3D A;  5D1R A;  3TW7 A;  1ENH A;  5IP9 J;  1SAN A;  3BQY A;  3JRH A;  2CQX A;  1LE8 B;  2G0E A;  4NDL A;  2CJJ A;  3BR2 A;  1SFO J;  1JKR C;  3VOX A;  3HBL A;  4M3B A;  2M9H A;  5FMP A;  3CWR A;  2ME6 A;  5EG0 B;  2MW8 A;  1HDP A;  2F07 A;  3S1N J;  5CW8 A;  2QWT A;  3BCG A;  2DG7 A;  3E7Q A;  1MBJ A;  2CU7 A;  1WI3 A;  2RAS A;  3M4O J;  2NP5 A;  5EF6 A;  2R93 J;  3HOX J;  1F43 A;  5FKM A;  2V57 A;  3JSJ A;  3NPI A;  2Y30 A;  2JK3 A;  3A01 B;  2ZCN A;  4MFD A;  2FD5 A;  3WHC A;  2LY9 A;  1X58 A;  2DA3 A;  4A3E J;  3MVP A;  2R5Z A;  3KKC A;  2HXO A;  3Q0U A;  2DMT A;  2UXU A;  2XGD A;  3VUQ A;  3HTA A;  1GV5 A;  1RR7 A;  3G56 A;  4A3K J;  2LR8 A;  3RD3 A;  4D5F A;  2NOG A;  3FIS A;  3VP5 A;  2DMU A;  3ZQL A;  4IHY A;  3RZD J;  4XRS G;  3LHQ A;  4XID A;  1Y1W J;  4A3B J;  3FKI J;  4UUT A;  2Y31 A;  3HTH A;  3SFI A;  3HOU J;  3S1R J;  5EGO A;  5EGO B;  3V6G A;  4IEJ A;  2VUM J;  2DA6 A;  3GTL J;  2VKV A;  2ZOZ A;  2DMQ A;  1IDZ A;  2LP0 A;  1T33 A;  4GFB A;  2E1O A;  2ECB A;  3A03 A;  1IGN A;  2K9N A;  1QVT A;  4NEL A;  2NVX J;  1OJL A;  2R0Q C;  3BTJ A;  2OI8 A;  5M5X J;  5E3M A;  2JN6 A;  4JL3 A;  3IH2 A;  2GUH A;  2L7F P;  2ME0 A;  1UG2 A;  2WB1 N;  3FK7 A;  3IH4 A;  4A3M J;  3GBG A;  4L5E A;  3ANP A;  2Y9Y A;  1LFU P;  1RPW A;  2GM4 A;  3F0C A;  5M5Y J;  5M5W J;  4JX5 A;  1W0T A;  4QIW N;  2EZI A;  1AKH B;  4GFL A;  2NS7 A;  4A3J J;  2R92 J;  3NAR A;  2K40 A;  4HNV A;  4FIS A;  1FIP A;  5F1J A;  2ZB9 A;  1EF4 A;  3NNR A;  2HQ5 A;  1NTC A;  2GEN A;  2Y2Z A;  5C3E J;  1W0U A;  1NK2 P;  4BY1 J;  2OF7 A;  2P81 A;  4DZP A;  2R5Y B;  4IHV A;  2LD5 A;  5C44 J;  4MXM A;  1WPK A;  3VVY A;  3JRF A;  3GTJ J;  2ID3 A;  1G2H A;  2B63 J;  2FQ4 A;  2ZCX A;  1QVU A;  2DA7 A;  2DA1 A;  1R9T J;  3S17 J;  5JLW A;  5HSZ A;  1VND A;  1FTT A;  1K83 J;  1Z77 A;  4A3C J;  1JGG A;  2ZCM A;  1IUF A;  3O8H A;  1T56 A;  5C4J J;  2M0C A;  3HE0 A;  4RDU A;  3PAS A;  5CXI A;  2XRL A;  1D5Y A;  2H8R A;  4I76 A;  2IBD A;  4FTH A;  4XIC A;  2HOS A;  1X2N A;  4CGR A;  3CQZ J;  2DG8 A;  2ECC A;  3BHQ A;  2X9D A;  2QIB A;  2D6Y A;  3NAU A;  1WCM J;  5DTD A;  2JA8 J;  1TWC J;  2EBI A;  4FCY A;  3QPL A;  5K7Z A;  2MGQ A;  1ETX A;  3LSR A;  3A02 A;  1BL0 A;  2JA5 J;  3VVX A;  5DAJ A;  2EZH A;  5FLV A;  2E2H J;  2XB5 A;  1SGM A;  1RKW A;  2XGE A;  9ANT A;  3LNQ A;  3WHB A;  3CDL A;  3CCY A;  1U8B A; 
#chains in the Genus database with same CATH topology
 4V2F A;  1XMA A;  1O57 A;  2E34 A;  2KRH A;  2V9V A;  4EM2 A;  2VKH A;  3LA7 A;  5CVJ A;  1A35 A;  4A3D J;  1S7E A;  4MHG A;  5IYD J;  1Y1V J;  2WA0 A;  3LSK A;  3OYC A;  4F92 B;  1S7O A;  3HYI A;  4G6T B;  4I01 A;  1ZG1 A;  4XLA A;  2L5Q A;  1BW6 A;  2Q2E B;  2CS3 A;  1HSJ A;  2ZC2 A;  3F9K A;  5DCM B;  3N97 A;  4IOA F;  2QTQ A;  3BQZ A;  4YFK F;  2CW8 A;  2KZV A;  2XC7 A;  2NVT J;  2YVX A;  1L0O C;  1SD6 A;  1QNT A;  3CF2 A;  3AQS A;  4EGY A;  3KEO A;  1T6S A;  4G7H F;  1OQY A;  1WH7 A;  3SDG A;  2Z2S B;  1Z0X A;  4IHW A;  3PSF A;  4CIC A;  1XDU A;  1JI8 A;  4IKF A;  1D5V A;  2LLK A;  1GV2 A;  3BZ6 A;  4G6D A;  1T0F A;  1EJ9 A;  1LFP A;  1IRX A;  1SAX A;  1B72 A;  2JSC A;  2IS6 A;  1CGP A;  4GDF A;  5E1W A;  3FF5 A;  1T2K A;  1TC3 C;  2FOK A;  2QM3 A;  3F22 A;  2EH3 A;  3QPS A;  5HAW A;  2PFV A;  4RS8 A;  2HDD A;  3WE3 A;  3BTL A;  3CTA A;  3VPR A;  4BL0 B;  5TGT A;  2KIU A;  4UHT A;  3LSJ A;  4M74 A;  1YJW I;  1O3T A;  2HXI A;  1SFE A;  3I64 A;  4LB5 A;  1JGS A;  5DCF A;  2DDA A;  4IF4 A;  2IU5 A;  2FX0 A;  1YFH A;  3I58 A;  1EH6 A;  3TDZ C;  3EPZ A;  2Q1Z B;  2ZCW A;  1JUS A;  2CRG A;  3GZN B;  2CW0 F;  2E1N A;  5JVT A;  3S5R A;  2A69 F;  3HOV J;  2QKO A;  1IJW C;  1O4X A;  2QKL B;  4XL9 A;  2PMH A;  4DYC A;  3NI7 A;  2HGC A;  3L2W A;  3W6J B;  2K9S A;  5JHU A;  2VBW A;  1XGS A;  5B1A H;  2WUI A;  1K79 A;  1F9N A;  4OD4 A;  3LFK A;  2K7L A;  2KQR A;  1XN7 A;  5HDK A;  2X6X A;  1SD7 A;  3K70 C;  4L9V A;  3BNI A;  5J1U A;  4LG0 A;  1DGR M;  2I5U A;  5DS9 A;  1UI5 A;  1XSV A;  2M34 A;  1E3O C;  3PNV A;  3Q9S A;  3TOA A;  3GYH X;  2GQQ A;  3WGG A;  4RB2 C;  2CG4 A;  2V6C A;  4CDG A;  5IOY A;  4XBF A;  1W5T A;  2A6H F;  3E6M A;  1ULY A;  3IAM 2;  3V8L A;  5L3B A;  2HQA A;  2XAH A;  2Z99 A;  1EH8 A;  3LWF A;  2K85 A;  1MH3 A;  1U3E M;  2X6Y A;  3C07 A;  2CFO A;  1IUY A;  4AYB N;  3BR1 A;  2LK2 A;  1MBF A;  2TCT A;  4D5C A;  3GFL A;  3GLL A;  4D0P A;  4C2M A;  4FE7 A;  3F8B A;  1NG6 A;  1OPC A;  3E3V A;  4BHP A;  4WCG A;  4KMF A;  2GLO A;  4BHB A;  3RDI A;  3ZMZ A;  3VYR B;  5GTI C;  1XD7 A;  5LHI A;  1A31 A;  1ZR2 A;  3S1Q J;  2Y48 A;  2FBQ A;  1XGO A;  2A68 F;  2GA2 A;  3KYL A;  2VBZ A;  3KNW A;  4ZDP A;  2QSF X;  2YU3 A;  3ISP A;  1IXR C;  3O8G A;  4KNY A;  1HKQ A;  4HLX A;  2DTR A;  4IZZ A;  3AL0 C;  2AHQ A;  1N77 A;  2V1N A;  3ABU A;  3TKY A;  1OYY A;  2V6E A;  2OJE D;  5IPA A;  4DGW B;  2LC2 A;  1ZQ3 P;  2HYT A;  1TWA J;  4ENK A;  4PFO A;  3NQO A;  3L00 A;  2QEN A;  3S15 J;  2VI6 A;  2I10 A;  4IRG A;  2OER A;  4HOB A;  2UXI A;  1VF9 A;  2DFI A;  1Y8R B;  4CO8 A;  3BY6 A;  4W1U A;  1LE8 A;  2DOD A;  2TRT A;  2HYJ A;  3O60 A;  3OL4 A;  5FHP A;  1TWH J;  1IAW A;  3U21 A;  3T8T A;  1IN8 A;  2H94 A;  2W53 A;  5DDG A;  2LBF B;  2QSH X;  2F5D A;  3ZMU A;  4D7M A;  3DPL C;  2B3W A;  2W1O A;  4GRI A;  1YS6 A;  4MLO A;  4KWA A;  1ORK A;  2UWM A;  2NX4 A;  3A01 A;  1G3T A;  1R22 A;  4HW0 A;  4Y7N J;  1BR1 A;  4BEH B;  2DYS H;  4BE0 A;  1R6R A;  2BOL A;  2IA2 A;  1VQM I;  1TWG J;  1Z7U A;  3GWZ A;  2K02 A;  2WAQ A;  2LH9 A;  2L9V A;  3IH3 A;  4F91 B;  1IC8 A;  2Z33 A;  3GFI A;  2X48 A;  3OYB A;  5IYB J;  1BIA A;  5EZH A;  1IF1 A;  1SAU A;  3E6B A;  2EFN A;  4PJ0 C;  1TT0 A;  1GDT A;  1IG7 A;  1YRN B;  3W6K B;  2LOO A;  3WTS C;  3LJL A;  1WQ2 A;  4EAT A;  4BQA A;  2P6S A;  4XRM A;  4HQE A;  4IHT A;  3PNY A;  3RKW A;  5K5O A;  2VPR A;  3JRD A;  4B8X A;  3WTZ A;  5IY5 H;  2R7D A;  5FKN A;  1VQ6 I;  3B02 A;  2NVQ J;  3AAF A;  3CC4 I;  3DFG A;  4LIT A;  2EA4 A;  2K3F A;  4QLC U;  2KP6 A;  3MZH A;  2DU9 A;  1WRJ A;  1XDS A;  1ZGJ A;  2W84 A;  4LIU A;  3GTM J;  2JJ7 A;  3MNL A;  4UDS A;  1STZ A;  4DJA A;  4C2M J;  1D1B A;  2O0Y A;  1OCR H;  3I0T A;  1I1G A;  1KON A;  3BTI A;  3N05 A;  1OYW A;  4C3J J;  5GP9 A;  3RH2 A;  3K4L A;  5D19 A;  3REO A;  2J5O A;  1LDD A;  2ZNY A;  3ZR8 X;  4M6X A;  1MND A;  2V9K A;  3TOB A;  1FSH A;  3BRU A;  3ELK A;  4A93 J;  3MN2 A;  4BDY A;  3E97 A;  3BG3 A;  1SD5 A;  5C4Y A;  4HLY A;  2IA0 A;  3GEZ A;  1ZGW A;  1YJN I;  3KP3 A;  4EJV A;  2D2W A;  3A0H C;  4OOI A;  2KMU A;  4X1E A;  3W3C A;  2ELJ A;  4P9F A;  4KT5 C;  4OIN F;  2M4K A;  1FT9 A;  1V54 H;  2JRT A;  4PSW A;  4RGU A;  4O6J A;  5HNF A;  5J47 A;  4LLN A;  2ZO4 A;  2KIS A;  5E1X A;  1GUU A;  2ISY A;  4MQV A;  1FC3 A;  1KU2 A;  2E19 A;  4LLG F;  3BJB A;  5LGU A;  5D4S A;  1YQA A;  2QQ9 A;  4XOT A;  4HKU A;  5D8K B;  2Z5U A;  2WAD A;  2XIG A;  2JSP A;  1FMW A;  3S3M A;  2HKX A;  1SVO A;  3QP6 A;  4ETS A;  2G3B A;  4II2 A;  3UKG A;  2MSY A;  1MMS A;  4XKB A;  2DJN A;  1HCR A;  2E5Z A;  4KIG A;  2QVO A;  2STW A;  2OA4 A;  2H1L A;  2AXL A;  1KU9 A;  4PJM A;  1G59 A;  4BE2 A;  1KYZ A;  1D1A A;  1ZTR A;  1HBX G;  3IKV A;  5KAI C;  3ZCO A;  2VOP A;  1PP8 F;  2KRF A;  2BHY A;  2O8K A;  5B66 C;  1ETV A;  2W57 A;  1MNE A;  3TW7 A;  3OIP A;  4U0Y A;  4UUV A;  1D8J A;  2GA1 A;  2XUB A;  5IP9 J;  3F21 A;  4A12 A;  1ZG3 A;  2YSR A;  2PN6 A;  3TL4 X;  4UNO A;  3MKW B;  3BJO A;  2HEO A;  1VQP I;  1G3Y A;  5GAE J;  4BGD A;  3IC7 A;  2D1H A;  2FMY A;  1UCR A;  3U9G A;  3EUK L;  3DLA A;  5CW8 A;  4RB0 A;  1MBJ A;  3GVA A;  1YG2 A;  2L9N A;  4PJN A;  4HDV A;  5EF6 A;  3SEQ A;  1PP7 U;  1F43 A;  3QOD A;  2P6T A;  4OAZ A;  2M3A A;  4GGG A;  3R4K A;  2EIN H;  2ZCN A;  2G9W A;  3WHC A;  4XRF A;  1X58 A;  4A3E J;  2UXU A;  3OYL A;  2XGD A;  1OR7 A;  2BY3 A;  3R60 A;  4WF2 A;  3D0S A;  2WAF A;  4KA4 A;  1M1E B;  4A3K J;  3KP2 A;  1FYM A;  3VP5 A;  4PCQ A;  1Y1W J;  4A3B J;  1GLN A;  2E1M B;  2A07 F;  4ZTJ A;  2NNN A;  4XKV A;  2OAZ A;  3K4N A;  1ZRC A;  2PJP A;  3S1R J;  1UZC A;  5HLI A;  5DM6 F;  3S3N A;  4IEJ A;  2VUM J;  4BH9 A;  2DQR A;  1T33 A;  3P9I A;  2E1O A;  1FLI A;  2ECB A;  2K9N A;  3OIQ A;  4XKW A;  1OJL A;  1TT5 B;  3BTJ A;  1KU3 A;  2VE9 A;  5M5X J;  4E7J A;  3TO6 A;  3CCR I;  4U88 A;  2EV6 A;  4ENJ A;  3J81 Z;  4JL3 A;  3IRQ A;  2GUH A;  2GOM A;  2ME0 A;  3BLY A;  5CQE A;  1U5T B;  3FXR A;  1ZRF A;  5M5Y J;  2GM4 A;  3UNG C;  4OIP F;  3OY9 A;  4QIW N;  4DOZ A;  1AKH B;  2NS7 A;  3GFM A;  3HRS A;  3A0B C;  1FSE A;  5L3D A;  4B3X A;  3NAR A;  1RUN A;  3V7R A;  1VQN I;  2YU9 J;  3LL7 A;  1GVJ A;  1EV7 A;  3I5U A;  1NK2 P;  1UFM A;  2YX7 A;  3OV8 A;  2XVC A;  5E17 F;  2LD5 A;  5HVQ C;  2JUG A;  3VSK A;  5DD4 A;  3VVY A;  3JRF A;  1BI3 A;  2DA1 A;  2DA7 A;  2IW5 A;  3KEY A;  5IT9 K;  2MD0 A;  3KP7 A;  1F5T A;  1K83 J;  4G6Q A;  1JGG A;  4I0A A;  1UHM A;  2DYR H;  3L7W A;  4ON0 A;  1BI1 A;  4NHJ A;  2ZCM A;  2M0C A;  4IRV A;  2LRD A;  4RGS A;  2H8W A;  2IBD A;  3KP4 A;  3LQR A;  2QBY B;  2DG8 A;  4HX7 A;  1W7P A;  3JAM K;  2ECC A;  2X9D A;  3OOP A;  3NAU A;  1DQU A;  5DTD A;  4IL6 C;  4RM3 A;  1WHU A;  1ZG5 A;  1KZH A;  2BV6 A;  3QPL A;  4Z2Y A;  4PUS A;  4LD5 A;  5K7Z A;  3OYA A;  3MAJ A;  2F5F A;  3G4S I;  1S29 A;  1A36 A;  1ETX A;  3LSR A;  3A02 A;  2JA5 J;  2E2H J;  4KN7 X;  1YIO A;  1SD4 A;  2OBP A;  2RN7 A;  1MJB A;  1TP4 A;  2XF6 A;  1X1C A;  3J80 K;  3CCY A;  2CUJ A;  4G8X A;  3TO9 A;  2LF7 A;  4C2T A;  1H9G A;  2HTS A;  2MBF A;  4BJ6 C;  3HRM A;  5EYR A;  3OYD A;  5CVU A;  4DYR A;  1AHD P;  4L62 A;  3MKZ A;  3K4B A;  1I1S A;  4LG3 A;  1T98 A;  5ICC A;  4EV0 A;  2CW7 A;  2Q8K A;  1RR8 C;  5BPD A;  5IYC J;  4DYQ A;  4YII A;  2FNP A;  4WIB A;  2ZJQ F;  4GYI A;  4Y13 A;  2EFQ A;  1MH4 A;  1E2X A;  4C30 A;  3CCM I;  2WAQ N;  2WV1 A;  2BYV E;  1P7J A;  2Y9Z A;  2HI3 A;  2XPV A;  1UJ8 A;  1LEB A;  2CUZ A;  3KFW X;  3BG9 A;  3KX2 A;  3HB9 A;  2ZNZ A;  5IP7 J;  3AG4 H;  1CF7 B;  1A6I A;  2XPW A;  3I56 I;  3I71 A;  2V1U A;  2P8T A;  3F1B A;  4XLC A;  1NH3 A;  2DI3 A;  2NNY A;  1ON1 A;  3ONQ A;  5BOX A;  2RRE A;  2NP3 A;  4KMU X;  3FZV A;  4L9T A;  3BZK A;  2NRA C;  4I6Z A;  1YLF A;  5FB2 A;  2FRH A;  5LGN A;  3VSL A;  3CF5 F;  3HRU A;  3RYR A;  2DN0 A;  3J7A O;  1WJE A;  4AM3 A;  2PFB A;  2F4O B;  2WV0 A;  3EQL F;  4U0W A;  3VW0 A;  3WTT C;  2R7T A;  5C4X J;  2QLZ A;  3BR0 A;  2LY1 A;  1HW1 A;  2XV4 S;  1VQL I;  5HNH A;  3OS1 A;  3T1B A;  5ED4 A;  2P5K A;  3EYY A;  3J7Y J;  3JRI A;  1SVL A;  2LF8 A;  1X4O A;  4IO9 F;  4ZYD A;  3EGQ A;  3M3Y J;  2F5E A;  4N9H A;  4G12 A;  2F48 A;  2W48 A;  4P9U A;  3CJQ B;  3KKD A;  3HOS A;  3RPU D;  4ENM A;  3W2A A;  2HKO A;  3L2R A;  4M9S A;  3K1N A;  2OU2 A;  3ZQI A;  1WVR A;  2ISZ A;  4NQW B;  2L2O A;  4LGW A;  2QF7 A;  1J59 A;  2XAQ A;  4XSX F;  1SMT A;  1Z3X A;  1ODD A;  3H5N A;  2QQB A;  3M9A A;  3W6V A;  3G1O A;  1FZP B;  2W25 A;  2RHA A;  3BPX A;  2YUS A;  1G3W A;  3BJ6 A;  2P5V A;  2QGU A;  1B9N A;  3FMS A;  4M71 A;  3G73 A;  1ZLJ A;  1VZ0 A;  1LNW A;  3TMO A;  5TRD A;  3CC2 I;  3BOQ A;  3KZ9 A;  3JRC A;  2MAB A;  2MLK A;  4UV9 A;  5CLS A;  1A04 A;  3CUQ B;  4IJA A;  2OPT A;  4E7H A;  4S05 A;  2BW3 B;  1R4N B;  2O7T A;  3PUB A;  3VYS B;  2ZJR F;  4B47 A;  3B73 A;  4FHT A;  1SFX A;  2LSO A;  1G8X A;  3FXM A;  3IWZ A;  2HDC A;  1SMY F;  2OV7 A;  4J00 A;  3IAS 2;  2R4G A;  3D1N I;  1MKM A;  3ABM H;  3JRA A;  2D45 A;  2KJB A;  1HKS A;  2XKP A;  4IX7 A;  1YO5 C;  1K61 A;  2ZXH A;  1K78 A;  4LG0 B;  3FXK A;  4LOC A;  2PI0 A;  5A2Q K;  2NXN B;  4AWX B;  5ILU A;  2DCE A;  2L9R A;  1LPQ A;  4IRH A;  3N4M A;  1JUP A;  1U9N A;  3VDX A;  3DV8 A;  1X1B A;  1APL C;  1P92 A;  2OTL I;  3JRB A;  3WTV C;  2WB1 A;  3CJT B;  5AIP A;  3U1K A;  3HL2 A;  3NS4 A;  1D1C A;  4E7S A;  4PJJ A;  1ZGA A;  3CP2 A;  1GT0 C;  2L9S A;  5CXG A;  5L3F A;  3T8R A;  4EGZ A;  4QSH A;  3GME A;  1ZRE A;  1R23 A;  3HOT A;  3KCC A;  1R5G A;  1V55 H;  3F8N A;  5D5U B;  1VQ8 I;  3SQN A;  5H6R A;  4IHX A;  2EZL A;  3SFZ A;  4U9N A;  5IT3 A;  1R4M B;  2VJ5 A;  5EEH A;  4BY7 J;  4JX6 A;  1USS A;  5J4V A;  3VEP A;  3EYI A;  3L2U A;  1W5S A;  1PDN C;  1FTZ A;  4A6E A;  1QPI A;  2FML A;  5FJ8 J;  3V7S A;  2IPQ X;  4CCN A;  4FX4 A;  1MDM B;  4FX0 A;  1GHC A;  1YTY A;  1I3Q J;  4JBA A;  2E1M C;  2COB A;  3V7C A;  1U8R A;  3COL A;  3Q0V A;  3I4P A;  3Q5F A;  3S3O A;  1PUE E;  3SHF A;  3T5X A;  1JTY A;  1QZE A;  3Q9V A;  3S2D J;  2FBK A;  3PFY A;  3FXQ A;  2LRE A;  2O9L A;  4HBL A;  1QRY A;  1XGN A;  4B1R A;  3HOZ J;  1MSF C;  1J7K A;  1XG1 A;  1AU7 A;  5KVR A;  2OZU A;  2ETH A;  3C2G A;  2BVL A;  2G7S A;  2ZY9 A;  3QU3 A;  1MW7 A;  1MMG A;  4L9J A;  3FXU A;  2VON A;  1DPU A;  1U5T C;  1F36 A;  1XCV A;  3LOC A;  2HOE A;  3DKY A;  1N75 A;  3QYB A;  3MFK A;  3JR9 A;  1V3F A;  4I0B A;  3RKY A;  3ZN0 A;  3HSR A;  4DQ2 A;  5CKT A;  3DCF A;  5F08 A;  2CMP A;  5D4R A;  2H09 A;  1SFK A;  4CYC A;  4A3L J;  1BOA A;  2UV1 A;  1MNM C;  4ICH A;  3EET A;  2R7X A;  3RZO J;  4MQ9 F;  2FJ1 A;  2GIV A;  2UXX A;  4W97 A;  1ETW A;  4L9N A;  4FAS D;  4IQJ A;  3HPG A;  5FGL A;  3E5X A;  2VPL A;  4ZZD A;  1TQI A;  4KN4 X;  1KU7 A;  2WWY A;  4JNN A;  5H9T A;  1XMX A;  2KIQ A;  5F04 A;  3TDU C;  1XPX A;  2B0L A;  2Y69 H;  2PJR B;  1PUF B;  4Y52 J;  2HQN A;  1ACI A;  2RQQ A;  1IRZ A;  2DT7 B;  4C9Y A;  2XKO A;  3ZMV A;  3GLX A;  4ZYG A;  2E36 A;  1UHS A;  2EPF A;  2K4J A;  1MSE C;  2HNH A;  1OKR A;  2QYO A;  5JR3 A;  2GWR A;  2DTZ A;  1FIA A;  1R71 A;  2HYF A;  1K7A A;  1FWZ A;  1O7L A;  1YIJ I;  3K7A J;  3JRE A;  3CLQ A;  2N8G A;  1C0W A;  2QEX I;  2XSD C;  1Z3Y A;  5J1Y A;  4RB3 C;  3O6B B;  3JSO A;  1B4A A;  1JTX A;  2MLG A;  4J19 A;  4CUG A;  1ZRD A;  2DMN A;  2DFE A;  3OS0 A;  5FD5 A;  3ANG A;  2P0W A;  4BE1 A;  5GAD J;  4LFU A;  3VB2 A;  3AFH A;  2K4B A;  2H27 A;  4WXD A;  4AU7 A;  1TNS A;  4NB5 A;  1WJD A;  3EUH A;  2ZJ2 A;  4MGR A;  3H3V K;  1BI2 A;  2F4M B;  5K7H A;  3HDD A;  3OWT A;  1JXS A;  5K58 A;  2HTJ A;  5AIQ A;  4DW6 A;  4C2U A;  3K6G A;  3G1M A;  3GEU A;  2DW4 A;  3LSH A;  2O03 A;  2RGV A;  4EEF G;  4ESF A;  3F8M A;  3LAJ A;  2XRN A;  4KT6 A;  3H0D A;  3SWH A;  2KRC A;  2A6E F;  2K3P A;  2XAU A;  5FLX K;  4BXX J;  1RES A;  4PDK A;  2MH9 A;  4OIO F;  3HOY J;  3RTR A;  4C3H J;  4FE4 A;  3MKL A;  3C1D A;  3Q0W A;  3VIB A;  2MG4 A;  1JT6 A;  3RKX A;  1Y6I A;  4BDZ A;  4UUS A;  2HKU A;  3I4M J;  3OYN A;  2DOF A;  1WFX A;  4M3G A;  1J2X A;  3MMY B;  1S72 I;  2CV0 A;  3HIF A;  1BN5 A;  2FQ3 A;  3DTK A;  3DEU A;  2IGO A;  1O7F A;  3OSF A;  2QZ8 A;  3S2H J;  4XLF A;  3GTK J;  3IRR A;  3ZMS A;  2MA3 A;  1FPQ A;  2OUM A;  2VJI A;  1CQT A;  1P4X A;  5H2F C;  4EMS A;  1WJF A;  3S14 J;  4F55 A;  3TW6 A;  3BZC A;  1IN4 A;  1BR4 A;  4XK4 A;  4XOP A;  5GPA A;  5J8C A;  1LJ9 A;  3LA2 A;  3WGI A;  1B8I A;  1DDN A;  4RAY A;  3GW2 A;  2O7O A;  3PIO F;  1MZB A;  4M3D A;  2HYG D;  3L2V A;  4BUP A;  3IKT A;  2EIK H;  1SAN A;  3HPH A;  2RVC A;  3WTX C;  1FX7 A;  2X4H A;  2R3S A;  3E6C C;  4Y15 A;  2CJJ A;  2EIJ H;  2ESN A;  1T08 B;  2Q2E A;  3BR2 A;  1XMK A;  4UVC A;  1SFO J;  3I3L A;  3HBL A;  4M3B A;  3GX4 X;  5FMP A;  2ME6 A;  5EG0 B;  2MW8 A;  2F07 A;  3SDB A;  4KJZ A;  3S1N J;  5HS9 A;  4HF2 A;  2X85 A;  5BPI A;  2QWT A;  3BCG A;  4QPO A;  1L3L A;  4CCO A;  1WI3 A;  3ZPL A;  2RAS A;  3H5R A;  3M4O J;  3OYJ A;  1BJA A;  1MGT A;  2I8D A;  2OC6 A;  1QA6 A;  4WWC A;  3HOX J;  3CMM A;  5FKM A;  2V57 A;  3JSJ A;  3NPI A;  2L7K A;  3EDP A;  3CUQ C;  1OCZ H;  4II3 A;  4MFD A;  2FD5 A;  3LAP A;  2DA3 A;  2HXO A;  2RNJ A;  2DMT A;  3Q0U A;  2O6G E;  3WGH A;  3DLL F;  2QKM B;  4I2O A;  1GV5 A;  1WJB A;  4IQ4 A;  4LK1 F;  4UB8 C;  4XKC A;  4RGR A;  4LLL A;  3RD3 A;  5E8I A;  2FSW A;  2NOG A;  1S9H A;  4M9Z A;  4IHY A;  1UEL B;  3RZD J;  3FXJ A;  4UUT A;  3M1E A;  2Y31 A;  4GCV A;  3DBL B;  3HTH A;  3SFI A;  1J75 A;  3HOU J;  4IRI A;  3UR3 C;  2W24 A;  3OS2 A;  4UXN A;  3BCB A;  1I6X A;  2HS5 A;  2VKV A;  3GTL J;  4I02 A;  3BDD A;  1IDZ A;  3HXL A;  2KKO A;  1S5L C;  1D0Z A;  2VC0 A;  1QVT A;  2V4J C;  2RC4 A;  1HW2 A;  2R0Q C;  1IGN A;  4NEL A;  1W36 C;  3CO7 C;  3IHU A;  2Z16 A;  3SYT A;  2E7W A;  5E3M A;  5CVI A;  2XAJ A;  5LGT A;  1QZY A;  3JW4 A;  3CCU I;  1Y0N A;  4A3M J;  2WB1 N;  1TBX A;  3IH4 A;  1N25 A;  3GBG A;  2FE3 A;  4JK1 X;  3X2Q H;  2HPM A;  1P2F A;  2K86 A;  2Y9Y A;  1LFU P;  2OD5 A;  4WXH A;  3F0C A;  1W0T A;  4JX5 A;  3HG9 A;  2HR3 A;  1BBY A;  2O3F A;  1OIS A;  3HUG B;  1U2W A;  2EIM H;  5CPR B;  4N0B A;  5J40 A;  5HS8 A;  3W2V A;  3FMR A;  4R8H A;  4HNV A;  3CCL I;  5F1J A;  2VQH A;  1XCB A;  1NTC A;  2LMD A;  2JVG A;  2GEN A;  4YEJ A;  4EM0 B;  2M7B A;  2OF7 A;  2P81 A;  3DTI A;  3PUF A;  3CDH A;  2R5Y B;  4BY1 J;  3QOE A;  4HAM A;  2AXT C;  1R49 A;  4J01 A;  1WPK A;  4HF1 A;  1QU3 A;  1LB2 A;  3GF2 A;  1G2H A;  2ZCX A;  2H6B A;  1BC7 C;  5ICE A;  1FOW A;  4HV6 A;  4BXU A;  1VQ9 I;  4CYD A;  2FBI A;  1VND A;  5JLW A;  3KYC B;  4E7K A;  5HSZ A;  1QGP A;  1IUF A;  1T56 A;  2JUC A;  3HE0 A;  1P9Q C;  3QPT A;  3WU1 B;  3PAS A;  2XRL A;  5LRS A;  1IZ1 A;  1D5Y A;  3GCM A;  2L3D A;  2CGP A;  2IXS A;  2HOS A;  5E79 C;  2HDW A;  4CGR A;  3CQZ J;  1B59 A;  2NYX A;  2HQR A;  2HZD A;  2D6Y A;  5K5R A;  1TWC J;  1DPR A;  4K2E A;  4FCY A;  1MJA A;  2BZT A;  1MJ9 A;  1R00 A;  5FGM A;  5BS6 A;  2OCE A;  3CCJ I;  3HKZ A;  1BL0 A;  1LEA A;  1WJC A;  1T8I A;  5FLV A;  1X1D A;  3P7N A;  2ZME B;  3WHB A;  5ILV A;  5JI6 A;  5HLT A;  3TED A;  4BJT A;  4HST A;  3HTU A;  2EQR A;  4XON A;  4GCL A;  1LVK A;  2XGX A;  4QTR A;  3QPH A;  3ZGK A;  1LDK B;  1WKM A;  1Z67 A;  4HG2 A;  1Z05 A;  2RKH A;  5KAF C;  3T6N A;  2VT2 A;  2E2I J;  1BI0 A;  1OMI A;  3K4J A;  2L01 A;  2E1C A;  4AVP A;  1YI2 I;  4S0H B;  2QOP A;  5IP6 A;  3QBM A;  5J1R A;  1JKP C;  1ZYR F;  5HOD A;  4X6A J;  2E2J J;  2JPB A;  2GXG A;  1QPM A;  1W5C C;  4OD5 A;  4YG2 F;  4WX9 A;  3ERM A;  2UXN A;  3J7Z I;  4IOC F;  2IA1 A;  3OOU A;  1ITY A;  1W4M A;  3OYM A;  3HGY A;  2IT0 A;  4M3E A;  1SVM A;  5L3E A;  2EFW A;  4V19 K;  2Y0S A;  1W1W E;  4PSX A;  4ASN A;  4ZTF A;  1I50 J;  4AVZ A;  4A69 C;  3CCV I;  2R5Z B;  1F1Z A;  1JHH A;  4PXI A;  3GTQ J;  3K70 D;  3C3W A;  1OCP A;  2A5W A;  2AO9 A;  2E60 A;  2L0K A;  3WU2 C;  4GCK A;  4RBO A;  3VOK A;  5FKK A;  3QKX A;  3VOD A;  4ZYE A;  2UXP A;  3R61 A;  1KQ8 A;  1FBS A;  1VQO I;  2DAO A;  1O3R A;  1J0R A;  1XSX A;  3P9K A;  5F27 A;  1BR2 A;  4KIT B;  4O5V A;  2VOO A;  3I4N J;  2VQL A;  4BEH A;  2EB7 A;  3BR5 A;  3CCE I;  3QP5 A;  1GXQ A;  1QQI A;  2VBX A;  2RDP A;  1Z9C A;  4L5I A;  4NN1 A;  4DVY P;  3MKY B;  4JX4 A;  4GXO A;  2NS0 A;  2VB6 A;  4JQF A;  3CCQ I;  2MC4 A;  3M7G A;  3VW2 A;  1YRN A;  2HVS A;  1ZKG A;  3DPU A;  3NWT A;  1OFC X;  4BKX A;  5EZG A;  3ECH A;  4BNC A;  1PYV A;  3K2A A;  1X1A A;  3K4K A;  5GAH J;  2A6T A;  3FM3 A;  3OYH A;  2OTJ I;  5EFY A;  3IWF A;  1VFC A;  1TQM A;  4XQF A;  2WAE A;  2LNB A;  2VXD A;  1ZR4 A;  1YE9 A;  3H0G J;  4M3F A;  2A5Y B;  2D1V A;  4AD9 A;  2MC3 A;  3RPQ A;  3HSE A;  5L3C A;  4YZE A;  3FK6 A;  4N4O B;  5K7F A;  3LQQ A;  4XLN F;  4JOM A;  2DA5 A;  2IVM A;  3DKX A;  2RQP A;  5HDG A;  3FXO A;  3L09 A;  1YOV B;  1HW5 A;  2W4S A;  1IRF A;  2L4A A;  2F4I A;  3B6C A;  3VYU B;  1K78 B;  1H8A C;  3JCU C;  4DBQ A;  1RC9 A;  4MFE A;  1X1P A;  4PZJ A;  2UZK A;  1X2M A;  3PQK A;  3M1C A;  3HTJ A;  2ELK A;  1DU0 A;  4B09 A;  3ABT A;  5BQT A;  1DP7 P;  1JE8 A;  1LKX A;  2LDU A;  5JVG F;  1I3A A;  1ZHF A;  4B44 A;  1BW5 A;  4B4C A;  4F93 B;  4A5M A;  1HST A;  1V4R A;  2JA2 A;  2V1D A;  3ERE D;  3I59 A;  5KCM A;  1XGM A;  3KIO A;  2VT3 A;  5E3L A;  2FA5 A;  2FXA A;  4P5O A;  5H20 A;  1ETO A;  5FKO A;  3VYT B;  4E70 A;  2FEZ A;  5TJJ A;  4B3A A;  2HWV A;  5D5X B;  4CZC A;  5DV5 A;  5GAG J;  1ZLK A;  3O3K A;  2D5V A;  2KDZ A;  3BR3 A;  3BT9 A;  5BMZ A;  1MD0 A;  4A3F J;  1B9M A;  2P4W A;  2P7C B;  4MO7 A;  2G7H A;  4OMZ A;  2PX9 A;  2ZBK A;  3PO2 J;  1ZK8 A;  2IS1 A;  1NK3 P;  3CRJ A;  1XTA A;  5IT9 Z;  2HZT A;  2GBY A;  2CUE A;  3NRG A;  4CCK A;  2BE5 F;  4BXF A;  3RQ4 A;  3I55 I;  1AWC A;  4ACI A;  2M30 A;  3VVZ A;  4JP0 A;  5M3F J;  1FBQ A;  4KDP A;  4I7H A;  3HHG A;  5LEJ A;  3JAM Z;  1LQ1 A;  2A3S A;  2CWE A;  2R7Z J;  2DJI A;  2M0M A;  3PFI A;  5F6F A;  4AUX A;  2A2F X;  3KEQ A;  3VWB A;  3CME I;  1ZEL A;  3BG6 A;  2MH2 A;  1EKE A;  1ZAR A;  1ON2 A;  4IXA A;  2B9S A;  3NXC A;  1BC8 C;  1KQ0 A;  1TLH B;  4Q48 A;  1E0E A;  4FQG A;  3KP6 A;  2DA4 A;  3J80 Z;  2CV2 A;  3OYE A;  1B72 B;  2JT1 A;  1GVD A;  4MIM A;  1D0X A;  4F3Q A;  1YIT I;  2DO7 A;  1YS7 A;  4CHU A;  4A3I J;  3M8E A;  5H6Q A;  4CYC B;  1SEU A;  2X1C A;  2BBY A;  5F0F A;  2EV5 A;  2XPU A;  3E1S A;  4XMY A;  5EEG A;  3RIR A;  1XB4 A;  3H3U A;  3OYF A;  2IGN A;  2VE8 A;  4XN0 A;  3O2P E;  5EEA A;  2WTE A;  3RSN A;  3R0A A;  3V4G A;  3CMY A;  3QQA A;  3TP3 A;  3FHZ A;  1S7A A;  4YFX F;  3I53 A;  4AIH A;  4EJO A;  3DBH B;  3WE2 A;  4KIC A;  3VFZ A;  1X3Z B;  3K4M A;  1IDY A;  1XSD A;  1SFU A;  2GXA A;  2X51 A;  3IV5 A;  1ETQ A;  2BY2 A;  2FBH A;  1IV6 A;  5J6X A;  2QQA A;  1DGW Y;  3L2Q A;  2KHM A;  4E7I A;  3ZRG A;  2BXY A;  5K5Q A;  4XR6 A;  5EJC A;  4M9X A;  2KL4 A;  3H1C A;  1JKQ C;  1HDD C;  2IGM A;  1H88 C;  4ENN A;  3CLO A;  4P1W A;  1O3S A;  2K27 A;  2XAF A;  2M4G A;  3ZXS A;  2VQG A;  1V5E A;  3PIP F;  2ZME C;  2IS4 A;  2EZK A;  3D5R C;  3HKZ N;  2NAZ A;  2RNG A;  2YR2 A;  1G3S A;  4I99 C;  3RKQ A;  1AKH A;  5E20 A;  2VAS A;  1ERD A;  3S32 A;  1X3U A;  3QAH A;  1S8N A;  5E3N A;  3QYF A;  4P96 A;  4YRV A;  4NUB A;  4MK6 A;  3LWJ A;  4BAY A;  1Y8Q B;  3ROU A;  3L2C A;  3SXY A;  1K4S A;  1TWF J;  2HVQ A;  4MTE A;  2DLL A;  4TV7 A;  2XAG A;  4NBQ A;  2OQG A;  1JKO C;  2HOA A;  4KFC A;  2NVU B;  1Z1D A;  3LST A;  1E17 A;  1HA8 A;  2CQQ A;  4UVA A;  3ZMT A;  2BHZ A;  2LFB A;  1RIO H;  4EVI A;  1WH5 A;  4KYW A;  2ZXI A;  4LJZ F;  3KP5 A;  2M5W A;  1IW7 F;  1FMV A;  3ZQQ A;  3ABK H;  3FBN B;  3KPH A;  2K9L A;  3OYK A;  2WBM A;  2WC2 A;  4XLE A;  1GXP A;  2QBY A;  2HOT A;  5FD6 A;  2Q24 A;  4RAZ A;  1POG A;  1XC5 A;  2G7U A;  3WU0 A;  4UUS B;  2GXB A;  3FX3 A;  1MBH A;  4U7B A;  2YVH A;  2Y0S N;  1JJ8 C;  2FJI 1;  3JRG A;  3HIM A;  3DP7 A;  1VI0 A;  2P7V B;  1R5H A;  3ZQH A;  2PBX A;  2XF5 A;  4I09 A;  3E5U A;  5ERI A;  2JQ7 A;  2V79 A;  3VTI A;  2ZFU A;  3A1Y A;  4JYK A;  3PNT A;  3DPJ A;  3MZY A;  5KHD A;  1OCT C;  2M8E A;  2O8X A;  1FBU A;  4BQQ A;  1B8I B;  1DUX C;  2ZKZ A;  1NHA A;  1B1B A;  5A2Q Z;  3P9T A;  1UG0 A;  2Y75 A;  3ULQ B;  4DNC A;  1Z91 A;  2Z9O A;  1ENH A;  5HOO A;  1R5I D;  1FY7 A;  2FOW A;  3MQ0 A;  4X0G A;  3JRH A;  5E1Z B;  2CQX A;  1R1V A;  1LE8 B;  2G0E A;  1X4P A;  4NDL A;  3VOX A;  5LEK A;  2M9H A;  4QWQ A;  1K4T A;  3CWR A;  1HDP A;  2FUG 2;  1KQ9 A;  5CJ9 A;  4YFN F;  1XX5 A;  1CF7 A;  3E7Q A;  1R58 A;  3TBI A;  3ESW B;  2A61 A;  2CU7 A;  2Z3Y A;  4EJW A;  1ZN2 A;  2PMU A;  2VOD A;  5DD8 A;  2KPM A;  3WTW C;  2Y30 A;  4MEX F;  2JK3 A;  4WK8 F;  3A01 B;  4I98 B;  3LMM A;  4HEA 2;  4HF0 A;  2HU9 A;  3K10 A;  3MVP A;  1VQK I;  1ZH5 A;  3KKC A;  1X3W B;  2ESH A;  1E3P A;  1O3Q A;  1J5Y A;  3G3Z A;  4OAY A;  3HTA A;  2COM A;  3LSI A;  3G56 A;  2KFD A;  4M73 A;  1IV8 A;  1RNL A;  2L02 A;  5KNL A;  3ZQL A;  4XRS G;  5FO5 A;  4XID A;  5DM7 F;  2PBI A;  2F5C A;  2W7N A;  4CCJ A;  1FNN A;  4G9Y A;  2DOE A;  4RLQ A;  4F52 A;  3CJR B;  5EGO A;  1T38 A;  5LLQ A;  1I27 A;  2ZOZ A;  1IN6 A;  5JHF A;  2LP0 A;  3CDI A;  3D5L A;  4GFB A;  3A03 A;  1AA7 A;  1MIJ A;  5B5E C;  2OI8 A;  1BIB A;  4R1H A;  4NQW A;  3E6D A;  1D0Y A;  4HPQ A;  3CP8 A;  1RRJ A;  3HZJ A;  2L7F P;  4RAG A;  1UG2 A;  1P4A A;  4PGG A;  3ANP A;  3M8F A;  2ZSI B;  1KYW A;  1YW8 A;  1RPW A;  3V8K A;  3S8P A;  1KA8 A;  2K5C A;  4E4H A;  3WOD F;  4GFL A;  2PMZ A;  3IL2 A;  5F64 A;  3H36 A;  2QSG X;  4PGH A;  4AIK A;  3PQJ A;  5LBQ A;  4EM1 A;  1YW7 A;  4FIS A;  3NNR A;  2CYY A;  2EFO A;  2ZB9 A;  3ECO A;  1EF4 A;  2HQ5 A;  3GUD A;  2IRF G;  5C3E J;  1W0U A;  3CUQ A;  1IN5 A;  1TQP A;  4L18 B;  5D6F A;  5C44 J;  2F5V A;  3EUA A;  2BW3 A;  3G6E I;  3K9T A;  5LHH A;  3GTJ J;  2IS2 A;  1OLT A;  1R9T J;  1H9T A;  1FTT A;  1Z77 A;  3C18 A;  5B3S H;  4KUM A;  4A3C J;  5C4J J;  1MMA A;  5CXI A;  4Y17 A;  3HJE A;  3PSI A;  2H8R A;  2MD5 A;  2LYC A;  4FTH A;  2BY0 A;  2DK5 A;  2XHK A;  5FRM A;  1QO0 D;  2QUF A;  4Q4Z F;  1BM9 A;  2E5N A;  4OIQ F;  2CH0 A;  2R7O A;  3ZP5 A;  3BHQ A;  1A6Q A;  4HQM A;  2HVR A;  1H0M A;  2ELH A;  2JA8 J;  2HFH A;  1Y39 A;  1HQC A;  2EBI A;  3DKW A;  1OCO H;  1T0F C;  5FRN A;  2MGQ A;  3M07 A;  3ABL H;  2DK8 A;  1W7P D;  2EZH A;  4U87 A;  4Q47 A;  4HNT A;  4L0Y B;  1SGM A;  5ICF A;  1RKW A;  2XGE A;  9ANT A;  3K4C A;  4BAC A;  3CDL A;  2XDV A;  1U8B A;  3VOE A;  4U7D A;  3HC7 A;  3F6O A;  3HGG A;  1I6H J;  4HDU A;  3CZ6 A;  4R79 A;  5D18 A;  3G2B A;  5E8G A;  1LUJ B;  4BBR J;  3LSM A;  1JT0 A;  1JUM A;  3G71 I;  4L0Z B;  2G7L A;  2LTP A;  2B1E A;  3FWE A;  3BJA A;  5D5V B;  4MTD A;  2R7W A;  1J09 A;  4HSR A;  3H3Z A;  4ME9 A;  2M45 A;  3V8J A;  3OYI A;  1MDM A;  5FLX Z;  2REK A;  2M8G X;  3NWS A;  1YHQ I;  3OYG A;  1J9I A;  2QWW A;  3DEW A;  4CA0 A;  3K1P A;  2EWN A;  2EIL H;  5DCM A;  5J3L A;  3KET A;  2DBB A;  3L9F A;  3L1P A;  2YVE A;  4A5N A;  1A5J A;  1FYK A;  3BWG A;  2GAU A;  3B81 A;  2ACJ A;  1FYL A;  2EV0 A;  4HX4 A;  3KE2 A;  3SZP A;  2X6O A;  2PEX A;  3BG7 A;  5HBU A;  1MMN A;  2OZ6 A;  3MWM A;  5HDN A;  4A2U A;  5CQG A;  2L7M P;  6PAX A;  3F8C A;  2RV8 A;  4BJ5 C;  2PG4 A;  2R7U A;  1ETK A;  3FM5 A;  2M2E A;  2Q0O A;  4XLH A;  3TP0 A;  1FJL A;  3BTC A;  3NRV A;  4V2G A;  3RPU A;  4ESB A;  3EUH C;  1LFB A;  2EA2 A;  2E7X A;  1QHG A;  3DPT A;  4ZC3 A;  4CCM A;  3DQV C;  1FOK A;  2JA7 J;  3AG2 H;  3GTG J;  3K69 A;  4CGZ A;  1RKT A;  2LKS A;  3Q3S A;  5IOZ A;  2DMP A;  4E7L A;  3FBI B;  3F23 A;  3GZ5 A;  5EDN A;  1U0J A;  3F3X A;  3F6V A;  3PM1 A;  2JTV A;  3ZQG A;  3K8P C;  2LG4 A;  1WJ5 A;  4N9I A;  3WTY C;  2ZJP F;  1RET A;  2PJR A;  1PUF A;  5M3M J;  2PQ8 A;  3PL8 A;  4LB6 B;  4DBR A;  5J8F A;  3J7A Y;  2GFN A;  4MNU A;  2LVS A;  3HSF A;  1G4D A;  4BQO A;  1XS9 A;  4ZDL A;  3LSG A;  1VQ5 I;  2PZ9 A;  1DU6 A;  2CO5 A;  2XGC A;  1IXS B;  1E3H A;  1WSU A;  4C3I J;  3CJN A;  3TQN A;  3T0Y A;  5B1B H;  2VC1 A;  1WWX A;  2M7A A;  4Z6Y A;  4Y3O A;  3ASO H;  4NC7 A;  2LKX A;  1IN7 A;  3CD6 I;  4RM2 A;  2XRO A;  2X1D A;  3K1M A;  1VTN C;  1WJA A;  1UMQ A;  2WGB A;  2RAE A;  3DXJ F;  3OIO A;  3G7R A;  2M87 A;  5F0H A;  4A6D A;  1S6L A;  3GO5 A;  2L4M A;  1TL8 A;  4ZH4 F;  5E3O A;  2H1K A;  1Z6R A;  4AC6 A;  3WG7 H;  1U9O A;  3R0J A;  3DWL E;  3S93 A;  5HS7 A;  4UV8 A;  1P4W A;  1IXC A;  1N78 A;  2CV1 A;  1D3Y A;  3S2W A;  2ZXJ A;  4YIR X;  1TNT A;  1W7P B;  3S16 J;  2CQN A;  3HTS B;  3ZQ7 A;  2UUZ A;  4ITV A;  4PFP A;  5D5W B;  2NVY J;  2K9Q A;  4M6V A;  5CVV A;  3ZQC A;  4Y33 A;  2O5R A;  4JKZ A;  1X19 A;  1Y0U A;  3TO7 A;  2CSO A;  2ICW G;  3DF8 A;  2YS9 A;  1DP3 A;  2IP2 A;  2STT A;  2CUF A;  2H6C A;  3I59 B;  2BXZ A;  2NS8 A;  1G6N A;  2DFH A;  3QU6 A;  2R7F A;  3WTU C;  5DUI A;  4XM3 A;  1WGX A;  1HF0 A;  2VJ4 A;  2QCO A;  2ID6 A;  1P7I A;  5FLM J;  2DFF A;  5GTH C;  1LDJ A;  4M72 A;  4CSW A;  1WI9 A;  1V5F A;  2AQE A;  4ABZ A;  3QWL A;  4U0V A;  5AQC A;  5ILS A;  3GTP J;  4U9L A;  4KIS A;  5E18 F;  2GZW A;  2BGC A;  2GOX B;  2BVM A;  2VKE A;  5F0C A;  2XDN A;  2Y0M A;  1TTY A;  5TIS C;  3FRQ A;  4HZF A;  3CC7 I;  1BJZ A;  5LRR A;  2YPR A;  2FU4 A;  5KK1 A;  5LFA A;  4GFK A;  3PO3 J;  3K2Z A;  3HM5 A;  5J4Y A;  3C2B A;  4AC0 A;  4G7Z F;  2OQR A;  4BBS J;  2A05 A;  2ADU A;  2BEO A;  3BG5 A;  4XLP F;  4BS9 A;  3H9G A;  3GZI A;  2W82 A;  4GCT A;  4BQN A;  1OCC H;  2DXI A;  3SEZ A;  2XAS A;  1HLV A;  3E7L A;  3BP8 A;  3F72 A;  3C7J A;  3H35 A;  2JA6 J;  5LHG A;  3IUV A;  3J81 K;  2E35 A;  2CFX A;  3MZ8 A;  5EG0 A;  5CVR A;  1JHF A;  4CXF A;  2Z1D A;  3RQI A;  1I39 A;  4OIR F;  2KZG A;  2LBF A;  4ESJ A;  2ZXW H;  1YYV A;  2DA2 A;  4YEL A;  4DZJ A;  1ETY A;  2KDO A;  3HEF A;  2XSJ C;  3MEX A;  4XRS A;  4AF5 A;  3ZQF A;  3AG3 H;  5D8L B;  3HRT A;  3RCO A;  2PMZ N;  4UVB A;  4FET A;  3CJD A;  3MCZ A;  3E5Q A;  3KLO A;  3VW1 A;  3M8J A;  2R7Q A;  1R36 A;  1I5Z A;  1UST A;  3CES A;  2XB0 X;  2V9P A;  5DYM A;  4QPQ A;  1VQ4 I;  2DT6 A;  3AQT A;  1R1T A;  2V26 A;  3R6S A;  4B48 A;  5DUK A;  1K6O A;  4EQQ A;  4HX8 A;  2VBY A;  3D5S C;  2IAI A;  2FNA A;  1FP2 A;  5FFX A;  2VN2 A;  3COA C;  4HRI A;  2ZOY A;  3ON2 A;  3DU6 A;  3FIW A;  1QHH D;  4DIQ A;  2DT5 A;  3CMA I;  4NC6 A;  4ZYH A;  1Z7L A;  3ON4 A;  4EJT A;  2GIZ A;  3EUP A;  1Q1H A;  3OR1 C;  2YX4 A;  1U78 A;  3KZI C;  3WG9 A;  2B7E A;  2DQL A;  4XNF A;  2L7Z A;  3W2W A;  3U2R A;  2VJJ A;  3CCS I;  2UXH A;  3H9J A;  5F1R A;  4A0X A;  3KYD B;  3IP4 B;  4M6Y A;  4Q5S F;  1S3J A;  1U6G A;  4ZZL A;  3QOP A;  5L3G A;  3JTG A;  3FMQ A;  1Q1V A;  2VL8 A;  3OR2 C;  4AID A;  2ZFW A;  4N4N B;  1BA5 A;  3H9Q A;  4WXC A;  1JJ6 C;  4NNJ A;  3QYE A;  3RYP A;  4LMY A;  1MBG A;  2V7F A;  3AKZ A;  2KIM A;  2HPI A;  3HUG A;  2IEK A;  4H0E A;  1MBE A;  3CUO A;  3JTH A;  1NG7 A;  1FEX A;  3H92 A;  3HTI A;  1REP C;  2UXO A;  4BU2 A;  1IRG A;  3DBR B;  3ZN1 A;  2R5Y A;  3RI4 A;  4XSZ F;  3A2K A;  3V42 A;  4IHS A;  1OYI A;  1P6R A;  4IPA A;  3GTO J;  3IUO A;  1RZ4 A;  2JMW A;  4YIF A;  3JSP A;  1UHW A;  2KT0 A;  1R1U A;  5GPC A;  3G1L A;  1MBK A;  3OSG A;  3NEU A;  3LSP A;  3V78 A;  5JLX A;  4D7N A;  4D9J A;  3HOW J;  1H89 C;  1UI6 A;  4UB6 C;  3ZOB A;  4CH7 A;  4OU0 A;  2VIX A;  4UY8 I;  3P9C A;  3MD2 A;  2VXZ A;  2G7G A;  4KIF A;  5FKL A;  4EJU A;  1MMD A;  1OR7 C;  3SJM A;  3FDY A;  1YX5 A;  1QBJ A;  5HLG A;  4RGX A;  4ZYA A;  1PJR A;  4LIV A;  2K9M A;  3LFU A;  4Y4R A;  5FRO A;  2ZME A;  3PPB A;  3DTE A;  4RB1 A;  4AIJ A;  2PLY A;  2CQK A;  2X0L A;  2JWT A;  1W36 D;  3E0J B;  2EJR A;  3BR6 A;  4NC8 A;  5CYV A;  1HOM A;  2DDB A;  4ZDO A;  3I54 A;  3B6A A;  3KZZ A;  5BNG A;  5D6E A;  5HLH A;  4PK4 A;  4O3M A;  3SZG A;  4A3G J;  1ZAO A;  1VQ7 I;  3ASN H;  2JZY A;  2V1X A;  3AG1 H;  3ML6 A;  5D1R A;  2R7V A;  3RJP A;  3FXL A;  4IVN A;  3CO6 C;  2IGK A;  3TGN A;  3BQY A;  1HXD A;  4ZJZ A;  2F6C A;  2VQC A;  1AOY A;  1LVA A;  1JKR C;  3ZMD A;  4G94 A;  1K6Y A;  1V5G A;  4AYB A;  1FP1 D;  2FF4 A;  3HHH A;  4XOR A;  2DG7 A;  2O61 A;  2DOA A;  2DPD A;  2NP5 A;  1R7J A;  2R7R A;  5AON A;  3GFJ A;  1TW3 A;  4HA8 A;  4F7Z A;  1YX3 A;  2KIF A;  4FT8 A;  1D8K A;  4HYE A;  1YJ9 I;  2R93 J;  1WZ2 A;  4HV5 A;  3PJR A;  3KLN A;  2VLA A;  2L54 A;  3A4C A;  1ONV A;  3H5A A;  2LY9 A;  2R5Z A;  4PJL A;  3VUQ A;  2VKD A;  3GZ6 A;  3K0L A;  3P5J A;  1Y56 A;  4CCL A;  1RR7 A;  4OWR B;  2OCC H;  4GYG A;  2LKP A;  2LR8 A;  4HNU A;  4G7O F;  4D5F A;  5DEQ A;  3FIS A;  2DMU A;  3LHQ A;  3AL0 B;  2AS5 F;  3FKI J;  3FHN A;  2BY1 A;  2X6W A;  4ANJ A;  1HKT A;  2MFZ A;  2WY8 Q;  2X1E A;  3F8F A;  4KIB A;  4A0Z A;  5EGO B;  2EFP A;  3V6G A;  3BPV A;  2JVH A;  1KGS A;  4E6K G;  2DA6 A;  2DMQ A;  1UB9 A;  4LK0 F;  1BOB A;  2J5P A;  2W00 A;  4BYY A;  2NVX J;  4S04 A;  1SC7 A;  5JFR A;  2JN6 A;  3IH2 A;  4MEY F;  2R7S A;  2JRM A;  1B6A A;  2ZSH B;  2QA4 I;  3FK7 A;  2EK5 A;  4L5E A;  4RAF A;  2W85 A;  1Z21 A;  1U5T A;  3C2H A;  3BC8 A;  5M5W J;  4BHC A;  3FKJ A;  2EZI A;  4A3J J;  4RLF A;  4P55 A;  3KZY A;  2LY2 A;  2R92 J;  3DEE A;  2K40 A;  1FOX A;  1FOY A;  2TDX A;  1FIP A;  1RUO A;  2NOJ B;  2Y2Z A;  4RA2 A;  3I9V 2;  4CZZ A;  2KJC A;  4DZP A;  4H4K C;  4IHV A;  4L5J A;  4MXM A;  4B43 A;  3OL3 A;  4E7Z A;  2M1B A;  1YW9 A;  2ID3 A;  3U1D A;  2B63 J;  2FQ4 A;  1TZL A;  4GO1 A;  1QVU A;  1IO2 A;  2DPU A;  2KLO A;  4OMY A;  3S17 J;  2C6Y A;  1EH7 A;  1RI7 A;  1PVE A;  1TW2 A;  3OMY A;  3O8H A;  2JPC A;  1T95 A;  3BRO A;  1QZZ A;  4RDU A;  3QRF F;  4I76 A;  4XIC A;  5FFZ A;  1X2N A;  3BCA A;  1UAA A;  5LD2 C;  4RMN A;  1Z6T A;  2P5L C;  2CQ7 A;  3SZT A;  2QIB A;  3DU5 A;  1WCM J;  1T39 A;  2IJL A;  4XN3 A;  2MYS A;  1EA3 A;  5ICG A;  2WY7 Q;  2QQ8 A;  3VVX A;  5DAJ A;  2E71 A;  2F2E A;  3GXO A;  1HC8 A;  2XB5 A;  1F4K A;  4A0Y A;  3LA3 A;  2XF7 A;  3LNQ A;  5K1Y A;  4D1Q A;  3S1M J;  2AQF A; 
#chains in the Genus database with same CATH homology
 3TED A;  4V2F A;  3HGG A;  1I6H J;  2EQR A;  5D18 A;  4GCL A;  4QTR A;  5EYR A;  4BBR J;  1JT0 A;  1JUM A;  4DYR A;  1S7E A;  1AHD P;  4A3D J;  2LTP A;  2G7L A;  5IYD J;  1Y1V J;  4L62 A;  5IYC J;  4DYQ A;  4ME9 A;  1MH4 A;  2WAQ N;  2WV1 A;  2REK A;  2M8G X;  3T6N A;  1P7J A;  2Y9Z A;  1BW6 A;  2E2I J;  2HI3 A;  3DEW A;  2XPV A;  4S0H B;  2QOP A;  5IP6 A;  3QBM A;  3BG9 A;  5J1R A;  1JKP C;  3HB9 A;  5IP7 J;  5HOD A;  5J3L A;  4X6A J;  2E2J J;  2QTQ A;  3BQZ A;  1A6I A;  2NVT J;  2XPW A;  3L1P A;  2YVE A;  3F1B A;  1A5J A;  3OOU A;  3AQS A;  1ITY A;  3B81 A;  3HGY A;  2NP3 A;  4M3E A;  4I6Z A;  1WH7 A;  3SDG A;  2X6O A;  5HBU A;  1Z0X A;  1I50 J;  4IHW A;  4A69 C;  2R5Z B;  2DN0 A;  4PXI A;  3GTQ J;  2L7M P;  1OCP A;  2AO9 A;  2L0K A;  2LLK A;  1GV2 A;  3VW0 A;  4GCK A;  4RBO A;  3VOK A;  5FKK A;  3QKX A;  1ETK A;  2UXP A;  5C4X J;  2M2E A;  3TP0 A;  1FJL A;  3BR0 A;  1B72 A;  3BTC A;  4V2G A;  1LFB A;  5F27 A;  3JRI A;  1TC3 C;  2EH3 A;  3I4N J;  2JA7 J;  3QPS A;  3EGQ A;  3GTG J;  3M3Y J;  5HAW A;  1RKT A;  3Q3S A;  4G12 A;  2W48 A;  2DMP A;  5IOZ A;  3BR5 A;  3KKD A;  5EDN A;  3PM1 A;  2HDD A;  3ZQG A;  3BTL A;  1RET A;  3VPR A;  1PUF A;  5M3M J;  3ZQI A;  4NN1 A;  2GFN A;  4JX4 A;  2QF7 A;  2LVS A;  1XS9 A;  3LSJ A;  3LSG A;  3W6V A;  2PZ9 A;  3VW2 A;  3G1O A;  1DU6 A;  1YRN A;  2XGC A;  2HXI A;  1ZKG A;  2RHA A;  4C3I J;  1OFC X;  2YUS A;  4BKX A;  5EZG A;  2IU5 A;  3K2A A;  2FX0 A;  2LKX A;  3KZ9 A;  1JUS A;  2CRG A;  3JRC A;  5EFY A;  1UMQ A;  2WGB A;  1VFC A;  2RAE A;  3S5R A;  3OIO A;  3HOV J;  1ZR4 A;  2OPT A;  2QKO A;  3G7R A;  3H0G J;  1IJW C;  4M3F A;  2O7T A;  1O4X A;  3NI7 A;  4DYC A;  4YZE A;  5F0H A;  3FK6 A;  2K9S A;  5K7F A;  5E3O A;  2WUI A;  2H1K A;  2DA5 A;  4AC6 A;  1U9O A;  3D1N I;  3JRA A;  1K61 A;  5J1U A;  3BNI A;  3B6C A;  1H8A C;  4LOC A;  5DS9 A;  2M34 A;  1UI5 A;  1E3O C;  4MFE A;  1X2M A;  3HTJ A;  2ELK A;  3S16 J;  1DU0 A;  2L9R A;  5IOY A;  1JUP A;  2NVY J;  1U9N A;  2K9Q A;  4M6V A;  3ZQC A;  1APL C;  4JKZ A;  3JRB A;  1BW5 A;  4B4C A;  2YS9 A;  1GT0 C;  3C07 A;  1MH3 A;  2CUF A;  5CXG A;  4AYB N;  3BR1 A;  4QSH A;  2LK2 A;  1MBF A;  2NS8 A;  2TCT A;  5E3L A;  4D5C A;  1ETO A;  5FKO A;  4IHX A;  1HF0 A;  1WGX A;  4FE7 A;  2EZL A;  2QCO A;  2ID6 A;  1P7I A;  4B3A A;  2GLO A;  5FLM J;  4BY7 J;  4JX6 A;  1ZR2 A;  2D5V A;  2KDZ A;  3S1Q J;  3BR3 A;  3BT9 A;  2FBQ A;  4A3F J;  4ABZ A;  5AQC A;  1FTZ A;  3GTP J;  1QPI A;  3KNW A;  4MO7 A;  5FJ8 J;  3O8G A;  3PO2 J;  1ZK8 A;  1NK3 P;  5F0C A;  2VKE A;  3CRJ A;  2AHQ A;  2XDN A;  1I3Q J;  2COB A;  2GBY A;  2CUE A;  3FRQ A;  3NRG A;  3COL A;  1BJZ A;  3Q0V A;  5IPA A;  4GFK A;  3PO3 J;  1ZQ3 P;  1JTY A;  3HM5 A;  2HYT A;  1TWA J;  3C2B A;  4JP0 A;  3VVZ A;  5M3F J;  4ACI A;  4AC0 A;  3S2D J;  3S15 J;  2VI6 A;  4BBS J;  3BG5 A;  2I10 A;  2OER A;  3GZI A;  2O9L A;  4GCT A;  2UXI A;  1QRY A;  1VF9 A;  2R7Z J;  4B1R A;  3HOZ J;  1MSF C;  4AUX A;  1HLV A;  1XG1 A;  4W1U A;  1LE8 A;  3E7L A;  1AU7 A;  2JA6 J;  2G7S A;  2TRT A;  3IUV A;  2HYJ A;  3O60 A;  5FHP A;  5EG0 A;  1F36 A;  1TWH J;  3LOC A;  3NXC A;  3RQI A;  2W53 A;  2DA4 A;  3JR9 A;  2DA2 A;  4DZJ A;  4D7M A;  1ETY A;  3HEF A;  1B72 B;  1GVD A;  4MIM A;  4XRS A;  4AF5 A;  3DCF A;  5F08 A;  3ZQF A;  4MLO A;  4KWA A;  4ICH A;  4CYC A;  4A3L J;  4A3I J;  2PMZ N;  1ORK A;  4CYC B;  1MNM C;  2NX4 A;  3A01 A;  3RZO J;  3CJD A;  2FJ1 A;  5F0F A;  4Y7N J;  2XPU A;  4W97 A;  3VW1 A;  1ETW A;  5FGL A;  2XB0 X;  1TWG J;  5EEA A;  4JNN A;  5H9T A;  3AQT A;  3IH3 A;  5F04 A;  3CMY A;  3QQA A;  1IC8 A;  3TP3 A;  2X48 A;  5IYB J;  5EZH A;  1PUF B;  4Y52 J;  2IAI A;  1IRZ A;  3ON2 A;  2ZOY A;  1GDT A;  3FIW A;  1IG7 A;  1UHS A;  1IDY A;  3ON4 A;  1YRN B;  3IV5 A;  1MSE C;  1ETQ A;  1IV6 A;  3EUP A;  3LJL A;  2DTZ A;  1FIA A;  1U78 A;  2L7Z A;  4XRM A;  3K7A J;  3JRE A;  2UXH A;  2N8G A;  3JRD A;  2VPR A;  2XSD C;  1JKQ C;  1HDD C;  5FKN A;  5J1Y A;  1H88 C;  2NVQ J;  1Q1V A;  1JTX A;  4J19 A;  1BA5 A;  2DMN A;  1JJ6 C;  3ANG A;  2EZK A;  3HKZ N;  3MNL A;  3GTM J;  1MBG A;  2JJ7 A;  4UDS A;  4C2M J;  3RKQ A;  1AKH A;  2IEK A;  5E3N A;  3BTI A;  4C3J J;  1MBE A;  5GP9 A;  4MK6 A;  3H3V K;  3LWJ A;  5K7H A;  3HDD A;  1FEX A;  3RH2 A;  5D19 A;  5K58 A;  3HTI A;  1TWF J;  4DW6 A;  2UXO A;  3G1M A;  3BRU A;  3GEU A;  2R5Y A;  1JKO C;  4EEF G;  4A93 J;  2HOA A;  3MN2 A;  2CQQ A;  3BG3 A;  5C4Y A;  1ZGW A;  2LFB A;  3GTO J;  2JMW A;  4X1E A;  2KT0 A;  5GPC A;  4BXX J;  1RES A;  3G1L A;  1MBK A;  1WH5 A;  3OSG A;  3HOY J;  3S1M J;  4C3H J;  3LSP A;  3V78 A;  4FE4 A;  3MKL A;  5JLX A;  4D7N A;  3Q0W A;  3VIB A;  2MG4 A;  1JT6 A;  1H89 C;  1GUU A;  2HOT A;  3HOW J;  1UI6 A;  3ZOB A;  2Q24 A;  1POG A;  1XC5 A;  2E19 A;  4UUS A;  3BJB A;  4UUS B;  2HKU A;  4HKU A;  2G7G A;  3I4M J;  5FKL A;  1MBH A;  2YVH A;  3SJM A;  4M3G A;  2Y0S N;  1JJ8 C;  3HIM A;  3JRG A;  2G3B A;  1VI0 A;  3UKG A;  2MSY A;  3ZQH A;  2PBX A;  2DJN A;  3OSF A;  3PPB A;  3S2H J;  1HCR A;  3GTK J;  1CQT A;  2JWT A;  1ZTR A;  4JYK A;  3BR6 A;  3DPJ A;  1HOM A;  3S14 J;  1OCT C;  3TW6 A;  1B8I A;  2YU9 J;  4XK4 A;  5GPA A;  2O8K A;  3B6A A;  5BNG A;  1B8I B;  1ETV A;  4A3G J;  3P9T A;  2O7O A;  4M3D A;  5D1R A;  3TW7 A;  1ENH A;  5IP9 J;  1SAN A;  3BQY A;  3JRH A;  2CQX A;  1LE8 B;  2G0E A;  4NDL A;  2CJJ A;  3BR2 A;  1SFO J;  1JKR C;  3VOX A;  3HBL A;  4M3B A;  2M9H A;  5FMP A;  3CWR A;  2ME6 A;  5EG0 B;  2MW8 A;  1HDP A;  2F07 A;  3S1N J;  5CW8 A;  2QWT A;  3BCG A;  2DG7 A;  3E7Q A;  1MBJ A;  2CU7 A;  1WI3 A;  2RAS A;  3M4O J;  2NP5 A;  5EF6 A;  2R93 J;  3HOX J;  1F43 A;  5FKM A;  2V57 A;  3JSJ A;  3NPI A;  2Y30 A;  2JK3 A;  3A01 B;  2ZCN A;  4MFD A;  2FD5 A;  3WHC A;  2LY9 A;  1X58 A;  2DA3 A;  4A3E J;  3MVP A;  2R5Z A;  3KKC A;  2HXO A;  3Q0U A;  2DMT A;  2UXU A;  2XGD A;  3VUQ A;  3HTA A;  1GV5 A;  1RR7 A;  3G56 A;  4A3K J;  2LR8 A;  3RD3 A;  4D5F A;  2NOG A;  3FIS A;  3VP5 A;  2DMU A;  3ZQL A;  4IHY A;  3RZD J;  4XRS G;  3LHQ A;  4XID A;  1Y1W J;  4A3B J;  3FKI J;  4UUT A;  2Y31 A;  3HTH A;  3SFI A;  3HOU J;  3S1R J;  5EGO A;  5EGO B;  3V6G A;  4IEJ A;  2VUM J;  2DA6 A;  3GTL J;  2VKV A;  2ZOZ A;  2DMQ A;  1IDZ A;  2LP0 A;  1T33 A;  4GFB A;  2E1O A;  2ECB A;  3A03 A;  1IGN A;  2K9N A;  1QVT A;  4NEL A;  2NVX J;  1OJL A;  2R0Q C;  3BTJ A;  2OI8 A;  5M5X J;  5E3M A;  2JN6 A;  4JL3 A;  3IH2 A;  2GUH A;  2L7F P;  2ME0 A;  1UG2 A;  2WB1 N;  3FK7 A;  3IH4 A;  4A3M J;  3GBG A;  4L5E A;  3ANP A;  2Y9Y A;  1LFU P;  1RPW A;  2GM4 A;  3F0C A;  5M5Y J;  5M5W J;  4JX5 A;  1W0T A;  4QIW N;  2EZI A;  1AKH B;  4GFL A;  2NS7 A;  4A3J J;  2R92 J;  3NAR A;  2K40 A;  4HNV A;  4FIS A;  1FIP A;  5F1J A;  2ZB9 A;  1EF4 A;  3NNR A;  2HQ5 A;  1NTC A;  2GEN A;  2Y2Z A;  5C3E J;  1W0U A;  1NK2 P;  4BY1 J;  2OF7 A;  2P81 A;  4DZP A;  2R5Y B;  4IHV A;  2LD5 A;  5C44 J;  4MXM A;  1WPK A;  3VVY A;  3JRF A;  3GTJ J;  2ID3 A;  1G2H A;  2B63 J;  2FQ4 A;  2ZCX A;  1QVU A;  2DA7 A;  2DA1 A;  1R9T J;  3S17 J;  5JLW A;  5HSZ A;  1VND A;  1FTT A;  1K83 J;  1Z77 A;  4A3C J;  1JGG A;  2ZCM A;  1IUF A;  3O8H A;  1T56 A;  5C4J J;  2M0C A;  3HE0 A;  4RDU A;  3PAS A;  5CXI A;  2XRL A;  1D5Y A;  2H8R A;  4I76 A;  2IBD A;  4FTH A;  4XIC A;  2HOS A;  1X2N A;  4CGR A;  3CQZ J;  2DG8 A;  2ECC A;  3BHQ A;  2X9D A;  2QIB A;  2D6Y A;  3NAU A;  1WCM J;  5DTD A;  2JA8 J;  1TWC J;  2EBI A;  4FCY A;  3QPL A;  5K7Z A;  2MGQ A;  1ETX A;  3LSR A;  3A02 A;  1BL0 A;  2JA5 J;  3VVX A;  5DAJ A;  2EZH A;  5FLV A;  2E2H J;  2XB5 A;  1SGM A;  1RKW A;  2XGE A;  9ANT A;  3LNQ A;  3WHB A;  3CDL A;  3CCY A;  1U8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...