4G12A

Crystal structure of putative tetr family transcriptional regulator, fad35r, from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
192
structure length
192
Chain Sequence
SDRRFQLLAAAERLFAERGFLAVRLEDIGAAAGVSGPAIYRHFPNKESLLVELLVGVSARLLAGARDVTTRSANLAAALDGLIEFHLDFALGEADLIRIQDRDLAHLPAVAERQVRKAQRQYVEVWVGVLRELNPGLAEADARLMAHAVFGLLNSTPHSMKAADSKPARTVRARAVLRAMTVAALSAADRCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable transcriptional regulatory protein (Probably TETR-F
publication title Crystal structure of putative TetR family transcriptional regulator, Fad35R, from Mycobacterium tuberculosis
rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 63
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4g12A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4g12A02
3QBMA 1JKRC 3B6AA 2HOTA 4DYQA 5JLWA 4NELA 2VKEA 3TP3A 2TRTA 3DPJA 4BBSJ 3KZ9A 3T6NA 4B1RA 1RKTA 3MVPA 1BW6A 3E7LA 3HKZN 4DZPA 5GPAA 2XDNA 3BR2A 1Q1VA 2ME0A 2JJ7A 5GP9A 1JKQC 1ETYA 3TW7A 5EGOB 2DA5A 1RPWA 2UXUA 2LTPA 5K7HA 2AO9A 2LFBA 3JRAA 4JL3A 5FKKA 4A3LJ 2CUFA 4I76A 2LVSA 3ZQCA 3VP5A 1ORKA 1QRYA 2COBA 2DJNA 3A02A 4Y52J 1OFCX 1AKHB 2TCTA 5C4YA 1JTYA 5K58A 3NXCA 2UXPA 3GTJJ 3ZQIA 4L62A 3HOUJ 5FKMA 1NK2P 3JR9A 1BJZA 3VW1A 3OSFA 1OJLA 2HI3A 4AYBN 1LE8B 2OERA 4UUSA 1D5YA 5J1YA 2WUIA 1WGXA 2HXIA 3NRGA 3S2HJ 3MKLA 3BTIA 1YRNB 4S0HB 2UXHA 2YU9J 2EZKA 3JRHA 3HDDA 2D6YA 2NVXJ 1ZK8A 1WH7A 1B72A 3I4NJ 1W0UA 2JK3A 3TP0A 3LSRA 2Y31A 4M3BA 3UKGA 3BNIA 2R7ZJ 4FCYA 1P7JA 1MBEA 5IPAA 1HLVA 1IV6A 1ETQA 3JSJA 2P81A 4X6AJ 1XC5A 2QIBA 3E7QA 4MO7A 4D7NA 5FKNA 4C2MJ 3GEUA 1XS9A 4CYCB 3DCFA 1UI6A 3S14J 3LOCA 3G56A 3NARA 2DA6A 2JA8J 2X48A 2W48A 2X6OA 2HYTA 1JUMA 3I4MJ 5FLVA 1HDPA 2FD5A 1DU0A 1JKPC 1MBHA 2VKVA 5EG0A 1PUFB 1JJ6C 5D18A 2DMNA 2HOAA 3HTIA 4RBOA 2YVHA 4W1UA 3ANPA 2IEKA 2XRLA 3ZOBA 4MFEA 2QKOA 5GPCA 2M0CA 3O60A 3K7AJ 4QIWN 2YUSA 3LSJA 2G7LA 3B81A 3VOKA 1AHDP 3NNRA 3HOWJ 2NP5A 3CQZJ 1T56A 3AQSA 2DMQA 2E2JJ 2ECCA 2AHQA 5M5XJ 3G1OA 4V2GA 3FIWA 5J1RA 2CJJA 3G7RA 2GM4A 1ETXA 2R5ZA 3PASA 3O8GA 1I3QJ 5IP7J 2XGDA 1MSFC 1JT6A 3NPIA 3HOZJ 5FMPA 3KNWA 1FIAA 5FJ8J 5DAJA 4AC6A 3A03A 3C2BA 2WGBA 3CJDA 2MW8A 5IP9J 2NVYJ 1SFOJ 1FTZA 1U8BA 1IG7A 4GFLA 3VVZA 3FK6A 2LKXA 2IU5A 2QOPA 2GENA 2ELKA 3W6VA 1DU6A 4A3GJ 1B8IA 2QWTA 2ME6A 1JUSA 2LP0A 2UXOA 2CRGA 5M3FJ 3FK7A 2NVTJ 3C07A 4YZEA 3WHBA 1TWHJ 1ZTRA 2HDDA 2HYJA 5D1RA 1Y1VJ 4XICA 4GCTA 3NI7A 4L5EA 1P7IA 1UHSA 5F0CA 2ZOYA 1GVDA 3F1BA 1SGMA 4NN1A 3H3VK 9ANTA 2JWTA 3IV5A 2DA7A 1S7EA 3BR1A 2LLKA 5DS9A 1ZR4A 2Y30A 4XRMA 3IH2A 3HBLA 3TEDA 5DTDA 3IUVA 5HBUA 3ON4A 2MSYA 3HB9A 5M5WJ 1UMQA 3IH4A 2PBXA 2F07A 1X2MA 2E2IJ 3HTHA 5FLMJ 3GTOJ 4W97A 3Q0VA 1NTCA 4DW6A 1TWFJ 3S16J 2NS8A 2EQRA 2DA4A 3S15J 4CGRA 1QVUA 1VFCA 4A3EJ 3RH2A 2WAQN 3LHQA 1Z0XA 1NK3P 3VW2A 1ETOA 1APLC 3MN2A 2L0KA 2H1KA 1Z77A 4A93J 5EYRA 4A3KJ 3WHCA 3JRIA 4RDUA 4IHWA 1JUPA 2CU7A 2JA7J 3PO2J 2G7GA 1ETWA 2HXOA 2EZLA 4GCKA 2G7SA 1U9OA 2R0QC 4UUSB 2XPWA 5M5YJ 4DYRA 3ON2A 4D7MA 2DG8A 1IDYA 3QKXA 1GV2A 1E3OC 3JRDA 3IH3A 4HNVA 1WI3A 1B72B 3ZQFA 5HODA 1IRZA 4FISA 5J1UA 3VVXA 3RD3A 2JA6J 2GBYA 1WH5A 2CQQA 3H0GJ 1TC3C 3HTJA 4UDSA 3LWJA 5F08A 2KDZA 3L1PA 2FJ1A 1ZQ3P 2UXIA 3GTKJ 1ETVA 1UG2A 3VPRA 3VUQA 2DA3A 1X2NA 5EZGA 3FRQA 2NX4A 3BRUA 4FE7A 2O8KA 5EFYA 3FISA 1UI5A 5HAWA 2K9SA 3PO3J 3HIMA 4B4CA 5BNGA 3Q0UA 3Q3SA 3S1RJ 3LJLA 4B3AA 4GFKA 3LSPA 4XRSA 4C3JJ 2E1OA 2V57A 5AQCA 4ABZA 1AU7A 3LNQA 2WB1N 5EG0B 3O8HA 3ANGA 1ITYA 2Y9YA 5IYBJ 2FQ4A 4IHXA 1FEXA 5FKOA 1H88C 4UUTA 4QSHA 3BR3A 2EBIA 1QPIA 2L7FP 2L7ZA 2IAIA 4MLOA 3NAUA 1TWCJ 2XGEA 4BY1J 4EEFG 1MH4A 4ME9A 3OIOA 1MNMC 1IUFA 2YVEA 1IGNA 2VPRA 5F0HA 2ZCNA 3JRGA 2DG7A 3PM1A 2MG4A 1JKOC 5CXGA 2X9DA 1BW5A 3V78A 4DYCA 1MBJA 3JRFA 2R5ZB 3BT9A 4XIDA 5E3NA 2QTQA 2R5YB 5M3MJ 3BTJA 2Y0SN 1T33A 1ETKA 1FTTA 4FTHA 3A01A 2GLOA 1MBKA 4JX4A 2E19A 2RASA 4PXIA 1MH3A 4A3MJ 1HOMA 2M8GX 3BQYA 2G0EA 3V6GA 5F1JA 4A3DJ 2JA5J 5IOYA 3BTCA 2YS9A 3DEWA 1OCPA 4JP0A 1IJWC 5E3MA 3B6CA 3COLA 4MK6A 3CWRA 4D5FA 3VIBA 3S1NJ 3SFIA 2K9QA 1B8IB 2MGQA 3HOYJ 2ZOZA 1RESA 1EF4A 3FKIJ 4BXXJ 2LR8A 3GTPJ 2M34A 4C3IJ 4MIMA 3SJMA 1VF9A 2DA2A 3OOUA 2EZHA 1GT0C 2NVQJ 3BR6A 4BY7J 4NDLA 3G1LA 3ZQLA 1K83J 5E3OA 3QPLA 1JTXA 2XB5A 4IEJA 4I6ZA 2REKA 4M3FA 3G1MA 2LK2A 2CUEA 5F04A 3RZOJ 1MSEC 1H89C 3M4OJ 2M2EA 3SDGA 1H8AC 2B63J 1ZKGA 1GDTA 2RHAA 1BL0A 5IYDJ 2NP3A 2O9LA 2PZ9A 4ICHA 2E2HJ 3K2AA 2Q24A 1ENHA 5C44J 3EGQA 5FGLA 3HTAA 2L7MP 5K7FA 4GCLA 2XGCA 3GTMJ 1X58A 4G12A 1HF0A 1IDZA 3P9TA 2I10A 1VNDA 2JN6A 4DZJA 1ZGWA 1I6HJ 4ACIA 1WPKA 3CRJA 1VI0A 1ZR2A 3CDLA 2O7OA 5EGOA 1A5JA 3QQAA 2QF7A 2M9HA 2EZIA 3BR0A 2VI6A 5JLXA 3TW6A 4XRSG 2LY9A 2JMWA 3HOXJ 3RKQA 3VVYA 5EDNA 3Q0WA 2R93J 4MXMA 2NOGA 2ID3A 3BG3A 2D5VA 3S17J 2KT0A 5H9TA 3BG9A 2OI8A 4BBRJ 1LFBA 2RAEA 3BQZA 1OCTC 1GV5A 2ZB9A 5FHPA 3S1QJ 1AKHA 5CXIA 2IBDA 2CQXA 4A3CJ 3BG5A 3JREA 4A3BJ 1LFUP 2N8GA 1JGGA 2QCOA 3HEFA 2DMUA 5EZHA 1LE8A 2ZCXA 4V2FA 4JYKA 3CCYA 3KKDA 2GUHA 1F36A 2DN0A 1FJLA 2DA1A 5IYCJ 4M6VA 3KKCA 1YRNA 4BKXA 5D19A 2EH3A 2XB0X 1F43A 2XPUA 5E3LA 2K40A 1WCMJ 4A3IJ 1XG1A 3OSGA 1SANA 3BCGA 1O4XA 5C4JJ 3HGGA 3EUPA 2XPVA 3QPSA 1TWGJ 4M3EA 2R92J 2ZCMA 3BHQA 3GTLJ 4A3FJ 1Y1WJ 3GTGJ 3BTLA 4X1EA 3GZIA 4LOCA 4CYCA 2DTZA 4A3JJ 1CQTA 5C4XJ 2ECBA 2OF7A 4QTRA 1BA5A 4AF5A 2XSDC 3GTQJ 4JNNA 1TWAJ 4HKUA 2Y2ZA 2DMPA 4M3GA 4A69C 1GUUA 4XK4A 5F27A 3M3YJ 3VW0A 3S2DJ 3HOVJ 1U78A 5CW8A 1IC8A 1A6IA 4J19A 4FE4A 1PUFA 5FKLA 5EEAA 1JJ8C 2DMTA 3AQTA 1HDDC 2NS7A 3GBGA 2OPTA 2HKUA 3BJBA 1RR7A 1I50J 4IHYA 1G2HA 5EF6A 4JX6A 3RQIA 3CMYA 3S5RA 4M3DA 5C3EJ 5IOZA 4C3HJ 1RETA 3RZDJ 3A01B 2K9NA 2H8RA 3MNLA 3VOXA 3HGYA 1POGA 2WV1A 1JT0A 2GFNA 3BR5A 4IHVA 1RKWA 2R5YA 3JRCA 3LSGA 5F0FA 2HQ5A 3ZQHA 1MBGA 5K7ZA 2L9RA 4JKZA 2FBQA 2ID6A 3F0CA 3PPBA 3HM5A 3HE0A 4AC0A 5HSZA 4JX5A 4Y7NJ 2VUMJ 4AUXA 4KWAA 3JRBA 1U9NA 5J3LA 4MFDA 2LD5A 5IP6A 2Y9ZA 1QVTA 1R9TJ 1HCRA 2W53A 1FIPA 1MBFA 4GFBA 2PMZN 4D5CA 2FX0A 2HOSA 3ZQGA 1K61A 3D1NI 3S1MJ 2G3BA 1W0TA 2O7TA
chains in the Genus database with same CATH superfamily
1YOVB 3QBMA 3U2RA 3GX4X 1U5TB 3B6AA 2HOTA 4DYQA 5JLWA 3FXQA 2PJRA 3K6GA 2VKEA 3TP3A 5L3BA 2RREA 2HKXA 2TRTA 2VJIA 5EEHA 4XLNF 3DPJA 3T6NA 3MVPA 2H6CA 3HKZN 4DZPA 1NH3A 5AONA 5GPAA 4CCMA 2R7WA 4P5OA 2KL4A 2IP2A 2ME0A 1YX5A 5J47A 3S3MA 4PFOA 1ETYA 5EGOB 1NG6A 2LYCA 1RPWA 2XAGA 4XORA 3WE2A 2LFBA 2MLKA 1XGOA 2BXZA 2K5CA 2VXZA 4I76A 3KP2A 2CV1A 3ZQCA 3V7CA 4HDUA 2DW4A 4Y52J 2YPRA 1OFCX 5LRSA 1JTYA 3HOSA 3NXCA 2LC2A 3ZRGA 3GTJJ 4ITVA 4L62A 5FKMA 1KA8A 2E34A 2O6GE 3VW1A 1BJZA 2HI3A 2OERA 1QZZA 1T8IA 2PEXA 5LFAA 3N97A 5J1YA 2KZGA 1BI2A 4RM2A 5JFRA 1KU3A 3F8NA 3OYAA 2YU9J 2BY1A 3HDDA 4BHBA 2D6YA 1ZK8A 1WH7A 1B72A 4P9UA 5CQGA 3RDIA 3TP0A 1LNWA 3LQRA 2Y31A 4D1QA 3LSRA 2VLAA 2E60A 2OBPA 1IV6A 3QRFF 1DGRM 2DPUA 3H9JA 4CCOA 2ZNYA 2HNHA 4X6AJ 1YITI 2BHZA 2VE8A 5FKNA 2LBFB 4CH7A 2X85A 5HS9A 2VBYA 4PK4A 3S14J 4GRIA 3WTWC 2EIMH 5GAHJ 1SMTA 2DA6A 2W48A 2VT2A 3GZNB 5FO5A 2KKOA 2HYTA 4CA0A 1JUMA 2ICWG 2RKHA 4XNFA 1VZ0A 2JSPA 3TO6A 3HPHA 1HDPA 3P7NA 1YIJI 2VKVA 5LHIA 2DMNA 2YVHA 2H8WA 2XRLA 1E17A 1DPRA 1D1AA 2BVLA 1J59A 3GCMA 2HTJA 2G7LA 2Y0SA 2IPQX 2A61A 1HKQA 4KICA 2G7UA 1FX7A 4HBLA 3CQZJ 2NP5A 2DMQA 2VBZA 2AHQA 5M5XJ 5E8IA 4RM3A 1IXSB 1ETXA 1TQMA 3FXLA 2R5ZA 1K4TA 1MSFC 2DLLA 2F5DA 3GVAA 4ESFA 4WWCA 4LFUA 1LPQA 5BMZA 1F1ZA 3MAJA 1FBQA 2OZUA 1FIAA 4ZTJA 1R49A 3LFUA 1P6RA 2ZXJA 2XROA 5E8GA 1KYWA 4U9NA 4KJZA 2Q2EA 1FTZA 1ZN2A 1FBSA 2A07F 1ZGJA 3VVZA 3P9CA 2CV2A 2LRDA 1SD6A 3WGIA 1K78B 3FK6A 2QOPA 2KRFA 3K4LA 4FASD 2ELKA 2LF7A 4HX4A 4XRFA 1BOBA 2ME6A 1STZA 3IKTA 5M3FJ 2UXOA 3FK7A 2L5QA 3WHBA 2BZTA 1D8JA 4O5VA 4GCTA 4P9FA 3NI7A 1LDJA 2OCEA 5KHDA 2W00A 4L5EA 2DDBA 9ANTA 1S7EA 2X6WA 4AVZA 2A68F 5LRRA 1BN5A 1WJFA 3HKZA 3OYLA 2QUFA 3FWEA 1X4PA 3TEDA 3H92A 2KP6A 3W6KB 3HB9A 3ON4A 2MD5A 2B7EA 4PFPA 2ZJ2A 3HSFA 4AIKA 1VQ4I 1XGMA 4G94A 5GAEJ 2E2IJ 3GTOJ 3BZCA 2GXGA 1NTCA 3DTEA 4IZZA 3S16J 4EATA 2NS8A 3M7GA 4KA4A 3S15J 4UHTA 1VFCA 4OMZA 3EUHC 3VW2A 1ETOA 2H1LA 1APLC 2KRHA 4DJAA 5EYRA 3WHCA 2VONA 3BPVA 3JRIA 1EKEA 3QU6A 1A04A 1LDDA 3K1NA 2JRMA 3PO2J 4A12A 2X6XA 1ETWA 1PVEA 2EZLA 1BR2A 3ZMDA 3OYGA 4GCKA 1V4RA 4PJLA 2EV0A 3I64A 3KLOA 3ZMSA 2R0QC 4UUSB 5M5YJ 1YO5C 2DG8A 2XRNA 4IRHA 1GV2A 1E3OC 4BQNA 4HNVA 2KLOA 3X2QH 4ENKA 1SD4A 1IRZA 4M71A 5BOXA 3CJQB 1B9NA 4A0YA 3RD3A 2BYVE 2GBYA 1WH5A 2JA2A 2CQQA 5A2QZ 2EFWA 3H0GJ 2VASA 5KK1A 2H27A 3PSIA 2J5OA 1FOYA 4GGGA 4BXUA 5AIQA 3GTKJ 2RDPA 3RKXA 2L9VA 5EZGA 2PMHA 5E17F 3BRUA 1BIBA 4FE7A 2V9PA 4XKVA 3IWZA 3AFHA 2I8DA 3HIMA 3Q3SA 1PP8F 4UUVA 3LSPA 5J8FA 3PJRA 4C3JJ 2O5RA 2OCCH 5AQCA 3DU6A 2MC3A 4IQ4A 3ESWB 3FM3A 3CF2A 2ZMEC 3GWZA 4LG3A 3PFIA 3ANGA 4IHXA 1R58A 4L9VA 2HPIA 3F8FA 2F4IA 3BR3A 1GLNA 4M73A 1QPIA 1XX5A 2L7FP 3PQJA 1TWCJ 4EEFG 3UR3C 2YX7A 3L2CA 1Z21A 5L3GA 2YVEA 4IQJA 2M4GA 2DYSH 2VPRA 3IAM2 1BI1A 4RAZA 3PM1A 1R5GA 2UV1A 4IOCF 1BW5A 5ICCA 4II3A 3G3ZA 1MBJA 3JRFA 2JTVA 3BT9A 5DCMA 2MC4A 4XIDA 2R5YB 1T33A 4FTHA 3A01A 1C0WA 1FZPB 2E19A 2RASA 2PJPA 2M8GX 3V6GA 3K70C 4A3DJ 5HS8A 2YS9A 1XSDA 4QLCU 2VQGA 4D5FA 5JHFA 3CJRB 4Y15A 2PMZA 2MGQA 1MMAA 1EF4A 2FOWA 4U88A 3G4SI 1VF9A 2P6TA 3FXKA 1IN6A 2NVUB 4B3XA 2HZTA 1J7KA 2NS0A 5DM6F 1WWXA 3OYHA 3CCEI 3IAS2 4M6YA 2HOEA 1ZLJA 3EYYA 4IEJA 5LGNA 2REKA 4M3FA 3QPTA 3KEQA 2BY2A 2CUEA 3D5SC 3AG1H 2ZMEB 2W82A 3H9GA 3SDGA 3DXJF 3ZQQA 3SWHA 3HHHA 3CP8A 3OYMA 2DT6A 5JVTA 2PZ9A 2K86A 4BE0A 3K4MA 3QP6A 4E7LA 3E0JB 5TGTA 4G6QA 1ZLKA 3W6JB 3ZXSA 5BPDA 3F3XA 1IN5A 2L7MP 3AG4H 4L5IA 5D5XB 3S3NA 1UG0A 1HF0A 3CUQC 4Z2YA 3CCJI 1VNDA 2VT3A 4DZJA 1QNTA 1R1UA 3CRJA 3J81Z 1B1BA 2A3SA 2O7OA 3L2RA 4HQMA 2DQLA 3QPHA 1P2FA 5KAIC 2EZIA 1GVJA 2P7VB 5LGTA 2JMWA 5FROA 3QYEA 3RKQA 4OIRF 4FX4A 1VQMI 2KIFA 4YFNF 3ABLH 2Z9OA 2NOGA 2D5VA 4EM1A 2XV4S 3ERMA 3HL2A 2RAEA 3IRQA 1GV5A 3ZQ7A 2IBDA 4UB6C 3V7RA 1OYIA 2M7BA 2NNYA 2M87A 3BG5A 1YIOA 1T2KA 1LFUP 4ESBA 2QCOA 2XSJC 4KISA 2EK5A 3TGNA 2ZCXA 3KETA 1T08B 4NB5A 3KKDA 2Q0OA 2DN0A 2DA1A 5IYCJ 1YRNA 4BNCA 1H9TA 2EH3A 1N78A 2V1DA 1EH6A 3MZ8A 1WCMJ 1R36A 1DDNA 1BR1A 3HHGA 3OSGA 1FYLA 1QBJA 1FLIA 2HQAA 3D0SA 2FMYA 3LWFA 3Q9SA 3SEZA 1O4XA 3HGGA 4EV0A 3EUPA 2JVGA 1E3PA 2R92J 3CD6I 2MYSA 4BEHB 1ACIA 4BJTA 3KP6A 3WTSC 4A3FJ 1IN4A 2A5WA 1MGTA 4E70A 3GTGJ 1BM9A 1KU9A 3WTTC 3H3ZA 4E7SA 2BGCA 4X1EA 4MEYF 1YQAA 3H0DA 5C4XJ 1H9GA 1S9HA 2O03A 4XL9A 2XSDC 3WE3A 3CUQA 3OV8A 4IHSA 3K4NA 2O3FA 1Y8RB 2DMPA 5F27A 3M3YJ 1MNEA 1T6SA 2L3DA 1FSHA 3SQNA 3KFWX 2CWEA 1IC8A 1A6IA 5HDNA 2OC6A 1PUFA 3CZ6A 4Q5SF 1WZ2A 5EEAA 2IA1A 2XAQA 2CW8A 3CO7C 3AQTA 2XKOA 3AAFA 4QWQA 2HR3A 2NS7A 2R7SA 2WY7Q 2DQRA 3ABMH 2MH9A 3H9QA 3OIPA 1TZLA 2HKUA 3CLOA 1RR7A 1I50J 2E7WA 4KIGA 3O2PE 1PP7U 1SD5A 1XB4A 1WJEA 5IOZA 2HVSA 2R7DA 4BS9A 4IL6C 4IXAA 1TNSA 2LKPA 5FD6A 2R7OA 4A2UA 2VOOA 2EPFA 2CFXA 2F5VA 3E5XA 3FZVA 3LSHA 4HSRA 3U9GA 5DYMA 3CCUI 3HGYA 4L9NA 1Z9CA 2WTEA 1I6XA 1JT0A 3BR5A 1RKWA 3S2WA 3OYIA 3LSGA 2HQ5A 4YIIA 1EV7A 2VKHA 3ZQHA 4A6EA 5TISC 3J80K 3M8JA 3ZN1A 3VODA 2H09A 2EFNA 3ZGKA 3SDBA 3GUDA 3KLNA 4C2TA 2NYXA 4L0ZB 2ZFWA 2WWYA 4EGZA 2L02A 3HE0A 1BC8C 2L4MA 2W85A 4L9JA 4KWAA 3JRBA 5B1BH 3ZN0A 1YJWI 1N77A 1QVTA 1HCRA 2P5LC 1FIPA 1MBFA 5TRDA 4GFBA 2QENA 4GYIA 4D5CA 3DEUA 4LLGF 3I54A 2CV0A 1K61A 3S1MJ 2V79A 3FXUA 2VODA 5LGUA 5HS7A 4KIFA 5F6FA 2DOEA 3QU3A 2ZSHB 4OD4A 2CW0F 1MDMA 1QZYA 2IS2A 4BBSJ 3KZ9A 2EB7A 3QOPA 4B1RA 1RKTA 4ZDLA 1BW6A 2XASA 3OYEA 2RV8A 2DAOA 1W7PB 4BE2A 1D3YA 2M3AA 3HRSA 4CO8A 1Q1VA 3DQVC 1JKQC 1Z3YA 2GOXB 1IRGA 4K2EA 3H5RA 1SMYF 2LTPA 4RGSA 3RSNA 1JE8A 2AS5F 4BU2A 5K7HA 2AO9A 2BY3A 2KRCA 4HDVA 1R4NB 5L3CA 3LSMA 4JL3A 2KISA 1MMDA 2CUFA 1S5LC 2UZKA 5L3DA 3VP5A 2KFDA 1ORKA 2Y69H 3R4KA 3SXYA 1QRYA 1XMKA 2DJNA 2VBXA 4M9XA 2OQGA 4RGRA 4EMSA 4FHTA 1AKHB 5CVJA 3K0LA 2TCTA 1IV8A 5C4YA 1SVMA 3T8RA 5K58A 3BY6A 1RIOH 4U7DA 4LLNA 1SFUA 2DODA 3HOUJ 3IL2A 3A0BC 3JR9A 4AYBN 3CUOA 2PBIA 1WGXA 4RGUA 3MKLA 3ASOH 2EZKA 3CMAI 3EYIA 4NUBA 2ZY9A 3I4NJ 4HX8A 3L2VA 4HV5A 4M3BA 1CF7A 3UKGA 3BNIA 2IS4A 1IRXA 5IPAA 1BOAA 1ETQA 1QPMA 3LA2A 3ELKA 1TW2A 4JQFA 2BY0A 1X3WB 2HDCA 3JSOA 2CH0A 2WB1A 3VTIA 4A5NA 5D5VB 3G56A 2AXTC 1X1AA 4HEA2 4IF4A 4Z6YA 2LMDA 2JA8J 2X48A 1Y8QB 1IW7F 1JHFA 5FB2A 4FETA 1LEAA 1UHMA 3I4MJ 1USTA 2PQ8A 2FD5A 1DU0A 1J9IA 1MBHA 5D18A 3K1MA 5EG0A 2HYFA 4UVAA 3HTIA 4YEJA 1X4OA 4W1UA 2IEKA 3ZOBA 2NRAC 1MMSA 4UNOA 3V8KA 5D8KB 2QKOA 2M0CA 3IKVA 3K7AJ 1XPXA 2KJCA 4BAYA 1FMWA 2Z16A 4DBRA 4XKCA 3HOWJ 3NWSA 3L7WA 2L7KA 3DPTA 1I27A 1T56A 3G1OA 3DWLE 1OLTA 3CCVI 4U0WA 2GM4A 4BJ6C 4PJ0C 3O8GA 3K1PA 1LDKB 1WRJA 3E5QA 3KNWA 3LMMA 3SYTA 1Z3XA 1FC3A 3HOTA 1LUJB 1MMNA 5IP9J 4A5MA 4GFLA 1TQPA 3CESA 1ZARA 3OYNA 1MD0A 1HSTA 2LKXA 3V42A 2IU5A 2JUGA 1DU6A 3ABUA 2QWTA 1B8IA 4I09A 1JUSA 1QHGA 1ODDA 2BHYA 2CRGA 2P4WA 4HOBA 4ZC3A 3C07A 3PIOF 2ZJRF 1TWHJ 2ZJQF 4XKBA 2HDDA 2HYJA 4LIUA 1TL8A 3ZMZA 1IXRC 2YU3A 2A2FX 3LQQA 2QGUA 3F22A 4KN4X 1Z7LA 4UXNA 4XBFA 1QHHD 1FMVA 3L9FA 4G6TB 2FE3A 3GMEA 4CZZA 4XSZF 2W57A 3BR1A 2M4KA 3RJPA 1V5GA 5E1XA 2OD5A 5JI6A 4XRMA 3WU2C 5M5WJ 4KDPA 1U5TA 2GWRA 2PMUA 1X2MA 4ZH4F 3HTHA 2FOKA 5FLMJ 4WIBA 3Q0VA 5L3EA 3BCAA 3HZJA 2EQRA 1KQ8A 2QBYA 1G3TA 2BOLA 2GA1A 1QVUA 2M1BA 3KP7A 4A3EJ 2WAQN 3EETA 1MZBA 3MMYB 4XSXF 5DCFA 1DP3A 3MN2A 2L0KA 1WSUA 2H1KA 1EH7A 3KP4A 2AQFA 4A3KJ 1PJRA 3WTUC 4RDUA 4U87A 3TOBA 3O3KA 5J4YA 5LHHA 1YTYA 4CHUA 1VQ8I 4XOTA 2O8XA 3JCUC 1KONA 3FX3A 1WVRA 2A6TA 1LQ1A 3BROA 1HXDA 4DYRA 1QZEA 5JR3A 5ERIA 2EIKH 4D7MA 3CCRI 3RTRA 3QKXA 1XD7A 3IH3A 2GIZA 3Q9VA 4MQVA 1B72B 3IWFA 4C2MA 5HODA 3VVXA 4KMUX 1LEBA 2QM3A 5GTHC 1RI7A 3DU5A 2M0MA 3PSFA 3VYSB 5A2QK 4CGZA 3HTJA 3LWJA 5F08A 4KYWA 3TO9A 1X19A 5FFZA 2FJ1A 3D5LA 2EILH 3C2HA 1ETVA 3MD2A 3VPRA 3VUQA 2DA3A 1D0XA 1RNLA 1V55H 2R7FA 3AL0C 1EA3A 2CGPA 2G7HA 3PO3J 2NXNB 4B09A 3KE2A 3U1KA 3CCQI 4B4CA 3Q0UA 1I39A 2OA4A 2F5FA 4CUGA 3REOA 4IJAA 2E1OA 3ZP5A 1G3YA 2COMA 4ABZA 2HZDA 4YG2F 4EVIA 1J09A 5KAFC 2ZFUA 2L7ZA 1ZH5A 4MLOA 4RB0A 1WHUA 2XGEA 1MH4A 4KFCA 2Z99A 1IUFA 5F0HA 2P5KA 1A35A 5D4SA 3JRGA 2DG7A 4QPQA 2ZCNA 1YYVA 1Y0UA 3LAPA 4C2UA 5CXGA 3I9V2 2VPLA 3M1EA 2HEOA 4B8XA 2R5ZB 2CS3A 4UVBA 4IOAF 5E3NA 1J5YA 2FBIA 3RKWA 2OUMA 4DOZA 2LF8A 3TBIA 2ADUA 4XONA 5CYVA 5L3FA 2WAEA 3MCZA 2DXIA 1RR8C 4PXIA 1MH3A 1BJAA 2E1NA 3BQYA 3W2VA 4CZCA 1Z1DA 4OAYA 3TKYA 2Q2EB 3V8JA 3DEWA 4JP0A 1IJWC 1ZREA 5E3MA 4KIBA 3NWTA 1REPC 3CWRA 1R5ID 4B47A 3S1NJ 3SFIA 2L2OA 2IGOA 3ECHA 2XAHA 1RESA 3MZYA 3FKIJ 3JAMZ 2HQNA 5H2FC 4C3IJ 2DA2A 1GT0C 4BY7J 4N4NB 5HLHA 2FUG2 3BLYA 3QPLA 1JTXA 2XB5A 2BVMA 2DFHA 1E2XA 3G1MA 2LK2A 4P96A 5KNLA 2EINH 1SVLA 4HA8A 1MSEC 4DGWB 1VQNI 1H89C 3M4OJ 1D5VA 1H8AC 1I3AA 4M6XA 1NHAA 2EIJH 3FMRA 2CSOA 4XM3A 1ZRDA 3FXOA 1BIAA 2IXSA 2HWVA 1YFHA 2Q24A 1MJBA 4KUMA 2B1EA 4CSWA 2L01A 1I1SA 3EGQA 5FGLA 4RB2C 3HTAA 1KQ9A 1ZRFA 3CDHA 5K7FA 2VQHA 1G59A 4G12A 1G3WA 1W5TA 2WAQA 1B6AA 1ZGWA 1I6HJ 1O3SA 3L2UA 1R7JA 3J81K 3AKZA 1OR7C 3KP5A 4E7IA 3VVYA 5EDNA 4MXMA 2YX4A 4AIJA 2KMUA 1LVAA 4OMYA 1MKMA 2ID3A 3BG3A 3RI4A 2KT0A 3VYRB 3K69A 5H9TA 3BG9A 1OCTC 2R7XA 3HRUA 3S1QJ 2CQXA 5JHUA 3I0TA 3ABKH 4BQQA 4A3CJ 3FHNA 1VQKI 1YLFA 2Q1ZB 2MA3A 1SVOA 2VN2A 4XLCA 5EZHA 1LE8A 4JYKA 5DDGA 1OCOH 1G3SA 3KKCA 4M6VA 5D6EA 1HKSA 2PFVA 3M9AA 2XPUA 1U0JA 1X3UA 2ZO4A 5E3LA 2K40A 4CCJA 1F43A 1QU3A 1XG1A 3LA7A 1U6GA 4OINF 4E6KG 1KZHA 2X0LA 1IF1A 1TWGJ 2ZCMA 2DOAA 4PGHA 2QQBA 4PUSA 3BDDA 2LG4A 3BTLA 4UY8I 2M30A 2OTLI 3OS2A 1RZ4A 2Z1DA 3GLXA 4CYCA 2DTZA 2VE9A 2OF7A 1S3JA 4KNYA 3GTQJ 1R1VA 1Z67A 2CYYA 3P9IA 2Y2ZA 4Q4ZF 4HF1A 1WJCA 4M3GA 4A69C 4YIRX 1H0MA 3E5UA 3VW0A 2H94A 4IHTA 5LBQA 4A6DA 4XLHA 1OR7A 4AU7A 1HKTA 3ML6A 4OAZA 3PL8A 1JJ8C 2R7TA 1UJ8A 1BI0A 2Y75A 1HDDC 1V3FA 2VXDA 3G2BA 2OPTA 4CCLA 3OYKA 2X1DA 2X1EA 1G2HA 3DBLB 3RQIA 4GYGA 3CMYA 3GFMA 5C3EJ 4C3HJ 5DCMB 3CC7I 1JXSA 3FBIB 3HRMA 3RZDJ 5CVRA 2W1OA 1Y0NA 5ICFA 3A01B 5E79C 2DFIA 3G73A 1O7LA 5E1ZB 3ZCOA 1XDSA 1BC7C 2ZJPF 4LG0A 2PN6A 4ZYAA 2ETHA 4HAMA 4IHVA 2DPDA 2R5YA 5IY5H 5F0FA 1YW8A 4LMYA 3SZGA 4LB6B 4WCGA 3HTSB 1Y56A 3CCMI 1MBGA 5K7ZA 2E1CA 1AOYA 1EH8A 2HVQA 1X3ZB 2CMPA 4ZTFA 2P5VA 1YHQI 2DFFA 2P7CB 5DD8A 4YRVA 3T5XA 1RRJA 4F92B 1U9NA 1SAXA 1ONVA 2HQRA 2Y9ZA 4HX7A 1FP2A 3IRRA 1D0YA 2HOSA 3DPLC 3D1NI 2G3BA 3SZPA 1W0TA 2V6EA 2O7TA 2ZNZA 4NNJA 4HRIA 4C9YA 1JKRC 1ZG1A 4NELA 1OYYA 2GIVA 2QZ8A 4AIDA 5FLXZ 1VQLI 3CCSI 3CJNA 3L09A 4ETSA 2K9LA 3MQ0A 4BQAA 2OU2A 4XLAA 2XAUA 3BR2A 2RGVA 2IGNA 2JJ7A 1R00A 3DLAA 5GP9A 2LY2A 3V7SA 3TW7A 1ZRCA 2DA5A 2K27A 3COAC 3QYFA 4G6DA 2MLGA 4JBAA 3JRAA 2F5EA 2X4HA 5IT9Z 5BQTA 4A3LJ 4XR6A 2LVSA 5D5UB 2M45A 4H4KC 3RQ4A 2UXXA 3OMYA 2DOFA 2XIGA 3KEOA 2RC4A 4OIPF 2KJBA 2UXPA 3ZQIA 4M72A 4G7OF 1NK2P 5E20A 3P5JA 4I7HA 4BE1A 3C2GA 4XLFA 1D5YA 2WUIA 4XLEA 2F6CA 2HXIA 5B66C 3NRGA 3S2HJ 3RKYA 3BTIA 5LHGA 1YRNB 4S0HB 2UXHA 2DYRH 4D9JA 5ILVA 1MJAA 2NVXJ 2FA5A 3JSPA 1K79A 1K6YA 2FJI1 1FOWA 2JK3A 3M8FA 5ICGA 1I5ZA 1P7JA 1MBEA 1R71A 2LOOA 3TDUC 1AWCA 3JSJA 4I99C 3MZHA 4S04A 2HKOA 2QIBA 3E7QA 2CUZA 4D7NA 3DPUA 3DCFA 1S8NA 4G9YA 2GXBA 2CQ7A 2K4JA 3CUQB 3E1SA 1L0OC 1YW9A 1OKRA 2X6OA 3DEEA 3S93A 3MKZA 1Z6RA 2DK8A 2XF6A 4B44A 2PI0A 4RS8A 2EFOA 5GTIC 5H20A 5FLVA 2W24A 3H1CA 1JKPC 3FKJA 4IVNA 3BWGA 1PUFB 1JJ6C 2FQ3A 1SAUA 3HUGA 4B43A 2ESHA 3W2AA 3T8TA 3ANPA 4I2OA 3KPHA 2R3SA 3RYPA 4LK1F 1SEUA 4Y13A 2P8TA 4HPQA 4QIWN 2YUSA 4KMFA 3R61A 1WKMA 1G4DA 3KZYA 3AQSA 1R5HA 4I02A 2ECCA 4XOPA 3VOEA 1E3HA 3FIWA 5H6QA 2FRHA 2VJ4A 4LJZF 3G7RA 4PJMA 1BBYA 4KN7X 4PJNA 4N0BA 3CC4I 1VQPI 1U2WA 1I3QJ 4RAGA 2XGDA 5IP7J 2TDXA 5FMPA 2RVCA 3WG7H 1JHHA 2VJJA 3F72A 3I58A 3E6BA 4R8HA 3I56I 3A03A 2V9VA 2WGBA 3CJDA 2MW8A 1D0ZA 5FD5A 1SFOJ 3MEXA 3H35A 3BG7A 3F9KA 2QQAA 4PJJA 4RAFA 2FU4A 3W6VA 1R23A 1K7AA 2LP0A 5TJJA 2ESNA 2XHKA 3J7AY 4YZEA 4JOMA 3F23A 3GFIA 1ZTRA 1B59A 2DJIA 1Y1VJ 4NC7A 3L00A 3HC7A 1RC9A 2VJ5A 1VQ9I 2IT0A 1P7IA 4L5JA 2QYOA 5F0CA 3F1BA 5LEKA 1SGMA 4IRVA 2DA7A 2OAZA 4Q47A 4AVPA 1MDMB 2CQKA 3DV8A 5DS9A 3V4GA 1TNTA 3U21A 3IP4B 2OTJI 3HBLA 1DUXC 3IUVA 5DTDA 3ISPA 5HBUA 1BI3A 4H0EA 2Q8KA 1DP7P 3KCCA 2QSFX 1F4KA 1OMIA 3DKWA 1T95A 3HRTA 1TWFJ 1YE9A 5GADJ 4BHCA 4CGRA 4AM3A 3RH2A 3OWTA 3I59A 3T0YA 3S32A 3HSRA 2BEOA 2JT1A 3W2WA 1Z77A 4A93J 3VYTB 1JUPA 2JA7J 4G7HF 1VQ7I 1TP4A 2DCEA 3TQNA 2G7GA 2FBKA 2HXOA 4ZYGA 3MKWB 5HLIA 2G7SA 4J00A 1UELB 2B0LA 4O6JA 3ON2A 3F6VA 1HBXG 3I3LA 4YFKF 1IDYA 3JRDA 1U8RA 1WJBA 1WFXA 3CDIA 4RGXA 1P4XA 3ZQFA 4FISA 2E7XA 1CF7B 2JA6J 3E3VA 2DT7B 3U1DA 4NQWA 1TC3C 2GQQA 4E7HA 4J01A 4UDSA 5B3SH 2KDZA 4XKWA 5J4VA 4ZYDA 3L1PA 4II2A 3CO6C 4ENMA 2UXIA 4HG2A 3GZ6A 1UG2A 2OZ6A 3C3WA 2R7QA 3F21A 1X2NA 2NX4A 2O8KA 1HW2A 2GA2A 2JPCA 5EFYA 3FISA 1WJDA 1UI5A 3EPZA 3JTHA 4JK1X 4WK8F 5BNGA 3LJLA 3S1RJ 4B3AA 2GZWA 4GFKA 3E6CC 3UNGC 2V57A 1W5SA 2DFEA 3ULQB 1VQ5I 4BGDA 4ZZLA 5EG0B 1MNDA 4E7KA 3O8HA 3GXOA 5EJCA 4RMNA 4HLXA 5IYBJ 2FQ4A 1FEXA 3R0AA 2PFBA 5CPRB 5FKOA 1OPCA 4UUTA 4L0YB 3RCOA 2BV6A 2I5UA 2HGCA 1I1GA 1QO0D 2LY1A 1O3TA 1N25A 3NAUA 1U5TC 4BY1J 3H3UA 3KIOA 4ON0A 4ME9A 1BR4A 1KU7A 1IGNA 5AIPA 4NC8A 1PYVA 5HNHA 1UFMA 1IAWA 2X9DA 3V78A 5ED4A 2FXAA 4GDFA 1T39A 3EUKL 2QTQA 1UCRA 4PGGA 4HSTA 3BTJA 3N4MA 2Y0SN 3GEZA 1XMAA 1O7FA 4QPOA 2GLOA 1MBKA 3WGGA 1OCRH 1HOMA 4A3MJ 4KITB 3J7YJ 3M8EA 2JA5J 5IOYA 2GXAA 3FF5A 3COLA 3MKYB 4MK6A 3B6CA 2DI3A 5HDGA 2L9NA 1XMXA 4LB5A 1ON2A 4I0BA 1D1BA 4F7ZA 3GO5A 1R6RA 2EA2A 2WC2A 3OIQA 1B8IB 3HOYJ 4DVYP 2AXLA 3ONQA 2ZOZA 2RNJA 3KP3A 3PQKA 2RN7A 4CCNA 2XC7A 1T0FA 2KIQA 2LR8A 3JAMK 4BXXJ 4OD5A 2CUJA 2M34A 3OR1C 4BACA 2NVQJ 2VBWA 2E71A 3OOUA 1VQ6I 2YVXA 2BW3A 4NDLA 2R7UA 4GO1A 2YSRA 3CTAA 2K9MA 3NQOA 3I55I 1QA6A 1B4AA 2PJRB 5HVQC 4LITA 4RLFA 3MWMA 1W4MA 1KYZA 1LKXA 3BJ6A 2RHAA 2UUZA 4KT5C 2PG4A 1OCCH 2VL8A 4BYYA 1BL0A 2O9LA 1IUYA 2NP3A 1QGPA 5HDKA 4ICHA 4IRGA 4ASNA 3OOPA 4MNUA 4ZYHA 3K2AA 2EJRA 5CLSA 2F4MB 2E1MC 2X51A 2EWNA 1ENHA 5GAGJ 1JGSA 1XTAA 2XGCA 3GTMJ 5FGMA 2QBYB 3L2QA 1ZG3A 4ACIA 1VI0A 1P4AA 1HSJA 3SHFA 5EGOA 1A5JA 5J8CA 2XAJA 3WU0A 2M9HA 3BR0A 4GXOA 5JLXA 3TW6A 4XRSG 2LY9A 5DM7F 2IA0A 3Q0WA 4NC6A 4AYBA 2LH9A 3S17J 4BL0B 3OL4A 3CJTB 1RUNA 4EJVA 2OI8A 1LFBA 1KGSA 3BQZA 3PUBA 2V26A 4DBQA 1OQYA 2ZB9A 3B02A 1PDNC 5FHPA 1M1EB 5CXIA 2HTSA 1P9QC 2DBBA 2WV0A 3ECOA 2N8GA 4EJOA 1JGGA 3GLLA 2DMUA 3HEFA 2ISZA 1S72I 2V1UA 1Y6IA 4F91B 1F36A 1FJLA 3QAHA 4RB1A 4HYEA 5FRNA 2CG4A 4BKXA 2GAUA 1HW5A 2XB0X 5DEQA 2A6HF 4A3IJ 1AA7A 1IN7A 5B5EC 2XPVA 3QPSA 2KHMA 2PLYA 2QLZA 4CDGA 5F1RA 2RNGA 3C18A 4HZFA 3GTLJ 2UWMA 3I71A 2DTRA 1Z91A 2LBFA 1E0EA 3GZIA 3EUAA 4LOCA 4A3JJ 2ECBA 2JVHA 2W4SA 2E1MB 4AF5A 1V54H 3E6MA 1TWAJ 2VB6A 4HKUA 1GUUA 4XK4A 3K2ZA 4HLYA 4N9HA 2K02A 1U78A 2PX9A 2W84A 3AG3H 4C30A 5ILUA 5CW8A 3KZZA 4F93B 3BZ6A 4FE4A 4J19A 2STTA 3WU1B 2R7RA 3DP7A 3VDXA 2V9KA 2R4GA 4LD5A 2L54A 3GBGA 2A6EF 3PNYA 4S05A 3G6EI 1OCZH 3D5RC 1FNNA 4ENJA 4OIOF 2HS5A 3B73A 4E4HA 4D0PA 4HF2A 3J7AO 5K1YA 4M9SA 2ISYA 3C7JA 1ZELA 1Z05A 3MNLA 3RPQA 3DKYA 3K10A 2CFOA 4F52A 1ZAOA 3VOXA 2JSCA 4UB8C 4CYDA 2GFNA 2OJED 3S8PA 2XVCA 1HC8A 1WJ5A 1XSVA 5J40A 3ZMVA 3BC8A 4M9ZA 1ON1A 3AL0B 2IS1A 3LSKA 2L9RA 2OV7A 4JKZA 3F0CA 1K78A 2EV6A 5D5WB 4AC0A 2F4OB 4Y7NJ 2VUMJ 3WTVC 3LA3A 5FRMA 2E5NA 5J3LA 4F3QA 1DGWY 2LD5A 2WY8Q 2CO5A 2QEXI 5K5RA 4KT6A 3ZMTA 2PMZN 2FX0A 3S3OA 3GZ5A 3GYHX 3ZQGA 1W5CC 4Y3OA 1J2XA 5LLQA 1OYWA 2P6SA 5DV5A 2JZYA 2KDOA 2BXYA 5FLXK 3OYCA 2HDWA 4ZDPA 3E7LA 3WTYC 3CP2A 1X1BA 2ZXIA 4AWXB 2XDNA 2DT5A 3LAJA 3L2WA 3K4KA 4Y17A 3PUFA 4ESJA 2UXUA 3HXLA 2MABA 1A36A 4LIVA 3VB2A 1VQOI 5FKKA 1QQIA 5IT9K 3BP8A 1TTYA 2D1HA 2EFQA 3QWLA 4P1WA 2IRFG 1SFEA 2V1NA 2K3PA 3VEPA 2LKSA 5DD4A 3OYFA 5DUKA 2COBA 3A02A 4EM2A 3F6OA 5FFXA 3OS1A 4PCQA 2GOMA 1S29A 1T98A 3M07A 4EGYA 1IRFA 1GXQA 1V5EA 5BS6A 2RQQA 2VQCA 3OSFA 1OJLA 2F5CA 3WTZA 1LE8B 2BE5F 2QA4I 2VKDA 3DF8A 4UUSA 2VQLA 2VOPA 2J5PA 3K8PC 4XMYA 3CMMA 3JRHA 4CICA 1FP1D 1W0UA 4MGRA 3HG9A 1Z6TA 3VSKA 4RAYA 2R7ZJ 4FCYA 2V7FA 1HLVA 3A2KA 4Y4RA 5KVRA 2P81A 3FBNB 1XC5A 3BG6A 3LL7A 3LSIA 3NRVA 4MO7A 4ZYEA 4C2MJ 2BBYA 3O6BB 3GEUA 1XS9A 3H36A 4CYCB 3FMSA 1UI6A 3LOCA 3G71I 3SZTA 3A0HC 4DQ2A 4ENNA 3NARA 4MQ9F 5F64A 3IC7A 1W36C 2M5WA 3NEUA 2F48A 1FYMA 2MH2A 4FX0A 2O0YA 2P0WA 2HOAA 4R79A 4RBOA 4HF0A 3EUHA 4MFEA 3E97A 5GPCA 3PIPF 4IPAA 2KQRA 3TO7A 2OQRA 1UAAA 3O60A 4IO9F 2DU9A 3LSJA 1LVKA 4PSWA 3B81A 1AHDP 3TOAA 3WODF 3NNRA 3VOKA 4EJTA 3I5UA 4HQEA 2E2JJ 4V19K 3KEYA 4V2GA 5J1RA 2CJJA 3DLLF 3PNVA 2QKLB 1ZGAA 1FOXA 3PASA 5D8LB 3NPIA 4X0GA 1JT6A 1ZG5A 2O61A 1SFKA 3HOZJ 4LG0B 1P92A 1R1TA 2B3WA 4BDYA 1K4SA 3V8LA 5FJ8J 2QSGX 5DAJA 4AC6A 3HIFA 3PFYA 1U3EM 3C2BA 4B48A 2MD0A 3RIRA 3GFLA 2JPBA 2NVYJ 4UVCA 1U8BA 1IG7A 1W36D 4FQGA 3ABTA 1UZCA 5BPIA 4XLPF 2GENA 1TLHB 2WAFA 1FBUA 3K4CA 3K4JA 3OR2C 4GCVA 3H5NA 3VSLA 4A3GJ 1X1PA 2V4JC 2CW7A 3C1DA 2NVTJ 4BXFA 5CQEA 2W25A 5D1RA 3KYCB 4XICA 2X1CA 1D8KA 1FY7A 1UB9A 4MTEA 5E18F 3TMOA 4G7ZF 2DK5A 1UHSA 2C6YA 1GVDA 2XGXA 2ZOYA 4NN1A 3H3VK 2JWTA 4I0AA 3IV5A 2ZMEA 1TT0A 1YI2I 2E5ZA 2LLKA 1XCVA 4YIFA 2FMLA 1ZR4A 2Y30A 3DBRB 3IH2A 4A0ZA 2D2WA 4F55A 2NAZA 2MSYA 1UMQA 3IH4A 4RA2A 2F07A 1G6NA 2PBXA 1GHCA 4LK0F 4PSXA 4W97A 4DW6A 2A05A 2DA4A 2EA4A 4DNCA 2D45A 2L9SA 2B9SA 2KZVA 1TW3A 4HV6A 2Z2SB 1Z0XA 3LHQA 1NK3P 2IA2A 5LEJA 3K70D 2VC0A 1RUOA 3CC2I 2X6YA 5B1AH 2K85A 1SFXA 3EDPA 4EJWA 3I4PA 4IHWA 4I98B 2JUCA 2CU7A 4AIHA 4ZDOA 1YX3A 1FPQA 5D6FA 1K6OA 3HTUA 2HPMA 3J7ZI 2WA0A 2F2EA 1U9OA 2HU9A 2HYGD 2XPWA 2ZBKA 4MHGA 1O3RA 1KQ0A 2IGMA 4Y33A 4UV8A 4G8XA 1WI3A 2QWWA 3ZPLA 3NS4A 1TT5B 1LJ9A 4U7BA 3A4CA 4N4OB 1WJAA 3WGHA 1XGNA 4IX7A 5J1UA 4Q48A 4ZZDA 4XN0A 1S7OA 1ZYRF 3IHUA 3H5AA 4O3MA 1R4MB 1ZQ3P 2YR2A 4BH9A 4I01A 3FM5A 1SC7A 2ZCWA 2G9WA 1ERDA 4BEHA 5ICEA 3FRQA 2UXNA 4E7JA 5LD2C 3R60A 2XDVA 3LSTA 4WX9A 3EQLF 3OYBA 4WXHA 2K9SA 2Y48A 5HAWA 4TV7A 3F8MA 3TL4X 3F8CA 3HSEA 1WI9A 4HNUA 4UV9A 3E6DA 4XRSA 4WXDA 4L9TA 3QODA 4PZJA 4ANJA 1AU7A 3LNQA 2WB1N 2LREA 1HA8A 1FSEA 3HUGB 1FWZA 1ITYA 2Y9YA 4U9LA 3BCBA 3K9TA 1H88C 4QSHA 2AQEA 1R22A 5D4RA 2EBIA 3OL3A 2A69F 2ZXWH 4OOIA 1W1WE 2IAIA 1IO2A 3FXMA 1MMGA 2EFPA 5HNFA 4XQFA 3OIOA 1MNMC 1N75A 3GF2A 5KCMA 2MG4A 4ZJZA 6PAXA 1JKOC 1Z7UA 2ZSIB 4DYCA 1GXPA 2IW5A 2DDAA 1DQUA 1YJ9I 2K4BA 3JW4A 3R0JA 2LSOA 3CCLI 5M3MJ 5CVVA 2RQPA 1ETKA 1P4WA 2ZC2A 2V6CA 4MEXF 4JX4A 4BUPA 2KPMA 4IRIA 1FTTA 1EJ9A 1D1CA 2G0EA 2LDUA 2NNNA 5F1JA 1A31A 3BTCA 3VYUB 3JTGA 1OCPA 1OISA 4EQQA 1IXCA 1TBXA 1UHWA 2Z3YA 4WF2A 3VIBA 2K9QA 1IZ1A 3F8BA 2ACJA 1O57A 3FHZA 3GW2A 3CLQA 3GTPJ 2FNPA 3FXJA 4CCKA 4MIMA 3OYJA 3SJMA 4FT8A 2EZHA 1YJNI 4WXCA 3OS0A 3BR6A 2M8EA 3W3CA 3G1LA 3VWBA 3ZQLA 5CKTA 1K83J 2QKMB 5E3OA 1FOKA 1X1DA 2H6BA 2ELHA 2MBFA 4PDKA 1LB2A 4I6ZA 2FEZA 1SD7A 3A1YA 5F04A 3RZOJ 1HQCA 2JRTA 1NG7A 3T1BA 4E7ZA 1MW7A 2M2EA 2B63J 1ZKGA 5DUIA 1GDTA 4IKFA 1HW1A 5IYDJ 4BQOA 1USSA 2JQ7A 1W7PD 5CVIA 2E2HJ 3KYDB 3HYIA 2L4AA 5C44J 3SFZA 1KU2A 4OIQF 1VTNC 5K5OA 3DFGA 3DBHB 4HW0A 2A5YB 1O3QA 4GCLA 3P9TA 1X58A 3K4BA 1IDZA 2I10A 1W7PA 4CXFA 2JN6A 1WPKA 2HVRA 3I59B 3FDYA 1ZR2A 3CDLA 3QQAA 3ROUA 2QF7A 3GFJA 5JVGF 2VI6A 4NBQA 3HOXJ 2VIXA 1IN8A 2R93J 3DTKA 3QYBA 2QSHX 3FMQA 5ILSA 2XAFA 3AG2H 4BBRJ 4U0VA 2M7AA 3WG9A 1AKHA 4EM0B 2LNBA 4MTDA 4BDZA 3JREA 4A3BJ 4OU0A 2W7NA 3MFKA 3P9KA 4HNTA 2V1XA 1XSXA 3ZMUA 1FYKA 4V2FA 4M74A 3CCYA 4YELA 2GUHA 2Y0MA 1ZHFA 1F9NA 2KIUA 1V5FA 2NOJB 5D19A 5J6XA 3CF5F 1S6LA 1MIJA 4NQWB 3CMEI 1CGPA 4XN3A 4DIQA 3RYRA 4EJUA 3OY9A 1SANA 1A6QA 3BCGA 3Q5FA 5C4JJ 5HLGA 3TDZC 1JI8A 1Q1HA 2FF4A 4M3EA 3BHQA 1T0FC 5HOOA 1WQ2A 2IGKA 4NHJA 1Y1WJ 1T38A 3KYLA 1L3LA 1YG2A 5HLTA 2HFHA 1CQTA 3BOQA 4QTRA 1ULYA 2XKPA 4LGWA 1BA5A 4JNNA 5CVUA 3SEQA 2DO7A 4YFXF 4R1HA 3S2DJ 5E1WA 3HOVJ 2R7VA 4LLLA 5EEGA 2FSWA 5K5QA 2KIMA 4OWRB 2K7LA 5FKLA 2D1VA 3HJEA 2DMTA 2EV5A 2IVMA 2K3FA 3RPUD 3DTIA 3BJBA 1B9MA 4U0YA 3ERED 4IHYA 3R6SA 5EF6A 4JX6A 3OYDA 2E36A 2QVOA 3S5RA 4M3DA 1G8XA 1TQIA 1RETA 3I53A 5H6RA 1X1CA 2VC1A 3RPUA 2STWA 3KX2A 3BZKA 4N9IA 5CJ9A 2E35A 1PUEE 3VFZA 2ZXHA 1YW7A 2MFZA 3WTXC 2ZKZA 2K9NA 2H8RA 1FT9A 4P55A 4BJ5C 1S7AA 1MJ9A 2XF7A 4BHPA 2Z5UA 1J75A 1POGA 2WV1A 2XF5A 3FXRA 3PNTA 3BJOA 3JRCA 3ASNH 3J80Z 2FBHA 3N05A 1Y39A 3HPGA 2Z33A 2XUBA 4RLQA 3IUOA 1XGSA 2FBQA 2ID6A 3BPXA 4AD9A 4L18B 3PPBA 3HM5A 4RB3C 3M1CA 1F5TA 1XN7A 5HSZA 2IJLA 3BJAA 4JX5A 1DPUA 4AUXA 2FNAA 2BW3B 3ZR8X 2WADA 4MFDA 3QOEA 5IP6A 1XDUA 2QQ8A 1R9TJ 5IT3A 2WBMA 2W53A 2ELJA 2CQNA 3DKXA 1XCBA 3QP5A 3KZIC 1J0RA 3LFKA 1YS7A 2QQ9A 2IS6A 4A0XA 1YS6A 1LFPA
chains in the Genus database with same CATH topology
3QBMA 1JKRC 3B6AA 2HOTA 4DYQA 5JLWA 4NELA 2VKEA 3TP3A 2TRTA 3DPJA 4BBSJ 3KZ9A 3T6NA 4B1RA 1RKTA 3MVPA 1BW6A 3E7LA 3HKZN 4DZPA 5GPAA 2XDNA 3BR2A 1Q1VA 2ME0A 2JJ7A 5GP9A 1JKQC 1ETYA 3TW7A 5EGOB 2DA5A 1RPWA 2UXUA 2LTPA 5K7HA 2AO9A 2LFBA 3JRAA 4JL3A 5FKKA 4A3LJ 2CUFA 4I76A 2LVSA 3ZQCA 3VP5A 1ORKA 1QRYA 2COBA 2DJNA 3A02A 4Y52J 1OFCX 1AKHB 2TCTA 5C4YA 1JTYA 5K58A 3NXCA 2UXPA 3GTJJ 3ZQIA 4L62A 3HOUJ 5FKMA 1NK2P 3JR9A 1BJZA 3VW1A 3OSFA 1OJLA 2HI3A 4AYBN 1LE8B 2OERA 4UUSA 1D5YA 5J1YA 2WUIA 1WGXA 2HXIA 3NRGA 3S2HJ 3MKLA 3BTIA 1YRNB 4S0HB 2UXHA 2YU9J 2EZKA 3JRHA 3HDDA 2D6YA 2NVXJ 1ZK8A 1WH7A 1B72A 3I4NJ 1W0UA 2JK3A 3TP0A 3LSRA 2Y31A 4M3BA 3UKGA 3BNIA 2R7ZJ 4FCYA 1P7JA 1MBEA 5IPAA 1HLVA 1IV6A 1ETQA 3JSJA 2P81A 4X6AJ 1XC5A 2QIBA 3E7QA 4MO7A 4D7NA 5FKNA 4C2MJ 3GEUA 1XS9A 4CYCB 3DCFA 1UI6A 3S14J 3LOCA 3G56A 3NARA 2DA6A 2JA8J 2X48A 2W48A 2X6OA 2HYTA 1JUMA 3I4MJ 5FLVA 1HDPA 2FD5A 1DU0A 1JKPC 1MBHA 2VKVA 5EG0A 1PUFB 1JJ6C 5D18A 2DMNA 2HOAA 3HTIA 4RBOA 2YVHA 4W1UA 3ANPA 2IEKA 2XRLA 3ZOBA 4MFEA 2QKOA 5GPCA 2M0CA 3O60A 3K7AJ 4QIWN 2YUSA 3LSJA 2G7LA 3B81A 3VOKA 1AHDP 3NNRA 3HOWJ 2NP5A 3CQZJ 1T56A 3AQSA 2DMQA 2E2JJ 2ECCA 2AHQA 5M5XJ 3G1OA 4V2GA 3FIWA 5J1RA 2CJJA 3G7RA 2GM4A 1ETXA 2R5ZA 3PASA 3O8GA 1I3QJ 5IP7J 2XGDA 1MSFC 1JT6A 3NPIA 3HOZJ 5FMPA 3KNWA 1FIAA 5FJ8J 5DAJA 4AC6A 3A03A 3C2BA 2WGBA 3CJDA 2MW8A 5IP9J 2NVYJ 1SFOJ 1FTZA 1U8BA 1IG7A 4GFLA 3VVZA 3FK6A 2LKXA 2IU5A 2QOPA 2GENA 2ELKA 3W6VA 1DU6A 4A3GJ 1B8IA 2QWTA 2ME6A 1JUSA 2LP0A 2UXOA 2CRGA 5M3FJ 3FK7A 2NVTJ 3C07A 4YZEA 3WHBA 1TWHJ 1ZTRA 2HDDA 2HYJA 5D1RA 1Y1VJ 4XICA 4GCTA 3NI7A 4L5EA 1P7IA 1UHSA 5F0CA 2ZOYA 1GVDA 3F1BA 1SGMA 4NN1A 3H3VK 9ANTA 2JWTA 3IV5A 2DA7A 1S7EA 3BR1A 2LLKA 5DS9A 1ZR4A 2Y30A 4XRMA 3IH2A 3HBLA 3TEDA 5DTDA 3IUVA 5HBUA 3ON4A 2MSYA 3HB9A 5M5WJ 1UMQA 3IH4A 2PBXA 2F07A 1X2MA 2E2IJ 3HTHA 5FLMJ 3GTOJ 4W97A 3Q0VA 1NTCA 4DW6A 1TWFJ 3S16J 2NS8A 2EQRA 2DA4A 3S15J 4CGRA 1QVUA 1VFCA 4A3EJ 3RH2A 2WAQN 3LHQA 1Z0XA 1NK3P 3VW2A 1ETOA 1APLC 3MN2A 2L0KA 2H1KA 1Z77A 4A93J 5EYRA 4A3KJ 3WHCA 3JRIA 4RDUA 4IHWA 1JUPA 2CU7A 2JA7J 3PO2J 2G7GA 1ETWA 2HXOA 2EZLA 4GCKA 2G7SA 1U9OA 2R0QC 4UUSB 2XPWA 5M5YJ 4DYRA 3ON2A 4D7MA 2DG8A 1IDYA 3QKXA 1GV2A 1E3OC 3JRDA 3IH3A 4HNVA 1WI3A 1B72B 3ZQFA 5HODA 1IRZA 4FISA 5J1UA 3VVXA 3RD3A 2JA6J 2GBYA 1WH5A 2CQQA 3H0GJ 1TC3C 3HTJA 4UDSA 3LWJA 5F08A 2KDZA 3L1PA 2FJ1A 1ZQ3P 2UXIA 3GTKJ 1ETVA 1UG2A 3VPRA 3VUQA 2DA3A 1X2NA 5EZGA 3FRQA 2NX4A 3BRUA 4FE7A 2O8KA 5EFYA 3FISA 1UI5A 5HAWA 2K9SA 3PO3J 3HIMA 4B4CA 5BNGA 3Q0UA 3Q3SA 3S1RJ 3LJLA 4B3AA 4GFKA 3LSPA 4XRSA 4C3JJ 2E1OA 2V57A 5AQCA 4ABZA 1AU7A 3LNQA 2WB1N 5EG0B 3O8HA 3ANGA 1ITYA 2Y9YA 5IYBJ 2FQ4A 4IHXA 1FEXA 5FKOA 1H88C 4UUTA 4QSHA 3BR3A 2EBIA 1QPIA 2L7FP 2L7ZA 2IAIA 4MLOA 3NAUA 1TWCJ 2XGEA 4BY1J 4EEFG 1MH4A 4ME9A 3OIOA 1MNMC 1IUFA 2YVEA 1IGNA 2VPRA 5F0HA 2ZCNA 3JRGA 2DG7A 3PM1A 2MG4A 1JKOC 5CXGA 2X9DA 1BW5A 3V78A 4DYCA 1MBJA 3JRFA 2R5ZB 3BT9A 4XIDA 5E3NA 2QTQA 2R5YB 5M3MJ 3BTJA 2Y0SN 1T33A 1ETKA 1FTTA 4FTHA 3A01A 2GLOA 1MBKA 4JX4A 2E19A 2RASA 4PXIA 1MH3A 4A3MJ 1HOMA 2M8GX 3BQYA 2G0EA 3V6GA 5F1JA 4A3DJ 2JA5J 5IOYA 3BTCA 2YS9A 3DEWA 1OCPA 4JP0A 1IJWC 5E3MA 3B6CA 3COLA 4MK6A 3CWRA 4D5FA 3VIBA 3S1NJ 3SFIA 2K9QA 1B8IB 2MGQA 3HOYJ 2ZOZA 1RESA 1EF4A 3FKIJ 4BXXJ 2LR8A 3GTPJ 2M34A 4C3IJ 4MIMA 3SJMA 1VF9A 2DA2A 3OOUA 2EZHA 1GT0C 2NVQJ 3BR6A 4BY7J 4NDLA 3G1LA 3ZQLA 1K83J 5E3OA 3QPLA 1JTXA 2XB5A 4IEJA 4I6ZA 2REKA 4M3FA 3G1MA 2LK2A 2CUEA 5F04A 3RZOJ 1MSEC 1H89C 3M4OJ 2M2EA 3SDGA 1H8AC 2B63J 1ZKGA 1GDTA 2RHAA 1BL0A 5IYDJ 2NP3A 2O9LA 2PZ9A 4ICHA 2E2HJ 3K2AA 2Q24A 1ENHA 5C44J 3EGQA 5FGLA 3HTAA 2L7MP 5K7FA 4GCLA 2XGCA 3GTMJ 1X58A 4G12A 1HF0A 1IDZA 3P9TA 2I10A 1VNDA 2JN6A 4DZJA 1ZGWA 1I6HJ 4ACIA 1WPKA 3CRJA 1VI0A 1ZR2A 3CDLA 2O7OA 5EGOA 1A5JA 3QQAA 2QF7A 2M9HA 2EZIA 3BR0A 2VI6A 5JLXA 3TW6A 4XRSG 2LY9A 2JMWA 3HOXJ 3RKQA 3VVYA 5EDNA 3Q0WA 2R93J 4MXMA 2NOGA 2ID3A 3BG3A 2D5VA 3S17J 2KT0A 5H9TA 3BG9A 2OI8A 4BBRJ 1LFBA 2RAEA 3BQZA 1OCTC 1GV5A 2ZB9A 5FHPA 3S1QJ 1AKHA 5CXIA 2IBDA 2CQXA 4A3CJ 3BG5A 3JREA 4A3BJ 1LFUP 2N8GA 1JGGA 2QCOA 3HEFA 2DMUA 5EZHA 1LE8A 2ZCXA 4V2FA 4JYKA 3CCYA 3KKDA 2GUHA 1F36A 2DN0A 1FJLA 2DA1A 5IYCJ 4M6VA 3KKCA 1YRNA 4BKXA 5D19A 2EH3A 2XB0X 1F43A 2XPUA 5E3LA 2K40A 1WCMJ 4A3IJ 1XG1A 3OSGA 1SANA 3BCGA 1O4XA 5C4JJ 3HGGA 3EUPA 2XPVA 3QPSA 1TWGJ 4M3EA 2R92J 2ZCMA 3BHQA 3GTLJ 4A3FJ 1Y1WJ 3GTGJ 3BTLA 4X1EA 3GZIA 4LOCA 4CYCA 2DTZA 4A3JJ 1CQTA 5C4XJ 2ECBA 2OF7A 4QTRA 1BA5A 4AF5A 2XSDC 3GTQJ 4JNNA 1TWAJ 4HKUA 2Y2ZA 2DMPA 4M3GA 4A69C 1GUUA 4XK4A 5F27A 3M3YJ 3VW0A 3S2DJ 3HOVJ 1U78A 5CW8A 1IC8A 1A6IA 4J19A 4FE4A 1PUFA 5FKLA 5EEAA 1JJ8C 2DMTA 3AQTA 1HDDC 2NS7A 3GBGA 2OPTA 2HKUA 3BJBA 1RR7A 1I50J 4IHYA 1G2HA 5EF6A 4JX6A 3RQIA 3CMYA 3S5RA 4M3DA 5C3EJ 5IOZA 4C3HJ 1RETA 3RZDJ 3A01B 2K9NA 2H8RA 3MNLA 3VOXA 3HGYA 1POGA 2WV1A 1JT0A 2GFNA 3BR5A 4IHVA 1RKWA 2R5YA 3JRCA 3LSGA 5F0FA 2HQ5A 3ZQHA 1MBGA 5K7ZA 2L9RA 4JKZA 2FBQA 2ID6A 3F0CA 3PPBA 3HM5A 3HE0A 4AC0A 5HSZA 4JX5A 4Y7NJ 2VUMJ 4AUXA 4KWAA 3JRBA 1U9NA 5J3LA 4MFDA 2LD5A 5IP6A 2Y9ZA 1QVTA 1R9TJ 1HCRA 2W53A 1FIPA 1MBFA 4GFBA 2PMZN 4D5CA 2FX0A 2HOSA 3ZQGA 1K61A 3D1NI 3S1MJ 2G3BA 1W0TA 2O7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBM A;  1JKR C;  3B6A A;  2HOT A;  4DYQ A;  5JLW A;  4NEL A;  2VKE A;  3TP3 A;  2TRT A;  3DPJ A;  4BBS J;  3KZ9 A;  3T6N A;  4B1R A;  1RKT A;  3MVP A;  1BW6 A;  3E7L A;  3HKZ N;  4DZP A;  5GPA A;  2XDN A;  3BR2 A;  1Q1V A;  2ME0 A;  2JJ7 A;  5GP9 A;  1JKQ C;  1ETY A;  3TW7 A;  5EGO B;  2DA5 A;  1RPW A;  2UXU A;  2LTP A;  5K7H A;  2AO9 A;  2LFB A;  3JRA A;  4JL3 A;  5FKK A;  4A3L J;  2CUF A;  4I76 A;  2LVS A;  3ZQC A;  3VP5 A;  1ORK A;  1QRY A;  2COB A;  2DJN A;  3A02 A;  4Y52 J;  1OFC X;  1AKH B;  2TCT A;  5C4Y A;  1JTY A;  5K58 A;  3NXC A;  2UXP A;  3GTJ J;  3ZQI A;  4L62 A;  3HOU J;  5FKM A;  1NK2 P;  3JR9 A;  1BJZ A;  3VW1 A;  3OSF A;  1OJL A;  2HI3 A;  4AYB N;  1LE8 B;  2OER A;  4UUS A;  1D5Y A;  5J1Y A;  2WUI A;  1WGX A;  2HXI A;  3NRG A;  3S2H J;  3MKL A;  3BTI A;  1YRN B;  4S0H B;  2UXH A;  2YU9 J;  2EZK A;  3JRH A;  3HDD A;  2D6Y A;  2NVX J;  1ZK8 A;  1WH7 A;  1B72 A;  3I4N J;  1W0U A;  2JK3 A;  3TP0 A;  3LSR A;  2Y31 A;  4M3B A;  3UKG A;  3BNI A;  2R7Z J;  4FCY A;  1P7J A;  1MBE A;  5IPA A;  1HLV A;  1IV6 A;  1ETQ A;  3JSJ A;  2P81 A;  4X6A J;  1XC5 A;  2QIB A;  3E7Q A;  4MO7 A;  4D7N A;  5FKN A;  4C2M J;  3GEU A;  1XS9 A;  4CYC B;  3DCF A;  1UI6 A;  3S14 J;  3LOC A;  3G56 A;  3NAR A;  2DA6 A;  2JA8 J;  2X48 A;  2W48 A;  2X6O A;  2HYT A;  1JUM A;  3I4M J;  5FLV A;  1HDP A;  2FD5 A;  1DU0 A;  1JKP C;  1MBH A;  2VKV A;  5EG0 A;  1PUF B;  1JJ6 C;  5D18 A;  2DMN A;  2HOA A;  3HTI A;  4RBO A;  2YVH A;  4W1U A;  3ANP A;  2IEK A;  2XRL A;  3ZOB A;  4MFE A;  2QKO A;  5GPC A;  2M0C A;  3O60 A;  3K7A J;  4QIW N;  2YUS A;  3LSJ A;  2G7L A;  3B81 A;  3VOK A;  1AHD P;  3NNR A;  3HOW J;  2NP5 A;  3CQZ J;  1T56 A;  3AQS A;  2DMQ A;  2E2J J;  2ECC A;  2AHQ A;  5M5X J;  3G1O A;  4V2G A;  3FIW A;  5J1R A;  2CJJ A;  3G7R A;  2GM4 A;  1ETX A;  2R5Z A;  3PAS A;  3O8G A;  1I3Q J;  5IP7 J;  2XGD A;  1MSF C;  1JT6 A;  3NPI A;  3HOZ J;  5FMP A;  3KNW A;  1FIA A;  5FJ8 J;  5DAJ A;  4AC6 A;  3A03 A;  3C2B A;  2WGB A;  3CJD A;  2MW8 A;  5IP9 J;  2NVY J;  1SFO J;  1FTZ A;  1U8B A;  1IG7 A;  4GFL A;  3VVZ A;  3FK6 A;  2LKX A;  2IU5 A;  2QOP A;  2GEN A;  2ELK A;  3W6V A;  1DU6 A;  4A3G J;  1B8I A;  2QWT A;  2ME6 A;  1JUS A;  2LP0 A;  2UXO A;  2CRG A;  5M3F J;  3FK7 A;  2NVT J;  3C07 A;  4YZE A;  3WHB A;  1TWH J;  1ZTR A;  2HDD A;  2HYJ A;  5D1R A;  1Y1V J;  4XIC A;  4GCT A;  3NI7 A;  4L5E A;  1P7I A;  1UHS A;  5F0C A;  2ZOY A;  1GVD A;  3F1B A;  1SGM A;  4NN1 A;  3H3V K;  9ANT A;  2JWT A;  3IV5 A;  2DA7 A;  1S7E A;  3BR1 A;  2LLK A;  5DS9 A;  1ZR4 A;  2Y30 A;  4XRM A;  3IH2 A;  3HBL A;  3TED A;  5DTD A;  3IUV A;  5HBU A;  3ON4 A;  2MSY A;  3HB9 A;  5M5W J;  1UMQ A;  3IH4 A;  2PBX A;  2F07 A;  1X2M A;  2E2I J;  3HTH A;  5FLM J;  3GTO J;  4W97 A;  3Q0V A;  1NTC A;  4DW6 A;  1TWF J;  3S16 J;  2NS8 A;  2EQR A;  2DA4 A;  3S15 J;  4CGR A;  1QVU A;  1VFC A;  4A3E J;  3RH2 A;  2WAQ N;  3LHQ A;  1Z0X A;  1NK3 P;  3VW2 A;  1ETO A;  1APL C;  3MN2 A;  2L0K A;  2H1K A;  1Z77 A;  4A93 J;  5EYR A;  4A3K J;  3WHC A;  3JRI A;  4RDU A;  4IHW A;  1JUP A;  2CU7 A;  2JA7 J;  3PO2 J;  2G7G A;  1ETW A;  2HXO A;  2EZL A;  4GCK A;  2G7S A;  1U9O A;  2R0Q C;  4UUS B;  2XPW A;  5M5Y J;  4DYR A;  3ON2 A;  4D7M A;  2DG8 A;  1IDY A;  3QKX A;  1GV2 A;  1E3O C;  3JRD A;  3IH3 A;  4HNV A;  1WI3 A;  1B72 B;  3ZQF A;  5HOD A;  1IRZ A;  4FIS A;  5J1U A;  3VVX A;  3RD3 A;  2JA6 J;  2GBY A;  1WH5 A;  2CQQ A;  3H0G J;  1TC3 C;  3HTJ A;  4UDS A;  3LWJ A;  5F08 A;  2KDZ A;  3L1P A;  2FJ1 A;  1ZQ3 P;  2UXI A;  3GTK J;  1ETV A;  1UG2 A;  3VPR A;  3VUQ A;  2DA3 A;  1X2N A;  5EZG A;  3FRQ A;  2NX4 A;  3BRU A;  4FE7 A;  2O8K A;  5EFY A;  3FIS A;  1UI5 A;  5HAW A;  2K9S A;  3PO3 J;  3HIM A;  4B4C A;  5BNG A;  3Q0U A;  3Q3S A;  3S1R J;  3LJL A;  4B3A A;  4GFK A;  3LSP A;  4XRS A;  4C3J J;  2E1O A;  2V57 A;  5AQC A;  4ABZ A;  1AU7 A;  3LNQ A;  2WB1 N;  5EG0 B;  3O8H A;  3ANG A;  1ITY A;  2Y9Y A;  5IYB J;  2FQ4 A;  4IHX A;  1FEX A;  5FKO A;  1H88 C;  4UUT A;  4QSH A;  3BR3 A;  2EBI A;  1QPI A;  2L7F P;  2L7Z A;  2IAI A;  4MLO A;  3NAU A;  1TWC J;  2XGE A;  4BY1 J;  4EEF G;  1MH4 A;  4ME9 A;  3OIO A;  1MNM C;  1IUF A;  2YVE A;  1IGN A;  2VPR A;  5F0H A;  2ZCN A;  3JRG A;  2DG7 A;  3PM1 A;  2MG4 A;  1JKO C;  5CXG A;  2X9D A;  1BW5 A;  3V78 A;  4DYC A;  1MBJ A;  3JRF A;  2R5Z B;  3BT9 A;  4XID A;  5E3N A;  2QTQ A;  2R5Y B;  5M3M J;  3BTJ A;  2Y0S N;  1T33 A;  1ETK A;  1FTT A;  4FTH A;  3A01 A;  2GLO A;  1MBK A;  4JX4 A;  2E19 A;  2RAS A;  4PXI A;  1MH3 A;  4A3M J;  1HOM A;  2M8G X;  3BQY A;  2G0E A;  3V6G A;  5F1J A;  4A3D J;  2JA5 J;  5IOY A;  3BTC A;  2YS9 A;  3DEW A;  1OCP A;  4JP0 A;  1IJW C;  5E3M A;  3B6C A;  3COL A;  4MK6 A;  3CWR A;  4D5F A;  3VIB A;  3S1N J;  3SFI A;  2K9Q A;  1B8I B;  2MGQ A;  3HOY J;  2ZOZ A;  1RES A;  1EF4 A;  3FKI J;  4BXX J;  2LR8 A;  3GTP J;  2M34 A;  4C3I J;  4MIM A;  3SJM A;  1VF9 A;  2DA2 A;  3OOU A;  2EZH A;  1GT0 C;  2NVQ J;  3BR6 A;  4BY7 J;  4NDL A;  3G1L A;  3ZQL A;  1K83 J;  5E3O A;  3QPL A;  1JTX A;  2XB5 A;  4IEJ A;  4I6Z A;  2REK A;  4M3F A;  3G1M A;  2LK2 A;  2CUE A;  5F04 A;  3RZO J;  1MSE C;  1H89 C;  3M4O J;  2M2E A;  3SDG A;  1H8A C;  2B63 J;  1ZKG A;  1GDT A;  2RHA A;  1BL0 A;  5IYD J;  2NP3 A;  2O9L A;  2PZ9 A;  4ICH A;  2E2H J;  3K2A A;  2Q24 A;  1ENH A;  5C44 J;  3EGQ A;  5FGL A;  3HTA A;  2L7M P;  5K7F A;  4GCL A;  2XGC A;  3GTM J;  1X58 A;  4G12 A;  1HF0 A;  1IDZ A;  3P9T A;  2I10 A;  1VND A;  2JN6 A;  4DZJ A;  1ZGW A;  1I6H J;  4ACI A;  1WPK A;  3CRJ A;  1VI0 A;  1ZR2 A;  3CDL A;  2O7O A;  5EGO A;  1A5J A;  3QQA A;  2QF7 A;  2M9H A;  2EZI A;  3BR0 A;  2VI6 A;  5JLX A;  3TW6 A;  4XRS G;  2LY9 A;  2JMW A;  3HOX J;  3RKQ A;  3VVY A;  5EDN A;  3Q0W A;  2R93 J;  4MXM A;  2NOG A;  2ID3 A;  3BG3 A;  2D5V A;  3S17 J;  2KT0 A;  5H9T A;  3BG9 A;  2OI8 A;  4BBR J;  1LFB A;  2RAE A;  3BQZ A;  1OCT C;  1GV5 A;  2ZB9 A;  5FHP A;  3S1Q J;  1AKH A;  5CXI A;  2IBD A;  2CQX A;  4A3C J;  3BG5 A;  3JRE A;  4A3B J;  1LFU P;  2N8G A;  1JGG A;  2QCO A;  3HEF A;  2DMU A;  5EZH A;  1LE8 A;  2ZCX A;  4V2F A;  4JYK A;  3CCY A;  3KKD A;  2GUH A;  1F36 A;  2DN0 A;  1FJL A;  2DA1 A;  5IYC J;  4M6V A;  3KKC A;  1YRN A;  4BKX A;  5D19 A;  2EH3 A;  2XB0 X;  1F43 A;  2XPU A;  5E3L A;  2K40 A;  1WCM J;  4A3I J;  1XG1 A;  3OSG A;  1SAN A;  3BCG A;  1O4X A;  5C4J J;  3HGG A;  3EUP A;  2XPV A;  3QPS A;  1TWG J;  4M3E A;  2R92 J;  2ZCM A;  3BHQ A;  3GTL J;  4A3F J;  1Y1W J;  3GTG J;  3BTL A;  4X1E A;  3GZI A;  4LOC A;  4CYC A;  2DTZ A;  4A3J J;  1CQT A;  5C4X J;  2ECB A;  2OF7 A;  4QTR A;  1BA5 A;  4AF5 A;  2XSD C;  3GTQ J;  4JNN A;  1TWA J;  4HKU A;  2Y2Z A;  2DMP A;  4M3G A;  4A69 C;  1GUU A;  4XK4 A;  5F27 A;  3M3Y J;  3VW0 A;  3S2D J;  3HOV J;  1U78 A;  5CW8 A;  1IC8 A;  1A6I A;  4J19 A;  4FE4 A;  1PUF A;  5FKL A;  5EEA A;  1JJ8 C;  2DMT A;  3AQT A;  1HDD C;  2NS7 A;  3GBG A;  2OPT A;  2HKU A;  3BJB A;  1RR7 A;  1I50 J;  4IHY A;  1G2H A;  5EF6 A;  4JX6 A;  3RQI A;  3CMY A;  3S5R A;  4M3D A;  5C3E J;  5IOZ A;  4C3H J;  1RET A;  3RZD J;  3A01 B;  2K9N A;  2H8R A;  3MNL A;  3VOX A;  3HGY A;  1POG A;  2WV1 A;  1JT0 A;  2GFN A;  3BR5 A;  4IHV A;  1RKW A;  2R5Y A;  3JRC A;  3LSG A;  5F0F A;  2HQ5 A;  3ZQH A;  1MBG A;  5K7Z A;  2L9R A;  4JKZ A;  2FBQ A;  2ID6 A;  3F0C A;  3PPB A;  3HM5 A;  3HE0 A;  4AC0 A;  5HSZ A;  4JX5 A;  4Y7N J;  2VUM J;  4AUX A;  4KWA A;  3JRB A;  1U9N A;  5J3L A;  4MFD A;  2LD5 A;  5IP6 A;  2Y9Z A;  1QVT A;  1R9T J;  1HCR A;  2W53 A;  1FIP A;  1MBF A;  4GFB A;  2PMZ N;  4D5C A;  2FX0 A;  2HOS A;  3ZQG A;  1K61 A;  3D1N I;  3S1M J;  2G3B A;  1W0T A;  2O7T A; 
#chains in the Genus database with same CATH topology
 1YOV B;  3QBM A;  3U2R A;  3GX4 X;  1U5T B;  3B6A A;  2HOT A;  4DYQ A;  5JLW A;  3FXQ A;  2PJR A;  3K6G A;  2VKE A;  3TP3 A;  5L3B A;  2RRE A;  2HKX A;  2TRT A;  2VJI A;  5EEH A;  4XLN F;  3DPJ A;  3T6N A;  3MVP A;  2H6C A;  3HKZ N;  4DZP A;  1NH3 A;  5AON A;  5GPA A;  4CCM A;  2R7W A;  4P5O A;  2KL4 A;  2IP2 A;  2ME0 A;  1YX5 A;  5J47 A;  3S3M A;  4PFO A;  1ETY A;  5EGO B;  1NG6 A;  2LYC A;  1RPW A;  2XAG A;  4XOR A;  3WE2 A;  2LFB A;  2MLK A;  1XGO A;  2BXZ A;  2K5C A;  2VXZ A;  4I76 A;  3KP2 A;  2CV1 A;  3ZQC A;  3V7C A;  4HDU A;  2DW4 A;  4Y52 J;  2YPR A;  1OFC X;  5LRS A;  1JTY A;  3HOS A;  3NXC A;  2LC2 A;  3ZRG A;  3GTJ J;  4ITV A;  4L62 A;  5FKM A;  1KA8 A;  2E34 A;  2O6G E;  3VW1 A;  1BJZ A;  2HI3 A;  2OER A;  1QZZ A;  1T8I A;  2PEX A;  5LFA A;  3N97 A;  5J1Y A;  2KZG A;  1BI2 A;  4RM2 A;  5JFR A;  1KU3 A;  3F8N A;  3OYA A;  2YU9 J;  2BY1 A;  3HDD A;  4BHB A;  2D6Y A;  1ZK8 A;  1WH7 A;  1B72 A;  4P9U A;  5CQG A;  3RDI A;  3TP0 A;  1LNW A;  3LQR A;  2Y31 A;  4D1Q A;  3LSR A;  2VLA A;  2E60 A;  2OBP A;  1IV6 A;  3QRF F;  1DGR M;  2DPU A;  3H9J A;  4CCO A;  2ZNY A;  2HNH A;  4X6A J;  1YIT I;  2BHZ A;  2VE8 A;  5FKN A;  2LBF B;  4CH7 A;  2X85 A;  5HS9 A;  2VBY A;  4PK4 A;  3S14 J;  4GRI A;  3WTW C;  2EIM H;  5GAH J;  1SMT A;  2DA6 A;  2W48 A;  2VT2 A;  3GZN B;  5FO5 A;  2KKO A;  2HYT A;  4CA0 A;  1JUM A;  2ICW G;  2RKH A;  4XNF A;  1VZ0 A;  2JSP A;  3TO6 A;  3HPH A;  1HDP A;  3P7N A;  1YIJ I;  2VKV A;  5LHI A;  2DMN A;  2YVH A;  2H8W A;  2XRL A;  1E17 A;  1DPR A;  1D1A A;  2BVL A;  1J59 A;  3GCM A;  2HTJ A;  2G7L A;  2Y0S A;  2IPQ X;  2A61 A;  1HKQ A;  4KIC A;  2G7U A;  1FX7 A;  4HBL A;  3CQZ J;  2NP5 A;  2DMQ A;  2VBZ A;  2AHQ A;  5M5X J;  5E8I A;  4RM3 A;  1IXS B;  1ETX A;  1TQM A;  3FXL A;  2R5Z A;  1K4T A;  1MSF C;  2DLL A;  2F5D A;  3GVA A;  4ESF A;  4WWC A;  4LFU A;  1LPQ A;  5BMZ A;  1F1Z A;  3MAJ A;  1FBQ A;  2OZU A;  1FIA A;  4ZTJ A;  1R49 A;  3LFU A;  1P6R A;  2ZXJ A;  2XRO A;  5E8G A;  1KYW A;  4U9N A;  4KJZ A;  2Q2E A;  1FTZ A;  1ZN2 A;  1FBS A;  2A07 F;  1ZGJ A;  3VVZ A;  3P9C A;  2CV2 A;  2LRD A;  1SD6 A;  3WGI A;  1K78 B;  3FK6 A;  2QOP A;  2KRF A;  3K4L A;  4FAS D;  2ELK A;  2LF7 A;  4HX4 A;  4XRF A;  1BOB A;  2ME6 A;  1STZ A;  3IKT A;  5M3F J;  2UXO A;  3FK7 A;  2L5Q A;  3WHB A;  2BZT A;  1D8J A;  4O5V A;  4GCT A;  4P9F A;  3NI7 A;  1LDJ A;  2OCE A;  5KHD A;  2W00 A;  4L5E A;  2DDB A;  9ANT A;  1S7E A;  2X6W A;  4AVZ A;  2A68 F;  5LRR A;  1BN5 A;  1WJF A;  3HKZ A;  3OYL A;  2QUF A;  3FWE A;  1X4P A;  3TED A;  3H92 A;  2KP6 A;  3W6K B;  3HB9 A;  3ON4 A;  2MD5 A;  2B7E A;  4PFP A;  2ZJ2 A;  3HSF A;  4AIK A;  1VQ4 I;  1XGM A;  4G94 A;  5GAE J;  2E2I J;  3GTO J;  3BZC A;  2GXG A;  1NTC A;  3DTE A;  4IZZ A;  3S16 J;  4EAT A;  2NS8 A;  3M7G A;  4KA4 A;  3S15 J;  4UHT A;  1VFC A;  4OMZ A;  3EUH C;  3VW2 A;  1ETO A;  2H1L A;  1APL C;  2KRH A;  4DJA A;  5EYR A;  3WHC A;  2VON A;  3BPV A;  3JRI A;  1EKE A;  3QU6 A;  1A04 A;  1LDD A;  3K1N A;  2JRM A;  3PO2 J;  4A12 A;  2X6X A;  1ETW A;  1PVE A;  2EZL A;  1BR2 A;  3ZMD A;  3OYG A;  4GCK A;  1V4R A;  4PJL A;  2EV0 A;  3I64 A;  3KLO A;  3ZMS A;  2R0Q C;  4UUS B;  5M5Y J;  1YO5 C;  2DG8 A;  2XRN A;  4IRH A;  1GV2 A;  1E3O C;  4BQN A;  4HNV A;  2KLO A;  3X2Q H;  4ENK A;  1SD4 A;  1IRZ A;  4M71 A;  5BOX A;  3CJQ B;  1B9N A;  4A0Y A;  3RD3 A;  2BYV E;  2GBY A;  1WH5 A;  2JA2 A;  2CQQ A;  5A2Q Z;  2EFW A;  3H0G J;  2VAS A;  5KK1 A;  2H27 A;  3PSI A;  2J5O A;  1FOY A;  4GGG A;  4BXU A;  5AIQ A;  3GTK J;  2RDP A;  3RKX A;  2L9V A;  5EZG A;  2PMH A;  5E17 F;  3BRU A;  1BIB A;  4FE7 A;  2V9P A;  4XKV A;  3IWZ A;  3AFH A;  2I8D A;  3HIM A;  3Q3S A;  1PP8 F;  4UUV A;  3LSP A;  5J8F A;  3PJR A;  4C3J J;  2O5R A;  2OCC H;  5AQC A;  3DU6 A;  2MC3 A;  4IQ4 A;  3ESW B;  3FM3 A;  3CF2 A;  2ZME C;  3GWZ A;  4LG3 A;  3PFI A;  3ANG A;  4IHX A;  1R58 A;  4L9V A;  2HPI A;  3F8F A;  2F4I A;  3BR3 A;  1GLN A;  4M73 A;  1QPI A;  1XX5 A;  2L7F P;  3PQJ A;  1TWC J;  4EEF G;  3UR3 C;  2YX7 A;  3L2C A;  1Z21 A;  5L3G A;  2YVE A;  4IQJ A;  2M4G A;  2DYS H;  2VPR A;  3IAM 2;  1BI1 A;  4RAZ A;  3PM1 A;  1R5G A;  2UV1 A;  4IOC F;  1BW5 A;  5ICC A;  4II3 A;  3G3Z A;  1MBJ A;  3JRF A;  2JTV A;  3BT9 A;  5DCM A;  2MC4 A;  4XID A;  2R5Y B;  1T33 A;  4FTH A;  3A01 A;  1C0W A;  1FZP B;  2E19 A;  2RAS A;  2PJP A;  2M8G X;  3V6G A;  3K70 C;  4A3D J;  5HS8 A;  2YS9 A;  1XSD A;  4QLC U;  2VQG A;  4D5F A;  5JHF A;  3CJR B;  4Y15 A;  2PMZ A;  2MGQ A;  1MMA A;  1EF4 A;  2FOW A;  4U88 A;  3G4S I;  1VF9 A;  2P6T A;  3FXK A;  1IN6 A;  2NVU B;  4B3X A;  2HZT A;  1J7K A;  2NS0 A;  5DM6 F;  1WWX A;  3OYH A;  3CCE I;  3IAS 2;  4M6Y A;  2HOE A;  1ZLJ A;  3EYY A;  4IEJ A;  5LGN A;  2REK A;  4M3F A;  3QPT A;  3KEQ A;  2BY2 A;  2CUE A;  3D5S C;  3AG1 H;  2ZME B;  2W82 A;  3H9G A;  3SDG A;  3DXJ F;  3ZQQ A;  3SWH A;  3HHH A;  3CP8 A;  3OYM A;  2DT6 A;  5JVT A;  2PZ9 A;  2K86 A;  4BE0 A;  3K4M A;  3QP6 A;  4E7L A;  3E0J B;  5TGT A;  4G6Q A;  1ZLK A;  3W6J B;  3ZXS A;  5BPD A;  3F3X A;  1IN5 A;  2L7M P;  3AG4 H;  4L5I A;  5D5X B;  3S3N A;  1UG0 A;  1HF0 A;  3CUQ C;  4Z2Y A;  3CCJ I;  1VND A;  2VT3 A;  4DZJ A;  1QNT A;  1R1U A;  3CRJ A;  3J81 Z;  1B1B A;  2A3S A;  2O7O A;  3L2R A;  4HQM A;  2DQL A;  3QPH A;  1P2F A;  5KAI C;  2EZI A;  1GVJ A;  2P7V B;  5LGT A;  2JMW A;  5FRO A;  3QYE A;  3RKQ A;  4OIR F;  4FX4 A;  1VQM I;  2KIF A;  4YFN F;  3ABL H;  2Z9O A;  2NOG A;  2D5V A;  4EM1 A;  2XV4 S;  3ERM A;  3HL2 A;  2RAE A;  3IRQ A;  1GV5 A;  3ZQ7 A;  2IBD A;  4UB6 C;  3V7R A;  1OYI A;  2M7B A;  2NNY A;  2M87 A;  3BG5 A;  1YIO A;  1T2K A;  1LFU P;  4ESB A;  2QCO A;  2XSJ C;  4KIS A;  2EK5 A;  3TGN A;  2ZCX A;  3KET A;  1T08 B;  4NB5 A;  3KKD A;  2Q0O A;  2DN0 A;  2DA1 A;  5IYC J;  1YRN A;  4BNC A;  1H9T A;  2EH3 A;  1N78 A;  2V1D A;  1EH6 A;  3MZ8 A;  1WCM J;  1R36 A;  1DDN A;  1BR1 A;  3HHG A;  3OSG A;  1FYL A;  1QBJ A;  1FLI A;  2HQA A;  3D0S A;  2FMY A;  3LWF A;  3Q9S A;  3SEZ A;  1O4X A;  3HGG A;  4EV0 A;  3EUP A;  2JVG A;  1E3P A;  2R92 J;  3CD6 I;  2MYS A;  4BEH B;  1ACI A;  4BJT A;  3KP6 A;  3WTS C;  4A3F J;  1IN4 A;  2A5W A;  1MGT A;  4E70 A;  3GTG J;  1BM9 A;  1KU9 A;  3WTT C;  3H3Z A;  4E7S A;  2BGC A;  4X1E A;  4MEY F;  1YQA A;  3H0D A;  5C4X J;  1H9G A;  1S9H A;  2O03 A;  4XL9 A;  2XSD C;  3WE3 A;  3CUQ A;  3OV8 A;  4IHS A;  3K4N A;  2O3F A;  1Y8R B;  2DMP A;  5F27 A;  3M3Y J;  1MNE A;  1T6S A;  2L3D A;  1FSH A;  3SQN A;  3KFW X;  2CWE A;  1IC8 A;  1A6I A;  5HDN A;  2OC6 A;  1PUF A;  3CZ6 A;  4Q5S F;  1WZ2 A;  5EEA A;  2IA1 A;  2XAQ A;  2CW8 A;  3CO7 C;  3AQT A;  2XKO A;  3AAF A;  4QWQ A;  2HR3 A;  2NS7 A;  2R7S A;  2WY7 Q;  2DQR A;  3ABM H;  2MH9 A;  3H9Q A;  3OIP A;  1TZL A;  2HKU A;  3CLO A;  1RR7 A;  1I50 J;  2E7W A;  4KIG A;  3O2P E;  1PP7 U;  1SD5 A;  1XB4 A;  1WJE A;  5IOZ A;  2HVS A;  2R7D A;  4BS9 A;  4IL6 C;  4IXA A;  1TNS A;  2LKP A;  5FD6 A;  2R7O A;  4A2U A;  2VOO A;  2EPF A;  2CFX A;  2F5V A;  3E5X A;  3FZV A;  3LSH A;  4HSR A;  3U9G A;  5DYM A;  3CCU I;  3HGY A;  4L9N A;  1Z9C A;  2WTE A;  1I6X A;  1JT0 A;  3BR5 A;  1RKW A;  3S2W A;  3OYI A;  3LSG A;  2HQ5 A;  4YII A;  1EV7 A;  2VKH A;  3ZQH A;  4A6E A;  5TIS C;  3J80 K;  3M8J A;  3ZN1 A;  3VOD A;  2H09 A;  2EFN A;  3ZGK A;  3SDB A;  3GUD A;  3KLN A;  4C2T A;  2NYX A;  4L0Z B;  2ZFW A;  2WWY A;  4EGZ A;  2L02 A;  3HE0 A;  1BC8 C;  2L4M A;  2W85 A;  4L9J A;  4KWA A;  3JRB A;  5B1B H;  3ZN0 A;  1YJW I;  1N77 A;  1QVT A;  1HCR A;  2P5L C;  1FIP A;  1MBF A;  5TRD A;  4GFB A;  2QEN A;  4GYI A;  4D5C A;  3DEU A;  4LLG F;  3I54 A;  2CV0 A;  1K61 A;  3S1M J;  2V79 A;  3FXU A;  2VOD A;  5LGU A;  5HS7 A;  4KIF A;  5F6F A;  2DOE A;  3QU3 A;  2ZSH B;  4OD4 A;  2CW0 F;  1MDM A;  1QZY A;  2IS2 A;  4BBS J;  3KZ9 A;  2EB7 A;  3QOP A;  4B1R A;  1RKT A;  4ZDL A;  1BW6 A;  2XAS A;  3OYE A;  2RV8 A;  2DAO A;  1W7P B;  4BE2 A;  1D3Y A;  2M3A A;  3HRS A;  4CO8 A;  1Q1V A;  3DQV C;  1JKQ C;  1Z3Y A;  2GOX B;  1IRG A;  4K2E A;  3H5R A;  1SMY F;  2LTP A;  4RGS A;  3RSN A;  1JE8 A;  2AS5 F;  4BU2 A;  5K7H A;  2AO9 A;  2BY3 A;  2KRC A;  4HDV A;  1R4N B;  5L3C A;  3LSM A;  4JL3 A;  2KIS A;  1MMD A;  2CUF A;  1S5L C;  2UZK A;  5L3D A;  3VP5 A;  2KFD A;  1ORK A;  2Y69 H;  3R4K A;  3SXY A;  1QRY A;  1XMK A;  2DJN A;  2VBX A;  4M9X A;  2OQG A;  4RGR A;  4EMS A;  4FHT A;  1AKH B;  5CVJ A;  3K0L A;  2TCT A;  1IV8 A;  5C4Y A;  1SVM A;  3T8R A;  5K58 A;  3BY6 A;  1RIO H;  4U7D A;  4LLN A;  1SFU A;  2DOD A;  3HOU J;  3IL2 A;  3A0B C;  3JR9 A;  4AYB N;  3CUO A;  2PBI A;  1WGX A;  4RGU A;  3MKL A;  3ASO H;  2EZK A;  3CMA I;  3EYI A;  4NUB A;  2ZY9 A;  3I4N J;  4HX8 A;  3L2V A;  4HV5 A;  4M3B A;  1CF7 A;  3UKG A;  3BNI A;  2IS4 A;  1IRX A;  5IPA A;  1BOA A;  1ETQ A;  1QPM A;  3LA2 A;  3ELK A;  1TW2 A;  4JQF A;  2BY0 A;  1X3W B;  2HDC A;  3JSO A;  2CH0 A;  2WB1 A;  3VTI A;  4A5N A;  5D5V B;  3G56 A;  2AXT C;  1X1A A;  4HEA 2;  4IF4 A;  4Z6Y A;  2LMD A;  2JA8 J;  2X48 A;  1Y8Q B;  1IW7 F;  1JHF A;  5FB2 A;  4FET A;  1LEA A;  1UHM A;  3I4M J;  1UST A;  2PQ8 A;  2FD5 A;  1DU0 A;  1J9I A;  1MBH A;  5D18 A;  3K1M A;  5EG0 A;  2HYF A;  4UVA A;  3HTI A;  4YEJ A;  1X4O A;  4W1U A;  2IEK A;  3ZOB A;  2NRA C;  1MMS A;  4UNO A;  3V8K A;  5D8K B;  2QKO A;  2M0C A;  3IKV A;  3K7A J;  1XPX A;  2KJC A;  4BAY A;  1FMW A;  2Z16 A;  4DBR A;  4XKC A;  3HOW J;  3NWS A;  3L7W A;  2L7K A;  3DPT A;  1I27 A;  1T56 A;  3G1O A;  3DWL E;  1OLT A;  3CCV I;  4U0W A;  2GM4 A;  4BJ6 C;  4PJ0 C;  3O8G A;  3K1P A;  1LDK B;  1WRJ A;  3E5Q A;  3KNW A;  3LMM A;  3SYT A;  1Z3X A;  1FC3 A;  3HOT A;  1LUJ B;  1MMN A;  5IP9 J;  4A5M A;  4GFL A;  1TQP A;  3CES A;  1ZAR A;  3OYN A;  1MD0 A;  1HST A;  2LKX A;  3V42 A;  2IU5 A;  2JUG A;  1DU6 A;  3ABU A;  2QWT A;  1B8I A;  4I09 A;  1JUS A;  1QHG A;  1ODD A;  2BHY A;  2CRG A;  2P4W A;  4HOB A;  4ZC3 A;  3C07 A;  3PIO F;  2ZJR F;  1TWH J;  2ZJQ F;  4XKB A;  2HDD A;  2HYJ A;  4LIU A;  1TL8 A;  3ZMZ A;  1IXR C;  2YU3 A;  2A2F X;  3LQQ A;  2QGU A;  3F22 A;  4KN4 X;  1Z7L A;  4UXN A;  4XBF A;  1QHH D;  1FMV A;  3L9F A;  4G6T B;  2FE3 A;  3GME A;  4CZZ A;  4XSZ F;  2W57 A;  3BR1 A;  2M4K A;  3RJP A;  1V5G A;  5E1X A;  2OD5 A;  5JI6 A;  4XRM A;  3WU2 C;  5M5W J;  4KDP A;  1U5T A;  2GWR A;  2PMU A;  1X2M A;  4ZH4 F;  3HTH A;  2FOK A;  5FLM J;  4WIB A;  3Q0V A;  5L3E A;  3BCA A;  3HZJ A;  2EQR A;  1KQ8 A;  2QBY A;  1G3T A;  2BOL A;  2GA1 A;  1QVU A;  2M1B A;  3KP7 A;  4A3E J;  2WAQ N;  3EET A;  1MZB A;  3MMY B;  4XSX F;  5DCF A;  1DP3 A;  3MN2 A;  2L0K A;  1WSU A;  2H1K A;  1EH7 A;  3KP4 A;  2AQF A;  4A3K J;  1PJR A;  3WTU C;  4RDU A;  4U87 A;  3TOB A;  3O3K A;  5J4Y A;  5LHH A;  1YTY A;  4CHU A;  1VQ8 I;  4XOT A;  2O8X A;  3JCU C;  1KON A;  3FX3 A;  1WVR A;  2A6T A;  1LQ1 A;  3BRO A;  1HXD A;  4DYR A;  1QZE A;  5JR3 A;  5ERI A;  2EIK H;  4D7M A;  3CCR I;  3RTR A;  3QKX A;  1XD7 A;  3IH3 A;  2GIZ A;  3Q9V A;  4MQV A;  1B72 B;  3IWF A;  4C2M A;  5HOD A;  3VVX A;  4KMU X;  1LEB A;  2QM3 A;  5GTH C;  1RI7 A;  3DU5 A;  2M0M A;  3PSF A;  3VYS B;  5A2Q K;  4CGZ A;  3HTJ A;  3LWJ A;  5F08 A;  4KYW A;  3TO9 A;  1X19 A;  5FFZ A;  2FJ1 A;  3D5L A;  2EIL H;  3C2H A;  1ETV A;  3MD2 A;  3VPR A;  3VUQ A;  2DA3 A;  1D0X A;  1RNL A;  1V55 H;  2R7F A;  3AL0 C;  1EA3 A;  2CGP A;  2G7H A;  3PO3 J;  2NXN B;  4B09 A;  3KE2 A;  3U1K A;  3CCQ I;  4B4C A;  3Q0U A;  1I39 A;  2OA4 A;  2F5F A;  4CUG A;  3REO A;  4IJA A;  2E1O A;  3ZP5 A;  1G3Y A;  2COM A;  4ABZ A;  2HZD A;  4YG2 F;  4EVI A;  1J09 A;  5KAF C;  2ZFU A;  2L7Z A;  1ZH5 A;  4MLO A;  4RB0 A;  1WHU A;  2XGE A;  1MH4 A;  4KFC A;  2Z99 A;  1IUF A;  5F0H A;  2P5K A;  1A35 A;  5D4S A;  3JRG A;  2DG7 A;  4QPQ A;  2ZCN A;  1YYV A;  1Y0U A;  3LAP A;  4C2U A;  5CXG A;  3I9V 2;  2VPL A;  3M1E A;  2HEO A;  4B8X A;  2R5Z B;  2CS3 A;  4UVB A;  4IOA F;  5E3N A;  1J5Y A;  2FBI A;  3RKW A;  2OUM A;  4DOZ A;  2LF8 A;  3TBI A;  2ADU A;  4XON A;  5CYV A;  5L3F A;  2WAE A;  3MCZ A;  2DXI A;  1RR8 C;  4PXI A;  1MH3 A;  1BJA A;  2E1N A;  3BQY A;  3W2V A;  4CZC A;  1Z1D A;  4OAY A;  3TKY A;  2Q2E B;  3V8J A;  3DEW A;  4JP0 A;  1IJW C;  1ZRE A;  5E3M A;  4KIB A;  3NWT A;  1REP C;  3CWR A;  1R5I D;  4B47 A;  3S1N J;  3SFI A;  2L2O A;  2IGO A;  3ECH A;  2XAH A;  1RES A;  3MZY A;  3FKI J;  3JAM Z;  2HQN A;  5H2F C;  4C3I J;  2DA2 A;  1GT0 C;  4BY7 J;  4N4N B;  5HLH A;  2FUG 2;  3BLY A;  3QPL A;  1JTX A;  2XB5 A;  2BVM A;  2DFH A;  1E2X A;  3G1M A;  2LK2 A;  4P96 A;  5KNL A;  2EIN H;  1SVL A;  4HA8 A;  1MSE C;  4DGW B;  1VQN I;  1H89 C;  3M4O J;  1D5V A;  1H8A C;  1I3A A;  4M6X A;  1NHA A;  2EIJ H;  3FMR A;  2CSO A;  4XM3 A;  1ZRD A;  3FXO A;  1BIA A;  2IXS A;  2HWV A;  1YFH A;  2Q24 A;  1MJB A;  4KUM A;  2B1E A;  4CSW A;  2L01 A;  1I1S A;  3EGQ A;  5FGL A;  4RB2 C;  3HTA A;  1KQ9 A;  1ZRF A;  3CDH A;  5K7F A;  2VQH A;  1G59 A;  4G12 A;  1G3W A;  1W5T A;  2WAQ A;  1B6A A;  1ZGW A;  1I6H J;  1O3S A;  3L2U A;  1R7J A;  3J81 K;  3AKZ A;  1OR7 C;  3KP5 A;  4E7I A;  3VVY A;  5EDN A;  4MXM A;  2YX4 A;  4AIJ A;  2KMU A;  1LVA A;  4OMY A;  1MKM A;  2ID3 A;  3BG3 A;  3RI4 A;  2KT0 A;  3VYR B;  3K69 A;  5H9T A;  3BG9 A;  1OCT C;  2R7X A;  3HRU A;  3S1Q J;  2CQX A;  5JHU A;  3I0T A;  3ABK H;  4BQQ A;  4A3C J;  3FHN A;  1VQK I;  1YLF A;  2Q1Z B;  2MA3 A;  1SVO A;  2VN2 A;  4XLC A;  5EZH A;  1LE8 A;  4JYK A;  5DDG A;  1OCO H;  1G3S A;  3KKC A;  4M6V A;  5D6E A;  1HKS A;  2PFV A;  3M9A A;  2XPU A;  1U0J A;  1X3U A;  2ZO4 A;  5E3L A;  2K40 A;  4CCJ A;  1F43 A;  1QU3 A;  1XG1 A;  3LA7 A;  1U6G A;  4OIN F;  4E6K G;  1KZH A;  2X0L A;  1IF1 A;  1TWG J;  2ZCM A;  2DOA A;  4PGH A;  2QQB A;  4PUS A;  3BDD A;  2LG4 A;  3BTL A;  4UY8 I;  2M30 A;  2OTL I;  3OS2 A;  1RZ4 A;  2Z1D A;  3GLX A;  4CYC A;  2DTZ A;  2VE9 A;  2OF7 A;  1S3J A;  4KNY A;  3GTQ J;  1R1V A;  1Z67 A;  2CYY A;  3P9I A;  2Y2Z A;  4Q4Z F;  4HF1 A;  1WJC A;  4M3G A;  4A69 C;  4YIR X;  1H0M A;  3E5U A;  3VW0 A;  2H94 A;  4IHT A;  5LBQ A;  4A6D A;  4XLH A;  1OR7 A;  4AU7 A;  1HKT A;  3ML6 A;  4OAZ A;  3PL8 A;  1JJ8 C;  2R7T A;  1UJ8 A;  1BI0 A;  2Y75 A;  1HDD C;  1V3F A;  2VXD A;  3G2B A;  2OPT A;  4CCL A;  3OYK A;  2X1D A;  2X1E A;  1G2H A;  3DBL B;  3RQI A;  4GYG A;  3CMY A;  3GFM A;  5C3E J;  4C3H J;  5DCM B;  3CC7 I;  1JXS A;  3FBI B;  3HRM A;  3RZD J;  5CVR A;  2W1O A;  1Y0N A;  5ICF A;  3A01 B;  5E79 C;  2DFI A;  3G73 A;  1O7L A;  5E1Z B;  3ZCO A;  1XDS A;  1BC7 C;  2ZJP F;  4LG0 A;  2PN6 A;  4ZYA A;  2ETH A;  4HAM A;  4IHV A;  2DPD A;  2R5Y A;  5IY5 H;  5F0F A;  1YW8 A;  4LMY A;  3SZG A;  4LB6 B;  4WCG A;  3HTS B;  1Y56 A;  3CCM I;  1MBG A;  5K7Z A;  2E1C A;  1AOY A;  1EH8 A;  2HVQ A;  1X3Z B;  2CMP A;  4ZTF A;  2P5V A;  1YHQ I;  2DFF A;  2P7C B;  5DD8 A;  4YRV A;  3T5X A;  1RRJ A;  4F92 B;  1U9N A;  1SAX A;  1ONV A;  2HQR A;  2Y9Z A;  4HX7 A;  1FP2 A;  3IRR A;  1D0Y A;  2HOS A;  3DPL C;  3D1N I;  2G3B A;  3SZP A;  1W0T A;  2V6E A;  2O7T A;  2ZNZ A;  4NNJ A;  4HRI A;  4C9Y A;  1JKR C;  1ZG1 A;  4NEL A;  1OYY A;  2GIV A;  2QZ8 A;  4AID A;  5FLX Z;  1VQL I;  3CCS I;  3CJN A;  3L09 A;  4ETS A;  2K9L A;  3MQ0 A;  4BQA A;  2OU2 A;  4XLA A;  2XAU A;  3BR2 A;  2RGV A;  2IGN A;  2JJ7 A;  1R00 A;  3DLA A;  5GP9 A;  2LY2 A;  3V7S A;  3TW7 A;  1ZRC A;  2DA5 A;  2K27 A;  3COA C;  3QYF A;  4G6D A;  2MLG A;  4JBA A;  3JRA A;  2F5E A;  2X4H A;  5IT9 Z;  5BQT A;  4A3L J;  4XR6 A;  2LVS A;  5D5U B;  2M45 A;  4H4K C;  3RQ4 A;  2UXX A;  3OMY A;  2DOF A;  2XIG A;  3KEO A;  2RC4 A;  4OIP F;  2KJB A;  2UXP A;  3ZQI A;  4M72 A;  4G7O F;  1NK2 P;  5E20 A;  3P5J A;  4I7H A;  4BE1 A;  3C2G A;  4XLF A;  1D5Y A;  2WUI A;  4XLE A;  2F6C A;  2HXI A;  5B66 C;  3NRG A;  3S2H J;  3RKY A;  3BTI A;  5LHG A;  1YRN B;  4S0H B;  2UXH A;  2DYR H;  4D9J A;  5ILV A;  1MJA A;  2NVX J;  2FA5 A;  3JSP A;  1K79 A;  1K6Y A;  2FJI 1;  1FOW A;  2JK3 A;  3M8F A;  5ICG A;  1I5Z A;  1P7J A;  1MBE A;  1R71 A;  2LOO A;  3TDU C;  1AWC A;  3JSJ A;  4I99 C;  3MZH A;  4S04 A;  2HKO A;  2QIB A;  3E7Q A;  2CUZ A;  4D7N A;  3DPU A;  3DCF A;  1S8N A;  4G9Y A;  2GXB A;  2CQ7 A;  2K4J A;  3CUQ B;  3E1S A;  1L0O C;  1YW9 A;  1OKR A;  2X6O A;  3DEE A;  3S93 A;  3MKZ A;  1Z6R A;  2DK8 A;  2XF6 A;  4B44 A;  2PI0 A;  4RS8 A;  2EFO A;  5GTI C;  5H20 A;  5FLV A;  2W24 A;  3H1C A;  1JKP C;  3FKJ A;  4IVN A;  3BWG A;  1PUF B;  1JJ6 C;  2FQ3 A;  1SAU A;  3HUG A;  4B43 A;  2ESH A;  3W2A A;  3T8T A;  3ANP A;  4I2O A;  3KPH A;  2R3S A;  3RYP A;  4LK1 F;  1SEU A;  4Y13 A;  2P8T A;  4HPQ A;  4QIW N;  2YUS A;  4KMF A;  3R61 A;  1WKM A;  1G4D A;  3KZY A;  3AQS A;  1R5H A;  4I02 A;  2ECC A;  4XOP A;  3VOE A;  1E3H A;  3FIW A;  5H6Q A;  2FRH A;  2VJ4 A;  4LJZ F;  3G7R A;  4PJM A;  1BBY A;  4KN7 X;  4PJN A;  4N0B A;  3CC4 I;  1VQP I;  1U2W A;  1I3Q J;  4RAG A;  2XGD A;  5IP7 J;  2TDX A;  5FMP A;  2RVC A;  3WG7 H;  1JHH A;  2VJJ A;  3F72 A;  3I58 A;  3E6B A;  4R8H A;  3I56 I;  3A03 A;  2V9V A;  2WGB A;  3CJD A;  2MW8 A;  1D0Z A;  5FD5 A;  1SFO J;  3MEX A;  3H35 A;  3BG7 A;  3F9K A;  2QQA A;  4PJJ A;  4RAF A;  2FU4 A;  3W6V A;  1R23 A;  1K7A A;  2LP0 A;  5TJJ A;  2ESN A;  2XHK A;  3J7A Y;  4YZE A;  4JOM A;  3F23 A;  3GFI A;  1ZTR A;  1B59 A;  2DJI A;  1Y1V J;  4NC7 A;  3L00 A;  3HC7 A;  1RC9 A;  2VJ5 A;  1VQ9 I;  2IT0 A;  1P7I A;  4L5J A;  2QYO A;  5F0C A;  3F1B A;  5LEK A;  1SGM A;  4IRV A;  2DA7 A;  2OAZ A;  4Q47 A;  4AVP A;  1MDM B;  2CQK A;  3DV8 A;  5DS9 A;  3V4G A;  1TNT A;  3U21 A;  3IP4 B;  2OTJ I;  3HBL A;  1DUX C;  3IUV A;  5DTD A;  3ISP A;  5HBU A;  1BI3 A;  4H0E A;  2Q8K A;  1DP7 P;  3KCC A;  2QSF X;  1F4K A;  1OMI A;  3DKW A;  1T95 A;  3HRT A;  1TWF J;  1YE9 A;  5GAD J;  4BHC A;  4CGR A;  4AM3 A;  3RH2 A;  3OWT A;  3I59 A;  3T0Y A;  3S32 A;  3HSR A;  2BEO A;  2JT1 A;  3W2W A;  1Z77 A;  4A93 J;  3VYT B;  1JUP A;  2JA7 J;  4G7H F;  1VQ7 I;  1TP4 A;  2DCE A;  3TQN A;  2G7G A;  2FBK A;  2HXO A;  4ZYG A;  3MKW B;  5HLI A;  2G7S A;  4J00 A;  1UEL B;  2B0L A;  4O6J A;  3ON2 A;  3F6V A;  1HBX G;  3I3L A;  4YFK F;  1IDY A;  3JRD A;  1U8R A;  1WJB A;  1WFX A;  3CDI A;  4RGX A;  1P4X A;  3ZQF A;  4FIS A;  2E7X A;  1CF7 B;  2JA6 J;  3E3V A;  2DT7 B;  3U1D A;  4NQW A;  1TC3 C;  2GQQ A;  4E7H A;  4J01 A;  4UDS A;  5B3S H;  2KDZ A;  4XKW A;  5J4V A;  4ZYD A;  3L1P A;  4II2 A;  3CO6 C;  4ENM A;  2UXI A;  4HG2 A;  3GZ6 A;  1UG2 A;  2OZ6 A;  3C3W A;  2R7Q A;  3F21 A;  1X2N A;  2NX4 A;  2O8K A;  1HW2 A;  2GA2 A;  2JPC A;  5EFY A;  3FIS A;  1WJD A;  1UI5 A;  3EPZ A;  3JTH A;  4JK1 X;  4WK8 F;  5BNG A;  3LJL A;  3S1R J;  4B3A A;  2GZW A;  4GFK A;  3E6C C;  3UNG C;  2V57 A;  1W5S A;  2DFE A;  3ULQ B;  1VQ5 I;  4BGD A;  4ZZL A;  5EG0 B;  1MND A;  4E7K A;  3O8H A;  3GXO A;  5EJC A;  4RMN A;  4HLX A;  5IYB J;  2FQ4 A;  1FEX A;  3R0A A;  2PFB A;  5CPR B;  5FKO A;  1OPC A;  4UUT A;  4L0Y B;  3RCO A;  2BV6 A;  2I5U A;  2HGC A;  1I1G A;  1QO0 D;  2LY1 A;  1O3T A;  1N25 A;  3NAU A;  1U5T C;  4BY1 J;  3H3U A;  3KIO A;  4ON0 A;  4ME9 A;  1BR4 A;  1KU7 A;  1IGN A;  5AIP A;  4NC8 A;  1PYV A;  5HNH A;  1UFM A;  1IAW A;  2X9D A;  3V78 A;  5ED4 A;  2FXA A;  4GDF A;  1T39 A;  3EUK L;  2QTQ A;  1UCR A;  4PGG A;  4HST A;  3BTJ A;  3N4M A;  2Y0S N;  3GEZ A;  1XMA A;  1O7F A;  4QPO A;  2GLO A;  1MBK A;  3WGG A;  1OCR H;  1HOM A;  4A3M J;  4KIT B;  3J7Y J;  3M8E A;  2JA5 J;  5IOY A;  2GXA A;  3FF5 A;  3COL A;  3MKY B;  4MK6 A;  3B6C A;  2DI3 A;  5HDG A;  2L9N A;  1XMX A;  4LB5 A;  1ON2 A;  4I0B A;  1D1B A;  4F7Z A;  3GO5 A;  1R6R A;  2EA2 A;  2WC2 A;  3OIQ A;  1B8I B;  3HOY J;  4DVY P;  2AXL A;  3ONQ A;  2ZOZ A;  2RNJ A;  3KP3 A;  3PQK A;  2RN7 A;  4CCN A;  2XC7 A;  1T0F A;  2KIQ A;  2LR8 A;  3JAM K;  4BXX J;  4OD5 A;  2CUJ A;  2M34 A;  3OR1 C;  4BAC A;  2NVQ J;  2VBW A;  2E71 A;  3OOU A;  1VQ6 I;  2YVX A;  2BW3 A;  4NDL A;  2R7U A;  4GO1 A;  2YSR A;  3CTA A;  2K9M A;  3NQO A;  3I55 I;  1QA6 A;  1B4A A;  2PJR B;  5HVQ C;  4LIT A;  4RLF A;  3MWM A;  1W4M A;  1KYZ A;  1LKX A;  3BJ6 A;  2RHA A;  2UUZ A;  4KT5 C;  2PG4 A;  1OCC H;  2VL8 A;  4BYY A;  1BL0 A;  2O9L A;  1IUY A;  2NP3 A;  1QGP A;  5HDK A;  4ICH A;  4IRG A;  4ASN A;  3OOP A;  4MNU A;  4ZYH A;  3K2A A;  2EJR A;  5CLS A;  2F4M B;  2E1M C;  2X51 A;  2EWN A;  1ENH A;  5GAG J;  1JGS A;  1XTA A;  2XGC A;  3GTM J;  5FGM A;  2QBY B;  3L2Q A;  1ZG3 A;  4ACI A;  1VI0 A;  1P4A A;  1HSJ A;  3SHF A;  5EGO A;  1A5J A;  5J8C A;  2XAJ A;  3WU0 A;  2M9H A;  3BR0 A;  4GXO A;  5JLX A;  3TW6 A;  4XRS G;  2LY9 A;  5DM7 F;  2IA0 A;  3Q0W A;  4NC6 A;  4AYB A;  2LH9 A;  3S17 J;  4BL0 B;  3OL4 A;  3CJT B;  1RUN A;  4EJV A;  2OI8 A;  1LFB A;  1KGS A;  3BQZ A;  3PUB A;  2V26 A;  4DBQ A;  1OQY A;  2ZB9 A;  3B02 A;  1PDN C;  5FHP A;  1M1E B;  5CXI A;  2HTS A;  1P9Q C;  2DBB A;  2WV0 A;  3ECO A;  2N8G A;  4EJO A;  1JGG A;  3GLL A;  2DMU A;  3HEF A;  2ISZ A;  1S72 I;  2V1U A;  1Y6I A;  4F91 B;  1F36 A;  1FJL A;  3QAH A;  4RB1 A;  4HYE A;  5FRN A;  2CG4 A;  4BKX A;  2GAU A;  1HW5 A;  2XB0 X;  5DEQ A;  2A6H F;  4A3I J;  1AA7 A;  1IN7 A;  5B5E C;  2XPV A;  3QPS A;  2KHM A;  2PLY A;  2QLZ A;  4CDG A;  5F1R A;  2RNG A;  3C18 A;  4HZF A;  3GTL J;  2UWM A;  3I71 A;  2DTR A;  1Z91 A;  2LBF A;  1E0E A;  3GZI A;  3EUA A;  4LOC A;  4A3J J;  2ECB A;  2JVH A;  2W4S A;  2E1M B;  4AF5 A;  1V54 H;  3E6M A;  1TWA J;  2VB6 A;  4HKU A;  1GUU A;  4XK4 A;  3K2Z A;  4HLY A;  4N9H A;  2K02 A;  1U78 A;  2PX9 A;  2W84 A;  3AG3 H;  4C30 A;  5ILU A;  5CW8 A;  3KZZ A;  4F93 B;  3BZ6 A;  4FE4 A;  4J19 A;  2STT A;  3WU1 B;  2R7R A;  3DP7 A;  3VDX A;  2V9K A;  2R4G A;  4LD5 A;  2L54 A;  3GBG A;  2A6E F;  3PNY A;  4S05 A;  3G6E I;  1OCZ H;  3D5R C;  1FNN A;  4ENJ A;  4OIO F;  2HS5 A;  3B73 A;  4E4H A;  4D0P A;  4HF2 A;  3J7A O;  5K1Y A;  4M9S A;  2ISY A;  3C7J A;  1ZEL A;  1Z05 A;  3MNL A;  3RPQ A;  3DKY A;  3K10 A;  2CFO A;  4F52 A;  1ZAO A;  3VOX A;  2JSC A;  4UB8 C;  4CYD A;  2GFN A;  2OJE D;  3S8P A;  2XVC A;  1HC8 A;  1WJ5 A;  1XSV A;  5J40 A;  3ZMV A;  3BC8 A;  4M9Z A;  1ON1 A;  3AL0 B;  2IS1 A;  3LSK A;  2L9R A;  2OV7 A;  4JKZ A;  3F0C A;  1K78 A;  2EV6 A;  5D5W B;  4AC0 A;  2F4O B;  4Y7N J;  2VUM J;  3WTV C;  3LA3 A;  5FRM A;  2E5N A;  5J3L A;  4F3Q A;  1DGW Y;  2LD5 A;  2WY8 Q;  2CO5 A;  2QEX I;  5K5R A;  4KT6 A;  3ZMT A;  2PMZ N;  2FX0 A;  3S3O A;  3GZ5 A;  3GYH X;  3ZQG A;  1W5C C;  4Y3O A;  1J2X A;  5LLQ A;  1OYW A;  2P6S A;  5DV5 A;  2JZY A;  2KDO A;  2BXY A;  5FLX K;  3OYC A;  2HDW A;  4ZDP A;  3E7L A;  3WTY C;  3CP2 A;  1X1B A;  2ZXI A;  4AWX B;  2XDN A;  2DT5 A;  3LAJ A;  3L2W A;  3K4K A;  4Y17 A;  3PUF A;  4ESJ A;  2UXU A;  3HXL A;  2MAB A;  1A36 A;  4LIV A;  3VB2 A;  1VQO I;  5FKK A;  1QQI A;  5IT9 K;  3BP8 A;  1TTY A;  2D1H A;  2EFQ A;  3QWL A;  4P1W A;  2IRF G;  1SFE A;  2V1N A;  2K3P A;  3VEP A;  2LKS A;  5DD4 A;  3OYF A;  5DUK A;  2COB A;  3A02 A;  4EM2 A;  3F6O A;  5FFX A;  3OS1 A;  4PCQ A;  2GOM A;  1S29 A;  1T98 A;  3M07 A;  4EGY A;  1IRF A;  1GXQ A;  1V5E A;  5BS6 A;  2RQQ A;  2VQC A;  3OSF A;  1OJL A;  2F5C A;  3WTZ A;  1LE8 B;  2BE5 F;  2QA4 I;  2VKD A;  3DF8 A;  4UUS A;  2VQL A;  2VOP A;  2J5P A;  3K8P C;  4XMY A;  3CMM A;  3JRH A;  4CIC A;  1FP1 D;  1W0U A;  4MGR A;  3HG9 A;  1Z6T A;  3VSK A;  4RAY A;  2R7Z J;  4FCY A;  2V7F A;  1HLV A;  3A2K A;  4Y4R A;  5KVR A;  2P81 A;  3FBN B;  1XC5 A;  3BG6 A;  3LL7 A;  3LSI A;  3NRV A;  4MO7 A;  4ZYE A;  4C2M J;  2BBY A;  3O6B B;  3GEU A;  1XS9 A;  3H36 A;  4CYC B;  3FMS A;  1UI6 A;  3LOC A;  3G71 I;  3SZT A;  3A0H C;  4DQ2 A;  4ENN A;  3NAR A;  4MQ9 F;  5F64 A;  3IC7 A;  1W36 C;  2M5W A;  3NEU A;  2F48 A;  1FYM A;  2MH2 A;  4FX0 A;  2O0Y A;  2P0W A;  2HOA A;  4R79 A;  4RBO A;  4HF0 A;  3EUH A;  4MFE A;  3E97 A;  5GPC A;  3PIP F;  4IPA A;  2KQR A;  3TO7 A;  2OQR A;  1UAA A;  3O60 A;  4IO9 F;  2DU9 A;  3LSJ A;  1LVK A;  4PSW A;  3B81 A;  1AHD P;  3TOA A;  3WOD F;  3NNR A;  3VOK A;  4EJT A;  3I5U A;  4HQE A;  2E2J J;  4V19 K;  3KEY A;  4V2G A;  5J1R A;  2CJJ A;  3DLL F;  3PNV A;  2QKL B;  1ZGA A;  1FOX A;  3PAS A;  5D8L B;  3NPI A;  4X0G A;  1JT6 A;  1ZG5 A;  2O61 A;  1SFK A;  3HOZ J;  4LG0 B;  1P92 A;  1R1T A;  2B3W A;  4BDY A;  1K4S A;  3V8L A;  5FJ8 J;  2QSG X;  5DAJ A;  4AC6 A;  3HIF A;  3PFY A;  1U3E M;  3C2B A;  4B48 A;  2MD0 A;  3RIR A;  3GFL A;  2JPB A;  2NVY J;  4UVC A;  1U8B A;  1IG7 A;  1W36 D;  4FQG A;  3ABT A;  1UZC A;  5BPI A;  4XLP F;  2GEN A;  1TLH B;  2WAF A;  1FBU A;  3K4C A;  3K4J A;  3OR2 C;  4GCV A;  3H5N A;  3VSL A;  4A3G J;  1X1P A;  2V4J C;  2CW7 A;  3C1D A;  2NVT J;  4BXF A;  5CQE A;  2W25 A;  5D1R A;  3KYC B;  4XIC A;  2X1C A;  1D8K A;  1FY7 A;  1UB9 A;  4MTE A;  5E18 F;  3TMO A;  4G7Z F;  2DK5 A;  1UHS A;  2C6Y A;  1GVD A;  2XGX A;  2ZOY A;  4NN1 A;  3H3V K;  2JWT A;  4I0A A;  3IV5 A;  2ZME A;  1TT0 A;  1YI2 I;  2E5Z A;  2LLK A;  1XCV A;  4YIF A;  2FML A;  1ZR4 A;  2Y30 A;  3DBR B;  3IH2 A;  4A0Z A;  2D2W A;  4F55 A;  2NAZ A;  2MSY A;  1UMQ A;  3IH4 A;  4RA2 A;  2F07 A;  1G6N A;  2PBX A;  1GHC A;  4LK0 F;  4PSX A;  4W97 A;  4DW6 A;  2A05 A;  2DA4 A;  2EA4 A;  4DNC A;  2D45 A;  2L9S A;  2B9S A;  2KZV A;  1TW3 A;  4HV6 A;  2Z2S B;  1Z0X A;  3LHQ A;  1NK3 P;  2IA2 A;  5LEJ A;  3K70 D;  2VC0 A;  1RUO A;  3CC2 I;  2X6Y A;  5B1A H;  2K85 A;  1SFX A;  3EDP A;  4EJW A;  3I4P A;  4IHW A;  4I98 B;  2JUC A;  2CU7 A;  4AIH A;  4ZDO A;  1YX3 A;  1FPQ A;  5D6F A;  1K6O A;  3HTU A;  2HPM A;  3J7Z I;  2WA0 A;  2F2E A;  1U9O A;  2HU9 A;  2HYG D;  2XPW A;  2ZBK A;  4MHG A;  1O3R A;  1KQ0 A;  2IGM A;  4Y33 A;  4UV8 A;  4G8X A;  1WI3 A;  2QWW A;  3ZPL A;  3NS4 A;  1TT5 B;  1LJ9 A;  4U7B A;  3A4C A;  4N4O B;  1WJA A;  3WGH A;  1XGN A;  4IX7 A;  5J1U A;  4Q48 A;  4ZZD A;  4XN0 A;  1S7O A;  1ZYR F;  3IHU A;  3H5A A;  4O3M A;  1R4M B;  1ZQ3 P;  2YR2 A;  4BH9 A;  4I01 A;  3FM5 A;  1SC7 A;  2ZCW A;  2G9W A;  1ERD A;  4BEH A;  5ICE A;  3FRQ A;  2UXN A;  4E7J A;  5LD2 C;  3R60 A;  2XDV A;  3LST A;  4WX9 A;  3EQL F;  3OYB A;  4WXH A;  2K9S A;  2Y48 A;  5HAW A;  4TV7 A;  3F8M A;  3TL4 X;  3F8C A;  3HSE A;  1WI9 A;  4HNU A;  4UV9 A;  3E6D A;  4XRS A;  4WXD A;  4L9T A;  3QOD A;  4PZJ A;  4ANJ A;  1AU7 A;  3LNQ A;  2WB1 N;  2LRE A;  1HA8 A;  1FSE A;  3HUG B;  1FWZ A;  1ITY A;  2Y9Y A;  4U9L A;  3BCB A;  3K9T A;  1H88 C;  4QSH A;  2AQE A;  1R22 A;  5D4R A;  2EBI A;  3OL3 A;  2A69 F;  2ZXW H;  4OOI A;  1W1W E;  2IAI A;  1IO2 A;  3FXM A;  1MMG A;  2EFP A;  5HNF A;  4XQF A;  3OIO A;  1MNM C;  1N75 A;  3GF2 A;  5KCM A;  2MG4 A;  4ZJZ A;  6PAX A;  1JKO C;  1Z7U A;  2ZSI B;  4DYC A;  1GXP A;  2IW5 A;  2DDA A;  1DQU A;  1YJ9 I;  2K4B A;  3JW4 A;  3R0J A;  2LSO A;  3CCL I;  5M3M J;  5CVV A;  2RQP A;  1ETK A;  1P4W A;  2ZC2 A;  2V6C A;  4MEX F;  4JX4 A;  4BUP A;  2KPM A;  4IRI A;  1FTT A;  1EJ9 A;  1D1C A;  2G0E A;  2LDU A;  2NNN A;  5F1J A;  1A31 A;  3BTC A;  3VYU B;  3JTG A;  1OCP A;  1OIS A;  4EQQ A;  1IXC A;  1TBX A;  1UHW A;  2Z3Y A;  4WF2 A;  3VIB A;  2K9Q A;  1IZ1 A;  3F8B A;  2ACJ A;  1O57 A;  3FHZ A;  3GW2 A;  3CLQ A;  3GTP J;  2FNP A;  3FXJ A;  4CCK A;  4MIM A;  3OYJ A;  3SJM A;  4FT8 A;  2EZH A;  1YJN I;  4WXC A;  3OS0 A;  3BR6 A;  2M8E A;  3W3C A;  3G1L A;  3VWB A;  3ZQL A;  5CKT A;  1K83 J;  2QKM B;  5E3O A;  1FOK A;  1X1D A;  2H6B A;  2ELH A;  2MBF A;  4PDK A;  1LB2 A;  4I6Z A;  2FEZ A;  1SD7 A;  3A1Y A;  5F04 A;  3RZO J;  1HQC A;  2JRT A;  1NG7 A;  3T1B A;  4E7Z A;  1MW7 A;  2M2E A;  2B63 J;  1ZKG A;  5DUI A;  1GDT A;  4IKF A;  1HW1 A;  5IYD J;  4BQO A;  1USS A;  2JQ7 A;  1W7P D;  5CVI A;  2E2H J;  3KYD B;  3HYI A;  2L4A A;  5C44 J;  3SFZ A;  1KU2 A;  4OIQ F;  1VTN C;  5K5O A;  3DFG A;  3DBH B;  4HW0 A;  2A5Y B;  1O3Q A;  4GCL A;  3P9T A;  1X58 A;  3K4B A;  1IDZ A;  2I10 A;  1W7P A;  4CXF A;  2JN6 A;  1WPK A;  2HVR A;  3I59 B;  3FDY A;  1ZR2 A;  3CDL A;  3QQA A;  3ROU A;  2QF7 A;  3GFJ A;  5JVG F;  2VI6 A;  4NBQ A;  3HOX J;  2VIX A;  1IN8 A;  2R93 J;  3DTK A;  3QYB A;  2QSH X;  3FMQ A;  5ILS A;  2XAF A;  3AG2 H;  4BBR J;  4U0V A;  2M7A A;  3WG9 A;  1AKH A;  4EM0 B;  2LNB A;  4MTD A;  4BDZ A;  3JRE A;  4A3B J;  4OU0 A;  2W7N A;  3MFK A;  3P9K A;  4HNT A;  2V1X A;  1XSX A;  3ZMU A;  1FYK A;  4V2F A;  4M74 A;  3CCY A;  4YEL A;  2GUH A;  2Y0M A;  1ZHF A;  1F9N A;  2KIU A;  1V5F A;  2NOJ B;  5D19 A;  5J6X A;  3CF5 F;  1S6L A;  1MIJ A;  4NQW B;  3CME I;  1CGP A;  4XN3 A;  4DIQ A;  3RYR A;  4EJU A;  3OY9 A;  1SAN A;  1A6Q A;  3BCG A;  3Q5F A;  5C4J J;  5HLG A;  3TDZ C;  1JI8 A;  1Q1H A;  2FF4 A;  4M3E A;  3BHQ A;  1T0F C;  5HOO A;  1WQ2 A;  2IGK A;  4NHJ A;  1Y1W J;  1T38 A;  3KYL A;  1L3L A;  1YG2 A;  5HLT A;  2HFH A;  1CQT A;  3BOQ A;  4QTR A;  1ULY A;  2XKP A;  4LGW A;  1BA5 A;  4JNN A;  5CVU A;  3SEQ A;  2DO7 A;  4YFX F;  4R1H A;  3S2D J;  5E1W A;  3HOV J;  2R7V A;  4LLL A;  5EEG A;  2FSW A;  5K5Q A;  2KIM A;  4OWR B;  2K7L A;  5FKL A;  2D1V A;  3HJE A;  2DMT A;  2EV5 A;  2IVM A;  2K3F A;  3RPU D;  3DTI A;  3BJB A;  1B9M A;  4U0Y A;  3ERE D;  4IHY A;  3R6S A;  5EF6 A;  4JX6 A;  3OYD A;  2E36 A;  2QVO A;  3S5R A;  4M3D A;  1G8X A;  1TQI A;  1RET A;  3I53 A;  5H6R A;  1X1C A;  2VC1 A;  3RPU A;  2STW A;  3KX2 A;  3BZK A;  4N9I A;  5CJ9 A;  2E35 A;  1PUE E;  3VFZ A;  2ZXH A;  1YW7 A;  2MFZ A;  3WTX C;  2ZKZ A;  2K9N A;  2H8R A;  1FT9 A;  4P55 A;  4BJ5 C;  1S7A A;  1MJ9 A;  2XF7 A;  4BHP A;  2Z5U A;  1J75 A;  1POG A;  2WV1 A;  2XF5 A;  3FXR A;  3PNT A;  3BJO A;  3JRC A;  3ASN H;  3J80 Z;  2FBH A;  3N05 A;  1Y39 A;  3HPG A;  2Z33 A;  2XUB A;  4RLQ A;  3IUO A;  1XGS A;  2FBQ A;  2ID6 A;  3BPX A;  4AD9 A;  4L18 B;  3PPB A;  3HM5 A;  4RB3 C;  3M1C A;  1F5T A;  1XN7 A;  5HSZ A;  2IJL A;  3BJA A;  4JX5 A;  1DPU A;  4AUX A;  2FNA A;  2BW3 B;  3ZR8 X;  2WAD A;  4MFD A;  3QOE A;  5IP6 A;  1XDU A;  2QQ8 A;  1R9T J;  5IT3 A;  2WBM A;  2W53 A;  2ELJ A;  2CQN A;  3DKX A;  1XCB A;  3QP5 A;  3KZI C;  1J0R A;  3LFK A;  1YS7 A;  2QQ9 A;  2IS6 A;  4A0X A;  1YS6 A;  1LFP A; 
#chains in the Genus database with same CATH homology
 3QBM A;  1JKR C;  3B6A A;  2HOT A;  4DYQ A;  5JLW A;  4NEL A;  2VKE A;  3TP3 A;  2TRT A;  3DPJ A;  4BBS J;  3KZ9 A;  3T6N A;  4B1R A;  1RKT A;  3MVP A;  1BW6 A;  3E7L A;  3HKZ N;  4DZP A;  5GPA A;  2XDN A;  3BR2 A;  1Q1V A;  2ME0 A;  2JJ7 A;  5GP9 A;  1JKQ C;  1ETY A;  3TW7 A;  5EGO B;  2DA5 A;  1RPW A;  2UXU A;  2LTP A;  5K7H A;  2AO9 A;  2LFB A;  3JRA A;  4JL3 A;  5FKK A;  4A3L J;  2CUF A;  4I76 A;  2LVS A;  3ZQC A;  3VP5 A;  1ORK A;  1QRY A;  2COB A;  2DJN A;  3A02 A;  4Y52 J;  1OFC X;  1AKH B;  2TCT A;  5C4Y A;  1JTY A;  5K58 A;  3NXC A;  2UXP A;  3GTJ J;  3ZQI A;  4L62 A;  3HOU J;  5FKM A;  1NK2 P;  3JR9 A;  1BJZ A;  3VW1 A;  3OSF A;  1OJL A;  2HI3 A;  4AYB N;  1LE8 B;  2OER A;  4UUS A;  1D5Y A;  5J1Y A;  2WUI A;  1WGX A;  2HXI A;  3NRG A;  3S2H J;  3MKL A;  3BTI A;  1YRN B;  4S0H B;  2UXH A;  2YU9 J;  2EZK A;  3JRH A;  3HDD A;  2D6Y A;  2NVX J;  1ZK8 A;  1WH7 A;  1B72 A;  3I4N J;  1W0U A;  2JK3 A;  3TP0 A;  3LSR A;  2Y31 A;  4M3B A;  3UKG A;  3BNI A;  2R7Z J;  4FCY A;  1P7J A;  1MBE A;  5IPA A;  1HLV A;  1IV6 A;  1ETQ A;  3JSJ A;  2P81 A;  4X6A J;  1XC5 A;  2QIB A;  3E7Q A;  4MO7 A;  4D7N A;  5FKN A;  4C2M J;  3GEU A;  1XS9 A;  4CYC B;  3DCF A;  1UI6 A;  3S14 J;  3LOC A;  3G56 A;  3NAR A;  2DA6 A;  2JA8 J;  2X48 A;  2W48 A;  2X6O A;  2HYT A;  1JUM A;  3I4M J;  5FLV A;  1HDP A;  2FD5 A;  1DU0 A;  1JKP C;  1MBH A;  2VKV A;  5EG0 A;  1PUF B;  1JJ6 C;  5D18 A;  2DMN A;  2HOA A;  3HTI A;  4RBO A;  2YVH A;  4W1U A;  3ANP A;  2IEK A;  2XRL A;  3ZOB A;  4MFE A;  2QKO A;  5GPC A;  2M0C A;  3O60 A;  3K7A J;  4QIW N;  2YUS A;  3LSJ A;  2G7L A;  3B81 A;  3VOK A;  1AHD P;  3NNR A;  3HOW J;  2NP5 A;  3CQZ J;  1T56 A;  3AQS A;  2DMQ A;  2E2J J;  2ECC A;  2AHQ A;  5M5X J;  3G1O A;  4V2G A;  3FIW A;  5J1R A;  2CJJ A;  3G7R A;  2GM4 A;  1ETX A;  2R5Z A;  3PAS A;  3O8G A;  1I3Q J;  5IP7 J;  2XGD A;  1MSF C;  1JT6 A;  3NPI A;  3HOZ J;  5FMP A;  3KNW A;  1FIA A;  5FJ8 J;  5DAJ A;  4AC6 A;  3A03 A;  3C2B A;  2WGB A;  3CJD A;  2MW8 A;  5IP9 J;  2NVY J;  1SFO J;  1FTZ A;  1U8B A;  1IG7 A;  4GFL A;  3VVZ A;  3FK6 A;  2LKX A;  2IU5 A;  2QOP A;  2GEN A;  2ELK A;  3W6V A;  1DU6 A;  4A3G J;  1B8I A;  2QWT A;  2ME6 A;  1JUS A;  2LP0 A;  2UXO A;  2CRG A;  5M3F J;  3FK7 A;  2NVT J;  3C07 A;  4YZE A;  3WHB A;  1TWH J;  1ZTR A;  2HDD A;  2HYJ A;  5D1R A;  1Y1V J;  4XIC A;  4GCT A;  3NI7 A;  4L5E A;  1P7I A;  1UHS A;  5F0C A;  2ZOY A;  1GVD A;  3F1B A;  1SGM A;  4NN1 A;  3H3V K;  9ANT A;  2JWT A;  3IV5 A;  2DA7 A;  1S7E A;  3BR1 A;  2LLK A;  5DS9 A;  1ZR4 A;  2Y30 A;  4XRM A;  3IH2 A;  3HBL A;  3TED A;  5DTD A;  3IUV A;  5HBU A;  3ON4 A;  2MSY A;  3HB9 A;  5M5W J;  1UMQ A;  3IH4 A;  2PBX A;  2F07 A;  1X2M A;  2E2I J;  3HTH A;  5FLM J;  3GTO J;  4W97 A;  3Q0V A;  1NTC A;  4DW6 A;  1TWF J;  3S16 J;  2NS8 A;  2EQR A;  2DA4 A;  3S15 J;  4CGR A;  1QVU A;  1VFC A;  4A3E J;  3RH2 A;  2WAQ N;  3LHQ A;  1Z0X A;  1NK3 P;  3VW2 A;  1ETO A;  1APL C;  3MN2 A;  2L0K A;  2H1K A;  1Z77 A;  4A93 J;  5EYR A;  4A3K J;  3WHC A;  3JRI A;  4RDU A;  4IHW A;  1JUP A;  2CU7 A;  2JA7 J;  3PO2 J;  2G7G A;  1ETW A;  2HXO A;  2EZL A;  4GCK A;  2G7S A;  1U9O A;  2R0Q C;  4UUS B;  2XPW A;  5M5Y J;  4DYR A;  3ON2 A;  4D7M A;  2DG8 A;  1IDY A;  3QKX A;  1GV2 A;  1E3O C;  3JRD A;  3IH3 A;  4HNV A;  1WI3 A;  1B72 B;  3ZQF A;  5HOD A;  1IRZ A;  4FIS A;  5J1U A;  3VVX A;  3RD3 A;  2JA6 J;  2GBY A;  1WH5 A;  2CQQ A;  3H0G J;  1TC3 C;  3HTJ A;  4UDS A;  3LWJ A;  5F08 A;  2KDZ A;  3L1P A;  2FJ1 A;  1ZQ3 P;  2UXI A;  3GTK J;  1ETV A;  1UG2 A;  3VPR A;  3VUQ A;  2DA3 A;  1X2N A;  5EZG A;  3FRQ A;  2NX4 A;  3BRU A;  4FE7 A;  2O8K A;  5EFY A;  3FIS A;  1UI5 A;  5HAW A;  2K9S A;  3PO3 J;  3HIM A;  4B4C A;  5BNG A;  3Q0U A;  3Q3S A;  3S1R J;  3LJL A;  4B3A A;  4GFK A;  3LSP A;  4XRS A;  4C3J J;  2E1O A;  2V57 A;  5AQC A;  4ABZ A;  1AU7 A;  3LNQ A;  2WB1 N;  5EG0 B;  3O8H A;  3ANG A;  1ITY A;  2Y9Y A;  5IYB J;  2FQ4 A;  4IHX A;  1FEX A;  5FKO A;  1H88 C;  4UUT A;  4QSH A;  3BR3 A;  2EBI A;  1QPI A;  2L7F P;  2L7Z A;  2IAI A;  4MLO A;  3NAU A;  1TWC J;  2XGE A;  4BY1 J;  4EEF G;  1MH4 A;  4ME9 A;  3OIO A;  1MNM C;  1IUF A;  2YVE A;  1IGN A;  2VPR A;  5F0H A;  2ZCN A;  3JRG A;  2DG7 A;  3PM1 A;  2MG4 A;  1JKO C;  5CXG A;  2X9D A;  1BW5 A;  3V78 A;  4DYC A;  1MBJ A;  3JRF A;  2R5Z B;  3BT9 A;  4XID A;  5E3N A;  2QTQ A;  2R5Y B;  5M3M J;  3BTJ A;  2Y0S N;  1T33 A;  1ETK A;  1FTT A;  4FTH A;  3A01 A;  2GLO A;  1MBK A;  4JX4 A;  2E19 A;  2RAS A;  4PXI A;  1MH3 A;  4A3M J;  1HOM A;  2M8G X;  3BQY A;  2G0E A;  3V6G A;  5F1J A;  4A3D J;  2JA5 J;  5IOY A;  3BTC A;  2YS9 A;  3DEW A;  1OCP A;  4JP0 A;  1IJW C;  5E3M A;  3B6C A;  3COL A;  4MK6 A;  3CWR A;  4D5F A;  3VIB A;  3S1N J;  3SFI A;  2K9Q A;  1B8I B;  2MGQ A;  3HOY J;  2ZOZ A;  1RES A;  1EF4 A;  3FKI J;  4BXX J;  2LR8 A;  3GTP J;  2M34 A;  4C3I J;  4MIM A;  3SJM A;  1VF9 A;  2DA2 A;  3OOU A;  2EZH A;  1GT0 C;  2NVQ J;  3BR6 A;  4BY7 J;  4NDL A;  3G1L A;  3ZQL A;  1K83 J;  5E3O A;  3QPL A;  1JTX A;  2XB5 A;  4IEJ A;  4I6Z A;  2REK A;  4M3F A;  3G1M A;  2LK2 A;  2CUE A;  5F04 A;  3RZO J;  1MSE C;  1H89 C;  3M4O J;  2M2E A;  3SDG A;  1H8A C;  2B63 J;  1ZKG A;  1GDT A;  2RHA A;  1BL0 A;  5IYD J;  2NP3 A;  2O9L A;  2PZ9 A;  4ICH A;  2E2H J;  3K2A A;  2Q24 A;  1ENH A;  5C44 J;  3EGQ A;  5FGL A;  3HTA A;  2L7M P;  5K7F A;  4GCL A;  2XGC A;  3GTM J;  1X58 A;  4G12 A;  1HF0 A;  1IDZ A;  3P9T A;  2I10 A;  1VND A;  2JN6 A;  4DZJ A;  1ZGW A;  1I6H J;  4ACI A;  1WPK A;  3CRJ A;  1VI0 A;  1ZR2 A;  3CDL A;  2O7O A;  5EGO A;  1A5J A;  3QQA A;  2QF7 A;  2M9H A;  2EZI A;  3BR0 A;  2VI6 A;  5JLX A;  3TW6 A;  4XRS G;  2LY9 A;  2JMW A;  3HOX J;  3RKQ A;  3VVY A;  5EDN A;  3Q0W A;  2R93 J;  4MXM A;  2NOG A;  2ID3 A;  3BG3 A;  2D5V A;  3S17 J;  2KT0 A;  5H9T A;  3BG9 A;  2OI8 A;  4BBR J;  1LFB A;  2RAE A;  3BQZ A;  1OCT C;  1GV5 A;  2ZB9 A;  5FHP A;  3S1Q J;  1AKH A;  5CXI A;  2IBD A;  2CQX A;  4A3C J;  3BG5 A;  3JRE A;  4A3B J;  1LFU P;  2N8G A;  1JGG A;  2QCO A;  3HEF A;  2DMU A;  5EZH A;  1LE8 A;  2ZCX A;  4V2F A;  4JYK A;  3CCY A;  3KKD A;  2GUH A;  1F36 A;  2DN0 A;  1FJL A;  2DA1 A;  5IYC J;  4M6V A;  3KKC A;  1YRN A;  4BKX A;  5D19 A;  2EH3 A;  2XB0 X;  1F43 A;  2XPU A;  5E3L A;  2K40 A;  1WCM J;  4A3I J;  1XG1 A;  3OSG A;  1SAN A;  3BCG A;  1O4X A;  5C4J J;  3HGG A;  3EUP A;  2XPV A;  3QPS A;  1TWG J;  4M3E A;  2R92 J;  2ZCM A;  3BHQ A;  3GTL J;  4A3F J;  1Y1W J;  3GTG J;  3BTL A;  4X1E A;  3GZI A;  4LOC A;  4CYC A;  2DTZ A;  4A3J J;  1CQT A;  5C4X J;  2ECB A;  2OF7 A;  4QTR A;  1BA5 A;  4AF5 A;  2XSD C;  3GTQ J;  4JNN A;  1TWA J;  4HKU A;  2Y2Z A;  2DMP A;  4M3G A;  4A69 C;  1GUU A;  4XK4 A;  5F27 A;  3M3Y J;  3VW0 A;  3S2D J;  3HOV J;  1U78 A;  5CW8 A;  1IC8 A;  1A6I A;  4J19 A;  4FE4 A;  1PUF A;  5FKL A;  5EEA A;  1JJ8 C;  2DMT A;  3AQT A;  1HDD C;  2NS7 A;  3GBG A;  2OPT A;  2HKU A;  3BJB A;  1RR7 A;  1I50 J;  4IHY A;  1G2H A;  5EF6 A;  4JX6 A;  3RQI A;  3CMY A;  3S5R A;  4M3D A;  5C3E J;  5IOZ A;  4C3H J;  1RET A;  3RZD J;  3A01 B;  2K9N A;  2H8R A;  3MNL A;  3VOX A;  3HGY A;  1POG A;  2WV1 A;  1JT0 A;  2GFN A;  3BR5 A;  4IHV A;  1RKW A;  2R5Y A;  3JRC A;  3LSG A;  5F0F A;  2HQ5 A;  3ZQH A;  1MBG A;  5K7Z A;  2L9R A;  4JKZ A;  2FBQ A;  2ID6 A;  3F0C A;  3PPB A;  3HM5 A;  3HE0 A;  4AC0 A;  5HSZ A;  4JX5 A;  4Y7N J;  2VUM J;  4AUX A;  4KWA A;  3JRB A;  1U9N A;  5J3L A;  4MFD A;  2LD5 A;  5IP6 A;  2Y9Z A;  1QVT A;  1R9T J;  1HCR A;  2W53 A;  1FIP A;  1MBF A;  4GFB A;  2PMZ N;  4D5C A;  2FX0 A;  2HOS A;  3ZQG A;  1K61 A;  3D1N I;  3S1M J;  2G3B A;  1W0T A;  2O7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...