4G1CA

Human sirt5 bound to succ-idh2 and carba-nad
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
267
Chain Sequence
PSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis of Carba-NAD and the Structures of Its Ternary Complexes with SIRT3 and SIRT5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-dependent protein deacylase sirtuin-5, mitochondrial
total genus 90
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4g1cA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4g1cA01
2H2IA 1YBHA 2H59A 1YHZA 4K9NA 4RJIA 5EJ4A 3GLRA 2OD2A 4IF6A 4TWIA 1U28C 4FZ3A 1UPCA 2C31A 4J1TC 5MFPA 2OO5C 1UPBA 2H4JA 4HDAA 3PKJA 1PT9A 1PVDA 4K9MA 4UTXA 2OORC 4HD8A 2A1TR 2VJYA 3CLTD 4MZXA 2VBGA 1QPBA 4J16C 3GLTA 3F6EX 2FWNA 4UTNA 2VBIA 4MQ5A 4UUAA 2WVAA 2JLCA 4JUDX 3D4BA 2AG1A 2EZ8A 1PI3A 1S7GA 5K2OA 5FEMA 2JI8A 5EJ6A 2EZ4A 2IHTA 1M2GA 1MCZA 4V1CI 2Q28A 4QPZA 5EJ7A 4KXQA 1O97D 3CLRD 1PYDA 2AG0A 2X7JA 4D5EA 1NM5C 1T9AA 1SZCA 1V5FA 4GM4A 5EJ5A 2B4YA 2FRDC 1Q17A 4BVHA 2Q5QA 4Q9DA 4C78A 4IG9A 4Y6OA 4TWJA 2DJIA 2PANA 4GPEA 4MPRA 5AHKA 1M2NA 2JIBA 2H4FA 4L3OA 4K9LA 1S5PA 2UZ1B 3FLMA 4UU8A 2NYRA 1V5GA 4JU8A 1OVMA 3IAFA 1DJLA 4JUCA 2FN3A 1YI0A 2EZUA 1PNQA 1Y9DA 1YHYA 4JT9A 3ZGOA 2Q5OA 4KPUA 4JT8A 4UTZA 4BV3A 1T9DA 4QELA 1MA3A 2A1UA 3HWWA 2JI7A 5BWNA 1E3TA 3RIYA 3JWPA 3U31A 5EJ9A 1YI1A 2VK8A 3U3DA 2H2GA 1Q14A 4V1CB 3PKIA 2FR8C 4K9QA 1N0HA 2Q27A 4COKA 3IAEA 4QQ8A 4X3PA 5MFZA 2VBFA 2H2HA 4KGDA 2EZTA 1Q1AA 3F6BX 4BVFA 3D7KA 5EJMA 1U2GC 4Y6LA 1ZPDA 4UUBA 2Q5JA 4RMIA 4JUAA 3CLUD 1EFVA 4G1CA 4O8ZA 2UZ1A 4L2IA 4F56A 4UTRA 4GM0A 4GP9A 3HWX1 3EY9A 1V5EA 4BVGA 3RIGA 4BV2A 2OD7A 1YC5A 2V3WA 3ZG6A 4R8MA 1POXA 1POWA 2OD9A 1Q6ZA 5BWLA 2BRUC 2EZ9A 1O96B 2HJHA 2Q29A 4JU9A 4V1CA 5DEIA 4ZP1A 3GLUA 2FSVC 2H4HA 2VK4A 3CF4G 5MGNA 5BWOA 4MPPA 4FEEA 2NXWA 5MF6A 4Y6QA 4UTVA 5D7NA 1M2KA 3ZGVA 4FVTA 1HZZC 1JSCA 1U31A 4BVEA 2IHUA 4JUBA 5EJ8A 2H2DA 4BVBA 3EYAA 4JSRA 3JR3A 3FSJX 1BFDA 5DGTA 4ZZIA 4BN4A 4K9PA 2PGOA 1YC2A 2QQFA 3PDHA 3FZNA 4GM1A 4RJJA 4IAOA 4F4UA 5DGDA 5K3SA 3E9YA 4C7BA 1PNOA 3D81A 4BUZA 2Q5LA 1ICIA 1OZGA 2W93A 4RMJA 1T9BA 1U2DC 1SZDA 2JLAA 2JI6A 2WVHA 5EJAA 1M2JA 1OZFA 4JUFA 4MPJA 1M2HA 1UPAA 1Z8NA 3K35A 4K9KA 3OE1A 5K6TA 3LQ1A 2PGNA 5FYQA 1PTJC 2QQGA 4I5IA 1EFPA 2IHVA 4RMHA 2WVGA 3CLSD 2VK1A 5IMSA 4UU7A 1T9CA 2H2FA 1XLTC 4X3OA 4RMGA 3GLSA 1PO7A 3EA4A 4RJKA 4K9OA 1YTLA 4D5GA 1J8FA 4BN5A 4FEGA 1YNOA 1OZHA 2JI9A 4GG1A 1D4OA 5K6RA 4JD5A
chains in the Genus database with same CATH superfamily
2VCYA 3QLUC 3SYTA 3GFRA 4NDNE 3SQNA 1E4EB 3VU9B 1FRVA 5F5NA 4BJ1A 4BO0A 4EY7A 5MFPA 4WA7A 1X6VA 1YD7A 3RJ9A 1A9RA 1HYHA 2P90A 2CXHA 4HL6A 2YOHA 4AD8A 2OB2A 4WY2A 1XFDA 1PT9A 3ET5A 2FPXA 1OA1A 2QX4A 4CF7A 4F92B 2F3UA 1HURA 3QKIA 1GAJA 3EZ7A 1ODKA 1WZUA 4EHFA 1YB6A 1RLTA 3KELA 2AN4A 4GX1A 3VX3A 2HY7A 5CFQA 3MCZA 3KB2A 4YWHA 4QOGA 2IXDA 3CU5A 3QJ5A 4WNCA 5EIWA 1M54A 4CFSA 4F6LA 4CIBA 3IKTA 2QP3A 3VHXB 4EZBA 1X7GA 1MCZA 2WTAA 2IUEA 4EPVA 4YQFA 2UUOA 2EDCA 1RACA 4TZTA 1M6EX 1WV0A 3O7WA 4EKGA 3FNHA 1F8GA 2Y99A 3NHKA 3I9LA 3P2KA 2CLLB 3UAOA 1W9HA 3CPSA 4ZO8A 3A58B 1FLAA 4EG0A 4B8ZA 1UKZA 4BTEA 2GZ3A 1NHGA 3EIXA 4BKMA 1ST3A 2OFWA 4TSKA 5J23A 3NHAA 1HRKA 2EJVA 4IG4A 3CLKA 1SQGA 3RBAA 4Q01A 1RJGA 1FRFS 5CDGA 2QNIA 4OUKX 4YAKA 1U98A 4F8EA 2GFQA 1T8RA 2DJ5A 2K2WA 3KB6A 2B8NA 4PSAA 3G8BA 2OFPA 2AX3A 1D2CA 4OREX 4UVDA 3T3DA 3TPZA 4IDAA 3JRNA 1O87A 4HYTA 2B1GA 2OXRA 1JU3A 3A14A 4LISA 1XQ9A 4RHFA 1OH7A 4CEJA 5DU2A 1CUFA 3HV2A 4RACA 2WZQA 1Z2OX 5EHIA 1S4MA 4TWAA 3LPLA 2IRWA 4FE7A 3TDNA 3LC0A 5C46F 3CUSA 1R7RA 1GADO 1CLUA 1QP4A 3NRCA 3T3OA 1GPBA 2RGNA 4QXPA 4WECA 4YCNA 1CHNA 5T57A 4RU1A 4YJGA 5JU6A 5IYZB 4PC3A 5G02A 2HH9A 3T9EA 3O8NA 5EMNA 4DT1A 3MINA 5DDIP 4R2JA 3NX4A 1FDUA 1KJJA 3FCSB 1KAHA 4MRSA 1FFCA 4IZOA 4B3BA 5JS2A 4M9UA 4URVR 1QBKC 4FWTA 5GMOA 1W96A 1B8UA 4UASA 4CM7A 1RNLA 2FLVA 3D2LA 1U0SY 3OLQA 1UMDA 4M98A 2FTKE 5KOHB 1VHDA 4M1MA 4TQUS 1XD9A 2JFQA 1S01A 5BVGB 3M6VA 4YREA 2IYNA 2J7PA 3IAS6 3IKMB 1BHO1 4LYJA 4PAMA 2GMWA 5GV7A 5H83A 2ZE7A 4AICA 4FC6A 3DE7X 3WGUA 1XK7A 1M9NA 3N2YA 4FE4A 1XPJA 3QNWA 4UE3S 3HBNA 3IKJA 1RWMA 1UM9A 2AMJA 5BWMA 2ECPA 2AZXA 3MQ2A 2BGUA 5CP8A 4ZVVA 1UKYA 3M5PA 4EHBA 1DFIA 2ZE6A 4P4GA 1QTRA 5FTKA 1TQDA 3NBYC 5A4KA 4YV1A 4CCYA 1QFJA 3P5SA 5B3KA 2BEVA 2QLNA 1HE4A 3D8SA 1OA0A 4YMSA 2RK3A 4CJXA 3JARB 5CEFA 5JQGF 2FUNB 5F3RA 4GI7A 4RV9A 1CZUA 2OBXA 3Q12A 4JCOA 3TSCA 4NCBA 4DSOA 2EWVA 4IJKA 1G60A 4CMAA 4P31A 2C7RA 5HRCA 4EHLA 1DWUA 1L8AA 3OA0A 4G1VA 4TV9B 4DDMA 2RD2A 5JVDB 2FWJA 4Y2PA 4WXMA 1JH9A 2O4UX 1P0FA 2N47A 1FNBA 1X8KA 2KM1A 3HVIA 3KVRA 3EYWA 5GONF 5EUQB 3KPJA 4LXHA 3MZ0A 3ORHA 1RI3A 3PDIB 3S5UA 2JAOA 4O4IA 5IEJA 1KMIY 3B52X 4IDHA 1QX4A 3IPYA 3PKZA 1TEXA 3EVAA 3T7RA 4L5AA 4D45A 3BXOA 4ND2A 3E8XA 2O3RA 1MJGM 2C3UA 3A4LA 3DHWC 2FMTA 3O4RA 1TB4A 5EJ6A 1SQFA 4ONEA 3RS2A 2AKYA 4KQWA 1CE8A 521PA 1SU6A 3PPYA 4GL4A 4UCWA 2GO7A 2JJMA 4PX2A 3QVLA 5J1TB 5LZ8A 4HAIA 1J8YF 4DZRA 2VRNA 3O90A 4FC7A 4XIJA 2FE1A 2QMZA 2VPPA 3C4JA 3IQWA 3OIGA 5EFOA 3IBTA 1MC5A 5IKPA 1GG2A 4WBNA 2A3NA 3ZJ5A 1P45A 1X86B 3CR7A 3HUUA 4LSMA 4DWVA 3TM5A 3EDOA 1WHTA 3DDHA 3AFGA 1EUDA 2X5JO 3VR3A 5DNDA 3ICVA 4OHCA 3ZIDA 1YR9A 4E4TA 4IDEA 5I9BA 3KG2A 4RESA 1GT6A 3DEZA 3JQGA 3QV2A 5TR9A 2C99A 5TV2A 2FFBA 2R4QA 2PD6A 1SHJA 1L5FA 3ZXIA 4L4XA 3QH4A 4FD3A 2AG8A 4QXRA 1NW8A 4TV8B 2H2GA 2YC4C 3G5MA 5THXA 2ZUFA 3UTDA 1Z17A 2D1TA 1N34B 4BO6A 5DH9A 5KJFA 4ZQBA 3LUFA 1I2AA 2DPXA 5AK6A 4LFAB 3EPJA 1DCTA 2PUTA 2ST1A 3Q85A 2HMWA 4UBLA 4XE5A 3T5BA 5BSGA 4KPYA 2VRBA 4BQNA 3SEAA 2HSZA 3GDWA 3X1XA 4EO7A 4ZA2A 5JYBA 2LRHA 2CUTA 1LB1B 3RU2A 1J2JA 2DH5A 2ZXFA 3VDQA 1Y6QA 1G8HA 3DVAB 3RSQA 1E3QA 1H9CA 1KY4A 2FXVA 2I7CA 4E3ZA 3U40A 4WLVA 3UT6A 2BCEA 1I51A 3BS4A 3P2OA 1FDWA 2XZPA 3PD1A 1J9EA 3PUXA 4NDAA 5SYAA 4KQKA 3EPRA 1SIBE 4F04A 1K6JA 1Z5OA 1ZQ9A 1KYIA 1XP8A 1SVLA 1AGRA 3WMXA 4QDJA 3IUJA 3THRA 2D1FA 3KX2A 4BMSA 1G2QA 3CEHA 3SR3A 3EQ7A 4UXIA 5D7BA 1YS4A 1F8UA 4TKMA 2J5BA 1T0BA 1YSCA 2AFHA 3PHGA 4HH3C 4JNCA 1GZSA 4ENPA 1H3EA 4JJAA 4TL8A 3V6MA 4RELA 5BRJA 3TIFA 1UBSB 4ANFA 3I1JA 1L5YA 3G9UA 4YRLA 3PD7A 2YDXA 4QA9A 3RC3A 3E2PA 1SEPA 1VA4A 1X7XB 2GPNA 2W5UA 3AETA 3O0DA 3GP3A 1G7RA 3O84A 5EIBC 1U0FA 2H29A 2DG2A 1JQDA 1TX4B 2IKSA 4X7BA 1FRNA 6REQA 1CUVA 3KOMA 1H4VB 1T3GA 2JJ2A 2JJ1D 2ZM6B 3PTAA 1E1CA 4IM7A 4O63O 2ZTUA 5BSEA 3V2IA 2BMFA 2Q8QA 2NTEA 3LC7O 4F93B 1L5LA 1ZD9A 1T9KA 4IJ5A 4INPA 5JSKA 3CN9A 3P7MA 5SZHB 1Q0SA 3W3AD 2QM7A 2ZPTX 5AOBA 3IVXA 1JHVA 1ZVMA 3LDUA 3GWGA 1ONNA 1XMIA 4BZXA 4X54A 1FP4A 5CDHA 5AW1A 2CDNA 1C9KA 1DB3A 1JDUA 4C2AA 1TM7E 2E6KA 2O2JA 2VHEA 2QVZX 3OM9A 5BSRA 5JSUA 3EPKA 2C7BA 1WF3A 4WOBA 5EQDA 1KQPA 1TK2A 4RIEA 1EDZA 1AURA 3ITKA 1PT5A 1U0TA 3M9XA 3SLRA 3HR8A 2WT9A 5TJ9A 3BREA 1TRHA 4RDHA 2Y05A 3DC7A 1VLVA 1DJPA 4A1FA 1RQGA 1HDIA 1M8GA 4XD7D 4IFTA 2CXTA 3CV3A 3ROZA 3OAAD 2I4RA 4IDDA 3WZMA 2ZQ5A 5I9TA 2AG6A 4Q9JA 3PR3A 4JKYA 3M4XA 1GNRA 3F6SA 4K46A 5HKLA 1BEZA 4ZAGA 1BAPA 4F12A 3KTOA 1NRXA 4YMVA 2IY8A 5E7IA 2HIAA 2Z2ZA 3BMNA 4YR7A 1BHQ1 4TXMA 1VI5A 2P7IA 2BM1A 5LA6F 2JS7A 2OCIA 2J7PD 4EZIA 2AR9A 2R8BA 3IE2A 3AWIA 5B55A 1X0VA 4X6XA 2PXHA 2YOGA 3DTNA 3NCTA 5HFJA 4B3CA 2YBEA 4Y2XA 3F3MA 4H7JA 4YRRA 4FSDA 2P4EA 4BKPA 1YVPA 1V1RB 2ZRAA 3OLYA 4EJFA 3X1JA 2ETVA 1W75A 4XCXA 2BR5A 5A7GA 1N2BA 3STTA 3LWBA 1D8AA 3H8JA 2C92A 2Y2VA 3OICA 7GPBA 4X8HA 3WLJA 2A5JA 4WNAB 4EJMA 1KI1A 2ZULA 5D3ZA 2F17A 2I7VA 2YS6A 3IB3A 2ZYDA 2D8AA 3UG7A 4BFWA 3RGGA 1SUAA 3Q9LA 2RGDA 4UARA 4HPJB 1X1BA 2J32A 4LX8A 4P54A 2Z6QA 4C4SA 4U7DA 4GE0A 3JD1A 1UR5A 4BV2A 5FKJA 3STHA 5I8PA 2DXIA 5JS1A 2ZZMA 2BZGA 3DTTA 4Y0VA 3LVFO 1EI9A 4A6XA 1TA4A 5CA1A 5E9AA 2XF8A 2Y71A 4JENA 1JTVA 1CJVC 5F7JA 4ZIRB 3PX7A 4E12A 1X0XA 3Q6MA 4A6EA 2VPWA 2CN1A 3OTOB 3KJGA 5C53B 1OZ0A 4RC9A 4RYDA 2A88A 2RBGA 1TADA 3LX8A 4RVHA 4BN4A 1SMKA 4E6PA 2AEFA 4JJ8A 5H82A 4DPLA 4DV7B 4OI4A 4II2A 3ESXA 1JQKA 1TZBA 1V26A 4YONB 3TM4A 4CMIA 4Y0NA 3VAAA 1ICEA 2B5VA 3FH0A 3KYCB 4JB0A 5AI0A 3WGLA 4ZMRA 3HCBA 4BS9A 2VO1A 1THTA 1O54A 4DIDA 1PZMA 1NXVA 4BNJA 1EDBA 2IYLD 4QGSA 5KYYA 1JPUA 2G82A 2WJHA 4OA8A 5ETJA 5SYNA 1NW6A 1DBVO 1Z8FA 3I39X 1YJBA 4G0ZA 4R7ZA 3VR0A 2KS6A 1L9KA 1XZEA 4OQ4A 2N9UA 1T1RA 4WFQA 4ZDKA 3H2KA 1B8VA 4XZ3A 5A9SA 1F4LA 1QHIA 5JXHA 4DADA 1FQJA 4AJHA 1P0PA 4A9AA 1R88A 5F2KA 1P7YA 1UBJS 5J4HA 3PNOA 4TQAA 3TNDA 1TECE 1XUOA 2R8ZA 4HQNA 1R5JA 2Q0QA 2OOSA 4Y7DA 4AP5A 4D57A 4EVQA 1ZHHA 4DDVA 3BD8A 1YF3A 4ON9A 1COWD 4TKVA 1NVEA 4UNQA 3ZNNA 3QBDA 2OAQ1 4D97A 5BV1A 3IXQA 4GR9A 3E9RA 4TTVA 3LY5A 2A1TR 4HDSA 1PLKA 3GJQA 3I5MA 2C5HA 3GIWA 4K81B 1IQUA 1LLQA 2HDNB 2VYCA 3I9V6 4KIJA 3ACCA 3EHEA 2ZRKA 3SP1A 4DJ5X 5ALYA 4EB6B 5DYWA 4N7RA 2CFTA 4ZDIA 4ABTA 2A7XA 4OI1A 1J6UA 1QWOA 3HGMA 1QTIA 4O4LB 4MTLA 1W93A 2WA1A 4E21A 1N5RA 4KMOA 4BIIA 2WJZB 2GBCA 3QOYA 2IP1A 4K03A 3KEOA 4DHWA 2F43B 4LCBA 4NE9A 2JGDA 3K0EA 3PHLA 4MAMA 1N2CA 1ISRA 4R31A 4WNYA 3IHLA 1IVYA 5FBKA 4FNMA 1JXAA 3GYBA 4Y67A 5KOIA 3VR1A 4DV1B 1A98A 4I19A 3PNBA 5BYJA 1XBTA 3GMTA 1R6VA 3GLHE 3LFTA 2BFBA 3M70A 3LE8A 4C76A 4D8VA 3LRTA 1P3Y1 2Q4BA 3EDRA 4TLBA 4HH0A 1ZM2A 2CYCA 3TB6A 3WS7A 2E4UA 3T54A 1GCOA 1YHYA 5K0NA 5TGTA 2W8BA 3HACA 3PLNA 3FPSA 3E9ZA 1Y6JA 3BKWA 2VRWA 3D6FA 2OAEA 1KI6B 4H7IA 4V2IA 5A4JA 2ZPAA 2XVYA 5HQ3A 2NUPA 5J2TA 2VXYA 4DLWA 2BW0A 1JJFA 4OB7A 1FZTA 2GSWA 4P38A 2DETA 4IFEA 5KSZA 4HK4A 3RF6A 2WKRA 2WSLA 3RSFA 1VLZA 3IQXA 4XVRA 2PVCA 3V48A 1TGYA 1P5FA 4P93A 1OB5A 3R8XA 2WW8A 4RH3A 5LR6A 1BS1A 3IH5A 3QKRA 1Y4UA 2OD7A 2CJYA 2E85A 1QRTA 3LHKA 4M1ZA 4FFDA 1GXSA 2QDKA 3JQGB 1B42A 2I9PA 4XASA 4LQDA 3ZDCA 4M37A 1H5UA 2Q29A 1QONA 3WYCA 3JQ9C 3QPCA 4ZP1A 2SKDA 5E1BA 3HXLA 1ZESA 3A6HA 1IOVA 3U3MA 4IWYA 3RVSA 1DEOA 2C03A 2RHTA 2NM0A 1SVMA 1U2RA 3D6HA 3SXUA 4BCDA 1IHUA 2W2MA 1NUUA 3MT7A 4RUKA 1HR0B 2O5VA 1T6ZA 1JDBC 1ZRMA 4L2IB 2HSWA 4LKRA 4G0YA 3PNKA 4IAOA 2X1HA 4KXFB 5GP1A 3WGOA 5ED0A 3BCSA 5AVXA 2CB9A 1PNOA 1L7NA 2DTXA 2R6R1 1E6WA 4NYIQ 5EERA 3R7LA 1T9BA 3K4PA 3LFHA 4JLDA 4C7OB 1VMKA 1LFAA 1X7ZA 2GS9A 3KR2A 3FF1A 1CJUC 4FGZA 1XHLA 4MV7A 1GT91 4MQUA 2RG7A 2XE7A 5AWFC 3GEEA 1J2TA 2PWYA 4OJKA 3WAGA 2IH2A 2C9OA 3C5EA 4UOZA 4FHFA 1Z68A 4KPGA 3ZE0B 2QF7A 1Y34E 1ILWA 1Z0UA 4Q16A 3DE2X 2GEVA 1PCXA 3CCBA 1JIJA 3L05A 1P6QA 1W88A 2HCTA 4DBLE 3Q7SA 1TM5E 3ZDZB 4C5AA 3RC2A 3ZUPA 4DJAA 1YR2A 3QEBZ 4OHKA 2VOJA 2VCEA 3U1TA 1Y63A 2P9EA 3M3DA 2AUNA 1V39A 3H1AA 5C7IO 5J3JA 4FYHA 3T7EA 3AEKA 4DEYA 3WTBA 3JQAB 3H4TA 1H4QA 2NP7A 2XVAA 3QEJA 4MW4A 2YJ4A 3JVVA 4HNSA 4DYDA 2GEBA 3C7CB 3EGVA 4I4IA 1Z15A 1UBNA 1Q7TA 2WMOB 1QIGA 4MQFA 3VPGA 4DRXA 4ZHQF 1UWLA 2SCUA 5A5FA 5B7GA 5CNMA 1KH2A 1C9JA 1KRHA 3KXKA 4S2UA 4UTPA 3LKVA 2IYYA 1SXJA 2ZRIA 4WKOA 2A6PA 4EA7A 5MDHA 3V00A 4N03A 3CJRA 1LLUA 2P9TA 4U8HA 1TMGE 1EVEA 1G18A 5CYOA 4IH1A 1NG1A 3WKBA 4C0JA 5H9WA 1MOZA 1N77A 4ZQFA 3N8KA 1XAGA 2YICA 3HG7A 4IMPA 2O8VA 3DCIA 3OEYA 3OQIA 3R7SA 4E5NA 2IY7A 3M5WA 4TX1A 3DM5A 4QDTA 3THSA 4RTSA 4WOCA 1UPTA 5A2QA 2ID4A 3IEKA 4XFJA 1P1RA 5HA5A 4BZPA 1JVSA 4E7OA 5L40A 3DL7A 1OIWA 5DTQA 3EH2A 3H6KA 1OVMA 3GHHA 4AG5A 1NLYA 2VJKA 4CGYA 4PIVA 1ADCA 1P7CA 1S4QA 1XL0A 3MJDA 4MOWA 2HN9A 1RQLA 1N7HA 1RWPA 2VSNA 3PFCA 4Q7QA 3NJ8A 1QE5A 2EJTA 4LJ5A 4CZ2A 1F2UA 3H2HA 1XZQA 1D04A 4F5ZA 1EXWA 2XZLA 3KSZO 2ZP1A 5EJAA 1IG3A 3B6EA 3BMNB 3HI4A 1MOSA 4AAYA 5IVHA 3AM5A 1E4YA 3K6SA 2GBIA 1NXSA 2Z2JA 5U1PA 4ZJZA 3DMTC 3ZQKA 1ND6A 1DC6A 4U0KA 3FPGA 3AY7A 2WJ3A 4X1KA 1XU4A 1U94A 4I50A 3ZN2A 3TXXA 4BLSA 5JSHA 5E9JA 1T4MA 3A9VA 4E2YA 3K16A 4RADA 2QP4A 2VUSA 5BWLA 1KNQA 2J1LA 4WT7A 1C0PA 3ROXA 3HZZA 4HAYA 3STWA 1YGPA 1MQAA 1S9DA 3VZQA 2ZITA 3EVGA 3EZLA 5JDCA 1R6BX 4BJHB 1JSCA 1RMQA 3PNSA 4XD7A 1JZTA 1Y5NA 3HEAA 1CF4A 3H2SA 3KVNA 4GD3Q 3VNQA 1OH8A 4LF6B 2BFFA 2XE6A 2ZUTA 3DXFA 1CCWA 4M8IA 2C0QA 3AEQB 4AMGA 2F1KA 2R2GA 4PZYA 4I1YA 5BUSA 5JYEA 4URXR 7YASA 2AOWA 2Y1KA 2OENG 4D3FA 1BJKA 2GJ9A 3CF4A 1QH0A 1TJ5A 4R4JA 1IXRC 2GRJA 2R5FA 4MEAA 4OFZA 4ZEMA 5DLYA 3C97A 4R0MA 1A72A 2F8TA 2PGNA 4A16A 1E2UA 1KSFX 2GN6A 1KO4A 2AYZA 1NFQA 3OIDA 1KK2A 4AYWA 1JLSA 3DDCA 4OYHA 5LC1A 3QXXA 4L8LA 1J8VA 3AIKA 1BMDA 8MHTA 4GU5A 3IVRA 4PYNA 3ZIAA 5ER6A 1RAAA 1H6DA 1WXDA 1QG0A 1SG6A 3C98A 4UAUA 1KJZA 3B7GA 2JJ2D 2JJ1A 3EOZA 4OCZA 2GJSA 3AVTA 2AYXA 2Q6VA 3ZWBA 1SBIA 3D2AA 1O95C 1U5AA 3QE3A 1E2IA 1JMYA 3B48A 3FPFA 3KLNA 1DJOA 3CXRA 4MUGA 4OHVA 5KCZA 4TMFA 3DZCA 4FFWA 3AJRA 3UUEA 1I33A 1KJNA 3CBQA 1J07A 5DIFA 2ZW9A 5FTMA 4OJNA 4M9QA 2PD3A 4QZVA 3QMVA 2GQ0A 3PENA 4I3HA 2HF9A 2ASEA 3E5RA 3UJ7A 1K3FA 1RMYA 3S6JA 1E59A 3I12A 2TSYB 1Z35A 3HGQA 3LKBA 4C4OA 1ABBA 5EAIA 2R3SA 4NMWA 1NW9B 2VQ6A 5A4DA 1K3UB 2Q99A 5AUQA 1SCUB 3GPCA 5BPHA 4R0VA 1OJ7A 1XTZA 3PTLA 5EXXA 3RUIA 3T3HA 5KREA 3OEHD 4YHBA 1ZUD1 1R6TA 4NXMB 2Z4SA 5JH7F 3OIWA 3U9TA 2DJIA 2VJLA 3CPHA 4B31A 4DWWA 2B9EA 4G4SP 4G89A 4JU8A 4ROSA 3UAXA 2FN8A 3OU6A 1Y0BA 1EAMA 3LPAA 3AUYA 2XZTA 2XUOA 3R0VA 1U0RA 1U99A 3FWYA 3ICQB 1GEGA 4ZOEA 2BFEB 4B74A 1NPYA 2WHRA 4QGBA 4DG9A 4K9QA 1XC7A 3RYHA 4KO3S 3N5CA 2YCLA 1GWNA 5IH7A 1ST2A 2YN0A 4QBIA 3RSGA 3DW3X 5JYCA 3FKJA 1BIFA 1T3SA 1Z0KA 1KC3A 1OLUB 3IQZA 4P53A 1SXJC 1SXGA 1KZ9A 2BR4A 2C9MA 5EVJA 3WKCA 4R3WA 1DUVG 1Z26A 1RJEA 3UK1A 1RM4A 2Q5HA 4L22A 3DD5A 2Z83A 3JSXA 2XVZA 2EW8A 2Q1XA 5IS2A 1H4SA 2VJBA 4U5XA 3GCZA 5HK8A 1DL5A 1H6AA 4DV2B 4CETA 2NACA 2WDPA 3QOWA 2CD7A 3K8YA 3EEQA 4L8YA 3F71A 1QOPB 3U3KA 3UA4A 3VR5A 3Q8KA 5FOXA 1WTCA 2O1WA 3DZFA 4RL6A 4WFJA 2BISA 4B43A 4CEJB 2XD9A 3O83A 4EFDA 1IHXA 4JZKA 4UJ5A 2CE2X 3M6XA 1TL7C 1E2PA 2XLBA 2LCIA 2W6CX 5CR9A 1XNGA 1ZBDA 1D4FA 5TMBA 4BUZA 3TZCA 3N1UA 3D1VA 1QGAA 5DN6A 3AVXA 1KMNA 3ILSA 4TSFD 2ZBFA 2V59A 1OLSA 3ILXA 2VDPB 4YP5A 5TQ2A 3DMDA 1NSYA 3TRKA 1YOVB 2C4UA 1JI3A 1AX9A 1DXYA 3PUKA 4Z9BA 3GDOA 3NW9A 4JLBA 3WAKA 3H65A 4FT2A 5JCPA 3B1WA 4OQPA 4TQGA 4EA8A 1KR5A 1LTKA 1ZWKA 2QGNA 2YRFA 4JP2A 2VSXA 4J4HA 3U3RA 3PI6A 2QG6A 3KWFA 3PRYA 3UMRA 2V1XA 1RE0A 3L9WA 1F17A 5JQWA 2IOHA 1Q1NA 1XXHE 2COKA 3C3KA 2B36A 3H9JA 4HYQA 2ZGVA 5DM2A 3RUCA 3FPJA 3ZDYB 1JXOA 3C16C 3MD9A 3V7WA 3FM9A 3CNLA 3T4PA 3UFXB 3WL5A 4F8JA 1G6HA 1R5NA 1E60A 1S9HA 5L9AA 4TXLA 3T3NA 1BSVA 4HNGA 1QP8A 1RHQA 5JNWA 4Z7NB 1Y8QB 2FVXA 5DI3B 3U3XA 4TTJA 3T7KA 1YS2X 1JMVA 2OQVA 2GDJA 2JLVA 4R1OA 3I2FA 2DHRA 2PMWB 2R1UA 2ZYIA 4UBJA 5TDHA 2RIPA 1QJCA 1RXVA 3T1NA 1XDUA 4WLNA 2PHZA 2IW3A 3H4VA 5CITA 5IT5A 5ALTA 5IN4A 3MERA 3O4FA 3Q3IA 5T8KA 4H7DA 4N5HX 1PNRA 4JV5B 1PZHA 3UA3A 2JJQA 4XVUA 4ZGWA 1KGSA 5GVRA 2ONCA 1V41E 1R0CA 2NXEA 3O8QA 4LBYA 4QYSA 2Z5FA 1ULHA 3AM4A 1E5DA 4EI8A 2FPKA 4TVSA 4JLKA 1C7EA 1KKMA 1JG2A 4K28A 2EAUA 4U1RA 4WVFA 3RS7A 1I5OA 4MQFB 3TLJA 4DRYA 2UVDA 4ZYVA 5IJ9A 2PTHA 5CX1B 1J1ZA 2AX4A 3QU5A 4BWGA 3N7AA 4YCJA 5D86A 2P5SA 2ZZKA 1GAEO 1D9XA 1Q19A 2VIIA 3GRUA 1PNQA 3DBIA 3IULA 3BXZA 3DT6A 3LSYA 3TB4A 4H1WA 2OAGA 4MIOA 4UD6A 3LQFA 1RXYA 1J5XA 2A9RA 1WUJS 2D1SA 2GPSA 3A1DA 3KL4A 3MT8A 2O07A 4Q1AA 4RXTA 2BMDA 5CVEA 3F5FA 4AJ4A 1U8ZA 2OGZA 4AF6A 1ADBA 2C77A 2C1EA 3OG9A 2WHXA 2IHKA 5ICMA 1SIWA 1C3OB 1TYCA 1K7CA 1YBVA 4GO1A 4LY3A 3V4SA 3FNEA 1X74A 2PZLA 1X1EA 1QG2A 4HJXA 4KIUA 1B6SA 4LQLA 3HZRA 3G2JA 3IT3A 4KXLA 2C4HA 3BXEA 4XJTA 5EWJA 2PL5A 4EB0A 1JLLB 2OTCA 3W6ZA 3SHFA 2OLEA 5JSQA 4EPYA 1WBDA 1H5QA 1V9SA 2HL6A 1NW4A 2P6OA 3Q15C 3ZQ6A 1XI2A 2D54A 4D6XA 1O95A 4FOTA 4E5UA 4ITVA 4CMBA 2OO5A 3AHCA 4J1TA 1JQAA 4PTLA 4HZUB 4B7ZA 1DJMA 5DM60 4D98A 5BR4A 1SEVA 1H2EA 3OD5A 3QNUA 2PRZA 3KETA 2VSFA 3ML1A 1WAMA 4MGKR 3A6DA 4XCQA 2HU5A 1II8B 1RKVA 4JBLA 5HEKA 7ADHA 4BVBA 4KDRA 1QC5A 2FPOA 5K3FA 3DE3X 4HRYA 1HSOA 1WV1A 3L49A 1SCQA 5IWAB 3DEIA 1WTAA 4C6RA 1ULSA 1PW5A 1QUFA 1S0UA 1LZKA 1QHHA 2MHCA 3DVAA 5GZ1A 5JH7B 3OWOA 1HOXA 1KZYC 1U04A 4R1QA 3L0CA 2W0SA 2W22A 2BKXA 1U3TA 3I01A 4D4KA 5CBKA 3WB0A 3SVLA 1QB7A 1SXHA 2WIJA 4XXHA 1QFSA 1VMEA 5AK5A 5TQJA 4EYOA 2VJOA 1B16A 5IAAA 3BGWA 4UVHA 3DC2A 4Q4JB 1WOMA 4PRYA 4N7MA 2VJMB 1NLZA 2LPMA 2VR1A 3S1AA 1JAZA 2UVQA 1UC4B 4NXNB 4H7HA 4F4CA 4FUQA 2B4RO 2V1UA 3ZWOA 1FTYA 2L0XA 4RNCA 3AY6A 4FPXA 3D6JA 3PQ5A 4B9EA 3X1ZA 2WK1A 3VA7A 1M33A 2E89A 4AUKA 3ZX4A 4NEHB 3NTVA 3K9LA 3KPVA 3KKNA 1UKEA 2XRMA 5TS3A 2OO5C 1CETA 4NHOA 4EVIA 1IAVA 4WACA 3C87A 4M7PA 3MMPA 2RGRA 3MIIA 1NP3A 4JA2A 4I55A 2R84A 2QMOA 4M86A 5AHOA 5NLLA 2OC9A 1WMSA 4KK3A 1JXMA 2GVDC 3LK6A 4GGMX 4AP6A 3H17A 3BE6A 1EX7A 1WZEA 2P11A 3K30A 4ZREA 3O9ZA 2B78A 4WD3A 5FX2A 2IU6A 1QRAA 1AIPA 4KE7A 1CUAA 4WBNF 3O21A 2E49A 3KS9A 1YJAA 2WF8A 4WA8A 4O59O 5EQTA 3WAJA 3A11A 3TZHA 4B4WA 1DV2A 3GRRA 4HQFA 2XW6A 3NTOA 1XCBA 3BA1A 1XKTA 3CX8A 3JAKB 3HHPA 2UAGA 2W6JA 3MAJA 2CZCA 4KOAA 2D2EA 2HSDA 4CRWB 5EJ5A 3TZQA 2O8FB 3S68A 3SYRA 1HQYE 2XRFA 1H0RA 3GROA 4H59A 5CLGA 4KPEC 3C4VA 1E0DA 3H4MA 3AILA 3V8RA 5BMVF 2QQEA 3E3OA 3P96A 3V55A 3GMDA 4LF4B 1G4AE 3HCCA 4H15A 4Q3CA 3U4GA 4ZMSA 2GBFA 3AEXA 4DQXA 5B5SA 1EWTA 3CR8A 4QM7A 2B20A 4WL0A 3SR0A 2ZAIA 4CKYA 4C1NA 3WFJA 1GU0A 2HPAA 3UEOA 4DMFA 4WMLA 1U3UA 3TCKA 2O0LA 3AVUA 2Z58A 3WL8A 3CXUA 4A0RA 2M6RA 4DE5A 2WWXA 1Z2PX 5C0OE 4F4HA 1AY0A 1W0JA 4E2FA 3O4VA 2GESA 1P4AA 1NN3A 3CUKA 3HN2A 4BCCA 1P44A 4DYHA 1GFIA 3W1EA 2IPLA 1PGOA 1O0SA 1QV9A 1AS0A 3JTMA 3VV2A 2CV0A 4Q93A 1WDKA 3KE9A 5TQVA 3TQQA 5BN3A 4OLAA 3GX1A 4DBZA 2L19A 1XCOA 2IEBA 1FNMA 1X3LA 1Y3DE 3BMQA 2AN1A 1QK3A 3BK2A 4R5HA 4RD1A 2O7RA 1I8TA 2G77B 3I8OA 3BFXA 2RCYA 4K2HA 4YEDA 1YMUA 3IDAA 4IWNA 4M1SA 3BIFA 4ZVKA 3QEMA 4YT4A 3QSYA 4JYAB 4G6ZA 4CCAA 4OUDB 5DHSA 4EELA 5F5XA 2VP6A 4MWSA 1QF9A 1SWVA 1NR5A 3OLWA 4JR0A 4D8WA 4E3WA 4QOIA 5JAZA 3RHSA 2YXEA 1Y6RA 4CCYB 1REQA 4J7AA 5HS6A 3BT7A 1FRQA 1JT9A 1SOAA 5JJBA 1CQIB 2I2FA 4GKAA 3FPLA 4Q7MB 2O8EA 1OX6A 3RROA 1U8TA 3TSAA 1WUKS 2GJAA 2XHZA 2CLEB 2WABA 3UHJA 1Q15A 1PS0A 2V7BA 4TV8F 3ZY2A 1A1VA 4YRJA 4NS1A 1KZHA 1SQ6A 3R9KA 1AF7A 3VZBA 1MGOA 2H1CA 3DEHA 4MV8A 3BRWA 1UDCA 1KI8A 1B3BA 3O03A 4A8HA 2XGMA 1KQ3A 4E33A 3U3JA 4XX0B 1XXHB 3N74A 5EIFA 1QIKA 3GC6A 1ORHA 1AZTA 2R4TA 3C6KA 4YIKA 3I45A 4EABA 4RHXA 4RMNA 4HS4A 3SLGA 4YCCA 1JHMA 1VL0A 2OE2A 3EF0A 1PZXA 2PT5A 3OOJA 1M10A 3IDFA 4M21A 4CV0A 2G72A 3LQ4A 3WL3A 2VZLA 2OORC 5BR1A 3L7LA 3C3EA 3H5TA 3ZE9A 4YJ2F 1KU0A 2PX6A 4GEKA 3KQOA 1VJCA 2J5XA 1Y42X 2CDAA 2VBIA 2ZBQA 2MMCA 1NKTA 1FNSA 1UDBA 1UEJA 3MXTA 4ZMBA 1MB2A 4GICA 3RUFA 4BQOA 2EP5A 5JROA 1DADA 1JW9B 2MR5A 4FYMA 1FTWA 2ZB4A 5INTA 3I0MA 2FPRA 4UVGA 3ENNA 1NY6A 4L75A 2B8TA 1Y3CE 5I7UA 3W5HA 1HNXB 4TV9F 3OU2A 2WAAA 3MC1A 4FNGA 4Y2QA 1BS9A 2CZGA 3PXDA 4G5RA 1TVEA 2ERCA 4JR1A 1IMOA 1ORWA 4LY0A 3IV9A 3LYHA 3M6AA 4PHTA 4LJYA 2IY9A 1CS0B 1ULAA 1X80A 1L1RA 1YR7A 2VZEA 1DO8A 3MWYW 4LN1A 4YC7A 5AHWA 3CVVA 2CGEA 2PJUA 1XMXA 3LZCA 5IJAA 1FVOA 3EY4A 3H83A 3ROGA 3OLXA 1NHWA 3CN7A 1V16A 2WB2A 3OOEA 3NJ4A 4FIZA 2HRCA 4DCPA 1Q6YA 3W3ZB 4C4PA 2OCKA 1P39A 1Z6QA 3CWQA 3CUWA 4KDFA 4NBTA 2PUHA 5EGNA 4A5SA 3W5DA 4CCSA 4EITA 4ZV9A 1AV7A 4OHWA 2C3OA 2G76A 2YWJA 2ZI9A 5KBYA 4D9MA 3CR3C 4CM9A 1YFZA 4Y3UA 3GJXC 2DKNA 2PMDA 4Y7CA 5DXJA 4OHUA 1E2BA 3OIUA 4B6EA 1Q1EA 4C21A 4ER5A 2CV2A 2YJ6A 1COWA 1WW2A 2GYUA 5LDGA 3R5SA 1W5EA 4PW0A 3X1WA 1ZAKA 1LVGA 2GCPA 2RHOA 1LF0A 1X9IA 3HCDA 4JT2A 4LPSA 3QM1A 1WR8A 4LF9B 1NOKA 4CNQA 2QI9C 1VSUA 4RHCA 1NW7A 1NTOA 2X6RA 3KEGA 3JVEA 3KJHA 4B33A 4JI1B 3WLNA 1GGFA 4BRSA 2PSSA 2GCNA 3PP8A 5IEBA 2AFHE 2CFSA 3NDPA 3W5VA 2P9GA 4FYWA 3RAGA 2UYOA 3OKAA 2J4FA 4CLOA 1D09A 1V1MB 1CF2O 1V5WA 2O50A 2OZPA 2WJAA 3RAFC 3QKRB 1NVMB 1AXGA 3RW9A 1ZUNA 2R87A 5AVQA 3BWBA 4YWJA 5D6OA 2DBYA 3SE0A 4BMDA 1GZHB 3WK8A 3GFVA 1HFEL 2G63A 2F55A 4JL6A 1P1KA 1RDFA 2JF0A 5TEWA 1X39A 1N3IA 2VP9A 3PC2A 3F0TA 5FNVA 4EHJA 1E1KA 3A4TA 1Z28A 2BKLA 2JBWA 1SKAA 4LMPA 4UU7A 2JVKA 3IPLA 4U4AA 4OL0A 1W581 2GXSA 1CQXA 5DE3A 3AI3A 4MJLA 4B17A 4JL8A 1KOFA 4INJA 4MUIA 1N36B 1AV6A 3LYLA 2QW1A 5JAIA 2E4WA 2Z4RA 4PS0A 4ZHQA 4XR4A 2IH4A 4BJ3A 3ERCA 3HPRA 1MVNA 2PS3A 4FFRA 2I2XB 1N9KA 2HI0A 4NBWA 1N75A 1QH8A 2W2KB 4KBYA 4P4SA 4TS1A 5G1OA 5IJXA 1N3YA 2PH7A 1GA4A 4BNYA 1L7PA 1A9SA 2RGUA 4GOJA 5DYNA 2CKDA 4IY1A 4IOLA 4MQMA 4PLCA 3RTDA 1KF0A 1AKWA 4DQKA 4E7PA 5K01A 4EYKA 3PDCA 3RVJA 1RHKA 1CT9A 5BNWA 3WZ2A 4EQ6A 3V7FA 3UJDA 2RMKA 3HSSA 2Y76A 1QH9A 3AL0C 1TKRA 4ZYLA 2AZDA 2C57A 2KPOA 2FLKA 2EZ4A 3ZOKA 2IHTA 3GRZA 3LBYA 3WJ1A 1QF6A 1GSIA 3LCMA 3ZDXB 4EG4A 1BA3A 1XZFA 4NYJR 3EVEA 4QJIA 4BLRA 3OZCA 3HSYA 4F91B 3OY7A 4N0QA 4IG9A 2GLTA 3ZHVA 1W6RA 2C5GA 4QDXA 3VR5H 4DS3A 5EMLA 1P3JA 3R3SA 5L3VA 3R7WA 1CUSA 4F4JA 3ONFA 1R00A 1TJ4A 3RBXA 4RORA 3WYDA 1RM3A 2Q4TA 4RHTA 3T4EA 4JXKA 4F3TA 1JT2A 1PQ4A 4KR6A 3KKEA 5LQSA 2JI7A 4D8YA 1UDXA 1QKIA 2C2HA 1O2DA 4JI4B 3PPIA 2VK8A 2W9XA 4I5DA 3FCXA 4YALA 2BI4A 1XEAA 2WWYA 3RVNA 5JD6A 2F1RA 2GLXA 3CRNA 3IMKA 4J3FA 2FDXA 4PYRA 3WMFA 4CI0B 3N7UA 5B64A 1ODSA 5CB8A 4EJ2A 1KO1A 2C98A 2J0UB 4JBYA 3RUEA 3VJKA 3K9FC 5EJFA 4Z1OA 1HA3A 3A06A 1SRRA 2D8MA 4W5WA 4JDUA 3U0VA 1G8AA 4ZEOA 5AYVA 4AN0A 5A02A 4ZXFA 4K3UA 4Q1VA 3U1BA 2HSGA 3OQBA 3DH0A 4X65B 1R6XA 3DOHA 3U5TA 1DINA 1XZJA 1UINA 4LQCA 4UHEA 4ACAA 2W48A 1W46A 2D0IA 2JFGA 2V4ZA 2VK4A 4ND8A 1I01A 4PZUA 4EA9A 1F1JA 5KNBH 3WIOA 2C0CA 1M2KA 1GITA 1XCGB 3IL2A 4H60A 1FP1D 3F7OA 3EULA 4ISBA 1XQ6A 4QUHA 3PQ2A 5SICE 4D41A 2WU3A 2VDVE 1XJQA 3AVOA 3HU1A 1G5PA 3IA7A 4KTVE 4OQDA 4DV0B 4M0FA 4XWGA 1I30A 1EGAA 3NHLA 5G1NA 5J4YA 1L4FA 1RKQA 2G17A 4LHWA 4ZXPA 4QTUB 2BE9A 3A05A 5TPZA 4ZYWA 1EM8B 4L28A 4A2QA 1S89A 1D7OA 4ZV7A 3QYFA 1LQTA 2PXCA 5HMLA 2IDJA 3CLSD 1VKJA 1NYLA 3N87A 4OHFA 4QPPA 4QXAA 4DANA 3DOEA 5AUNB 1GM5A 3CONA 3OZRA 1LDGA 4BNDB 1RAEA 1A69A 1ENPA 1PSWA 1KSGA 3CRQA 2GXAA 5IBRA 2EW1A 4FYYA 1Q5PA 4BN5A 2QZ4A 3NYIA 1B14A 1WXFA 2CMKA 1BX3A 2IOYA 3G1TA 3QEOA 2DC1A 2QUIA 3AX6A 4Q7JB 5EKDA 1EWQA 4OMCA 4CDMA 3KQLA 1CUBA 2WOJA 5IAGA 2C4WA 3DEYX 4QICA 4AKEA 1BDHA 2O8CB 1YDMA 1IN8A 2LWIA 2WQZA 4DCTA 3BJZA 2EBUA 2A9JA 3BH0A 3SZUA 1Z25A 3Q87B 3RQSA 3RIMA 1W85A 1PQUA 5ISMA 2B5WA 4ML3A 3LQRA 3AUJB 3JU3A 2C7OA 3T06B 2IP4A 1TI7A 2YMQA 2ATVA 4WEOA 1DQSA 4BO5A 5ECGC 3WLLA 1CY6A 4B40A 4ZAWA 1RKBA 3FMFA 3FKQA 5K03A 1KI6A 2WSSD 3WR5A 2Q28A 4F72A 2HJRA 1ESDA 3C85A 2ADOA 3FZGA 3ZHSA 2D5LA 1YONA 3FDZA 2F7SA 2FSSA 4E2ZA 3B5JA 1DX9A 2Q1WA 4BQSA 5IBCA 4MR9B 2PGJA 1WUHS 1B2LA 1P2BA 2ONJA 1E9SA 1JAYA 2JAPA 2VLIA 4RPJA 1GN8A 1CS4C 1NUSA 2DWUA 4KLAA 3SC3A 3EZXA 1GLVA 2BGTA 2GJ4A 3GY0A 3IJEB 2YJ5A 4XDGA 2PDAA 4LI0A 1LC0A 3DYVA 4FFVA 4YI3A 1YJ5A 2QN1A 3SYLA 1SCUA 2R751 2QSUA 4EJSB 3KSDO 2I71A 2AE1A 4B6OA 4LMRA 1XKLA 2GN4A 2FPPB 3OE4A 4ARAA 1MA0A 1WKBA 4GOLD 3ZZNA 1GPJA 1THMA 3V7YA 4EYEA 2XB8A 2XDQA 1H3FA 3EZ2A 1L4KA 5FWXA 1QGDA 5BVGA 1QH1B 5KIAA 1U2GA 4DLXA 4WZZA 2OY0A 1ZCFA 2OCPA 1KQNA 5H4GA 2C7GA 3PNYA 2OZVA 4PR3A 1U2QA 1KIFA 3C1AA 4A0GA 2FZKA 2GF9A 2QB5A 5F1PA 3TLGA 3NDIA 4EJ6A 4Z9XA 2G67A 2C1ZA 1ZEMA 3FBWA 2PZ8A 3QU7A 2VQ3A 3D5TA 4GKBA 4JU9A 3ZX5A 1KQGA 2FQYA 2H4HA 3VR4H 1NI5A 3LTEA 1R0YA 2DY0A 5D5QA 1DDOA 3GUHA 1Y8CA 2GAAA 3I1IA 1ADGA 4ZDWA 3ZHYA 3L41A 1ZIDA 4CDGA 4A3SA 1BWPA 3RVLA 4GOXA 4ZZIA 2B2NA 2K7FA 4BRZA 1UQRA 1X1RA 1S3GA 2J46A 3VNVA 4NF2A 3GEBA 5JD4A 1N4AA 2JFYA 1YDWA 3G6WA 3QBTA 4J29A 4G81A 5LKRA 1Z5WA 3JWGA 2YNMD 4KVAA 3F8TA 3DR3A 4XLTA 1YRLA 3F47A 2BFNA 3A3NA 3P9YA 4H77A 3R77A 2B8JA 4L1KA 4RSMA 3KEMA 1NR1A 4TV9A 1R0WA 3AIIA 5CB0A 3AHIA 2BP7B 3LVBA 4R68A 1Z8NA 8ABPA 5HW0A 2A4MA 1RYEA 1Y5RA 4OL9A 1ID1A 3C5WP 5DX1A 1LTQA 2G9VA 2W42A 3I1FA 1ZOIA 4W9NA 3ZCTA 3WV4A 2O5RA 4AX8A 2JA1A 5FF9A 1G5QA 1I4LD 2N1MA 4FN4A 3K72B 3GEPA 1C7ZA 2BL4A 4YRSA 1DKPA 3ANTA 5L7TA 1FYFA 1YNOA 1PV1A 3RD5A 3CNQS 1Q1GA 4YJ2A 3KQVA 4QUEA 1HEYA 5GIOE 2FQWA 3H05A 4N5DA 3BRQA 3OZAA 3DTVD 3ZCUA 3I53A 1VCMA 1N0WA 5EZ5A 4XLZA 3SDBA 1PVDA 1T1EA 1J8QA 3VH3A 2EX0A 5ALRA 2Z6AA 2CFCA 3LUAA 4X1YA 1H85A 1LDEA 4ESOA 2BEVB 2UV8A 3U7IA 2Q21A 3C3YA 1JI0A 4XARA 5KYWA 1MX3A 4ZOQI 1ABFA 4KSYA 5AVZA 4P0QB 5JBIA 4W5QA 5GGXA 3HKEB 5CLLA 1ZIOA 5AJWA 4E5PA 3WNVA 1R8XA 1IZ7A 5IN5A 1PF7E 3IAM1 4LYYA 4DRZA 5CNJA 3TMAA 1TT7A 1O9HA 3OPMA 1XTKA 3K15A 2JFZA 4UEWA 1B4DA 1D2RA 2FRDC 1NF2A 1ZA2A 2AN9A 2JKZA 3BB4A 4N5LA 5HILA 2BGIA 3OCUA 1PJ4A 3ZYZA 3H16A 3GVIA 5KQMA 3MWLA 2H18A 4AS3A 2WV7A 2P9YA 2NADA 3DMNA 4XVQA 2CLCX 1SIUA 4OYYA 3A36A 2JNWA 3CKMA 3ZBQA 1CEQA 3KT8A 4LGYA 1FP2A 4IGEA 5FIUA 2YJNA 4H0NA 2UUCB 4EJSC 2BHSA 3SBDA 3V1KA 1OYYA 1WZNA 2PUBA 2M32A 2K6GA 5E7QA 1KSHA 4TMKA 5CNIA 3OOYA 4R2LA 4FIDA 1NDHA 2VWPA 4UQOA 4WNIA 1G8JA 2YN4A 4TVKA 2C2KA 2RKOA 4CTMA 1IY0A 1NYQA 3SDZA 1NBEA 1W2HA 3E9QA 4HQ0A 1K8RA 4ZI7B 4WIAA 4OX9B 4RETA 1OI7A 3HU5A 3SQWA 2Q4DA 1E0KA 2HRZA 3G9XA 5FJIA 4JI8B 1POWA 2OD9A 2C78A 4KHPB 1RRGA 2Q6OA 3UJHA 4HVTA 2K7ZA 4UNIA 1L8QA 1H8EA 4R1SA 5CYFA 5J9FA 3M1LA 1RE1A 1FDSA 2AW5A 2CWDA 2VHTA 2ZR7A 3C3JA 3K0AB 3MS4A 1P7PA 1OFIA 2M6LA 1R4NA 3T5TA 2VTDA 3PIRA 2G5TA 4I7EA 4QTZA 1RMTA 3BWEA 3GQVA 4RPCA 8GPBA 2E0IA 1MKYA 4AQYB 1BXZA 2PU5A 3TEFA 1RRKA 4CMKA 1JLLA 5BMVB 4KN6A 1DOZA 1GPLA 3D59A 4RK1A 2ODAA 4BKRA 5F7XA 3PFWO 1PW7A 3ICPA 2WLTA 1T6NA 1BWSA 4BJ5A 4YV0A 3E1SA 2FY8A 1C4XA 2C2XA 1LVUA 1T3HA 5F2OA 3GA7A 1DT3A 2YHSA 3ANNA 1GTVA 3JALB 4W7SA 4TL6A 2ZIFA 2LD4A 3VZSA 4AKTA 1TM2A 4YMWA 2I33A 3NALA 1UBHS 2CDBA 4YMTA 5KNCH 2J87A 4DR2B 1PUXA 4IQ4A 4LHEA 3TLMA 3E3AA 4A26A 4ZI2A 1J1IA 5KNDD 2C7PA 1GNVA 2TMDA 4QBGB 3T15A 3H87A 3CBGA 3OCYA 1D4OA 5LP6B 4P7FA 1I1HA 1D7AA 2OHVA 2CK3D 2RHHA 3HC7A 4MUHA 3T9DA 4PPYA 5K7SA 4N5NA 3CUUA 4BGIA 1RW4A 3GN1A 4X41A 1T10A 1DV1A 3PGXA 4CWAA 4MRVA 4DY6A 2ZIZA 1W52X 4YH1A 3N0XA 1M0EA 4UTXA 2J9FB 2R0QC 2FW7A 1GFWA 4RFVA 4C6TA 4QPNA 2OGTA 4OBEA 1BNCA 4DXDA 2X9QA 4YJ3A 2EGUA 3BRCA 1IN7A 1QVWA 3AWDA 1HE1C 4LUCA 2P30A 3WI7A 1L7OA 1GHTA 1CU1A 2W58A 4PU0A 3IVCA 2GZMA 3L9XA 1NONA 3DOFA 3PVCA 4NH0A 2C54A 4HNVA 1FMLA 3PWZA 3ZZUA 2YDYA 4HTAA 1BA2A 2H48A 3HP4A 1ISMA 3MRSA 1EZ1A 5HFAA 1ZD3A 3EPHA 1DBPA 2QSYA 5KOJA 3IKLA 3SS9X 3OFVA 1V8OA 1DLJA 2OBLA 4RPLA 2B4YA 4GBJA 4BEWA 2DFLA 3D3KA 4V0MA 1AS3A 1M34E 4FP9A 5DXAA 5FRDA 4OU5A 2DU8A 2CJWA 2Y1GA 3LGSA 5D3MB 5D87A 1DAEA 3EEFA 5AVKA 3ZDQA 1E8DA 2CHFA 3FKSA 3R0QA 2IIVA 5DOZA 4WINA 3VSAA 4CN9A 4DSUA 5I7EA 3B9PA 1Y8AA 1NM5A 1UBMS 3NEPX 1GCIA 3RIYA 4ZEXA 2EKDA 2IYTA 3DNMA 4FKMA 4FYPA 4BXOB 4M89A 4BO4A 2IGBA 4X8LA 5E6SA 1CFJA 4FM9A 1QPZA 1ISIA 4L7VA 1M74A 1U2GC 5IAKA 3WV5A 2NNWB 2QYHA 4FEAA 2IGTA 3E1GA 1DMSA 3E9CA 1AUOA 3GXBA 3LA8A 3WHIA 2KSQA 4Y2JA 5AI9A 1P72A 5JZMA 4MVWA 4CM8B 2COUA 2PKEA 1Y3AA 5HIIA 3KB1A 5SY9A 2Z1DA 1QOZA 1PR1A 1S2NA 1VG1A 2Z3WA 3ANYB 4RPKA 4S35A 2GARA 2C3YA 3ROFA 1UMCB 4CMIB 2AKEA 2RGEA 3S8MA 3UWMA 4EHNA 2FU5C 4J0IA 3WK4A 1IBMB 3FPBA 4HN4B 1FNDA 1U28A 3B89A 4PZEA 4R8KA 3ZGYA 2SHKA 1TQ4A 2ZQZA 5TMDA 2X41A 4V38A 1DWOA 1DIRA 3L0YA 1CIVA 1QM5A 3B78A 3TQFA 1KNXA 5SV2A 4F86A 2JA2A 1OFVA 3HLKA 4LEIA 1XDBA 1PJAA 2QTAA 2DBRA 1ELOA 1TQ8A 1M2EA 3A1NA 3A70A 3WWZA 3PC8A 1GU7A 5KHAA 1P2VA 2CVFA 1I0LA 1O5OA 1I6MA 1ORDA 3DBVO 5JZOA 3A2LA 2L18A 2LR0A 1DAGA 5F7ZA 4Z0HO 3H42B 1XO1A 1JZQA 4GF5A 3G5UA 3EDYA 5K8JB 1JRLA 1M7HA 2P69A 4IQGA 2PZMA 2CD9A 3AY0A 4B09A 3DCYA 4KMSA 3QYPA 2MSDB 2PQ6A 4GMHA 1REQB 4TMTA 3NO4A 1LW7A 3W2EA 1SFRA 3RU3A 4NYJQ 1AKEA 1H8HA 2FZWA 1T0IA 2LV8A 3W9YA 4QJ5A 1FMCA 1UPXA 4D02A 2AZTA 3ANLA 1PFGA 3CIFA 4I81A 4X64B 3JY6A 1YTUA 3FSRA 5AI6A 4QU5A 3G0DA 4MUNA 2F1IA 5KQRA 2ALJA 2YFHA 4HDAA 1Q7BA 3HYSA 3QKSA 1OWPA 5B6IA 2QMYA 2YVKA 3UJPA 1GEEA 1DC8A 4OFBA 4Q15A 2WAMA 1I3MA 4UFNA 4DA0A 2TRSB 4JYZA 4NJEB 4B46A 2RHWA 4RF3A 2JLUA 4K5QA 2X2FA 3Q7QA 2QN7A 5DRYA 3REOA 1RCUA 1DFGA 4P33A 3ZXXA 1JR2A 1VIVA 4QU8A 4UEKA 2IE0A 2GCIA 5JMPA 3ZIUA 3ZQJA 1H6CA 1KKLA 2O2GA 4MWGA 1P4SA 4QC2A 3V2UA 2PGDA 2CHGA 4NBVA 1Q0HA 4WKCA 4EUEA 1UBKS 1WXHA 4H3SA 2DSNA 3IXLA 1N57A 1XK6A 2MWMA 4HQLA 1RABA 3AEUB 5ALFA 3R9IA 4Z6KA 1JJIA 3LECA 1WMAA 4DCCA 1F5SA 2RKWA 5IUKC 3EBPA 2PANA 5AHKA 3MRXA 5TXGA 5HZHA 1DRJA 3TW0A 2Q8NA 1NDQA 1US8A 3DLHA 1EUQA 5JDIC 4W63A 1S2IA 1KEKA 3IBYA 4EF5A 4X24A 1AN0A 2OC4A 3E58A 2H2WA 4QEDA 1YZTA 3CF6R 3T8YA 1QHNA 3BL5A 3VKUA 4EDFA 4XGQA 4O33A 1XRMA 4C87A 2IYQA 2O52A 3QFCA 1NVKA 4JVSB 2ZIVB 2QS9A 4M0KA 4RGQA 5DNEA 3PS9A 4B2IA 2ABWA 4BU1A 2O7SA 1HL3A 2QT9A 2Y0DA 4I1RA 3HN6A 1AMNA 4OKNA 5IT9A 2H4WA 5CVUA 4DBLC 2ZIXB 3NHFA 1P0CA 3RNLA 2I7TA 4Q9IA 3CW8X 2BGMA 2J67A 3K4QA 1H8HD 1WUYA 2OZEA 1ZD4A 4J0DA 5F9MA 2C2ZA 4DIOA 5LOVB 1E98A 1ABEA 3P9ZA 4G09A 5I7AA 2HREA 1YV9A 4II3A 1ZLYA 1NZJA 3ZG6A 1FJHA 3O3NB 4Q02A 4DY4A 4O4HB 4LZOA 1XCPA 2ZT8A 3CPEA 3T9CA 1L4UA 1PDWA 4S1OA 2G1AA 5CJ2A 5AW7A 2BTEA 2GJKA 3NOOA 4KQ1A 4PQFA 3SICE 1V11B 2BZ0A 3RU9A 4Y6QA 4KSCA 4DDKA 3F9IA 3PSAA 1NQOA 4ARCA 3TYXA 1ESMA 1FNCA 2VHWA 1YU6A 3WMWA 2Q9UA 4CF5A 3EYAA 1RSZA 1X7YB 4KQIA 4MS1A 3OKPA 3LBAA 2P79A 3HRKA 4FGJA 4PLYA 3LOQA 3T1HB 1XDWA 1OFTA 4HXGA 5IJWA 1IJKA 1GGMA 2CLOB 2JFPA 2QAGA 3D2BA 3FLEA 3MSCA 1ULUA 3MTBA 5CT6A 1X94A 1JBEA 3JWIA 4FMCF 3RYIA 1T8TA 2FZGA 4QU0A 5FHQA 1IWBB 1A2BA 1ONPA 3WKDA 3NV7A 2M6KA 3K70D 3G5AA 4MVXA 1JKMA 2IIQA 4F1JA 3BF7A 2IFTA 3I2HA 2Z5VA 1TYBE 1YQ9A 3B3QA 1HT1E 4RMHA 3FBTA 3G2NA 4I55B 4IIFA 4Z3DA 3S81A 4NI5A 5TS2A 2AC7A 4Q3AA 1Z5NA 4ROTA 1IVNA 5JXIA 3GUCA 1RM5A 16PKA 3GLSA 1OI3A 4GECA 2XMGA 3U9SA 3B85A 4JN6B 4ZRDA 3OP4A 5L8VA 4Q82A 1QYCA 2X8BA 5FOVA 3W4KA 4ZEVA 4O3FA 4COOA 2PL1A 1C1XA 1VI6A 2EF1A 5EG5A 3WGVA 3UGJA 2C5LA 4E51A 1H23A 1MTOA 2Z04A 3O95A 1NRIA 4FHDA 2YY5A 2EFJA 3CSDA 2YZMA 3MM4A 3RRYA 1JR4A 1EP3B 1NU6A 2BFMA 2GEFA 2N0SA 1PHPA 2CY0A 3TBKA 5DGIA 4BE7B 2AG1A 3OTWA 3GJ7A 4LVNA 4N8DA 2RGWA 4ZHQB 1AOXA 1DO0A 1TA0A 1T8YA 1BE1A 3ENQA 1RP7A 3ORSA 4G07A 4P84A 1KDYA 3SJ7A 5EWMB 5HIJA 3AEYA 5CDFE 1U0GA 3UMSA 1EK2A 3VU9A 1O9BA 1Y33E 3JAWB 5JVDA 2NZVG 4MCHA 4D9JA 4RLHA 1W19A 2I6GA 1PL0A 1NX6A 3LUPA 4P36A 1VCOA 2ZVPX 1OW3B 3LPMA 1AG9A 5ALKA 3SY8A 3BCRA 2FP3A 4I46A 2WWIA 5DK4A 5F2NA 3PDIA 5JLJA 1R8QA 1T36B 2H08A 2O2XA 2X3YA 1MENA 3E4CA 4LY6A 5A4FS 5I4IA 1HNZB 4NK4A 5G0SA 4DCVA 1SUDA 1U8CB 3KV1A 1PFQA 1M76A 4OSOA 2IX9A 3QFHA 2CCKA 4Y18A 4AO6A 1VB3A 3RYCA 3DHEA 2GHIA 5DLEA 3UJ9A 3ROTA 4R8VA 3LKDA 2YW2A 1Y9JA 2XVMA 1G20E 1MP0A 1JSXA 4P0PB 1S2GA 1S8FA 3DEFA 4JXXA 5JJCA 3N2GB 3VH2A 1ZZEA 4PCUA 1NVVQ 1A04A 1I24A 4G1CA 1I2MA 3DKRA 5K3AA 5U9CA 1KKUA 3P0RA 4OU4A 3UPDA 4QRIA 4UUNA 4UTRA 3V1YA 1M34A 5E38A 2WAXA 1QFMA 1H05A 2HHLA 3CEPB 4X6UA 1ZJWA 5FULA 2WJ6A 2FWBA 2XRZA 4O02B 2VWGA 1HRDA 2AFIA 1L5SA 2AZMA 2BEJA 3F4LA 3K1AB 2DLCX 1N8SA 1USVA 1I3LA 1IBSA 3SC2B 2UZ4A 2PUWA 5AUPB 4KQXA 3RNOA 5TIIA 1FFWA 4LK2A 1ML4A 2ZI6A 4UHCA 3KQTA 3S2IA 4L9RA 3A9CA 2RGCA 3EVZA 1II9A 2BZSA 2O2SA 3U49A 4DQUA 5LM3A 3M33A 4X66B 2IHJA 4W9RA 4NFLA 4G24A 2D1RA 4P7JA 5K8TA 2XHEA 4JJIA 4FFOA 4HKTA 4KNYA 3ND8A 3ZGXA 3GWZA 3K1TA 3VSBA 3WY9A 4A6DA 2G4VA 4ZVOA 1W7AA 5G0VA 1RFLA 2BMJA 4RL4A 4E5SA 4ND8B 2FFRA 4KFUA 4NZYA 1UPAA 3SX4A 2AOTA 2W8ZA 2WUDA 1JQ3A 4YQYA 3DO6A 1X7HA 2ZTSA 2O05A 3M6WA 2B2CA 1OX5A 3LUCA 4Y6RA 3T6KA 3U80A 5AM3A 1XQ1A 4NAVA 2BN4A 3AI1A 4XQEA 1HFJA 2ZIUB 2HBYA 4GS5A 3B9RA 1C30A 4UAJA 4P34A 3BPSA 3LIPA 4LX0A 4WADA 2H8GA 1S8NA 4CM3A 4D9CA 3SF0A 1NBMA 2PX4A 3BJEA 5F76A 2QLBA 3IQIX 5HOQA 4ZYXA 1M2OA 1L4BA 4J0GA 1QLJA 5J2TF 1NOIA 1SD2A 3W7AA 1MV8A 4YUXA 2XNHA 4IIGA 4JBXA 1BRTA 3BMXA 4HGRA 4M83A 2FEAA 2H1FA 2PEZA 1Z4OA 1Z62A 2XDWA 2OQRA 3OVMA 4O4LF 5CLHA 5E1MA 4BATA 3HTXA 5KYKA 4JJ6A 1M0TA 3M5DA 4B76A 4GOKA 3UXMA 1UC8A 3CKYA 3CX3A 3NPAA 5KJEA 2NVBA 4IS2A 4PLHA 5FI3A 2OV3A 4XJXA 5IZCA 2J08A 5U4QA 2UUAB 2J0QA 2QLLA 5LBTA 5B7NA 3VOAA 2OFFA 1AHHA 2YHBA 4P3XA 2MSWA 5DPMA 4EW3A 4HLQB 5DHRA 3TR5A 1A7AA 2HNAA 2C8JA 2JG3A 3U6BA 1CB0A 4I8IA 2FF7A 3H99A 2XUIA 2XMSA 4CM4B 1L5MA 4IX9A 3AM1A 5EA2A 3DKVA 1OWNA 1W4LA 4OGFA 2O3UA 5CIQA 4YT2A 1M1XB 1IBRA 4K40A 1D2NA 3OM0A 1E3TA 3SJUA 4UMDA 4JDPA 4LRQA 4JMPA 4BYMA 5K8LA 4EY5A 5ICSA 1R9NA 1IMJA 5REQB 1LZLA 1QVRA 3JQFA 3N0WA 3FHJA 3NXKA 1SU4A 3WICA 4RYLA 1VSBA 1G8MA 3R4VA 4WN9A 4NCNA 1UBOS 1HQDA 2GNPA 3F2VA 2G1UA 2ZJ0A 4EYGA 4YRGA 4KXXA 4Q4LA 4LDRA 4G37A 3GBSA 2XMPA 3LGAA 2EKQA 4OQNA 4RVFA 3L7YA 4H2DA 3ABSB 1T34A 4HDKB 1DAOA 2FV8A 1MT3A 4L9SA 1OX4A 3EC1A 4FGSA 2Z2YA 3W06A 3SDSA 3MHTA 4RA9A 3HM9A 5HM6A 2F67A 3CE9A 4HZIA 1POXA 2WT4A 5AQEA 4JXJA 3HR4A 2Y0EA 1DZIA 1E7RA 3R3ZA 1NQTA 2F90A 1AHPA 3IPRA 4AMUA 5IDVA 1WU8A 1BDIA 3EVBA 5EXPA 1MW9X 2V9ZA 4BAUA 3U7QA 9GPBA 3NDBB 2KWIA 5DBHX 2D1QA 5JCXA 1BZYA 4PCAA 3H3JA 2WSSA 1R0RE 4D99A 3RWOA 4XQ0A 1Z6GA 2PCJA 1XEWX 2OBYA 4EY3A 2QRJA 1R8SA 3GJSA 2VZ8A 1UXGA 1VYVA 5AVTA 4AS2A 1DC5A 5I9NA 5BORA 3RADC 1QIDA 2B5OA 2Z8YM 3FIUA 3W6PA 1P5ZB 1E5XA 1EIZA 2FFQA 2G70A 2MYPA 1ADFA 4HUJA 4QQFA 4D0LB 2Y6UA 4LYFA 2J5KA 4PYLA 3T3EA 4TRJA 5KKNB 1HEUA 2BMVA 1L7VC 2PPLA 2W6ZA 3A2MA 3HLTA 4KE9A 3UH1A 3UHFA 4D80A 1E0JA 3LA6A 5JS7A 4HB0A 3ZJVA 1U7HA 2JGFA 1J42A 4KH0A 4KQHA 1Z0ZA 2EJBA 2QJOA 5B1HA 3VPSA 5JTUA 2UYCA 1UANA 5K0GA 4OO3A 3TPCA 4LDPA 3BIXA 2E7ZA 4NESA 1K7SN 2NTJA 1Z4LA 2QAGB 1WQ4A 2QRLA 4NDZA 2EEPA 4B6QA 3NYRA 1J99A 2XYRA 5GGYA 5KKCA 3DP9A 2YJTD 2YCBA 1E7YA 4ZGGA 4QTYA 4PVCA 4A0FA 5K0FA 2FSVA 2E5FA 2J3IA 2WYIA 3AETB 2DBQA 3K6RA 1VBMA 3L3BA 2BRUA 3O2NA 4PICA 1T2UA 2AQIA 2FRVA 4J94A 4KU4A 4PR0A 3OF3A 4BNIA 5JI2E 1DQNA 3PX2A 5JAUA 3LQYA 3LP8A 4I99A 2JZCA 3MJEA 1IULA 4UZEA 1ZGJA 3T94A 2BFCA 5AXCA 1KEPA 4V0LA 5JFGA 2BFAA 5I3CA 5JI3E 3AF5A 3GFFA 2WNIA 3L6OO 4KMRA 1DS6A 4EW1A 4IMIB 4L5YA 4CV3A 3PFKA 4GYYA 1FVXA 1DCMA 4CU2A 4RD0A 1IEQA 2I6SA 1TEZA 1FFSA 3DPSA 1USGA 1DEAA 1GFZA 1BW9B 2OMKA 3C6MA 4I6EA 4J9VA 1R1DA 4LC1A 5WRFA 3MD0A 3HK2A 2O6HA 3GJ6A 1T35A 1TF7A 4RV4A 4EMUA 3QX8A 1RRVA 1WX1A 2BJWA 3K9HA 3UGQA 2XUJA 5F33A 3LMKA 3P20A 3VPCA 4YAOA 2J0UA 4WZBA 1U2TA 4B82A 4PG8A 4PINA 4X7PA 1LW6E 3WGNA 1UEXC 2HFJA 1QHEA 4XGNA 3VRHA 4L0DA 4ZTZB 1LJUA 3NU1A 1UH5A 2BFPA 1SPXA 2OQIA 3W4JA 1MAAA 2X5NA 1E9RA 1WHSA 3C48A 2P1DA 4L4RA 1ENOA 5K4AA 5KTTA 3EIQA 3HNPA 3BICA 3BMOA 2V3CC 2VF7A 1JYFA 3W1WA 1U9CA 5ALOA 3HYRA 3PJEA 1ZGGA 2O0MA 4QQ8A 3H11A 5TVGA 2VAPA 3DQPA 3VPHA 1YGYA 1YKSA 2ZSKA 3G17A 1Z4IA 1KVSA 1UJBA 2XQFA 1LK0A 1LI7A 3KP1A 4XLLA 4LHVA 4NEGA 4KO1S 3FJOA 1I1QB 2D4AA 1HL7A 5H81A 1EUCA 3SM9A 4EMTA 1G9SA 2AFHB 1KXJA 1NUQA 3BQMB 4GYKA 4NBLA 4JQOA 4NABA 4ZQHA 1TFRA 3AOEA 1B8PA 2PJRA 5AW6A 3BIWA 4ZAYA 3CZRA 3ELYA 1KTIA 3EFOB 3UJBA 3VVMA 3RAJA 1X42A 3LQQA 1O94A 4OGGA 4YJFA 3FNFA 4OQXA 4B2LA 4C7MA 1DCFA 3OT5A 4FCTA 4KUEA 1U1DA 5FL3A 2R85A 3DT8A 4OI2A 4EZEA 1RAGA 4IHQA 1W5TA 2I67A 3SOZA 1LRLA 2IDKA 3JQCA 4FNOA 1B74A 4WKPA 3OO0A 4EGCB 3WA7A 1BVUA 1MEEA 4OAOA 2RB5A 4BFZA 3HQ4O 1JHRA 4JQSA 3HDHA 3TD6A 1KI7A 4JLWA 4LGVA 4O0LA 5A9TA 1GXSB 2WHEA 7ABPA 3VR4A 1J23A 5C80A 3L6UA 1WCIA 1QQ5A 3KSMA 1E96A 2C94A 2X2EA 4LC0A 1Y4AE 3A7DA 3OJLA 1EQAA 4YYZA 4IIDA 1B76A 1KEUA 2X0KA 4PC6A 5JCJA 3RWMB 5BNTA 2YWEA 2D3WA 1ZJ6A 3ZKWA 2FWIA 2DSTA 4L57A 4MYTA 3ON5A 3P0JA 1UFKA 1BX1A 2ZKIA 4IIJB 3N0TA 4FONA 2IXEA 4Q05A 5NULA 3TX6A 4ARZA 5BMVA 1ZNWA 3JTEA 3P52A 2AOUA 4LE1A 2N1BA 3KTFA 3PT9A 4AKIA 2CV1A 2JFXA 2B69A 1XZNA 3D7LA 4U3JB 2B0JA 3GFQA 3I9OA 4TWIA 2C8LA 1PV2A 2VC2B 3A1VA 3DE6X 1E8MA 3I6QA 4XWWA 1IOZA 5BQ5A 2P0EA 3VKWA 3IOEA 4JGIA 3NFRA 3TQIA 2XBLA 4HJRA 4IEIA 4IXNA 2OILA 4WV3A 4J16C 4L7QA 5EUMA 2VNHA 1Q74A 1UJCA 2VJMA 3IQGX 3VX4A 3E70C 2BEKA 3ZE2B 2WOOA 4V0OA 4B3SB 3R23A 2GHTA 1TIKA 3IIKA 3H9UA 4Q7KA 1PYGA 1EG7A 5EUBA 3U3OA 2YWRA 4HSEA 2HMAA 5DHQA 1EESA 3IUSA 4QRHA 5DTEA 1M1YA 1Z22A 2P9BA 2D5BA 2H65A 2XMBA 4I4NA 4KAFA 2WTNA 3HB0A 4OB8A 3MFQA 1VIYA 4HMQA 3M9LA 2ECKA 3I2JA 2ODTX 1CUIA 2CDCA 3RRXA 3BTOA 3ZY5A 3B1KA 1NLUA 1JHAA 3R2JA 5LZ7A 1E2KA 4IGIA 5HE8A 1U7UA 3D7MA 4E11A 1PZFA 1IWOA 1KP2A 3E5NA 3HVKA 4MPRA 1E9AA 1U9JA 4HVAA 3QQPA 5CYPA 3VDRA 5AUOB 4YRFA 1DBSA 3HCFA 5GADl 1EFVB 1RWBA 2BVNA 2I99A 2Q3CA 2W6IA 3AZQA 1EB9A 1V5GA 3FE2A 3OF5A 2WFLB 3O5AA 1YI0A 2W2LA 1MV5A 1PBNA 3UC5A 4E4RA 6AT1A 3CVUA 4HGOA 1KY3A 3D6NB 3HWWA 3WGMA 4LSZA 1FYDA 2F43A 4HH4A 1MO2A 2QGFA 1HGXA 1N5OX 2H8KA 5BSKA 4X3PA 4IO0A 1JGTA 5A71A 4YP0A 3K3PA 4BFVA 1X8LA 2PAAA 3T1YB 1RJ9A 1YJ8A 1E3LA 2V6BA 2D4HA 4ZCLA 4UUBA 3W78A 3ADCA 3BHMA 3CLUD 3G9TA 3OT1A 1LV8A 4G85A 4KDEA 4KQCA 3RYIB 1U0BB 3BGIA 3GGJA 1JDSA 4JELA 2O5CA 3PUIA 4JLJA 1N1DA 3Q8WA 3VFDA 1TM3E 2P35A 1M8FA 2V3WA 2ZYTX 3DBRB 1ZP6A 2R65A 5A05A 3ZWXA 4DA7A 1XRQA 1W5BA 2EJWA 2BRUC 3NGMA 4FFNA 5JATA 1JR6A 3ORYA 3WGZA 4FZVA 5F12A 2GZSA 4R83A 3VR6H 2EIXA 5ICEA 1FFXB 2WT8A 5LN1A 3EVDA 5ENVA 1XRSB 4L4ZA 2GCEA 5IAEA 2ZJZA 3EXFB 4R5MA 5KTKA 1HX7A 1A9YA 3IDQA 3B6ZA 1K6EA 1U0LA 3QE2A 1JTFA 5LQUA 1G8KA 2QHXA 4GM1A 3V8NA 2CXXA 5KPDA 3N3BC 4BMNA 3MCUA 3WSWA 3UGKA 1N1MA 4KLCA 1MOPA 2OYRA 1UPUA 2X2PA 2A0UA 3I28A 5KOYA 3EG5A 2UZAA 2AFIE 4TRNA 4KI0A 2EJCA 4M9SA 3IO5A 4I5FA 2A5FA 5LSAA 2J9ZB 1VGRA 4I1VA 1AE1A 2K4MA 2Z8ZA 2Y4OA 3F1KA 4MLCA 5IUJC 1KPIA 1U0JA 1ZGZA 3GGOA 3HS3A 5JC8A 4LWOA 1CJCA 4GPIB 5C8YB 2FPMA 2XKBA 1C4WA 4H08A 1FQWA 3B38A 3FN4A 5EZQA 4HUTA 3EJWA 3ND9A 3OPVA 3VHXA 1FOEB 3GLRA 1K3TA 4C01A 1Z37A 2GN0A 4IMRA 4HXYA 2ZRDA 3FVWA 4N0PA 5H16A 3ZDRA 2VJDA 4NQZA 3S1SA 2FWPA 3VJLA 3CVXA 5FD8A 1D0IA 1D2GA 2BFDB 4X9XA 1AZSC 2J4CA 2BLNA 4LRXA 3S2YA 2E48A 4MKXA 5LMZA 2ZSFA 3GL9A 5CIYA 3PE4A 3LX5A 3SK0A 2PSJA 3HXTA 1XZMA 1GV0A 2Q1SA 3UTCA 3TLBA 3RSSA 1UK7A 3BSFA 3ORFA 1DIOB 5CM8B 1I32A 3MN1A 3OKFA 4DV4B 4KREA 3X1KA 3K2EA 1TUIA 2H3HA 4QDKA 1ZNYA 1KS2A 3EC2A 2ZIWB 4KXQA 4LF5B 2GZRA 2VDQB 4FN5A 4CMEA 1Q20A 3IUBA 4F4DA 4FJ0A 5E2IA 1J70A 1N7IA 2Q2QA 1M5RA 3P27A 3FYSA 1NV9A 4MS3A 5AM4A 2YZ2A 4YO7A 5E4YA 3RHTA 1JJVA 2AOVA 4B6JA 1ZXXA 3B3AA 5EXTA 1FUIA 2JC3A 4BKQA 1B6TA 4BX9A 5CVCA 5CG2A 1RRPA 1R64A 2PRJA 2VDWB 3QMMA 5CB4A 4HTFA 2DQKA 4BQQA 5EGSA 4OY3A 4D4JA 3AZPA 3FLAA 1XEXA 2JCSA 5BW4A 1FMTA 3B6JA 3CQ9A 2RC5A 1Q14A 1Z47A 1EQUA 2E21A 2IPXA 2ZRLA 2JFHA 1R74A 2I78A 1KO8A 2A57A 3OQIB 1MQ9A 4GZ6A 1JS1X 4RAOA 3PC8C 5H80A 2ISQA 1X8JA 3NZEA 4L16A 3WFIA 1YZFA 5CDUA 2X0EA 3UGTA 4B3IA 4LXXA 4I50F 3VHRA 2R6ZA 1A95A 1EDEA 3PF9A 5T5QA 1Y3HA 1KO5A 4L2IA 3L8DA 4LTDA 4CT0A 4EX6A 3V5NA 1Z34A 4H4CA 2G06A 2ONYA 4I14A 2PE5A 2NV0A 4Y1RB 3RIGA 2WYVA 1O77A 2PBRA 2JVJA 1C9DB 2ORED 3QTBA 3AUAA 4HBZA 4YMGA 5BSFA 1FMJA 2OLKA 4TV8A 2AI1A 1RI5A 1TC2A 3BULA 3ZWPA 4CT5A 4WXHA 3PC4A 4RPGA 1FPMA 1ZUHA 1R5OA 4RTLA 3DONA 4MVJM 1OU0A 2ZU0C 3EDCA 3ONDA 4IIHA 4OLHA 3KOYA 4TLDA 1OLUA 3UT5A 4ENQA 5FEUA 2Z8YA 1P1IA 4MUKA 5E0KB 8AT1A 4NG4A 1KK3A 3GLFA 3TRIA 5L53A 1EUCB 1QTQA 1GCAA 5ARBA 5ALVA 3IEIA 3R6GA 1NVXQ 2XKKA 2XIQA 3N8DA 4HEJA 3M4ZA 3H3XA 1H1LA 2RHBA 4QREA 3SNKA 2GCOB 3DMFA 4U2GA 1X1CA 2AMFA 5JWRA 3K35A 4DIFA 2WTBA 1I10A 3IP1A 4OKIA 4ZTUB 4NHEA 3CE6A 2WM8A 2WKSA 2QSZA 4PRLA 3UFBA 5K0SA 1JMKC 2FA9A 2XYVA 1UIMA 4JBNA 2IDMA 2SCUB 1PR0A 1QK5A 4NOLA 5H7XA 3SS7X 2R7LA 4GE3A 3VR4D 3X1MA 1Z3IX 3HZHA 3EQ6A 4M1YA 4NECA 4DMGA 3JASA 1P77A 3WJ7A 1GLGA 1GN9A 1LU9A 1L5WA 2WKPA 2YMMA 1CEXA 2EATA 2AIRA 3IUEA 1OT5A 2R60A 3ODGA 1NSTA 3FCAA 4U7JA 5FORA 1NW3A 2VHJA 2VA8A 2P68A 3A9UA 2ZRMA 1AN9A 3DS8A 3OJWA 1CJSA 3JWHA 4IHAA 1S7CA 2I87A 1DNPA 3ZE8A 1Y7TA 1Q7EA 2J33A 4BRWA 2VBGA 4N7BA 1F6WA 2HGZA 3B1XA 4TYNA 4QHSA 1YFLA 4ZVSA 5L45A 4YLYA 2PJZA 2HK7A 4IJUA 1ZCJA 3A9TA 1GPAA 1A8PA 3SMVA 4W9NC 5DO9A 2Q46A 3U7JA 3GBPA 5HZGA 2D6FA 3AOGA 1YQTA 4IHJA 4S1WA 2VJQA 5BOVA 3AIOA 2OUIA 5A3VA 1WUIS 1W49A 1RLUA 2H17A 4BBPA 2FP4B 4QPZA 1H2RS 4V24A 1R4AA 4EBBA 2RAVA 4BMXA 3CC8A 4ZQEA 1XG5A 4EFMA 1I7LA 1ZCBA 2ZCVA 2Q1YA 1GL3A 4K6OA 3CZAA 4ALKA 4BVHA 1A8HA 1K7EB 3F74A 4C78A 1KZGB 4X85A 4CG2A 4MVJP 5ITZA 3MUOA 3LVRE 1W1WA 3Q1KA 2QPTA 5L7WA 1V2HE 2FPWA 2Q49A 2WP0A 4MICA 3FTQA 3FMPB 4G1BA 5G0TA 1Z4QA 4Q21A 4ZICA 3I92A 1PJZA 1YQQA 1R0BA 2WMNB 2PKYX 4FUTA 4Q1CA 3RI3A 1L4NA 2H9YA 1XZCA 5DCUA 1P9OA 3E53A 2XXBA 1ZLXA 1DAFA 1XDDA 1ES9A 3IP3A 4TMXA 5JJLA 1IRIA 4UPEA 1T0JB 2FYTA 4TUYA 2I4MA 2BWJA 3WGHA 5JCZA 1V3UA 2P8SA 5D8DA 3WBFA 1IY9A 1JN0A 2WYUA 4P92A 3I3OA 5KSWB 1MORA 3JQ7B 2NWQA 4AC9A 3QKTA 3SD7A 4CKBA 1VYUA 4P35A 4PGHA 2AC2A 1VIMA 1G291 1YT5A 3BGSA 2IZ0A 3E15A 1VDZA 2QTVA 2ZG6A 4CNBA 4CEHB 1QHSA 4J3JA 4BVGA 3H2IA 2UXDB 5CVVA 1EP2B 1EVKA 1K7YA 1ECJA 5DHPA 5LNK1 2IHBA 1OWLA 4OH1A 2OG1A 3A3YA 2AUTA 5K0EA 5EMJA 1BU8A 1JDPA 3IALA 4MUFA 4O2AF 4QOFA 4BRUA 5HKKD 3ADBA 3IXMA 4ITRC 2J0VA 2PSFA 4UM5A 4DCJA 4PYQA 1EVLA 1ZA1A 2Y4NA 1XDZA 2R9VA 3IUYA 3I61A 1F4PA 3OT4A 5D7NA 4MUBA 2Z6VA 1M5UA 2R00A 1NE7A 2B6HA 3VHQA 5BW8A 2WWRA 3H4IA 4BWFB 3FETA 5F9HA 1IEXA 2VSQA 4TM7A 1AVTA 2B61A 3R7AA 5HZMA 3AZOA 2FJPA 3T5AA 4M3NA 1EP9A 3V8VA 3U60B 4YUYA 1FXWF 3NONA 4ZIRA 2AFIB 4RV5A 1VE7A 2GAOA 4KWHA 1L9XA 4MPJA 5JMOA 3WRVA 2W2LD 4GMFA 4RQTA 2REBA 2HM7A 2JH9A 5CG1A 2ESRA 1XTRA 2VJPA 3BDIA 3GNQA 2IYXA 3II6X 3P9CA 1VKZA 4TTSA 1YZYA 3SZ3A 4AZ0A 3GD7A 4G41A 3KQYA 4LZZA 3P4UA 4K2AA 2BELA 1PO7A 1IB0A 1UBGA 3IJ5A 3KEQA 4AK9A 1TU4A 3PWSA 2ZBUA 1J8FA 1ODFA 3TFQA 5HE9A 4GI2A 2X4GA 4KXNA 4LV6A 3VI3B 2I6TA 5DTJA 2Q0XA 4HUQB 4G5GA 4PSKA 3CINA 1JEDA 1EM8A 3NKLA 4DCNA 3NOXA 2VAXA 1H93A 3EIWA 4G63A 4M9XA 3ND6A 3FDZB 3OE7D 3PA8A 4NVRA 1INLA 4JEMA 5C52B 1Q2XA 1I36A 1JZSA 2H5IA 4INZA 3G88A 4J1NA 3T5GA 4PLFA 4YUVA 3ZW8A 4D9FA 4F1KA 4EB8A 5C8YF 3TTSA 5JSYA 1KH1A 1NW5A 3ZEIA 3ZR4B