4G1QB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with rilpivirine (tmc278, edurant), a non-nucleoside rt-inhibiting drug
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
424
structure length
416
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Snapshot of the equilibrium dynamics of a drug bound to HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/inhibitor
total genus 117
structure length 416
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4g1qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g1qB03
3GIKA 2JEJA 1RT3A 5F8HA 4TY8B 4NLWA 3KHGA 2W9BB 4EEYA 4WXWA 5KG4A 5DQGA 1RTJB 3CJ4A 1RT3B 2ILYA 4ZHRA 4ICLA 4K4UA 1YVFA 4MFBA 4O44A 1RDRA 3QZ8A 3I0RB 2R2UA 4ZHRB 4ICLB 2FVCA 4K4ZA 1VRTB 4MFBB 4O44B 1ZTWA 3CDUA 3RAXA 4K50A 2BANA 1C1CB 4O3OA 3RBEA 1EP4A 2HNDB 4ED3A 1RT1A 4IDKA 1RYRA 2OPPA 2BANB 1S0NA 3MEEA 2FVSA 4TXSA 2E9RX 4IQXA 1RT1B 4YR0A 1RT6B 2OPPB 3JSMA 5L1IA 5KFXA 3MEEB 3UPFA 4TLRA 4O3SA 4NCGA 4KV8A 3C6TA 1S1UB 4NLVA 3H4BA 4JV0A 4EYHB 3CJ0A 1RAJA 1HMVB 5KFWA 5KT5A 4NCGB 4NLSA 3OLBA 1S1VB 4WYWA 3C6TB 3GV5B 1T94A 4O4GA 3KHHA 1BQNA 2FVQA 4EO6A 3SFUA 3PJXA 5HROB 4R0EA 5J2PA 5KFDA 4O4GB 3KK3B 1BQNB 3MR3A 3DM2A 2ASLA 1RA6A 2BQ3A 2WCXA 3PW4A 4JV2A 3LAMA 4K4SA 5K14A 3QO9A 5J2PB 1C2PA 2OPRA 3DM2B 1JIHA 3KLEB 5L9XA 2W8LA 4ZVFA 3OL9A 1IKXA 1JLCB 4RW9B 3HVWA 3MR6A 5C24B 2W9CB 2B5JB 5KFZA 4RW7A 2OPRB 3KLGA 3BREA 1IKXB 4RW8A 4ZPCA 3OHBA 4R5PB 2RF2B 5I3UA 4X2BA 3KLGB 3GIMA 1EETB 4O3QA 4ECTA 4ECVA 2IA6A 1S1TB 1LW2B 3N6NA 2UVWA 4IG3A 3NAHA 2D41A 1RT2A 3FRZA 4KSEB 3G6VA 2IJNA 3KJVA 1RTHA 4IG3B 1KLMA 4DL5A 1RT2B 1TL3B 2BRKA 3H2LA 5CYMB 1SH3A 3OLAA 5F9LA 1SUQA 1RTHB 2WONA 4URSA 3EPIA 3KHRA 3H98A 2XCPA 3NBPA 2B6AB 3V6DB 1DTTA 2C2DA 1TL1A 2UUTA 4FS2A 3DRRA 1DLOA 4TQRA 1QE1A 5CYQA 4ED8A 1RT7A 1HNVB 1HNIA 1HPZA 3DRRB 3FFIA 3NL0A 5DGBA 5CYQB 2IJFA 5L1JA 5F8NA 1KHWA 3V6KA 2JC0A 1IKYA 4NYZA 5KFAA 5DGAA 2YNIA 1S6QA 3HVTA 4H4OA 1R0AA 4U6PA 3V6HA 2YNHA 4IG0B 1IKYB 1TV6A 2OPSA 4KFBB 1W25A 4IH7A 4J9OA 4LSLA 3V81A 1S6QB 4H4OB 1R0AB 3H59A 4U7CA 3KMQA 2YNHB 3I0SA 1JLFB 3KK1A 4LSLB 3V81B 2IBKA 1HARA 2HMIB 2AX0A 5F8LA 4K4WA 4O4RA 3KK1B 2ZKUA 2V4QA 3DOKB 4JV1A 4G3IA 1K1QA 2XC9A 3IS9A 3NKYA 4RNNA 4PUOA 2IM2A 3EZUA 5L1LA 1FK9A 4NRUA 4ED0A 3KK2A 1MU2A 5J2NB 4K4VA 1S1WA 4NLYA 5HP1B 4RUAA 1D0EA 3ITHB 5KG5A 2AGOA 2AGQA 5C25B 1S9GA 4H4MA 2IC3A 3CIZA 4MKBA 3Q8SB 3RB0A 3H5YA 4IRDA 4ED6A 3QLHB 4H4MB 5C42A 4PQUB 3KOAA 2HNYA 1HYSA 1C0TB 4ECUA 2FVRA 3SI8A 2FJVA 2FLPA 3GYNA 2GIQA 1LWCA 1IKWB 4O3PA 3GV7B 1T05A 3BQ1A 2UVUA 1SH2A 3DLKA 3DRSA 2VG7A 1LWCB 4EBDA 3LP1B 1C0UA 4ZPDA 3PR4A 2RDJA 5J1EA 4XPCA 5KFGA 1XR5A 2CJQA 2VG7B 2W7OA 4M95A 3HVAA 1SH0A 1C0UB 5C5JA 4QW8A 2VG5A 4O3RA 3DI6A 3JYTA 5F8IA 1TKXB 2ZE2A 4JUZA 2IAJA 1FKPA 4IFVA 1XR7A 3FQKA 4Q44A 3MR5A 3M9OB 2J6TA 3QYYA 2VG6A 3DI6B 3JYTB 4K4TA 4F50A 4WE1A 3I5BA 4J9PA 1TP7A 1S0OA 2VG6B 2AQ4A 2AGPA 1XR6A 4MK9A 5KFCA 1S0MA 2FLLA 4WE1B 2V9WA 2JC1A 3QIPA 4QWCA 1VRUA 4MKAA 4WFYA 4ZMMA 2R8HA 3RB6A 2XCAA 3QIPB 5KFLA 3RB3A 2YNFA 1FKOA 3GV8B 3NMAA 1EP4B 4MIBA 4LQ9A 2OPQA 3M9MB 4IDKB 2I1RA 3PW0A 2YNFB 3UQSA 4Q43A 3CDWA 4YR2A 1LW0A 3KLVA 1N5YA 4KHMA 3JSMB 3E01A 5J2QA 3V4IA 1GX5A 3OSNA 5T14A 2DPJA 4G1QA 4QPXA 1JX4A 4QW9A 5DG7A 4NZ0A 5J2QB 3E01B 4Y2CA 4KV8B 4XO0A 2BR0A 1DTQA 2F8EX 4G1QB 5DLFA 2UVRA 4NRTA 3Q8RB 1TKTA 5KG0A 5HLFA 5KFBA 1DTQB 4NLUA 2JEGA 4R8UA 1TKZA 1S9FA 2XI3A 3DLEA 3MECA 3RB4A 3DYAA 5KFUA 2RDIA 3MR2A 4ECSA 3CO9A 3BJYA 4WFXA 1JLQA 3QO9B 3MECB 5K14B 1S6PA 3QGHA 5JXSA 4F4ZA 3MEGA 2WB4A 2XI2A 2CKWA 1S6PB 2I5JA 1RTDA 1HQUA 2D3UA 4J9QA 4RW7B 1QUVA 2WTFA 4J9MA 4RW8B 1JXLA 2FJXA 1IKVA 5DG9A 1HQUB 4TQSA 4K4YA 5I3UB 2ILZA 3CJ2A 2J6SA 5JUMA 1IKVB 4NLDA 3DMJA 3GIIA 4RW6A 5KT4A 2YNGA 4YQWA 5KT3A 3EPGA 2R8JA 4NLTA 4ZP6A 3M8QA 3KJVB 4IKAA 1KLMB 4RW6B 3KLIA 2YNGB 4NLOA 3KNAA 1TQLA 3PHEA 2FLNA 1JLAA 5KG7A 1SUQB 4LSNA 3GQCA 2WONB 5KFKA 5KFHA 1OS5A 2BQRA 1JLAB 3FQLA 3NBPB 1CSJA 3HKWA 4LSNB 1DTTB 4WXOA 4F4WA 1TL1B 5KG2A 5KG3A 3CWJA 1DLOB 3M8PA 1QE1B 2WRMA 4IR1A 1RT7B 4ECRA 1HNIB 1HPZB 3FFIB 3GILA 3H5UA 3M8PB 4ED7A 4H54A 4WZMA 1JKHA 2UUWA 4FBTA 4NLXA 2WOMA 3DOLA 3QGIA 2YNIB 2B43A 3HVTB 5EWGA 3LP0A 4NLPA 3DOLB 1TV6B 2OPSB 2R8KA 2JLEA 3LANA 1WNEA 2WK4A 2E9TA 2FJWA 3KLHA 4DL2A 3LP0B 3I0SB 4ZVHA 5KFJA 3M9NB 4I2QA 5I42A 2D3ZA 5DQIA 5KT2A 1J5OA 2J6UA 3DLGA 1LWFA 4WYLA 3IS9B 3MEDA 2R2RA 1S49A 4I2QB 4PUOB 4B3OA 2C2EA 3T5KA 4I2PA 1JLEA 1RT4A 1FK9B 4K4XA 3TVKA 4DL7A 3KK2B 4QWBA 1MU2B 2V4RA 3VQSA 1S1WB 5EDWA 4B3OB 4YR3A 4ZVEA 4I2PB 1NHVA 5F9NA 2HNZA 3MTKA 5J2MA 3QZ7A 3T5LA 1HQEA 1I6JA 1S9GB 4Q8FA 2IC3B 3MFHA 4O3NA 3H5SA 1HQEB 4ECXA 5KFEA 4IRKA 5C42B 3V6JA 2HNYB 1HYSB 3OL8A 2GC8A 4FBUA 3C6UA 3BSAA 2ALZA 3DRPA 1T05B 5F8GA 4RU9A 4EBCA 3RAQA 4ECWA 2AU0A 3DLKB 2RKIA 3DRSB 4TYBA 2IMWP 4XPEA 3DRPB 4URQU 3FSIA 3FDSA 4J9NA 4KB7A 1JLGA 3ISND 5J1EB 2R2SA 2W8KA 3LP2A 3E51A 3IN5A 4RNHA 1S1XA 2ZD1A 3PW2A 1JLGB 1N6QA 2VG5B 1QAIA 2IM1A 4MK7A 4YP3A 5KFFA 3PZPA 2ZE2B 1S1XB 1FKPB 2IAJB 4IFVB 1U09A 4F4YA 1N6QB 3OL7A 1N56A 2FVPA 1ZETA 3H4DA 2EC0A 3BSOA 1BQMA 1RTIA 5FDLA 2VA2A 1TVRA 3IG1A 3T1AA 3I5AA 2W9AA 4KAIA 2JEFA 2UVVA 4ZP7A 3G6YA 4DL6A 4ZVGA 2XGQA 1KHVA 2ASJA 1VRUB 2R2TA 5KG1A 2DPIA 4TY8A 2W7PA 2W9BA 4TY9A 3SFGA 4Q45A 2BRLA 2XWYA 1FKOB 2IM0A 2HAIA 3OHAA 2JEIA 2OPQB 5DG8A 3Q8QB 3LAKA 3BR9A 3Q8PB 3I0RA 4MH8A 4KBIA 3CDEA 1LW0B 1VRTA 2IM3A 3G6XA 1N5YB 4J9KA 2GIRA 1C1CA 3ISNC 3V4IB 4IFYA 1RYSA 4DL3A 2HNDA 4Q8EA 4RNFA 3BSNA 4ECYA 3H40A 4IFYB 3PR5B 3T5HA 3ICLA 1RT6A 4TN2A 4Q0BA 1REVA 1TKTB 5HLFB 4KE5A 4EO8A 4Q0BB 1REVB 4Y34A 2BE2A 5KFOA 5KFPA 4OL8A 4R8UB 1TKZB 4ID5A 1S1UA 3N6LA 3DLEB 5KFIA 3DYAB 4I7FA 5KFSA 1HMVA 2BE2B 3N6MA 1S1VA 3BGRA 4ID5B 1JLQB 3D5MA 4ECQA 4I7FB 2HWIA 3MEGB 5HROA 2V0NA 4NLRA 3BGRB 1ZTTA 4ZP9A 4HYKA 5KFTA 2I5JB 3KK3A 1RTDB 3CVKA 1GX6A 2C2RA 1Z4UA 1QAJA 3T19A 2E9ZA 5F8MA 3KLEA 1JLCA 4RW9A 4YMEA 5C24A 2W9CA 2B5JA 3DMJB 5HBMA 4IH6A 2QE5A 2BQUA 3GIJA 4R5PA 3M8QB 2RF2A 1IM4A 5HBMB 3T5JA 5D3GA 1EETA 4IOBA 1T03A 1S48A 3KLIB 4KO0A 2O5DA 1S1TA 1LW2A 3QIDA 3NAIA 2YKNA 4Y2AA 2ASDA 5D3GB 1T03B 4KO0B 5KFNA 1S9EA 3PVXA 2YKNB 3OL6A 3MF5A 1TL3A 5CYMA 3IRXA 4Y3CA 1S9EB 1K1SA 5KG6A 4J9SA 1S97A 5KFMA 3CJ3A 2WHOA 4ED1A 3TAMA 2AX1A 3LALA 3IRXB 4QWDA 3KLFA 4RUCA 2B6AA 3V6DA 1JKHB 5EUHA 1T3NA 3H5XA 2WOMB 2D7SA 3TAMB 4ZPAA 1RT5A 4HKQA 3KLFB 3I5CA 4DEZA 2AWZA 3TQ1A 1HNVA 1RT5B 3QGGA 2HWHA 4LQ3A 3DDKA 1NHUA 4TYAA 3KLHB 5F8JA 4NLQA 1SV5A 3KHLA 4ZPBA 3D28A 2YKMA 4IG0A 4KKOA 4URGA 4KFBA 4FS1A 5I42B 5EWEA 1SV5B 1J5OB 2XGPA 3DLGB 1LWFB 4IH5A 1MMLA 5DLGA 2YKMB 3MEDB 4KKOB 1JLFA 3IGNA 4NLGA 4KHRA 4QWAA 4QWEA 4RZRA 5KT6A 5KFQA 1JLEB 2HMIA 3OSPA 1RT4B 3RBDA 5KFVA 4PWDA 3IGVA 1N4LA 3DOKA 5EWFA 5L1KA 2R8GA 2HNZB 4ECZA 5J2MB 4PWDB 1S4FA 3CJ5A 3PW7A 4RNOA 3G86A 4WFZA 3MFIA 4J9LA 4J9RA 5J2NA 3UDLA 5HP1A 4DG1A 4EYIB 3ITHA 5C25A 1NNDA 4F4XA 3C6UB 2C28A 4DG1B 5KT7A 3BSCA 1C1BA 4MK8A 1LWEA 3PW5A 3QLHA 3PJWA 2RKIB 4PQUA 1N48A 1C0TA 1C1BB 5DQHA 2OH2A 1D1UA 4IRCA 1LWEB 3BQ0A 4RNMA 3LP2B 1IKWA 4DL4A 4RW4A 2ZD1B 2QV6A 3BQ2A 4WZQA 3HHKA 2ATLA 1JLBA 4GC7A 4EBEA 3UR0A 3LP1A 1RA7A 1UWBA 4RW4B 4IR9A 4GC6A 4ED2A 1JLBB 2C22A 3KMSA 5KFRA 1S10A 4ZP8A 3NGDA 1BQMB 1RTIB 1UWBB 5FDLB 1TVRB 3IG1B 5KFYA 4M94A 2VA3A 1TKXA 4MIAA 2R8IA 1RTJA
chains in the Genus database with same CATH superfamily
3O44A 3Q2TC 2LQ9A 4EEYA 1RT3B 4P72A 4GMKA 3UD5A 3A1YG 2W25A 2R2UA 1B0VA 1XERA 1PBAA 1BD6A 3BGLA 4IDKA 2VDIA 1LXJA 3CCSS 2GS8A 4M5LA 3MEEB 2VDHA 2HHXA 1O0PA 3EE3A 2V67A 4NCGA 1S1UB 3DOMB 3OPKA 3OLBA 2H51B 4NLSA 3TEHB 4IQMA 2HVIA 3R6LB 1QLNA 1B7YB 1FTCA 1C2PA 3KLEB 2HVEA 5LXRA 4M5NA 3OHBA 2EK1A 4ECTA 2IA6A 3Q89A 2GGPA 3NAHA 4HI1A 4QYRA 1VRQC 4NX9A 2VB6A 1XEZA 3C2PA 4IG3B 1TL3B 2Z57B 3ILOA 3W2WA 3PNIA 5ADZA 1G7CB 1S6QB 5DDPC 2EFGA 4CP5A 2GW8A 4OZJA 5F8LA 1SC6A 3CCWA 2IIHA 4JV1A 1Y3JA 1R3NA 1RADB 5J2NB 1S1WA 3JTNA 4USUA 4WPAA 1PC4A 2MKJA 2YWFA 2FJVA 1D9AA 2ZZNA 2W2MP 4CM2A 4KGZB 2F8HA 3PR4A 1CEZA 3AJ1A 5IT4A 5KOWA 4LVOP 4DV0F 3MM6A 3DI6B 2DIUA 3MM9A 1UZDA 1S0MA 2RJZA 4ZMMA 1NDLA 4NASA 3CCLS 5DM7Q 4OJHA 3CDWA 4YR2A 1ZAVA 2DH9A 2DTJA 1VBKA 2DHSA 2L41A 1S12A 2GV1A 4ZCIA 4G1QA 2FJAB 5LMNJ 4FYXB 5DLFA 4NRTA 3Q8RB 1Q82T 2JHEA 2AZ1A 2MGZA 4ECSA 2CVIA 3CO9A 1LWXA 2VFSA 3F73A 4WFXA 3QGHA 3BDPA 4DR4F 2HYIB 2AEFA 2HHVA 3W60A 1PYTA 5DG9A 2J6SA 2MMYA 3TX0A 3KJVB 4C2MA 1WG1A 1R0CB 1BUXA 2WRMA 1RT7B 4WZMA 2UUWA 3MM8A 1VBZA 3KTQA 2PFFB 4CI0B 4B02A 3MEDA 3D2WA 3UN2A 1JLEA 1FK9B 1G6BA 3THVA 4B3RF 1TUWA 1JWWA 4DV2F 3FSXA 2W2NP 5HJYA 4UTGA 4LF8F 3U7JA 1FDDA 2R7XA 1OIAA 4KB7A 3W61A 1XNQF 2W8KA 3KYLA 4FXVA 3E51A 4F26A 2XMJA 2B7CB 5KFFA 5HI7A 1TVRA 3EGNA 2FJBB 1KHVA 4TY8A 3S6EA 1P27B 2PMWA 3Q8PB 3I0RA 3V2UC 1UVJA 4FKYA 4ECYA 2N3LA 4MKVA 5B0BA 3I87A 3BO4A 4DV1F 1REVB 4OL8A 2K2PA 1TKZB 1WG4A 3CEDA 3D5MA 3SDEA 5F0WA 3OTOJ 3D1QA 2B9XA 2DNHA 1GX6A 1X4FA 3WIVA 1R8PA 2LKZA 3HMJG 2QLFB 2NXNA 2RF2A 4OZNA 2DHXA 2O5DA 5D3GB 1R8BA 4KO0B 2KG1A 1KNZA 3GSIA 4DQSA 1PG5B 2YH0A 2EG2A 5KG6A 3UCUP 2BVZA 3DCAA 2V2ZA 2EKYA 3AOCA 2XSFA 1SI9A 5IT0A 1X4BA 1ZYQA 3M8SA 4GKJJ 4I6AA 2DNNA 2Z56B 1D8ZA 2BJ7A 3FUYA 3TX8A 5F8JA 4ZVTB 4DR1F 4B9LA 2R4FA 3A12A 3L7OA 2HQDA 2ZZTA 4CNZA 3R7NB 5IV3A 5L1KA 2LQ5A 3JS9A 2P2CB 1HLWA 4QOTA 4ZLNA 2MLZA 4MAKA 1QDUB 3DGVA 2ZHOA 3RW6A 4B3MF 5CQGA 4GC6A 4ZP8A 2IFXA 4GKKJ 2WSCC 5HSPA 2B8QA 1LXNA 2W9BB 5F41A 1W26A 3CCQS 2ZOGA 2JX2A 3RAXA 4WU3A 1VMBA 2BANB 4TXSA 4DUYF 2R7UA 7FD1A 2U1AA 3ZO7A 3JQJA 1GXTA 2RS8A 2ADCA 2D69A 4PG8A 2VPWB 2R42A 2C2ZB 2R7WA 3LAMA 2D3OR 4IO9Q 4X4TA 2GHPA 2OPRA 4D3HA 4ZVFA 5DETA 2N3OA 1MLAA 3KLGA 2FDNA 3I31A 2BKOA 2HQFA 4I64A 1RT2A 2QMXA 1KONA 1HHTP 4J5OA 3DRRA 1HNVB 4C8KA 4NYZA 4UZCA 3MMCA 4A8SA 3IWLA 4P10A 2BDPA 4B9UA 1LOUA 1YRUA 1R0AB 4DSJA 4DSLA 2LQBA 4RWWA 2JFKA 1Q79A 2NXEA 1U1LA 2V8HA 2FY8A 2H54B 4L73A 2RRAA 2PO4A 5B09A 1S9GA 2VV5A 2VU5A 4PQUB 2HNYA 1CJVA 3UNGC 4UOGA 2DXFA 4F7VA 4OYZA 1PGZA 2HBRB 4M95A 2MY7A 1SB6A 4O3RA 2HHHJ 2Y1IA 5JVHQ 2XULA 4F50A 1KLNA 1T11A 2AGPA 4ZDNA 1TTHB 4WFYA 4M5GA 3GV8B 4LQ9A 4IOCQ 1A0OB 3KLVA 2P9EA 3GFHA 4CO0A 2DBBA 2VBWA 3L09A 2DXEA 3MECB 4ES3A 5E2QA 2I5JA 4DPYA 3B54A 3L95X 1UW9A 4A46A 2B4UA 1YWXA 1S79A 4QPTA 5AXNA 2WONB 1ROFA 3HKWA 2B9YA 1SC1B 2EKNA 3GILA 1HBOB 1SKRA 3ENAA 3LP0A 4NLPA 3RG6A 2OPSB 3LANA 1PYSB 2Y0SD 4W98A 3I0SB 5E0OA 4ZVHA 1KDNA 4DN0A 4WYLA 4XDCA 2RU9A 9RUBA 4PUOB 3HM9A 4DL7A 1X4HA 2EG1A 1TUGB 1IBMJ 3IA0A 3MTKA 3HD1A 5J2MA 2VL1A 4FYVB 3V6JA 2CG8A 1UMJA 2DY1A 3BH7B 1TL5A 4ZA1A 1A7GE 4C8LA 1R89A 3HHEA 4A8QA 3PZPA 1S1XB 1U09A 3QT5A 2XY7A 3G9CA 2P6TA 4CIOA 2VA2A 1U1MA 3T1AA 1T9TA 4PABA 2D9PA 1EIYB 2J7UA 4TY9A 4F0MA 3R5GA 3OXGA 2IM3A 3G6XA 3LA0A 2ZDPA 2KJWA 1KC8T 4LFCJ 2E1PA 3GIRA 4Q0BB 5ETSA 2DIVA 3FGVA 4FNIA 1RTDB 1ZZFA 2C2OB 4LUBA 4B3TJ 2B8PA 1Y9OA 2B5JA 4IH6A 4W90B 4R5PA 3M8QB 1PC5A 4LREA 1WC3A 2ZJPQ 1GNKA 4DR5J 5KFNA 1WC5A 3P3DA 1SJQA 2AJ2A 3B82A 1Q95G 3US5A 4Y0FA 3LALA 1FFSB 2G2ZA 5LMUJ 4G1PA 3TAMB 2PEBA 3VAHA 3Q23A 2ZWOA 3CD0A 4QR2A 3KLHB 4GVBB 3FRYA 2QX0A 3BB5A 4ZN3A 3ZZ0A 1SIZA 3BKFA 2XGPA 2A3JA 4CT9A 3IGNA 3WBZA 1RT4B 2DXDA 4RNOA 3QT8A 1J5EF 5SZTA 3RYLA 4JI0J 3PTWA 4DFKA 2A6OA 3PYDA 1P6TA 3PRDA 3S7RA 1RWNB 2R7SA 4YDXA 2J7KA 3DXBA 2QV6A 2E5LF 1VYAA 2CQCA 2GHVC 2XMAA 3KMSA 3FSYA 5KFRA 3NGDA 2HS3A 4G1IA 4ZITA 5KAKA 2L3MA 3KHGA 4DQIA 2NS1B 3HZGA 2QLJB 1YZ6A 4ZHRB 4MFBB 1RT1A 1A9NB 2OPPA 3TR5A 3DLJA 1NCLA 1F5BA 2OEKA 4DR2J 3LGHA 4EYHB 5LSRA 4HTIA 1WHVA 1FDNA 1W7WA 1V5IB 4O4GA 1VJQA 3W64A 1VQ4S 2KVQE 2NXCA 5KFDA 1NLKL 4FXDA 3PW4A 3L9ZA 3QO9A 3SCJE 5FD1A 1YI2S 5A6WA 3KDNA 2ZZMA 4KGMA 3MAAA 4ALZA 2ZH8A 3R5BA 1DJ0A 4FVMA 2VBYA 1WUUA 5F3ZA 3KDOA 1VQ9S 3N01A 5F8NA 1FXRA 3V6KA 4PG6A 1U47A 3JAMY 1W25A 4K4SA 4IH7A 1NDCA 1RBOB 2DISA 2HGNA 4YB6A 3C14B 1N5TA 3N4WA 3KK1B 2K7KA 4F4AA 1IN0A 2MZ1A 4RNNA 4O0NA 1U7LA 3A13A 2AGOA 1AFJA 2CFXA 3H90A 5HO4A 3VALA 3P5BP 3QLHB 4H4MB 2ROEA 4OV6A 3BR8A 3KWMA 3SI8A 2FLPA 1XMBA 3BQ1A 1TELA 2DNMA 2ROGA 1VGYA 3ENWA 2H4YB 3OFFA 2BABA 2GAGC 4JUZA 1F9EB 1XR7A 2YPYA 3VAGA 1DBDA 2VG6B 4P2SA 1UVNA 1S5ZA 5IC4B 4U9RA 3U1MA 1FKOA 2Q79A 4LF2A 2XTJP 1QTMA 2HZCA 2J8SA 3JSMB 1GX5A 4ELVA 1IUJA 2L9WA 2XMWA 4ELUA 2F40A 3HHLA 4DX6A 2JEGA 1FI4A 5H9EK 2RDIA 4OHYA 4CH1A 2DR6A 5MAOA 3MMBA 1S6PA 2VC1A 5HQLA 1IKVA 4YN3B 1L3VA 3MM5A 5KT4A 3EPGA 4ZP6A 3GG1A 2QYCA 2KI2A 4Z7CA 1LNQA 4E98A 1DLOB 3HF5A 3R5CA 4L3NA 5IT9Y 1SCJB 4AD6A 3H8YA 3N9UC 1Y0HA 3UN5A 2JLEA 1SL1A 2RUSA 3CD5A 2VZ9A 4ZVUB 5D77A 2J6UA 5JMNA 5BJRA 2LLZA 5B0CA 4P7TA 5LXYA 4CO4A 1KKHA 2E5GA 5C42B 1VIXA 2N7YA 2DNRA 3FSIA 1APSA 2VASA 2BJ1A 2XSJA 2HIYA 2ZE2B 3AT1B 3UDVA 3HHNB 2EC0A 5A0YA 1XIQA 3L4BC 1TFWA 2MKKA 2EC2A 4JI7F 5DG8A 4KBIA 1SC3B 5IV4A 1K0VA 3C46A 3AHPA 4FXWA 1UP1A 3G4SS 4KE5A 4OYIA 4XDDA 4R8UB 3H2UB 1V3ZA 4I7FA 2BE2B 3BGRA 4QYZK 2KG0A 4ZP9A 2HK3A 3KK3A 1N36J 3ETMA 4NZ7A 4DR7J 2YKPA 5HBMB 1FD8A 3UDCA 3UVJA 1OYDA 1G4CA 1S97A 3BEGB 1BE4A 4RUCA 3V6DA 1JKHB 3OFEA 5HMYA 3MD1A 1FT8A 1WSRA 4F67A 2ZJQQ 4DR6F 2G2YA 1VLYA 1X9SA 2ZVSA 4USVA 3K7RA 3F56A 1WD6A 2W7AA 5EWFA 4FDFA 3PW7A 2HG4A 4OX9J 2BJDA 2HW3A 2FC8A 4KTQA 4C4WA 2C1EB 5E3PA 3TQEA 3VAJA 2F8MA 5AXMA 4D3GA 4CLUA 1F60B 2RHSB 1VQSA 2KDOA 4PQAA 4JBCA 2OD6A 4OQJA 2H5EA 2R8IA 3GIKA 1RT3A 1RP5A 5DQGA 3POTB 2IBOA 3H7HB 4HI2A 1YRTA 2QT7A 3D1HA 4ICLB 3RR7A 4USJC 3LH2S 3T3FA 2PC6A 2OEMA 1Q86T 1SJ3P 3MEEA 1LK7A 2C3YA 4O3SA 1FRXA 1RSCA 3NS7B 2QZ8A 1YRXA 4QR0A 1R6VA 2MZJA 2JL9A 2E1AA 2XYHB 3CDAA 3NWRA 5K8NA 4RW9B 3L7PA 3ZTSA 2ZBQA 3J81Y 1IKXB 1RE1B 1EETB 2QN6B 2YQ0A 4J91A 3CD7A 1Q1KA 4IG3A 4DCOB 1BC6A 4JI4J 1F5AA 2EFVA 3OLAA 5AXKA 2XCPA 2B6AB 2ZEJA 1QE1A 4N41A 4DL0C 1HPZA 2MKYA 3O3LA 1KHWA 1RAAB 1RAEB 2LQJA 4CTAB 1S6QA 1PKUA 5ETTA 2KN4A 4YEAA 2ZH6A 4NRUA 4WCEQ 1NM2A 1UFLA 4NLYA 5DJBA 1U26A 1KN6A 2GJ2A 3C3LA 4PRFA 1ZM4A 5DS7A 1NB2A 2YY3A 1X9MA 1IKWB 4O3PA 1FO1A 1RACB 1Y3KA 1SH2A 3W7BA 3PIPQ 1KVKA 2FYXA 3RTVA 5J1EA 5KFGA 3K8WA 4HTJA 5IWAF 2D74B 3KFWX 3DI6A 2ZFHA 1AZSA 1QJHA 3CDBA 3M8RA 2FHJA 5KFCA 2JLFA 1I3OB 5HVGA 2EPIA 1B64A 3BGUA 2MTLA 2BW7A 1TR0A 2CDQA 2CAJA 2M88A 4KPYA 1JX4A 3BDEA 4U67Q 1TKTA 2WW4A 2PDAA 1HNZF 3OR1B 4X66J 1JLQA 1IQTA 5JXSA 1CULB 3AD9C 1VFJA 4J9MA 2HFNA 2I6WA 4W4MA 4GVLA 2CQIA 3MMAB 4RW6B 4C8ZA 3Q0AA 1E6YA 2IRYA 1DQ9A 1DTTB 3MURP 3K17A 4QQBA 3FFIB 1IBKF 1NDPA 1Y10A 1UEKA 2AJ4A 3GPAA 1Q5VA 2AHOB 3LUYA 3T9ZA 2AP6A 5D0RA 4C11A 2VUGA 1J5OA 2HK2A 1IBLF 3BO3A 4EMDA 1D9DA 4LR7A 2GAHC 4JI2J 3EWGA 4QWBA 4Y28C 2MQPA 1J27A 1Q7LB 5F9NA 1FRMA 2GC8A 2KFNA 4ZJLA 4ECWA 3QRQA 3HX9A 1R43A 1WWHA 3DFEA 4DSIA 4ZJOA 3D0GE 3EUNA 1T7PA 2JEFA 5T7LB 4USMA 2E5HA 1XNRJ 1NUEA 2HEKA 3I96A 3SFGA 3LAKA 3FJ2A 5FIIA 1Q8BA 3ISNC 1YK9A 4HDGA 2BOPA 3BBCA 3UO0A 5M2RA 3OXFA 1REVA 2PMZD 4EO8A 2C2MB 3U1NA 5A76A 1N32J 2GQ2A 2K7JA 3BYPA 1VK8A 1T3OA 3AOBA 2E7VA 3GJSB 2VH7A 3IMQJ 2X1FA 4DSEA 2KM8C 1IBMF 4ELTA 3GIJA 1XC9A 1FHTA 3T5JA 5D3GA 2ZH7A 4KO0A 2AMCB 1LW2A 2BA9A 5B0AA 2DNZA 2ZBPA 4MJKA 2CNOB 3MEKA 2YX7A 3ZTQA 4DV7F 4DF4A 2D7SA 4ZPAA 2ROPA 4BHQA 3K0JA 5HQMA 2AT1B 5THWA 1DARA 2MQMA 3C66A 2MLYA 5IFMA 3TA1A 1AUSL 3DOKA 4DZ6A 4OYBA 5E5NA 2RILA 3HHLD 2COLA 1X5SA 2C28A 4DG1B 2KRBA 2UUCF 3G8SA 2RKIB 4ZK7M 1U1OA 2EEYA 4NI2A 4DL4A 2ZD1B 1AUDA 1D9FA 3GFZA 4OJGA 5GVQA 1KRPA 4LRCA 5FDLB 3T1HJ 3AH6A 5CCMA 3GR0A 2UU9J 5EX0A 1Z2LA 3S8SA 2BANA 3TOQA 1M5VC 1EKRA 2LA4A 4X4PA 3W9JA 4KYZA 2DEJA 3UPFA 5LMUF 1S77D 3CJ0A 3W62A 4DOZA 3PYGA 3HXMA 2VPYB 5ETNA 2FVQA 2KZMA 2W2OP 3A8JA 1OYEA 2J8AA 1JLCB 3CJKA 4F3QA 2QC3A 1JNZB 3CJRA 1UVKA 2J7WA 3GIMA 3QRRA 1ZM3A 2W1BA 1WHWA 2BRKA 1SH3A 1RTHB 3H98A 5CAAA 1YIJS 3CCJS 4FS2A 3GMGA 3OR2A 2BMBA 1G2EA 5DGBA 3R5JB 1VI7A 5D15A 2YNIA 3BBBA 1R0AA 3V6HA 2RMLA 1TV6A 1K73T 3K5OA 4LR9A 3IS9A 3NKYA 3EZUA 3MAQA 1LV5A 5KG5A 2AGQA 2UXBF 4CQ1A 1FWLA 3OTCA 4QJVA 2OJ3A 2IHR1 3GV7B 3DLKA 3J7Z5 1R8CA 2VG7B 3PDNA 3HVAA 1C4AA 1NBEB 2K06A 1TP7A 2IYGA 2AQ4A 1XR6A 2P9GA 5ETKA 4A8MP 1FDBA 2XCAA 4LF1A 2RHQB 1IR0A 1DRZA 4MIBA 2HLTA 3PW0A 2FC9A 1LW0A 4B9SA 4PPDA 1FNOA 2V50A 3P96A 5A8WA 4QPXA 3E01B 4YHHJ 1H72C 2VQFJ 4KV8B 2UVRA 1N5VA 4U8VA 3HSJA 2XI3A 3MECA 4G65A 4NXMJ 5D4LA 4LJMA 4RW7B 3KXDA 4DU8A 3HJVA 2I38A 2YKOA 5HK4A 2R8JA 4NLTA 2DGXA 5D8HB 3J7YU 1SUQB 1ZAWA 2QSFA 2HRUA 3P6YC 3R1LA 4C8OA 5M2UA 4H54A 2KU7A 4CRJA 2KXNB 1NSKL 2X3GA 3AQOA 1WNEA 4WWSA 2AJ0A 5KFJA 1HA1A 5IOLA 5DQIA 3PO5A 1M5KC 5C7PA 1HBMB 3C15B 2C2EA 2CNNB 2NCKL 4DV5F 3ILJA 3KK2B 3M2VB 2VBZA 3E3XA 3W5YA 4TU7A 1I6JA 3B4DA 4ECXA 3TJ9A 4X62F 1Q4RA 2HFSA 3C6UA 4USHA 2E7WA 2VF3A 1NAQA 3DRPB 1RUSA 2R2SA 1GK8A 3AY0A 1UVIA 4HEA9 1S1XA 4K5SA 1YBAA 3MCSA 2ZKTA 1DQ8A 6AT1B 1RTIA 3UN3A 1QD1A 3AD8C 5GAEU 4ZP7A 2NPIA 4NWBA 4DFJA 2W7PA 2FB0A 4Q45A 1CPZA 2BXJA 2BYCA 2XS5A 4MH8A 1AA1B 1VRTA 4NMXA 3V4IB 3MCNA 4Q8EA 5G0RB 3ICLA 4Q0BA 5HLFB 4RKUC 4AYBD 3MD3A 1UTAA 2MQOA 2HQCA 2DNQA 4LT6A 3DN9A 3M8YA 4HYKA 3TNVA 1U4BA 1RHKB 2PFDA 1GTEA 4DV0J 3DMJB 4ZOSA 4RUHA 2FPHX 1NSPA 2RB7A 3WC2A 3CGIA 4DU7A 2CJYB 4UOHA 2W24A 2QG9B 2C3MA 1Q8IA 3TAMA 2EFPA 3X3UA 3IRXB 4DI6A 7AT1B 2UXCF 3M05A 1ULRA 2FHJD 4RU2A 4LQ3A 2ZH5A 4IG0A 1Y5LB 3RBDA 4DR4J 2YKQA 4CO3A 1EHWA 2XZWA 3KKFA 4ZCLA 2ZM6F 5A8KB 1QSLA 2QEXS 2Z0GA 4CLWA 3CMQA 2XQCA 4LBHA 1LWEB 4WJBA 1FJGF 4F8RA 1F3VA 1RBAA 1RA7A 3TUIC 4RW4B 1CJUB 2DRAA 2RRBA 1UWBB 3CCRS 4I0WA 4N77A 1IJEB 1RQ0A 4ZHRA 4ITSA 4MFBA 3HHDA 4O44B 4LR8A 4DV3F 2J9CA 1EP4A 2HNDB 3MPUB 1I51B 3KUEA 4B3RJ 3G8QA 3DU6A 4O23A 3EVOA 4AL7A 4DV2J 3M7VA 1NZAA 5HMXA 2KYZA 1HMVB 3OD2A 3GV5B 2ABYA 4LF8J 4KY3A 1ZPWX 4OHZA 1BQNB 3QJJA 1GT8A 2AJFE 3OQ2A 1XNQJ 5J2PB 2W8LA 3X1LB 2V63A 4HACA 4DX5A 2DR8A 3MR6A 5BYSA 5AJ3F 2BACA 3NLCA 5ETVA 3LW5C 3M2UB 1VQLS 2JSXA 3R3TA 3B78A 3DNCA 2HQGA 3N79A 1EKSA 1Q7YT 1WKKA 1IKYB 4DV1J 3QFWA 1M0SA 3KMQA 3KK1A 2JFDA 3R8YA 5HVFA 2HMIB 3AFGA 4MYTA 1EJ7L 3MOJB 4PXBA 1TUVA 1Q5YA 4CO1A 3FNNA 4X4QA 1MU2A 3BF4A 3RBXA 2DH8A 4H4MA 1YDLA 3L3CA 3RR8A 2DGQA 1HIYA 4X65F 4V19X 1FWPA 2UVUA 1JNRB 2VG5A 3AOAA 1VDHA 2XEXA 3QSYB 4Q44A 2VG6A 5GADI 3W9HA 3Q8YA 5E3RA 4DCJB 4DR1J 1U24A 4BCAA 4CH0S 4UT4A 1N5YA 2VQEF 1YX2A 1V6HA 2F4FA 4A47A 3AODA 1XK8A 5DZ6A 3DYAA 3UD3P 5K14B 1RWVB 1Q53A 2BEFA 3MEGA 4DV4F 2WB4A 3D0IE 3BKUA 3RUBL 4B3MJ 1H2TZ 4C98A 4RW8B 4UW2A 1NPPA 5I3UB 4LSZB 1CJKA 4HDHA 4EK2A 1RAIB 4JYAF 1HFEL 1RCXB 1KLMB 4RUBA 5DRKA 3RGIA 2GIFA 4LBPA 3FKBA 4CLZA 1TL1B 4DS4A 2OHDA 4DUYJ 2J9EA 2B9WA 3HVTB 2OLWA 2FJWA 4MYUA 4CYUA 3G2XA 5LSOA 2W01A 3DLGA 1LWFA 4HHUA 2YXLA 2PI4A 3M32B 4WKRA 3VWSA 4B3OB 3CCTA 2KL8A 4M5DB 2RQKA 3MFHA 2G0CA 3CULA 1HYSB 2J5AA 3BSAA 2ALZA 4CH7A 2MB0B 2V4JB 4EBCA 2B4VA 5IZHA 1RWUA 2GZOA 3PW2A 5J1NA 1FKPB 4KPCA 1ZETA 2BM1A 4DL6A 1XMQJ 4OV1A 2DPIA 3D68A 3BR9A 3U1LA 3JSRA 3HFVA 1TU0B 4QBUA 1TL7B 3GJRB 5D78A 4OYWA 2CDRB 2QLBB 2BE2A 4QZVB 3DLEB 3SEOA 2F4VF 1S1VA 3SSQA 4F3OA 1Q78A 1HBNB 2PD1A 3R2CJ 1TMMA 1SL0A 1G1XA 4DQPA 3FEYB 4JI2F 3MPYA 5HBMA 2QE5A 2HSEB 2MQNA 4I1TA 1CJTB 2GHWA 2VD3A 4ZPTR 4DFMA 1VCTA 2WHOA 4ED1A 2VOOA 2LEAA 3ZNUA 4USIA 2PE8A 2GQCA 2MKSA 3I5CA 1RT5B 2AYGA 4TYAA 1B7FA 4OI3A 3ZFVA 3HCXA 4TU8A 4KH1B 4FS1A 2XLKA 1RISA 2YKMB 1JLFA 2ZJRQ 1RHQB 3OSPA 3CJ5A 1HI8A 3IM9A 3UDLA 4EYIB 3A3NB 3UE2A 2ZOFA 1X5TA 1IVZA 1V3SA 1C0TA 2D1CA 3PYFA 3CMES 4QIFA 3TAQA 3IBFB 2FJEB 4ZJQA 2C22A 3IG1B 2VA3A 2G9OA 5F8HA 3M4XA 5BR8F 2CWKA 4ICLA 1U8WA 4DZDA 1XMOF 2HHPA 5EHHA 2FVCA 1FD2A 4WFBQ 4O3OA 3PO4A 2EFOA 3KJNB 3UCZP 2E9RX 2CQDA 3EVWA 1C4CA 3FMBA 5H1SV 4EO6A 2V94A 1OY6A 2DR7A 2WCXA 4HHJA 3W2VB 1VC5A 2DNPA 4LF6F 3CCVS 1IKXA 2DGSA 1LFWA 2DHGA 5DM6Q 2V2QA 5AXLA 1YJTA 2LFVA 1S1TB 5GAGU 1RI7A 5F9LA 5B08A 3MUVP 2XLIA 2CPJA 1NXIA 4P71A 4C3LA 4N76A 4X84A 1PYOB 3IR7B 2KM8B 3D67A 5CZXA 3M6WA 4WBFA 2LEPA 4O4RA 2CZ9A 2XC9A 4J37A 4HR2A 2A2CA 2HKEA 1T02A 1J2VA 3ITHB 1FFGB 2V2KA 2IC3A 4QR1A 4ETZA 4B08A 2OELA 2C3PA 1E6VB 1SKUB 3GYNA 4NCBA 1T05A 3I56S 3V5RA 5LL6d 1X5PA 1AB8A 3HHLC 5D4PA 1UWAA 3MMJA 3JYTB 3FBCA 2R7TA 1B4SA 5SUHA 2BJEA 5GMDA 2H4WB 2R7VA 1GXLA 3UW1A 4X4RA 3QIPB 3LTOA 2Z30B 5IXUA 4IDKB 4PXEA 3KUGA 1X4EA 3UD4P 2WVDA 1F9FA 3UI3A 3J7YI 1J5EJ 1HWIA 4YY3F 1DTQB 5K20B 4I6YA 1UPPA 1S9FA 1DURA 1CULA 2XO6A 2E5LJ 2CKWA 2JVOA 4NMLA 1U48A 1PJ5A 2VPXB 1S0VA 1WF0A 2GGPB 2DT9A 4RW6A 4OIXA 2WAQD 4HT5A 4NLOA 2FLNA 5KG7A 1UJ6A 4HLBA 3W9IA 3GG0A 2CPDA 5HVHA 1X0PA 2ZOMA 3W2WB 1PAUB 4IR1A 2IRXA 4ED7A 2E5JA 3CJQA 3ILIA 1FWKA 1NRKA 2R8KA 2ZH1A 3GTYX 2DNLA 4U95A 2CJXB 4WP9A 3D6MB 3TA2A 4ANEA 5GAEI 1S1WB 2YWWA 4ZVEA 1NHVA 1M5PC 2ZH4A 1BXNA 4JI6F 1B70B 5L46A 3FK4A 1T9XA 5IQQA 1UL3A 4WFNQ 2BOAA 1BHNA 4ANCA 2HFZA 4UQGA 3I9V9 5T7LA 3QFHA 2B51A 2XGQA 2NYHA 5KG1A 5KOXA 1O6XA 2BRLA 2CJKA 1RGVA 2JEIA 3K2YA 5K9FA 4P2FA 1RT6A 2B0GA 2E1RA 1T8EA 2BUNA 2B7BB 3CC2S 3LGMA 5H9FJ 2MGZB 8ATCB 1UA0A 3OFGA 3CPWR 9ATCB 2DHHA 5KFTA 2C2RA 3T19A 5F8MA 4E2FB 1RKJA 5C24A 4C97A 3MI7X 3DHXA 2QO3A 2HQIA 4GRSA 5EX3A 1K1SA 4M5IA 3IWXA 2JOQA 4X4VA 1RWPB 3GWCA 3H5XA 4DF8A 2RDDA 2CRLA 1U2RA 2A6MA 3TQ1A 4M5JA 5LOQA 3RRHA 3QGGA 5KTQA 3DDKA 1UFKA 3FCVA 2I9SA 3M8ZA 3OW2R 4URGA 4KFBA 2VICA 2MQ8A 3VGUA 3MEDB 3D6TB 4KHRA 1R8AA 5KT6A 1JLEB 2QIFA 1JQGA 1YBUA 4PWDB 4JI3F 4X64F 5HP1A 4DG1A 5C25A 1ZM2A 4LF5F 1KVIA 5GMEA 4IRCA 3DGPA 2E44A 4OYMA 2HHSA 1KOHA 2XYGB 3LP1A 5RUBA 3FBEA 4CO2A 1Z1ZA 1TVRB 2ACYA 2CWXA 1TKXA 3PRBA 4TY8B 3DC2A 5L9NA 1HD1A 2KJVA 2XMTA 1WOOA 3I0RB 4V1Ak 3RBEA 1FXLA 4ER8A 4ENOA 3ZZRA 2FVSA 1V3RA 4CWBA 2P9CA 3M6UA 1KVJA 2KFYA 2J0SD 3G6ES 3SDEB 2YQ1A 3WZ0A 2ZHAA 5KFZA 2PIIA 1NB7A 2RF2B 3FEZA 4O3QA 3D6HB 4OYOA 2SXLA 3FRZA 2LMIA 1RTHA 4JI7J 1WF1A 4OX7A 1ICEB 1FVSA 1HHSA 1D8YA 3SV4A 2GNKA 1T95A 3U27A 4U8YA 3ENVA 1FXDA 4FKXA 2MYFA 4K4WA 5D0GA 5A6PA 2N4DA 3KJQB 2FHMA 3QAUA 1RXOB 1T9YA 3WDOA 5L8RC 4ES2A 5K8OA 4DN9A 4X4UA 3ZTOA 4IRDA 4JI1F 1U6FA 3Q86A 2WB1D 2VG7A 1VJWA 3SSSA 4JV5J 2RDJA 2W7OA 1X5OA 4USTA 4LF9F 3MOZA 4XTTA 4IFVA 1HR0F 2W2PP 3M9OB 2HBQB 2HHUA 1JJCB 2A10A 4IO1A 5FJ4A 5IC6B 4DR6J 2Q6BA 1HNXF 1GMWA 5AT1B 1Q0NA 3M9MB 5B0FA 1HBUA 3W5ZA 3E01A 2RQMA 3EYZA 4CCHA 3A3PB 4I68A 4AT1B 2DGOA 4HVZA 5KFBA 3FVYA 2KHDA 2DJWA 3J7ZT 1QUPA 4P75A 5D0HA 1H0HB 3ZTPA 2QLWA 4F4ZA 2YX1A 4OYPA 2XI2A 3NCPA 2MQQA 2O1PA 1WI6A 4LFAF 4LRAA 3GB0A 1ZAXA 4C48A 1HKAA 2UXDF 1YG0A 1ZS6A 4OZ2A 3NGRA 2BE7D 3Q24A 3SCLE 3NNAA 4F4WA 1NSAA 4L76A 3KG4A 4ECRA 3M8PB 2G0JA 1QM9A 2EWHA 1OQ3A 1VR6A 1RBLA 3MMCB 3TA0A 1XWLA 3DOLB 4ZLPA 1F2HA 1PBUA 3M2RA 1HBMA 3C15A 4PYDA 3M2VA 1TK5A 3T5KA 2NQPA 5BYQA 5EDWA 1NK7A 2HNZA 2OAUA 1KD1T 1IWAA 1S9GB 1U0HB 2QJ3A 3T1YF 3GP9A 1HQEB 2HNYB 3VQTA 1OMSA 1CJVB 4B9TA 3DRPA 2HIQA 4ILRA 1X7VA 1GQEA 2YWEA 3UWTA 4EWTA 1JLGB 2H5JB 3OVAA 4MK7A 1PJ7A 1NK9A 3OL7A 2G1DA 3NS6A 1WSVA 3W66A 2Z2YB 3MZIA 2ASJA 2XZTB 1X0FA 2C2KB 4OZ1A 2GIRA 1C1CA 3VF0B 3BSNA 4QU7A 3W1YC 4RBUA 3CJTA 3FC9A 4NXNF 5KFOA 3N6LA 5KFIA 5KFSA 3N6MA 2LXIA 2HWIA 5HROA 2I5JB 4RBVA 1VBXA 3TUJC 2GVDB 2E9ZA 5IWAJ 2OO4A 3UDEA 2MLXA 2KT2A 1YJWS 2DD8S 4UOFA 2Q43A 4Y2AA 5C2CA 1UJ5A 2OP5A 3IRXA 4JOUA 3VGTA 5CCLA 1S7IA 1BWVA 1VISA 4FF3A 4I67A 4P2MA 3KHLA 5LSLA 5EWEA 5HANA 1XMQF 4IH5A 1ZBTA 5DLGA 1HNZJ 4KKOB 4RZRA 2YBVA 5J2MB 1S4FA 3N0VA 1U6BA 3RJMB 4BLGA 5A8KA 1WDDA 1SKSA 1LWEA 2DK2A 2JZ5A 3PJWA 1FNMA 2WVCA 3BQ0A 2CQ4A 4FP9A 4RW4A 1HD0A 4KJIA 1UWBA 4IR9A 2QA4S 1IBKJ 3VV2B 1FRKA 3VAKA 1KSPA 2KFZA 4KIAA 2J76E 4Y65A 4O44A 2W2QP 2HBYB 3A4TA 2K8GA 4RR5A 1IBLJ 3DRXA 2J9DA 4YR0A 2A18A 1JJ4A 5GAGI 4J7CA 6FDRA 1FTRA 3OFHA 5BXIA 2XMKA 1NEEA 3QT6A 2CQPA 2BJ8A 5KFWA 5KT5A 3T9NA 1BQNA 2BJ9A 4EFAC 1O5JA 5J2PA 1CVJA 3MR3A 1RA6A 2G13A 2B5JB 4RX6A 2L9NA 1MROB 4R5PB 1NMEB 4ECVA 4OZ3A 5CHCB 4AE5A 2EVZA 3H0PA 2LXFA 4DL5A 1BMQB 2OFHX 2QA4G 3SQGA 3OJSA 4QCLA 1WF2A 2MSSA 4L72B 4TQRA 2OIHA 3ZZOA 1IKYA 3FCWA 1NKCA 3Q8VA 2CQ2A 4IOAQ 4KHPF 2YNHB 1IM6A 4M5KA 1FE0A 3D3CJ 3NEKA 3VZHA 1GEHA 4K4VA 2JVRA 4OZ5A 3LPEA 1AW0A 1L3KA 1NJXA 3KOAA 4ECUA 4YUDA 1H6KX 4HT7A 1F9HA 3K5NA 3DRSA 2OSQA 3OTEA 4DV7J 3M1VA 1UAWA 1C0UB 2A2DA 4Q2LA 1PILA 2IAJA 2J6TA 4OYAA 3MR5A 2MKHA 3SXLA 4CM0A 2C3OA 5HATA 1VRUA 4K8RA 4WFAQ 2LCWA 2LECA 1N8RT 2I1RA 2YNFB 4A8XA 4F04B 4ZVSB 4EZ6A 1SXLA 4ED4A 2DPJA 3C8YA 2V8PA 4FF2A 3TUZC 2F8EX 5KG0A 2UUCJ 3MM7B 1H73A 1AYEA 3RB4A 2C42A 1UW4A 1Y5IB 3QO9B 5HQ8A 3NGUA 3K8VA 5EN1A 2RU3A 1MWQA 2HZAA 4F4KA 3I32A 2ILZA 4NLDA 2RQ4A 2YNGB 2CQGA 3GFYA 1LEOA 5C2GA 4LSNB 2XLJA 1M5HA 2DGTA 4M5MA 2QMUB 1HW8A 1H3DA 2WOMA 4PWWA 3AAWB 2A0FB 1OO0B 3T6JA 4CNYA 5E41A 3WC0A 1AXQA 3E8OA 3J80U 3BV8A 5I42A 1WHXA 1BQXA 1S49A 4B3OA 1T9WA 2MHEA 4X4OA 2QYGA 1AROP 4I2PB 1LK5A 4L3KA 3SZ2A 3MDFA 4IRKA 4DV6F 3DHWC 4OX8A 2PA8D 1CS4B 5IQ6A 3HULA 2RQCA 4CLTA 2ZH2A 4URQU 3UR3C 1NH7A 2N4CA 1P9QC 4YP3A 1BQMA 4KT0C 3GSDA 3EX7B 3M6VA 3NCRA 2R2TA 4DQQA 1B0TA 4B3SF 4JI8F 1FKOB 4LVNP 4OHWA 1U45A 2M7SA 4ED5A 2GMLA 3H40A 1DHMA 2UXBJ 3HHLB 4NA1A 2GVZB 2FTRA 5DO2A 3W8GA 4Q5VA 4ETXA 4WIIA 2FGCA 4U96A 3MMBB 4CLPA 3CVKA 3AJ2A 4ZKAA 4WTYA 1NK0A 3BPSP 2RUGA 4C6AA 2W9CA 3M6XA 3L7UA 3MM5B 2FQQB 1U1NA 1CJTA 2MDAA 1YTYA 1T03B 2ZBRA 3MF5A 2MKIA 5CYMA 3NOCA 3ELHA 4UF4A 3CJ3A 5HAOA 1B3TA 2E29A 5EUHA 5LJ3Y 1RT5A 2HS0A 1NSQA 2A1BA 3ZZZA 2YKMA 4M1KA 2PSZA 5KFQA 4TNOA 2H1YA 2CQBA 2GMHA 4TVAB 2YX4A 4ZPVR 5E33A 3O1LA 4JI5F 3PW5A 4DLEA 2R7OA 5DQHA 1D1UA 4ERDA 5IM0A 1KWMA 2XSJB 2CZ4A 2R7QA 2XWXA 1LFPA 2HQ3A 4UY85 3EGZA 5A0YB 4F02A 2DEIA 4MIAA 2JEJA 4LBIA 2R9LA 3MXHP 2ILYA 3C16A 2XY5A 1UVLA 2VBXA 2BE9B 3DDNA 4HH0A 4ED3A 1L3UA 4DV5J 1HHQA 2I2YA 2WVFA 2GO9A 1WELA 4NLVA 4X62J 1GFWB 3C19A 3TP2A 1RWKB 3PJXA 3W2VA 3KK3B 2ASLA 4BWJA 3CB4A 5L9XA 3DM2B 1HWLA 3HVWA 1REGX 2D3O1 1Z2ZA 3MPDA 2UVWA 2K3KA 1FRLA 2D41A 1V9OA 4KSEB 1URRA 5JJBA 3UVJB 5CXTA 4URSA 1S99A 5CA5A 3NBPA 3V6DB 2AYMA 2UUTA 1X4GA 1PJ6A 4CLYA 1HNIA 3TAPA 5CYQB 3RAMA 4U6PA 3LOUA 2GA7A 1H2UX 4U7UK 3CXCR 3BM7A 3V81B 2V4QA 3CJSA 4G3IA 3OV7A 1KOOA 5L1LA 2IM2A 4NA3A 2HURA 4PWUA 1CG2A 4MKBA 2AJ1A 2QL9B 2OKQA 2ASYA 4LIRA 2CPYA 3BGOP 3BGFA 2DGUA 1R0BG 2J0QD 4H4KC 3W3SA 1SH0A 2MZSA 3IM8A 2UXCJ 3JYTA 3HLUA 3HT3A 1NJZA 4EU0A 3JQMA 2G2OA 4QWCA 3QIPA 2F1FA 2CQHA 3NS5A 2HWTA 4NYOA 2OPQA 4R25A 3OSNA 4DPWA 2Z2ZA 2KB2A 4NCAA 1DTQA 3JB9k 2ZM6J 2UZAA 1MNEA 1RWMB 1UA1A 4JB8B 2WW8A 4CLKA 3UCGA 2LP4A 1FJGJ 2FZGB 3MAHA 1HQUB 5I3PA 3M30A 1UKUA 4HHHA 4WU2A 2N82B 2CNLB 1N33F 2QMWA 3LWMA 3SV3A 4IKAA 3KLIA 1TQLA 4DUZF 3GQCA 2YH1A 4WXOA 4DV3J 5KG2A 1QE1B 3CSKA 2H3EB 1HPZB 2WSEC 4JV5F 2Q66A 2F63A 4QIWD 2WVEA 4Q2MA 3AA9A 1FX2A 4ZIWA 2IYIA 3CNQP 2VFRA 2EK6A 3NXZA 4OMFG 2D3ZA 3VTIA 4UUWA 3TVKA 2V4RA 2I0XA 3VQSA 5GMKa 3QZ7A 1TL4A 4DS5A 1M1KT 5AJ3J 2DGWA 2JRSA 4I56A 3BH6B 2QGFB 2CJBA 1U1PA 4AXJA 2LU2A 3RAQA 4OHVA 2BKNA 4TYBA 3FDSA 5J1EB 3LP2A 1K47A 1AZSB 2RT3A 3HFZB 3ENQA 2Y0BB 3I5AA 1YLXA 1KQKA 1MWYA 4C8NA 2FIUA 2FHKA 4K59A 3I9ZA 4WP8A 2H48B 5A8RB 2W4DA 3VCDA 2U2FA 4ZN1A 1RYSA 1KTQA 4HL9A 4TKTA 1FRHA 3GLJA 4IFYB 3PR5B 1TKTB 2B56A 4KH0B 4C0BA 1S1UA 3B6BA 1RWOB 3DOMA 3NMRA 1JLQB 4ECQA 2Y1LB 4X65J 3RZAA 3HK2A 1OY9A 4OI4A 4OI0A 3J81j 3KLEA 1K8AT 2NSCA 3MUMP 2HVHA 3QSIA 3QIDA 1E6YB 3TVYA 3JSBA 3WIUA 2FZCB 4FF4A 1TL3A 2KXFA 4J9SA 1D3WA 4DX7A 3MCMA 2XMVA 2VQEJ 2AWZA 5B7WA 2ZNYA 4NPOA 1TZ0A 4C11B 1PCAA 3A8EA 4PG5A 4EGLA 1J5OB 1BGXT 4QWEA 5KFVA 4PWDA 1X9WA 2QA1A 4DV4J 4KRWA 2NSBA 3VAFA 2R8GA 4TLQA 5J2NA 3R9LA 1JJHA 2XO7A 4JYAJ 5KT7A 3BSCA 1X4CA 3LGNA 1SJ1A 1UJ4A 1IR2A 1K0TA 2AD9A 3BQ2A 4OHXA 3PYEA 3QAEA 2RRNA 4K7QA 4DQRA 3TEGA 2UUAF 1RTJB 1NZ8A 1WORA 1ZTWA 4BC9A 4GO5X 2POKA 1RYRA 2ZVIA 4QIEA 4ZLLA 3EZ5A 1HWUA 3P45B 3T6BA 2ZNZA 3C6TB 4AL6A 4LIWA 3IWNC 4JV2A 4LF4F 1ZH5A 5ETRA 3OL9A 4CO5A 1KQGB 2M0GB 3EDRB 3BREA 4UOCA 3SCKE 1U1QA 2OD4A 2VKRA 4C0HA 1LW2B 2IJNA 3KJVA 5E3QA 1GH8A 1S6UA 1QAYA 3GCXP 2C2DA 4B9VA 1RT7A 2D9OA 3RB6A 1JK9B 1FNXH 3H59A 2ZH3A 2GJIA 2F4VJ 4LSLB 2IMOA 1HARA 3KG0A 5HN0A 3DOKB 2W4CA 1YQHA 1FK9A 4GO7X 4ED0A 2DO0A 5A2QU 4M8LA 4QIGA 3EXYA 3THTA 4FF1A 1RKIA 4NI2B 1LWCB 4LF7F 4K0KF 2RH3A 4WK1A 2HZVA 1O8BA 3N5FA 3IP0A 2HGLA 3FQKA 4K4TA 1Q81T 3HDSA 4PEOA 2UV8A 2CUYA 4WE1B 3V4MA 3PKMA 3MPWA 4S0MA 2QSWA 2WBMA 2KH9A 1WEZA 2CPXA 2V8DA 1N0VC 3NGSA 1QTNB 4CLSA 1EARA 1HI0P 1NO8A 2VC0A 2DRBA 5DG7A 2DY9A 2EFNA 1TKZA 3ZXWA 1HNWF 1B0PA 3CJKB 4J9QA 3PACA 2D3UA 4NEZA 4K2XA 4N47A 3P4UB 1JXLA 2FJXA 2Z4PA 4Z2XA 4ZS6A 3JTOA 4NOHA 2APOA 2CNKB 2IPOB 5BR8J 2ERRA 5KFKA 1XMOJ 2L9DA 4USKA 1VC0A 1CSJA 1TAQA 3TZXA 3M8PA 3OR2B 1VBYA 2HLUA 4OI2A 4NE9C 4YB7A 3DOLA 1VOMA 2YNIB 1TV6B 3PRVA 1HQ2A 2YWGA 1NKEA 3ULHA 2F9JA 4L74A 3IS9B 1KFSA 4I2QB 2G4BA 1I94F 2AEJA 4LF6J 4K4XA 1L3TA 1FF2A 4YR3A 3ZZYA 1U0HA 3SBMA 4J9UE 1HQEA 4Y2IA 2LVWA 3D4JA 3W8PA 2ALYB 3CC4S 3DLKB 2ACMA 2IMWP 2OGUA 1JLGA 3ISND 4MMOA 2F9DA 2HAFA 1YJ7A 1N6QB 3AB2B 3WX4A 1H38A 2W9AA 1NHKL 1P9YA 2W9BA 1VQNS 3IBWA 4AQYF 4CLLA 3QJPA 1LW0B 4ZCMA 4J9KA 4DL3A 5A8WB 1N52B 2MKCA 5KFPA 3BYRA 1BWEA 1RU2A 2E5IA 3BBFA 1FEHA 1T0TV 4DXLA 3EDQB 4NLRA 2GVDA 4AFFA 1M5SA 2M52A 2E1MC 2ZC3A 4K2JA 1AFIA 4FZVA 3BS9A 1N88A 2C2NA 2OEJA 1EAYC 1EB0A 2RE1A 1FCAA 2AJQA 3VAMA 2MHNA 1S9EB 7FDRA 5AE3A 3PM9A 2HFOA 2KHCA 3KLFB 1R6YA 2KKHA 4L6V3 3JQKA 1HNVA 2HWHA 4YY3J 2N7CA 4KKOA 5E3CA 1SV5B 4QWAA 2RS2A 2XG8A 4FYYB 3W63A 3EXCX 4ECZA 2GCFA 3G86A 3G82B 4J9RA 4P6QA 3IR5B 3C6UB 4MK8A 5GAHU 1N34F 2GQQA 4PQUA 3PEHA 2WSFC 3TJAA 2PEHA 2ZBCA 1U25A 2NXUA 1VQ6S 2EBEA 1RTIB 4M94A 5K5MA 5H9FK 3P49B 5CD4A 1ZOTA 3KNGA 3R7SB 2ZUAA 2OSRA 3TZYA 3G71S 1XJWB 3QZ8A 2IJRA 1MWZA 1VRTB 3R7BB 2K1RB 3PIOQ 5D4OA 1NH8A 2F7VA 5KFXA 4JI6J 3D7SB 2CQ3A 4ES1A 3NGKA 3EMTA 1ACMB 1H98A 3ZZUA 4NEYA 3KHHA 3TUPA 1VHFA 3BN4A 4DHVA 3PV8A 3K59A 2ADBA 1MROA 4ZPCA 2WBRA 3O2IA 4X2BA 5E3AA 3H20A 1SC4B 4OI1A 1X4DA 4XK8C 2WONA 2JH3A 2X7IA 4LRDA 1HBOA 3NRBA 1WC6A 1SL2A 2YNHA 4IG0B 2OPSA 2OFGX 2CPFA 4H4OB 3R1HA 3I0SA 1T9VA 3CF5Q 4LFBF 2QFIA 2IBKA 2AX0A 2RSQA 4PAAA 3MCOA 3IC1A 4PUOA 1FRJA 2KT5A 3AB4B 2B3TB 2XY6A 4F2SA 1CQNA 2DCUB 2Z8QA 4EBDA 1C0UA 4DCPB 1XR5A 1TAUA 4YFUA 4OJ3A 3SCIE 3MPVA 1WC4A 2JC1A 2R8HA 3O6QA 5KFLA 2YNFA 4HH1A 1EP4B 4Q43A 2IY5B 3DLBA 4JI3J 5T14A 4X64J 5J2QB 5CYJA 2F5GA 2BR0A 1DAXA 3MM7A 4LF5J 2E66A 1JB0C 3MR2A 1RAFB 4P7VA 4F2RA 4HACB 1UFWA 1RTDA 1QUVA 1U1KA 3FBBA 4DR3F 1RAGB 2VOPA 5JUMA 1M5OC 4B17A 2YNGA 2XMUA 4YQWA 3M8QA 2CJ9A 5G4DA 1RAHB 4LSNA 3CTRA 1WI8A 1XN9A 3AXKA 3CO0P 4A8YA 2NUUG 1VS3A 4WTOB 2UUBJ 5HJXA 3H5UA 3D3BJ 1FESA 2B4PA 5EWGA 1VQOS 3DRYA 2HHWA 3GZ7A 3D0HE 2E9TA 2P5VA 3KLHA 4GVBA 2CVEA 4BWMA 3FZBA 3VZIA 2Y8YA 3CCMS 4I2PA 1RT4A 2V6AA 1MU2B 1U8SA 1TMJA 8AT1B 2IVMA 2EXUA 3H5SA 1QVGR 1CS4A 5EGYA 4FBUA 3GCWP 2DR5A 4ILLA 4F0KA 5LT5A 2AU0A 4XPEA 1QSSA 5HMZA 3SMZA 3IN5A 5JVGQ 2VG5B 1QAIA 2Q3PA 4F4YA 3HKZD 1VQKS 2ZH9A 1XBWA 3IBCB 1WEXA 2XWYA 2OI2A 2K3IA 4C7QA 1N5YB 1FDAA 2R3VA 2EFQA 1X60A 3ADAC 3THPA 2GVZA 3E2EA 4C3MA 4Y34A 1Y5NB 4C8YA 4JI1J 3DYAB 1YGYA 3PKYA 2LU1A 3MEGB 1ZTTA 2XNRA 3K5PA 1Z4UA 2GMJA 1WOSA 4LF9J 2XB2D 1CJKB 2VFTA 5HMWA 1HR0J 1H7XA 4EZ9A 1T03A 2DYAA 3ZTRA 4C8MA 3CW2C 5CABA 1F3FA 2CJAA 3PVXA 1RTZA 2Z2MA 2YKNB 1HNXJ 4Y3CA 5KFMA 1T3NA 2ZDOA 4RLEA 4DEZA 4PXCA 1RHRB 4PXDA 4CYUB 1YHQS 3D28A 3DLGB 1LWFB 1MMLA 1RJJA 3C14A 3GJTB 4ZVRB 3IGVA 3IXQA 3GU0A 4I6WA 1Q16B 4LFAJ 2ZHBA 4WFZA 4J9LA 3PG9A 3TRGA 2UXDJ 4Z37A 5LMNF 4OX6A 3NNHA 4XAKA 2BX6A 3QLHA 1C1BB 1UCNA 1QAXA 1S4EA 1RAOA 3HHKA 3J7A1 1HWKA 2BV3A 2PI5A 4PG7A 1VLOA 1S10A 5IS2A 3QQCD 5KFYA 3UNYA 3EZOA 2CG4A 2VIHA 4NLWA 4FNHA 2X1GA 4WXWA 2QL7B 2M70A 4ZPWR 2V8VA 2HBZB 1TKDA 1I1GA 3I4HX 5F3TA 4DMZA 1BLUA 3OTBA 3JSMA 2M4MA 2VPZB 3T1YJ 4TLRA 1PIEA 3HO1A 2FJDB 1RAJA 2YQ3A 1S1VB 1K9MT 1CC8A 2CPZA 4R0EA 5CD4H 3DM2A 2MPUA 4UY8T 3I4PA 1JIHA 1NK8A 2QL5B 2J9DE 1O51A 4N7TA 4A8FA 4YB5A 3K58A 3IFEA 3HZEA 4FPRA 1GMVA 1NPRA 3H25A 2NZCA 1DZ5A 2PT0A 2KZZA 2AW0A 1DLOA 5CYQA 1RZMA 2LDIA 2IJFA 2O01C 3GJQB 3M8WA 5D0EA 4NL5A 2NUHA 3AJDA 4NXNJ 3V81A 1H74A 1JLFB 4F36A 3PHTA 4USWA 3IRWP 3ONQA 1WEYA 2EW9A 2FUG9 4DWIA 1D0EA 3EVMA 3K89A 1FKAF 3SYZA 2B4OA 1YJRA 3LWLA 5C42A 1F0XA 1C0TB 4FVCA 2GIQA 3OTOF 4CZCA 4N8NA 5F0UA 2UP1A 1SQEA 2X1BA 2Y1JA 1IJFB 2DNOA 1HW9A 3MR7A 5F8IA 2ZE2A 1S76D 3LF0A 2YVSA 3I5BA 3CUNA 4MK9A 4B9NA 2FGOA 1M90T 4N5SA 3H2VE 3RB3A 5ETMA 3PFOA 5AE1A 1SIWB 4GKJF 3ETOA 2BBEA 4NZ0A 4Y2CA 3TO8A 2X51A 2F65A 4NLUA 2V69A 4UUXA 4R8UA 5K8PA 1HQUA 1VQMS 3N5BA 2FD2A 2QRRA 4PG4A 3GIIA 2MJNA 1S72S 2HHTA 2VFVA 2CIMA 5KFHA 4C9DA 3Q8UA 1JLAB 5DDRC 4PPZA 2Y3YA 5KG3A 3PY8A 1S6OA 4P73A 2AEMA 1JKHA 4FBTA 4GKKF 2VKZG 2WK4A 1FRIA 2QFJA 5KT2A 2OUGA 2M9KA 2NLWA 3T5LA 2JJ4D 4Q8FA 2IC3B 2ZUGA 3NWGA 1URNA 2Y9HA 4RWXA 8RUCA 3PXGa 3DKDA 4Z7YA 3AXMA 1T05B 2HGMA 2DRDA 1IQZA 4F0HA 4M63A 2ATCB 4EUVA 1UPMB 3TWZA 5DDOC 5K8MA 2FVPA 3BSOA 1VQ8S 3G6YA 1UEVA 4E8UA 4V19J 5A8RA 3VGSA 4KHPJ 3POTA 4IYQA 3OHAA 3CCZA 3Q8QB 4XIUA 3O8WA 4RL1A 3AQPA 4IFYA 3T5HA 3HVRA 5GADU 1OY8A 3I55S 2AIRB 1JJ2R 4ID5B 1IXKA 3HPOA 1NK5A 3CD6S 4RBTA 4RW9A 1RWWB 2MY8A 3GYXB 1IM4A 1EETA 5LM7E 4CDIA 1F1BB 1S57A 1YJNS 3ET6B 2XYPB 1FJ7A 3N28A 4YB1P 2B6AA 2HHHF 4DFPA 4OFZA 5GAHI 4MKYA 5D4NA 3OUYB 1NHUA 4CTAA 1ITPA 4F3MA 2GJFA 3HT0A 1GAOA 4FYWB 3TI0A 4PKDB 2YWHA 1JXVA 3Q22A 3CCUS 2MJUA 4F4XA 2PGCA 2X3DA 4OZLA 4M5HA 1N48A 3OVBA 4RNMA 4ZLJA 2HFVA 3J80Y 1IKWA 4ZVPB 2ATLA 1SBRA 4QU6A 2RAQA 5B0GA 5ETOA 3OBIA 1JLBB 1R31A 3TYTA 4LRFA 1RTJA 5E7OB 2B9EA 3CJ4A 3G87A 2KVIA 4DBQA 4K4ZA 3CDUA 3MWBA 1OPZA 4WP3A 5CH7B 1S0NA 5HL7Q 1U49A 1RT6B 4X4SA 3H4BA 3C6TA 4JV0A 4DV6J 1NK6A 4NCGB 1P8GA 4WYWA 1T94A 2MEWA 4U7UD 5L39A 3QNWB 4OYXA 3OR1A 2HRTA 2CYYA 5C24B 4C0OC 5ITHA 2LEBA 1NU4A 3QBCA 3RW7A 3R97A 6FD1A 3MMAA 4B3SJ 4JI8J 1WKJA 3F44A 3H2LA 4FYDA 3LPYA 4FN5A 1DTTA 5FLXY 2DVIA 1NPKA 2C3UA 3FCHA 1RB0A 3FFIA 3SSRA 4TU9A 5L1JA 2XNQA 5KFAA 5DGAA 1FX4A 4KFBB 4J9OA 2JLGA 4LSLA 4U7CA 2MZTA 3TZZA 2M5YA 2JWNA 2M2BA 4LFCF 4RUAA 5HP1B 2F3JA 5C25B 3HD2A 2DH7A 3R6GB 1SKWA 1LWCA 2JDJA 3DGPB 4UQTA 1Y11A 3LP1B 4ZPDA 3P8BB 3DLLQ 4ILMA 4B3TF 4QW8A 1TKXB 4C3KA 4BC7A 4WF9Q 3DU5A 4WE1A 4J9PA 3MM6B 1YITS 2DKOB 3IAM9 3MM9B 4DR5F 4MKAA 4DSKA 1UVMA 1GTHA 1MW7A 3LQVA 3NMAA 2M8HA 3UQSA 2VHGA 1R8HA 3PCOB 1U2CA 4G1QB 1FJCA 4JI5J 5ETLA 1L3SA 2O67A 4NZ6A 3BJYA 4WKYA 2V2VA 3EICA 2DO4A 1TFYA 4K4YA 1JXEA 3CJ2A 4JI0F 3PX6A 1VQPS 3PHEA 2BQRA 3GONA 3CWJA 2J0WA 1NJIT 3QRPA 1XQIA 4NLXA 2CA9A 2XZDB 2B43A 1Y00A 3MM8B 2EI5A 4DL2A 2AKWB 4OLPA 1L5UA 4I2QA 1VQYA 4ZIVA 3QATA 4MIWA 4DX8H 2BKPA 4X4NA 1A6LA 4KC5A 3W65A 3IR6B 1F2GA 2XS2A 3QPIA 4DR2F 5KFEA 1U6ZA 1SJRA 3SIPB 1RHUB 3OL8A 1IWGA 4Y00A 3JXOA 3QGPA 5F8GA 2RKIA 3A8KA 3TZWA 4J9NA 3F0NA 4ZVOB 2ZD1A 1N6QA 5M2PA 2IM1A 3BPDA 4IFVB 3J7AN 1YKWA 3H4DA 5FDLA 1FE4A 1QY7A 3Q83A 2M3DA 1TK8A 1SVDA 3AA8A 1IBCB 2CXEA 2NZ4A 4DPOA 3DXSX 2HAIA 2BZ2A 1WDTA 1HBUB 1H2VZ 2YWKA 2UUBF 1MN7A 3UFCX 2XM3A 1U0SA 2O3DA 2LDYA 1VK3A 1UZHA 2G1HA 2V0NA 3RRGA 3MGJA 1JLCA 3GYGA 3JAMU 2AYBA 1WC1A 4IOBA 3NAIA 3D9BA 1S9EA 3O5TB 3OL6A 1YSJA 3R5DA 3KLFA 2W4PA 3FBFA 2CPHA 1RLDA 3QJLA 1FERA 2DCLA 4NLQA 1FJEB 3M2RB 1SV5A 5I4MA 1W2BR 2O66A 2WZ1A 3G82A 4ID8A 2HNZB 4AUKA 1DY3A 2QA2A 1XTZA 2OMOA 1N33J 2DHAA 1MMNA 3K57A 4DUZJ 3KJFB 1JMTA 2P8IA 4WZQA 1Y7PA 4GC7A 1KQFB 4EBEA 1LQ9A 1EQMA 1QSYA 2NPFA 3B8HA 2IVFB 1KP6A 2VJVA 4PCQA 5KG4A 4DJBA 4K4UA 1YVFA 1NK4A 1NJYA 3BKTA 2K1RA 2VONA 3EGWB 1C1CB 2KO1A 3HI9A 4IQXA 3G8TA 2DGVA 4OI6A 3AD7C 4KV8A 1U2FA 1N5SA 4P52A 4OLOA 3SFUA 5HROB 1WHYA 4MTPA 3T41A 1N0UA 5IT9U 1WJ9A 4RW7A 2OPRB 5DDQC 3KLGB 3TARA 1SQFA 3N6NA 1F6TA 4Y2KA 3G6VA 1RT2B 1SUQA 2UV8G 5H9EJ 3KHRA 3PX4A 3DRRB 1M1HA 2JC0A 5ETQA 4H4OA 1OWXA 2V9KA 2ZC4A 2WVBA 2ZKUA 1GMUA 1K1QA 3KK2A 3WQPA 1U02A 2V34A 1WC0A 1T9UA 3Q8SB 5B0DA 3RB0A 3NOGA 3H5YA 4Y2MA 4ED6A 3D54A 2NXJA 1N5QA 1BY9A 1RABB 4BS2A 3HSZA 5U47A 3QWUA 2NR0A 3B4MA 1N36F 4XPCA 2CJQA 4B9MA 3HSGA 4I4BA 4L75A 3QYYA 4DR7F 1X31C 1S0OA 2V9WA 4KGKA 1Q8LA 2MSTA 3RBZA 1YJUA 3HSDA 3EM1A 4W92B 1OSCA 1RWXB 1UEUA 2Q6CA 2RD5C 4KHMA 5J2QA 3V4IA 4BBYA 3CMAS 5G0RA 3VVTA 4QW9A 1EZZB 2KYXA 4EI2A 5HLFA 1KR4A 4KGVB 3VGVA 1ELOA 1YBTA 1FFWB 1PAEX 1R27B 1D09B 3ZNJ1 4DLGA 4E0DA 4OX9F 2RVJA 3DMJA 2DB1A 5KT3A 1P1LA 4A8WA 2FZKB 2H5IB 3OJUA 2UUAJ 1SJ4P 3SQGB 3HP6A 1OS5A 2MQLA 1FEEA 2OMLA 3FQLA 4QYZJ 2ZWPA 1RCOB 2FY1A 2YPZA 3OVSA 2DNKA 2CZVC 4F25A 1VQ7S 3LP0B 5D6GA 3BO2A 3D6FB 1VC6A 3EJMA 4CT8A 1MG7A 3RU0A 4LF4J 3NNCA 3G96A 4NYPA 2X1AA 2L48A 1VQ5S 2HPUA 2IVYA 1F5CA 1G3OA 3PX0A 4LRBA 4RJVA 5L38A 4KGXB 1M1GA 4DPUA 3DRSB 3ZZTA 1GXUA 3M1VB 1YJVA 3OTDA 2Q1LA 2GX8A 4YOEA 4AL5A 1OJ4A 4A4JA 1CJUA 2IAJB 2Z58B 1N56A 4I69A 4DDFA 1NKBA 3RRKA 5A2QY 4K5RA 4ATNA 2AV5A 1VRUB 3MHYA 1YJ9S 4JI4F 1WOPA 3ZZPA 1X4AA 4H4KA 3BN7A 2HNDA 3J81U 1ZPVA 4Y6IA 4KR0B 1NDKA 1HMVA 4LMZA 2XS7A 2HRYA 1HWJA 1FVQA 5T41A 5LJ5Y 4LF7J 4K0KJ 4YMEA 3A3OB 3VVUA 2BQUA 4AXIA 3HJFA 2RNEA 1N54B 2YKNA 2ASDA 2CPEA 3MTJA 1AT1B 2KXHA 2LYVA 2KTQA 3M2UA 3S1TA 4QWDA 2WOMB 1NJWA 4CLFA 4YS2A 2CPIA 2AZ3A 4ZPBA 5I42B 2HS4A 4NLGA 2HMIA 3TW0A 1HNWJ 1N4LA 3GR1A 4RPFA 4NA2A 3R2DJ 2RIJA 3CIMA 3BZQA 1ZM9A 1C1BA 2R7RA 4X66F 4RO0A 1S7HA 3UR0A 2LA6A 3CE8A 1BQMB 1V5VA 2H65B 3D66A 1VHIA 1UETA 3QMQA 2BW2A 4PYAA 2LXUA 1RDRA 2E1CA 1RK8A 1ZA2B 4K50A 3OXLA 1I94J 1PSDA 1CC7A 1RT1B 4Q7AA 4WK3A 2DITA 2OPPB 2PMHA 5L1IA 4FPIA 1SPBP 3U02A 2Y8WA 2QLXA 3IAS9 1DFDA 4O4GB 2V8GA 2BQ3A 4IUFA 1Y4ZB 5K14A 2BJ3A 2W9CB 3IO1A 5BYRA 1KS2A 4RW8A 1OPIA 5I3UA 1SJFA 4BDPA 2IDEA 2XMMA 3R5AA 3EGVA 1KLMA 3MAAB 5CYMB 4DSFA 3EPIA 4AQYJ 1S59A 3QWPA 1MMDA 1TL1A 4ED8A 2FHOB 3NL0A 3NP5A 2QTWA 4JP8A 1K44A 3OT9A 1I5OB 3GE9A 1FA0A 1XNRF 3HVTA 2MXYA 5ETPA 4P74A 2OTJS 1RLCL 1VIOA 2IA0A 1HI1A 3M32A 3S01A 2IRUA 3K5LA 1WACA 2JNJA 4M5DA 1KEKA 3CIZA 4A8OA 2XHCA 1N32F 2DNGA 2CQ0A 2VFUA 1HYSA 2FVRA 4QIVA 1LKZA 5IM0B 2G0IA 1WTBA 2V4JA 1X8DA 1TK0A 4DUTA 3JSYA 3NG8A 5C5JA 2E7XA 3VR1A 1FKPA 4UZBA 1WG5A 3H42A 3FMWA 2FLLA 3CJ8A 3C16B 2EBGA 3HFKA 1HL6A 2VJUA 4G6VB 2PA3A 3TJ8A 1TL7A 3MUTP 4XO0A 4R0JA 2NREA 2YKAA 1CLFA 2I8EA 1N34J 3DLEA 5KFUA 4P9SA 1MSWD 1RHJB 1HBNA 3TVZA 1S6PB 2HVZA 1ZZNA 3I6PA 2WTFA 2KT3A 1EX8A 4TQSA 3DLHA 5FLXU 1IKVB 2FLOA 3SQOP 4J90A 3KNAA 3VHQA 3CCES 1JLAA 3R27A 2ZITA 4N56A 3ISZA 3JTPA 3NBPB 3CT9A 3PFEA 1EQ0A 1OQ6A 1HNIB 4A48A 4DPXA 3I82A 3T1HF 3QGIA 3DDIA 2Z2LA 2UU9F 4OZ0A 4KQZA 5DZ7A 3M9NB 2V68A 4P2XA 1PO6A 1GMWD 2R2RA 3TANA 4PR6A 2AF6A 1KQSR 3PJ9A 3PEJA 3ILLA 3NY0A 4O3NA 1SQGA 1YZ7A 4N8OA 2HHQA 3WX8A 1H7WA 2BM0A 3P5TL 4ANDA 2PN6A 4RU9A 1P1TA 5B0EA 5MLCV 2HFUA 3NCQA 1B99A 4RNHA 1WKLA 1WTFA 3IG1A 3A8IA 1IR1A 4KAIA 2UVVA 1KTVA 4ZVGA 3Q2SC 2M8DB 2IM0A 1W2IA 4LFBJ 2OPQB 2LQ8A 3CDEA 2AYEA 1KBRA 4RNFA 1OSDA 4OJ1A 3F41A 4TN2A 1U1RA 3VAIA 2GO8A 4ID5A 2Y1RI 2XHWA 3QT7A 4YDDB 2CADA 4ZCKA 4I7FB 1R7IA 1CQMA 3BGRB 2IDLA 3KG1A 5CZVA 2DR9A 3GFXA 3D1OA 1QAJA 3M30B 2ZBIA 1RHMB 1S48A 3KLIB 2J0XA 1S1TA 2XBPA 3ET6A 3WHIA 2MZRA 4ZVQB 2NYIA 1MN9A 1CBKA 4WIQA 3CC7S 2GFFA 2KRRA 2AX1A 3FEXB 4PZVA 3K5MA 4HKQA 4O0IA 3ZC4A 3OUYA 2H9ZA 1QVFR 2L08A 2VODA 2YTCA 3FZ2A 2DNYA 2OTLS 3KUHA 2MZQA 3NGTA 4DR3J 3MFIA 4MT1A 4YHHF 2VQFF 3ITHA 1NNDA 2CQ1A 2V5HG 2HVDA 1RU1A 3W5XA 1DQAA 5AE2A 3LO3A 1E6VA 1Q8KA 5J1PA 2OH2A 4NXMF 2P6SA 5I3QA 3LP2B 1JLBA 4DPTA 1ZA1B 4J9VA 4ED2A 1KFDA 4A8KA
chains in the Genus database with same CATH topology
2CG4A 1KSPA 5EX0A 2KFZA 3O44A 4NLWA 3Q2TC 2LQ9A 4FNHA 4EEYA 1Z2LA 2X1GA 4WXWA 4KIAA 2J76E 1RT3B 3S8SA 4GMKA 4Y65A 4O44A 3A1YG 2W25A 2R2UA 1B0VA 1XERA 2K8GA 2M70A 4ZPWR 2BANA 3DRXA 1BD6A 2V8VA 3TOQA 3BGLA 1TKDA 1M5VC 2LA4A 4IDKA 4X4PA 1I1GA 3I4HX 1LXJA 5F3TA 2J9DA 4DMZA 3CCSS 4YR0A 1BLUA 2A18A 3OTBA 1JJ4A 3JSMA 3MEEB 5GAGI 2M4MA 3UPFA 2VPZB 5LMUF 2HHXA 4TLRA 6FDRA 1FTRA 1O0PA 3OFHA 1S77D 4NCGA 3HO1A 1S1UB 2FJDB 1NEEA 2XMKA 3CJ0A 4DOZA 1RAJA 2CQPA 3HXMA 2YQ3A 3OPKA 5KFWA 4NLSA 5KT5A 3OLBA 1S1VB 1K9MT 3T9NA 2VPYB 1BQNA 2FVQA 4EFAC 1CC8A 1O5JA 2CPZA 4R0EA 4IQMA 2HVIA 2KZMA 5J2PA 1CVJA 5CD4H 3MR3A 3DM2A 2MPUA 1RA6A 4UY8T 1QLNA 3I4PA 2J8AA 1FTCA 1C2PA 1JIHA 3KLEB 2G13A 1NK8A 1JLCB 3CJKA 4F3QA 2B5JB 2J9DE 5LXRA 4RX6A 2L9NA 1JNZB 1MROB 4R5PB 3OHBA 1O51A 1UVKA 2EK1A 2J7WA 3GIMA 4ECTA 4ECVA 2IA6A 4A8FA 4YB5A 3K58A 3IFEA 2GGPA 5CHCB 1ZM3A 4AE5A 3NAHA 4HI1A 2EVZA 1WHWA 4NX9A 4QYRA 3HZEA 4FPRA 2VB6A 1XEZA 3C2PA 4IG3B 2LXFA 2BRKA 1TL3B 4DL5A 2OFHX 1SH3A 3H25A 2QA4G 3SQGA 1RTHB 3OJSA 4QCLA 1WF2A 3H98A 1DZ5A 1YIJS 2PT0A 2KZZA 3CCJS 2MSSA 4FS2A 2AW0A 3GMGA 4L72B 1DLOA 4TQRA 3OR2A 5CYQA 3W2WA 3PNIA 5ADZA 2OIHA 1G2EA 1G7CB 2LDIA 5DGBA 2IJFA 2O01C 1VI7A 3ZZOA 1IKYA 1NKCA 2YNIA 1R0AA 3V6HA 4NL5A 2RMLA 2CQ2A 1TV6A 2NUHA 4IOAQ 1K73T 3K5OA 3V81A 1S6QB 5DDPC 2EFGA 4KHPF 2YNHB 1JLFB 2GW8A 4OZJA 5F8LA 1SC6A 3CCWA 4JV1A 1Y3JA 1FE0A 3IRWP 3IS9A 1R3NA 1WEYA 3ONQA 3NKYA 3VZHA 3EZUA 2EW9A 2FUG9 3MAQA 4DWIA 5J2NB 4K4VA 1S1WA 3JTNA 2JVRA 1LV5A 1D0EA 5KG5A 2AGQA 2UXBF 4OZ5A 1FKAF 3SYZA 2B4OA 1YJRA 1AW0A 3LWLA 4CQ1A 1L3KA 1NJXA 3OTCA 5C42A 1PC4A 3KOAA 1F0XA 4ECUA 1C0TB 4QJVA 4FVCA 2OJ3A 2MKJA 2YWFA 2FJVA 4YUDA 1H6KX 4HT7A 2IHR1 2GIQA 3GV7B 3OTOF 1D9AA 3K5NA 2ZZNA 3DLKA 3DRSA 3J7Z5 4CZCA 2OSQA 4N8NA 3OTEA 5F0UA 2F8HA 1R8CA 3M1VA 3PR4A 2UP1A 1SQEA 2VG7B 3PDNA 2X1BA 3AJ1A 1CEZA 1UAWA