4G27B

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and phenylurea
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
b'GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
publication title Identification of the functional binding pocket for compounds targeting small-conductance Ca(2+)-activated potassium channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport/calcium binding protein
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g27B00
4KFMA 5KUMA 3E83A 2WLJA 3E8FA 5CBHA 4I9WA 1ORQC 2WLIA 4P9PA 3E8GA 3TCUA 3STLC 2Q67A 3SYQA 5CBFA 1S5HC 3FB5C 4R6ZA 2HFEC 1K4CC 3ABLC 3LDDA 3SYAA 2YEVA 3AG3C 4MS2A 1R3KC 3VOUA 2P7TC 1QLEC 1R3JC 2HJFC 3OR7C 3STZC 4LP8A 4F4LA 4MVUA 2HG5C 1R3LC 3LUTB 4P9OA 3X2QC 3K06A 4JTAB 4PA3A 4X88A 4WFFA 5B1BC 3OGCC 4GX5A 2EINC 4GX0A 2ZD9A 4H33A 3HPLC 4RAIA 5EBMC 1BL8A 2R9RB 4R7CA 4X89A 2Y69C 3SPGA 3WG7C 3E86A 1G4YB 2QKSA 2EILC 2QTOA 2JK5C 4J9YB 4MTOA 5EC1C 2ITDC 2X6AA 3K0DA 3K08A 3PJSK 4P30A 2KB1A 5EK0A 4XDKA 2WLNA 4LCUC 4MW8A 1M57C 5EC2C 4J9ZB 3AG2C 2DYRC 2DWEC 3E89A 3FB7C 2Q6AA 4HYOA 2HVKC 2ATKC 3IFXA 2EIJC 3RVYA 2AHZA 3SJQC 3K03A 3F7VC 1M56C 4XDJA 3F5WC 2K1EA 2IH3C 4R50A 4MTFA 3RVZA 3T2MA 4MVMA 4MW3A 4LBEC 3F7YC 2BOCC 3SPIA 1KKDA 5B1AC 2H8PC 1XL6A 4PDRA 4H37A 4RO2A 5B3SC 2HVJC 1OCCC 4PA4A 3SYPA 5IY5C 4WFGA 1J95A 4OXSA 3OUFA 3LNMB 4BW5A 4QNHB 2ITCC 2A0LA 1XL4A 1K4DC 4MVSA 2NLJC 1OCRC 3RW0A 1JVMA 1P7BA 3SYCA 3SPJA 3T4DA 3SPCA 3UM7A 1V54C 3OUSA 3T4ZA 5J9PC 3JYCA 4QE7A 3SYOA 1OCOC 2Q68A 3ASNC 3LDCA 3TETA 2X6BA 5EBWC 4MVQA 4PDVA 1LNQA 4X8AA 2WLLB 1V55C 3E8BA 4JTCB 4XDLA 3LDEA 4MSWC 1OCZC 2AHYA 3UKMA 3OR6C 4QE9A 5EBLC 3IGAC 4TWKA 2A79B 5KUKA 3T1CA 2WLHA 4EKWA 4RUFA 2ZXWC 4ZBMA 2WLKA 4UUJC 2A9HA 3ZJZA 2EIKC 4PA6A 5BZBA 4WFEA 2EIMC 2WLMA 2WLLA 4GX1A 4PDLA 4MTGA 1R3IC 3KG2A 4WFHA 2IH1C 1ZWIC 3AG1C 4MVRA 4PA9A 3RBZA 3FB6C 3AG4C 4PA7A 4P2ZA 4PDMA 4G27B 2OCCC 4G28B 2W0FC 3ABMC 4RUEA 4CBCA 4MVZA 2WLIB 3R65A 3K0GA 3ABKC 3ZRSA 3ASOC 2X6CA 3EFFK 3K04A 3BEHA 3E8HA 3GB7C 4JTDB 4R8CA 5E1AC 3SPHA 4DXWA 2BOBC 2DWDC 3FB8C 4GX2A 4HZ3A 5CBGA 4MVOA 2DYSC 2Q69A
chains in the Genus database with same CATH superfamily
4KFMA 3D36C 1TVKB 3ZX6A 4I9WA 4K8ZA 4DV7B 4O2BB 2JIZG 4MS2A 1TVKA 2QGNA 3OR7C 4B3RO 1QBZA 3EVKA 2QWNB 2LW7A 4PI2A 4X88A 3ZCCA 2EZPA 4GX5A 4H33A 4TUYB 2Y69C 5JJNB 4ZIBA 1OHHG 2JK5C 2ITDC 1NVPB 2IBZH 4F6EA 3L72H 4J9ZB 4TUYA 2M7WA 3ZIAG 4FLUA 2WSSG 4JI8O 4B3MB 2RDCA 4FLZA 3F5WC 1I7FA 2IH3C 4LBEC 3F7YC 2P4VA 3SPIA 1E1QG 1NBMG 4UVBA 4ZOLB 2ZE7A 5JJJB 4WFGA 4H0LB 1RM1B 4TQDA 3BHPA 5LXTB 1D5NA 3OTOO 4ZOLA 3JSLA 3UM7A 3BA9A 2KG7A 3JYCA 4I0XB 3ZRVA 4NXNO 4CS2A 3CRCA 3K59A 4Z2WA 5LXTA 5IY5B 3CXCU 5D5QA 2A3QA 3N2KB 4I0XA 4DR3O 1A32A 2YS8A 2WAMA 3C90A 1YTFD 2GV9A 4TV8B 2A9HA 3P32A 2RQ6A 1HWYA 1SETA 3N2KA 3Q4HB 3RGBA 2EZOA 1BE3H 3MAQA 4TV8A 1MMMA 2KQXA 2WLIB 2CH7B 3WG7B 3A0BZ 3K04A 2DWDC 2LFSA 3Q4HA 1KB9F 2WLJA 2WLIA 2CH7A 2XOKG 1SZTA 4MT8A 2WWWA 2YXLA 2JDIG 4JI1B 4I55B 1DF5A 2ZDIC 4O2AB 1K8AW 3CCQV 4GYCB 4B08A 4B3SO 4LFBO 3CRRA 1XBLA 3HPLC 2R9RB 2QKSA 3ZMZA 4E4EA 4O2AA 3JAMN 3K08A 3M7MX 1WAZA 5EK0A 2LGQA 3G67A 4O4LB 3DC6A 1O9HA 3QO5A 4DUYB 4LFAB 1OCOB 1BSMA 1IZ3A 1YHQV 3MDSA 1H2NA 3RVZA 1OCZB 4RQEA 4O4LA 4LNUB 4LF5O 1FFTB 1WP8A 1THZA 4BWAA 1M1KW 2EIKB 5BR8B 4YJ3A 3AEIA 4LNUA 1OCRC 3N2GB 5KHJA 3O65A 1R1BA 4LFCO 2IJKA 1V54C 2ZQMA 4AQYO 4YXWG 1KMIZ 4MVQA 1JCHA 2YIBD 3E8BA 3N2GA 5JWPA 3UKMA 4DR6B 5EBLC 2W6IG 2UXNA 2ZINA 4YY3B 5KUKA 1AROP 4RQFA 1M57B 4EKWA 4RUFA 3UT5A 2UXDO 5FL7G 2BCCH 2JJ1G 1SS3A 2DE0X 2YI9A 4JAVA 1LUWA 1K33A 3TK1A 1L1FA 1VF6C 4G28B 4DR4B 4LF7O 2EX3A 1BMFG 1QHTA 3RWRD 5JCOC 3BEHA 1AI4A 2EILB 3EHBB 2UUCB 3E8FA 4DV2O 4JAUA 1RP3B 3ZRXA 1XEQA 3G80A 3CJHB 2EIJB 3B2EE 4FLWA 5CB4A 4LP8A 1XQ8A 2ARHA 2HG5C 2FL4A 3X2QC 4X1YB 3ML0A 3CC2V 1AJQA 1XILA 1S77D 2EINC 1GN6A 4UCSA 2HR3A 5KHHA 3JSNA 3B40A 3FYIB 4A5UB 3C3SA 1LR1A 4JI2O 2QDOA 2DYRC 1COWG 2N04A 1VF7A 1FD9A 3OMNB 2JEUA 3F7VC 4FFKA 1ENVA 5FNVA 3KZIZ 1XMOB 5CA1B 3RYHB 2YXHA 1J5EO 2HVJC 1I94O 2F66C 2OCHA 3P30A 3BPZA 4BW5A 2ITCC 2X0LA 5CA1A 3RYHA 4CS3A 1YDXA 4IL6Z 4ASUG 1MSWD 1GN2A 4DV7O 5FPOA 1EN5A 2WA3A 1WA8B 1H2SB 1N33B 4LF4B 1JJOA 2IU3A 2A79B 1US6A 3W7SA 5CMUA 1WA8A 4DV0O 4PA6A 3JALB 3OMIB 3JCZA 3AG1C 3H1JH 2KKWA 1PP9H 3H1LH 2IU0A 3VQXA 5B66Z 4UCRA 4LF9B 4B3MO 3JALA 5DN6G 2OIGA 4JTDB 1VQ8V 4HZ3A 4DR2O 2GHYA 4FJCC 2AXTZ 5HFLA 3L9DA 3OE7G 1DLBA 4YHHB 5EIBC 2P7TC 3WB2A 3K06A 3E35A 3HKEB 4G2KA 4PD4F 3KCXA 2AZ0A 1UPGA 4UV9A 3U11A 3VQVA 2QTOA 4CH3A 1SZXA 2XT9A 1MOFA 1YEWA 1WJZA 2HLDG 4LF6B 5EC2C 1Q86W 3HKEA 2OT5A 1JQ0A 3ABUA 3BFRA 3G4SV 2K1EA 4NR1A 1MZFA 2ILMA 2BOCC 1EZJA 1ZL8A 4QPKA 3AK3A 4H37A 5B3SC 1TUBB 1FKAO 5H6QA 3QF7A 3KKYA 2ZR3A 4NTWA 1TUBA 3FAVA 2DW4A 4JI1O 1URFA 1AJPA 1Q6IA 4X64O 1IXBA 4TWKA 3A8TA 1VQ7V 4CH5A 4WFHA 1SQFA 3P3NA 1BGYH 2OCCC 4JPRA 5LMNO 4RUEA 1GRJA 2ZNJA 4LFAO 2Q0OC 3K58A 1QCEA 2XASA 1SRYA 1QVFU 1FFXB 1HDJA 1JMKC 2UU9B 3CCJV 1JFFB 2Q67A 5IJ9B 5CBFA 2WA4A 1BHAA 3CX5F 1OJHA 3ABLC 5K1PA 1FFXA 3TXSA 5EZYA 3JAWB 4GLXA 1XREA 5D5PA 2CGOA 3LSQA 1JFFA 1K3EA 5B1AB 4DUZB 4PA3A 5IJ9A 1H2MA 5B1BC 1KBHA 4RAIA 2R72A 3CB2A 1Q5OA 4W4LA 3JAWA 5LA6B 4DR6O 1YF2A 3ZMVA 2XTAA 4YY3O 1W0KG 1TAEA 2RNBA 4XBFA 3S3XA 3S3WA 1PKXA 2XHBA 3E22B 3UO3A 3M8AA 4X20B 2Y4UA 1QU7A 5IYDO 1JPXA 4JI3O 3A2FA 3ZBHA 5KX5B 1E79G 4MVMA 4FK5C 5EYPB 1MZEA 4NB5A 2ADPA 3E22A 2VQFO 4DR4O 3K5OA 4X20A 2UUAB 3OUFA 5KX5A 1XL4A 1VQMV 4MVSA 5EYPA 3D3QA 5IDJA 2YICA 1I0HA 1KUQA 2R9IA 5C8YA 3ABKB 1R6TA 1LNQA 2WLLB 4JYYA 2PYLA 4FZ0A 1NTMH 4I5SA 4DV3O 3CCMV 4JASA 1QQCA 3A0RA 2NR5A 3C3TA 1WB7A 1GKFA 1CP9A 3CCUV 1PPJH 2F1MA 3DSQA 4HNAA 2Q7GA 2EIMC 2WLLA 2Z5UA 4PA7A 5H2FZ 1NR7A 3H1IH 4G27B 3U0ZA 4MVZA 1NU1H 3SJAC 3SJBC 1XMOO 3CRMA 2F23A 1VQKV 2NN4A 1PL0A 1GTOA 1V54B 1VMGA 1S5HC 1NTZH 1NJIW 1NTKH 5KHKA 3AG3C 4TOIA 4F4LA 3ZHVA 2JS3A 4WFFA 3APOA 1HNZO 1OCCB 1IX9A 2ZD9A 4UCOA 2W6JG 1N33O 4KP4A 1Q81W 4LF4O 2X6AA 1Y4MA 2Q0AA 5CA0B 4OX9B 4MW8A 4NYKA 2Q6AA 1HNWB 2ATKC 3ASNB 1HR0O 3D8CA 5LP6C 5DEDA 1MG1A 2IW5A 5CA3A 2XAFA 3B09A 1YIJV 5CA0A 5BXZA 4I50B 1GM9A 4O2BA 1DTOA 2UUBO 2RMKB 3K5MA 1R73A 1VIBA 5L3BA 5B1OA 2LW1A 3AG4B 1AI5A 3SYCA 1K97A 3APQA 5JH7B 1UFIA 2ETNA 2MW2B 1YITV 4YHHO 2OYQA 1XHZA 2IM9A 1V55C 2GTSA 3P3PA 4GCZA 2XAQA 1GO3F 5JH7A 3TJTA 1NH2B 2LO1A 2YIBA 5AG2A 3KG2A 5A2QN 1NQTA 1ZWIC 4PA9A 5LGNA 1MNGA 2F93B 3CMEV 4OGQB 1L8DA 4LF6O 1BZKA 4GZRB 1TUEB 3R65A 2GTAA 3ASOC 3OM3B 2P67A 1M4UA 4R8CA 4FM1A 2E5LO 2BOBC 1H2GA 5CBGA 3CXHF 2Q9LA 1PD3A 1ORQC 3TCUA 4B3TO 1QNMA 1R3KC 1Q43A 4MVUA 1R3LC 2DOSA 3ZS8C 4DR7B 3W7XA 3IJ4A 3ZHRA 1XMQO 2KB1A 4DV6O 4GUNA 1HNXB 1VQ4V 2A7WA 3BVOA 3FB7C 2QKAA 5DM6V 1PNMA 3CYOA 5L3DA 2P90A 2R9AA 4YJ2B 4JI6B 4MW3A 2G38A 5JJEB 1KKDA 4TQFA 4J10A 4JI5B 4X66B 4I55A 2CDYA 4OXSA 1YI2V 4YJ2A 1QLNA 2QM4A 1PL4A 4Z1VA 5TISZ 1SESA 4K0KB 1WPXA 2PTMA 1KP2A 4DO2A 1G8MA 1VQNV 4X8AA 1SKVA 3BRCA 3OAAG 3OR6C 4QE9A 1K9MW 4DUZO 3I55V 2M6YA 4X1IB 4BIZA 4GX1A 3NR7A 1R3IC 2CGNA 3W7WA 5J2TB 1NS1A 1QLEB 4RWUA 3WB1A 3IC7A 4K3AA 4U7OA 1Y74B 3MHSC 1SQXH 3AG7A 4X1IA 2ZE5A 3GB7C 4KUMA 4FLYA 4TT3G 3G6BA 1Y74A 4UVCA 4I9QA 5KUMA 2YI8A 1IBMB 1I5XA 1NH2D 3STLC 4FPPA 4JYAB 3E2EA 3FB5C 4R6ZA 1EM1A 3GVMA 4AI8A 4F6RB 1ZSPA 1M56B 1M5IA 3ZRWB 5IWAB 2QWPB 4JGSA 2ZIOA 1FJGB 1X4TA 5K1XA 3CCLV 1M93A 2HP8A 5H6RA 4KHPO 2ADQB 1WPBA 4R7CA 3SPGA 3HB3B 3ZRWA 4F6RA 2QM7A 4B7KA 3BAAA 1FXKB 3VQYA 1FXVA 1H8HG 4LCUC 5BY1A 2F4VO 1Q7YW 4DW1A 1YXBA 1N36B 2JGDB 1L0NH 2ZM6B 2OWOA 1XNQB 1FXKA 3T2MA 3JD3A 1FS0G 1XL6A 2JGDA 3CJHA 4RO2A 2RJZA 1P4RA 1Q90D 2E3CA 2ZXWB 5H9CA 1SA0B 4O4JB 3L74H 4IYIA 4JYCA 4X1YA 2Z3YA 1LUVA 2XAHA 4HBNA 2AGAA 1CPYA 3SPCA 3SJCC 3T4ZA 1BQ0A 3IC9A 4O4JA 2QKCA 3H1KH 3FX7A 4WFBV 2LFRA 3UCSC 2P4KA 1I08A 3DXRB 3LSSA 2O57A 5BMVB 2WLKA 4WBNB 2Y4TA 3TXQA 1B3QA 5B1NA 3FYEB 5IYZB 1QR9A 2ZKOA 4OX9O 5EIBD 1HNWO 2CAZC 1SF9A 3K0GA 3ZRSA 2IJJA 5IY5C 2BTOA 3OW2U 4JTCB 2Q69A 4YIOA 1N0NA 1ZTEA 4N21A 1SQGA 3OTFA 4EFEA 3JARB 1XHXA 2B1GA 5KLVH 3CCRV 4B7EA 1EBOA 3OGCC 4NXMB 1Z2GA 3WG7C 4LF8B 1Q3EA 1N4CA 2Z0AA 2ODMA 1WLEA 1GN3A 5B5EZ 2R70A 3T1YB 4JI4B 3CWBH 3JD1A 4DV5B 2IJHA 3HKDB 1S5LZ 1KKCA 4AILC 5KA5A 3OGIB 2ZR2A 4OPAA 3HKDA 4JI8B 1ROPA 4UXNA 3RW0A 4H44B 2P06A 1JVMA 4H13B 3ZN1A 3RYCB 5KHGA 3ABMB 4U3JB 3SR2C 1OCOC 2X6BA 3DTUB 5EBWC 2HHHB 4JV5B 1PM9A 2EJ7A 1AJNA 1YVWA 3CSXA 3LDEA 3RYCA 1W0JG 1OCZC 2DYSB 2AHYA 2YEVB 3IGAC 4U3JA 3ZN0A 5IE9A 3CRAA 4KXRA 4ZBMA 1XOUA 2EIKC 2XNDG 2NNUA 2WLMA 3RBZA 1NI8A 1KQSU 4PDMA 2W0FC 3I5DA 3ZHTA 5LYJB 4J7KA 1D2DA 1AB3A 2Y69B 2ZE6A 4PI0A 4ICGA 5GTIZ 5IYCO 1D5AA 1NR1A 2CE4A 2D2CB 2YIDA 2UXBB 5LYJA 5FLXN 4BW9A 4JI5O 4X66O 4BAYA 2OTJV 1IDSA 4AHCA 1PNKA 5KAIZ 1N0JA 3VOUA 3M99B 2H3OA 5LGTA 2B9ZA 2A06H 2VQEB 3K9AA 3RT3C 3LUTB 4DUYO 3FD9A 1JOYA 2K9PA 3ETQA 1YJNV 2Q5ZA 3QO8A 2EILC 4K8XA 3CC7V 4MTOA 4P30A 4IHJB 3G6EV 2PF4E 4JI0B 5BR8O 4HYOA 4X65B 3IFXA 2EIJC 2AHZA 3ETDA 5KA6A 4R50A 4X62B 2GUZB 4IHJA 2CK3G 4FIPC 2P22C 3HKBB 2BE3A 5JQGB 4DK1A 3UQ8A 3LNMB 4QNHB 2GUZA 4N23A 2PZSA 5H5NA 1N34B 3HKBA 1AI7A 1QVGU 4K35A 4JAAA 3OUSA 1F23A 3DC5A 4D7SA 2N05A 4JZ2A 3CPWU 4LF5B 4Q6GA 5LA6A 3TETA 1IBLB 3ZMUA 3L71H 3TGUH 2UUCO 1N32B 3JASB 3FB6C 4P2ZA 2V4DA 2F43G 3T1HB 4LC1A 4PV1B 2V7QG 2LQTA 2ZM6O 1AP6A 3RYFB 3KCYA 1W2BU 3JASA 2ZDIA 2FMLA 4FM2A 2QE7G 1SQPH 1K5SA 4FMTA 4ZI7B 4NTXA 3THOA 5LOVB 1WP7A 2HFEC 1K4CC 3STZC 1K34A 4ZI7A 5LOVA 4OPHA 4DV2B 5ITZB 3RVYA 2ZNIA 2C2AA 1G4YB 2PUSA 4JZGA 1IXMA 1HW7A 1G6UA 2XAGA 1OCRB 1EN4A 1H2KA 1K92A 5ITZA 2PYJA 5KHIA 3PN1A 3O9OA 5LL6Y 4FLVA 1L0LH 1U97A 2E76B 4J42A 4DR1B 4CH6A 1BT8A 3JD0A 4ZHQB 2PGGA 3CCVV 3W7UA 4LR3A 3B4SA 2CTPA 4X1KB 1MSDA 5F2VO 1YZBA 2NLJC 3A0HZ 4HAMA 3T4DA 4ZHQA 2Q68A 1M90W 4X1KA 4FFBB 1J5EB 4LH6A 1K5QA 2JRIA 4XDLA 4CC5A 1VF6A 3IAYA 4LF9O 2DMXA 4NXMO 4FFBA 4O4IB 3NXSA 4UUJC 5JCOA 1B04A 4LF8O 3W7TA 4I50A 4QGPA 1Y6XA 3T1YO 3H01A 4ABMA 4JI4O 3X2QB 3D3IA 4O4IA 5FPRA 2EINB 4DV5O 4MTXA 3LNNA 2X6CA 3EFFK 2Y48A 4DV0B 4GX2A 4DR5B 3ZMSA 2BTQB 1TGOA 2Y0IA 2DYRB 3SYQA 1VQ6V 4IIJB 3AK2A 2QWOB 2E74B 3LDDA 3K3WA 3SYAA 2D3OW 1Q8IA 4D6TH 2CTWA 4JF3A 4Z1MG 2BTQA 1K7DA 1B6QA 2RCVA 4DR2B 2F95B 1GMGA 4JTAB 4IIJA 1IVSA 1VQLV 4CH4A 2VWKA 2HHHO 4JV5O 2KG7B 3CS5A 4IT5A 1SC5B 4J9YB 5EC1C 1KD1W 3K0DA 4QPJA 2OIEA 3AG2C 2OTLV 3CEIA 4YIPA 3JATB 1VF5B 1CEZA 2HKOA 3BY6A 1WN7A 1PV0A 1VEWA 1JX9A 3F5TA 2EBOA 3JATA 4JI7B 5B1AC 2CUGA 1EZVH 4PDRA 4CC6A 3JAKB 1AR4A 4PA4A 3SYPA 3ZMTA 1J95A 1KYOF 3AG1B 4GKJB 1K4DC 4J80A 4CS4A 5L3GA 2IJIA 4BR6A 2UXBO 1V9PA 4EEQA 4DV1B 3SPJA 3JAKA 2VS0A 1YCIA 3RYIB 1BCCH 5L3FA 1ZX3A 4UVAA 4DK0A 5LHGA 4J11A 2VQEO 5LHIA 1G1XB 1EFRG 1IBKB 1OZ0A 1AILA 3RYIA 3H1HH 4WFEA 3GWOA 5LBQA 3B8NA 2L6LA 2QR4A 1H8EG 2UU9O 1RPRA 4J41A 2MK3A 4JI0O 4X64B 4X65O 1MABG 4UCTA 3ABKC 3OEHG 4X62O 3BCCH 4MVOA 1P7GA 4UFZA 1Y67A 4PJ0Z 5LMNB 4PELA 1N34O 4TV9B 4UCVA 2HJFC 4YJ3B 4P9OA 4DV4B 1R6KA 4DYLA 5B3SB 1IBLO 1KU9A 4QJFB 5J2TA 4TV9A 2VRZA 3RN4A 1TA8A 1P84F 5GW7A 2FTKA 2UUAO 4C7UA 1NVPD 1W59A 3SJQC 5IT9N 4XDJA 4U3FH 3UT5B 1N32O 4GKKB 1AR5A 1E1RG 3CMAV 1CXZB 3T1HO 1OCCC 3QTCA 1RSOB 5JVDB 1S0VA 4NKGB 3CD6V 1RFYA 1SQBH 1GK9A 1P7BA 1MA1A 4JI3B 2OCCB 1RSOA 1OV9A 5JVDA 1VQ5V 5LMUB 3ASNC 2VQFB 5E79Z 4W4KA 4ZKIA 2YUAA 5CB4B 3T1CA 2B1IA 2BSKB 3ZJZA 5BZBA 2JGUA 4PDLA 3ABLB 2IH1C 3QNEA 3ETGA 3AG4C 1XUQA 3J7AU 3J81N 3WU2Z 4DV3B 1SA0A 1Q6UA 1Y76B 1GN4A 4J7JA 2BSKA 5B1BB 3OD4A 3FFQA 3SPHA 1ZAUA 3FB8C 4DR1O 2DWEC 3CP1A 1F7YA 3G71V 1Y76A 3E83A 5FNVB 1AVMA 1BS3A 3WB0A 1HP8A 3OEEG 2QJ1A 2QM8A 3J80N 1XNRB 1RM1C 2V1DA 2PI4A 2WPDG 4UCUA 4WFAV 4FM0A 1WB8A 3CCSV 3DXRA 5BMVA 5DECA 1JR9A 4WBNA 2PY5A 3AK1A 3FKSG 4WCEV 1H2LA 4GX0A 4EB6B 1NKDA 5IYZA 2N74A 3E86A 3CRQA 5CN0A 3QO7A 1GM7A 3CC4V 1K73W 1JA8A 5HFMA 2ZT9B 2UXCB 2WLNA 5A9GA 1Q6HA 2LJ2A 3E89A 4KL1A 4EB6A 1XI1A 2Q4PA 1HNZB 2ZIMA 3OT7A 3HR0A 2LP7A 2LGWA 2H8PC 3ZHQA 1NZ6A 2JS5A 1H38A 1BQZA 1SQQH 2EIMB 3JARA 3L70H 4FLTA 1HR0B 3BA8A 3LSUA 4DR5O 4EFBA 1WNSA 4B3RB 4QE7A 2RN9A 2HEPA 2UUBB 1T5EA 1F4MA 4MSWC 4QIWF 4FLXA 5KMGB 2QWQB 3ABTA 1GH6A 1P49A 1YSCA 1RPOA 1DK1A 2JJ2G 3N27A 4IYHA 4O4HB 3AG3B 4MVRA 5KMGA 1PNLA 1O9GA 2E75B 1VQOV 2DN9A 1EN6A 3VQWA 1KECA 4GT1A 4O4HA 2H94A 5KAFZ 2JVDA 3OTOB 2XAJA 4JI7O 2CTQA 5CBHA 2P6JA 3QVNA 5IJ0B 2QWRB 1ZL8B 1FPOA 4DR7O 1Q82W 4NXNB 2B5UA 2FKXA 2JEXA 3L73H 2YEVA 2Q7EA 1I5YA 3D36A 1NT2B 5LP6B 4GKJO 1QLEC 1HNXO 2E5LB 4DV1O 5IJ0A 1YJWV 4BIOA 4DR3B 1FXHA 5EBMC 1BL8A 4X89A 5LP6A 4JI6O 4B3TB 4L87A 3FAVB 3B77A 1F4NA 4Q20A 2KSDA 4PHZA 3PJSK 5GTHZ 4CZZA 1VARA 1S76D 1M57C 3GWKC 1IBKO 1F51A 2DQ3A 2AZ2A 1VQPV 1M56C 1V55B 5C93A 4MTFA 4BIUA 1XMQB 2P5OA 4LWSB 1M9NA 2UXXA 3JCUZ 4UV8A 4K0KO 4DV6B 4LH7A 4E2LA 2FB5A 5J2UB 2A0LA 3SGIA 3UO2A 4TSFG 1FXKC 3OFNG 4LWSA 1AP5A 1DGSA 5J9PC 1SQVH 1VQ9V 3EXAA 4B3SB 2YSUB 3B8MA 5J2UA 4LFBB 3ASOB 1FAFA 3I56V 2L35A 3JD4A 2GSMB 4JYBA 2FYUH 3ZHSA 4DV4O 2QTSA 3ICXA 5EZYB 2QSAA 4DW0A 2WLHA 2XUMA 3AG2B 5L3CA 2ZXWC 4FZ1A 5LGUA 3K79A 2ZCEA 2GBOA 1IBMO 4L8JA 5JQGA 1GAXA 4CBCA 4DRXB 4JYAO 1X59A 2CTRA 3VBBA 5IWAO 1Y66A 1FJGO 1Z5WA 5E1AC 3E8HA 4GKKO 4DRXA 4LFCB 2ZE8A 4P9PA 3E8GA 4AQYB 1AR1B 1S5JA 3CHXA 2Q7HA 1R3JC 3DGEA 2Y0PA 1B06A 1N36O 1JJ2U 2Q8VA 5LMUO 4FVMA 4IGGA 3JD2A 2DJVA 1XNQO 2UXDB 5C8YB 2YXYA 3OMAB 3SDLA 1GM8A 3ETEA 1R6NA 3U10A 5L3EA 4XDKA 4UB6Z 2YIAA 4NVPA 3RYFA 1Z5VA 2DQ0A 3WFVA 3QG5A 2HVKC 2QA4V 4KHPB 4LF7B 3K03A 1UJWB 5IYBO 4HNAB 4I7ZB 1N8RW 1YTFB 3L75H 1FYJA 1ZUQA 1XDCA 2F4VB 2YDEA 2VWJA 3K5NA 4J7ZA 3CCEV 4X9QA 4D7TA 2YC0A 1ZLZA 4UB8Z 3SYOA 1QR8A 3HKCB 2EJRA 3CE2A 1XNRO 3LDCA 2HJDA 3K5LA 2PI5A 3MHHC 1KC8W 2AW9A 4PDVA 3K57A 3ZEDA 2QEXV 4NTYA 2GDSA 3HKCA 3BABA 4JI2B 1YJ9V 3H9VA 1SERA 4I4TB 1VP7A 3R66A 2X7RB 1DF4A 2EULA 1BHBA 4WF9V 4MTGA 1KP3A 1IURA 5GONB 2UXCO 3RFRA 2W0XA 1S3JA 4I4TA 3ABMC 4U7NA 5LHHA 1I94B 3K9SA 5GONA 2Q73A 4DXWA 1AI6A 1S72V 1U96A 3MD0A 2DYSC 3ZHUA
chains in the Genus database with same CATH topology
4KFMA 3CCJV 4I9WA 4N21A 2Q67A 4PELA 5CBFA 1BHAA 3ABLC 2JIZG 4MS2A 2HJFC 3OR7C 1QBZA 3LSQA 4P9OA 2B1GA 1K3EA 5B1AB 3CCRV 4PA3A 4X88A 3ZCCA 2EZPA 5B1BC 1EBOA 1R6KA 5B3SB 3OGCC 4GX5A 4H33A 4RAIA 3WG7C 4QJFB 2Y69C 1OHHG 2JK5C 1WLEA 2ITDC 1NVPB 3ZMVA 5GW7A 4J9ZB 1W0KG 2FTKA 4XBFA 1NVPD 1PKXA 2M7WA 3ZIAG 2WSSG 3JD1A 3SJQC 2IJHA 5IYDO 4XDJA 3F5WC 1JPXA 2IH3C 1E79G 4MVMA 4LBEC 3F7YC 3SPIA 1E1QG 4FK5C 1E1RG 1NBMG 4UVBA 3CMAV 5KA5A 1OCCC 2ZR2A 1S0VA 4WFGA 1RM1B 3OUFA 1ROPA 3CD6V 1XL4A 1VQMV 4UXNA 3RW0A 4MVSA 1JVMA 3ZN1A 1GK9A 1P7BA 5IDJA 2OCCB 3UM7A 3ABMB 2R9IA 3JYCA 3ZRVA 1VQ5V 1OCOC 3ABKB 3ASNC 2X6BA 3DTUB 5EBWC 5IY5B 3CXCU 1LNQA 2WLLB 1AJNA 3LDEA 1W0JG 1OCZC 2DYSB 2AHYA 4I5SA 3CCMV 4JASA 4ZKIA 2YEVB 3A0RA 3IGAC 3ZN0A 1GKFA 1CP9A 2WAMA 3T1CA 1YTFD 3CCUV 2B1IA 4ZBMA 3ZJZA 2A9HA 2EIKC 2XNDG 3P32A 5BZBA 2EIMC 2NNUA 2WLLA 2WLMA 2Z5UA 4PDLA 3ABLB 3RBZA 2IH1C 3QNEA 1HWYA 3ETGA 3AG4C 4PA7A 1SETA 1KQSU 1NR7A 4PDMA 4G27B 2W0FC 2EZOA 5B1BB 4MVZA 2WLIB 3WG7B 2Y69B 3K04A 3SPHA 2DWDC 3FB8C 5IYCO 2LFSA 2DWEC 1NR1A 3CP1A 3G71V 3E83A 2WLJA 1VQKV 3OEEG 2WLIA 1PL0A 2QM8A 1GTOA 1V54B 2XOKG 4MT8A 1SZTA 4BAYA 2WWWA 1RM1C 1S5HC 2V1DA 2PI4A 2JDIG 1NJIW 2OTJV 2WPDG 3AG3C 4WFAV 1PNKA 1DF5A 3VOUA 2ZDIC 3M99B 3CCSV 5LGTA 1K8AW 4F4LA 3K9AA 3CCQV 3LUTB 4WFFA 1JOYA 3FKSG 4WCEV 1OCCB 1YJNV 4GX0A 2ZD9A 3HPLC 1NKDA 2R9RB 3QO8A 3E86A 2QKSA 5CN0A 2EILC 3QO7A 1GM7A 3ZMZA 2W6JG 3CC7V 4KP4A 1Q81W 3CC4V 1K73W 4MTOA 5HFMA 2X6AA 3K08A 4P30A 1Y4MA 5EK0A 3G6EV 2WLNA 4MW8A 3QO5A 3E89A 2Q6AA 4HYOA 1OCOB 2ATKC 3IFXA 3ASNB 2EIJC 2AHZA 1YHQV 3ETDA 5KA6A 1MG1A 4R50A 2IW5A 3RVZA 5CA3A 1OCZB 2XAFA 2CK3G 4FIPC 4RQEA 1YIJV 1GM9A 2LP7A 2H8PC 1DTOA 1FFTB 1THZA 1H38A 1M1KW 2EIKB 1R73A 2EIMB 5L3BA 3LNMB 5B1OA 4QNHB 4N23A 3AEIA 1OCRC 3AG4B 1AI7A 1AI5A 3SYCA 1QVGU 1K97A 2IJKA 1V54C 1F23A 3OUSA 4QE7A 2ZQMA 3CPWU 1YITV 3TETA 4YXWG 4MVQA 1F4MA 1JCHA 1V55C 3E8BA 4JTCB 4MSWC 4QIWF 4GCZA 2XAQA 1GO3F 3UKMA 5EBLC 2W6IG 3ABTA 3ZMUA 2UXNA 1NH2B 5KUKA 1YSCA 1AROP 1RPOA 4RQFA 1M57B 4EKWA 4RUFA 5FL7G 2JJ2G 2JJ1G 4JAVA 3KG2A 1NQTA 1ZWIC 3AG3B 4MVRA 4PA9A 5LGNA 1K33A 3TK1A 1L1FA 3FB6C 1PNLA 3CMEV 4P2ZA 4G28B 1VQOV 2F43G 1KECA 1TUEB 3R65A 4LC1A 2V7QG 4GT1A 3ASOC 1BMFG 3BEHA 1AI4A 2EILB 2P67A 2ZDIA 3OM3B 4R8CA 1W2BU 2BOBC 1H2GA 5CBGA 2H94A 3EHBB 2XAJA 2QE7G 3E8FA 1PD3A 1K5SA 2P6JA 5CBHA 4JAUA 1ORQC 4FMTA 3TCUA 3ZRXA 1Q82W 2B5UA 2EIJB 2JEXA 2HFEC 1K4CC 2YEVA 1I5YA 3D36A 1R3KC 1QLEC 3STZC 4LP8A 1K34A 4MVUA 2HG5C 1R3LC 3X2QC 3ML0A 3CC2V 1YJWV 1AJQA 1FXHA 1S77D 2EINC 3RVYA 5EBMC 1BL8A 2HR3A 4X89A 2C2AA 1G4YB 4L87A 3W7XA 3B77A 1IXMA 1F4NA 4Q20A 2XAGA 1OCRB 3FYIB 3PJSK 2KB1A 4CZZA 1S76D 1M57C 2DYRC 1COWG 1K92A 1VQ4V 3OMNB 3FB7C 2JEUA 5DM6V 1F51A 1PNMA 2DQ3A 3CYOA 3F7VC 1VQPV 1M56C 1ENVA 2P90A 5L3DA 1V55B 5C93A 4MTFA 4MW3A 4BIUA 3JD0A 1KKDA 1M9NA 2UXXA 4UV8A 2HVJC 3CCVV 4E2LA 3W7UA 3P30A 4OXSA 1YI2V 4BW5A 1QLNA 2ITCC 2A0LA 2X0LA 2NLJC 4TSFG 4HAMA 1FXKC 3OFNG 4ASUG 1MSWD 3T4DA 5J9PC 1VQ9V 1SESA 2YSUB 1WPXA 2Q68A 3B8MA 1KP2A 4DO2A 3ASOB 1G8MA 3I56V 1M90W 1VQNV 4X8AA 1K5QA 4XDLA 3JD4A 2GSMB 3OAAG 4JYBA 3OR6C 4QE9A 1K9MW 2IU3A 3I55V 2A79B 3W7SA 2WLHA 5CMUA 3AG2B 5L3CA 2ZXWC 4UUJC 3NXSA 4PA6A 4BIZA 5LGUA 4GX1A 3K79A 3OMIB 1R3IC 3JCZA 3AG1C 3W7WA 3W7TA 1QLEB 2IU0A 3H01A 3IC7A 4U7OA 3X2QB 4CBCA 3D3IA 3MHSC 2EINB 3VBBA 4MTXA 1Y66A 5DN6G 2X6CA 3EFFK 5E1AC 2Y48A 3E8HA 3GB7C 4JTDB 4KUMA 4TT3G 4GX2A 1VQ8V 4HZ3A 2GHYA 4UVCA 3ZMSA 4FJCC 5KUMA 1I5XA 2DYRB 4P9PA 3E8GA 1NH2D 3STLC 3SYQA 4FPPA 1VQ6V 5HFLA 1AR1B 3E2EA 3FB5C 4R6ZA 3LDDA 3OE7G 1DLBA 3K3WA 3SYAA 2D3OW 3ZRWB 1M56B 4JGSA 2P7TC 4JF3A 1R3JC 4Z1MG 3DGEA 1K7DA 1B6QA 3CCLV 1GMGA 1JJ2U 3K06A 4JTAB 5H6RA 1VQLV 3E35A 3JD2A 4G2KA 4R7CA 3SPGA 3HB3B 3ZRWA 4UV9A 2QM7A 2QTOA 3OMAB 1GM8A 3ETEA 4J9YB 5EC1C 1KD1W 1R6NA 3K0DA 1MOFA 1FXKB 4QPJA 5L3EA 4XDKA 1FXVA 1H8HG 2HLDG 4LCUC 5EC2C 1Q86W 3AG2C 2OTLV 2DQ0A 3WFVA 1Q7YW 2OT5A 3ABUA 1JQ0A 2HVKC 2QA4V 1CEZA 2HKOA 3BY6A 3K03A 1UJWB 5IYBO 3G4SV 2K1EA 1FXKA 3T2MA 1JX9A 1N8RW 3JD3A 2EBOA 1FS0G 2BOCC 1EZJA 1YTFB 5B1AC 1XL6A 4PDRA 4QPKA 4H37A 4RO2A 5B3SC 3SYPA 4PA4A 1P4RA 2ZXWB 5H9CA 3ZMTA 3CCEV 1J95A 3AG1B 5H6QA 4JYCA 1K4DC 2Z3YA 5L3GA 2XAHA 2IJIA 1CPYA 3SPJA 3SPCA 3T4ZA 2ZR3A 3SYOA 1QR8A 2EJRA 3LDCA 2DW4A 2PI5A 3MHHC 1KC8W 4PDVA 5L3FA 4UVAA 4WFBV 2QEXV 5LHGA 1AJPA 4TWKA 2LFRA 5LHIA 1YJ9V 1VQ7V 1SERA 1EFRG 2X7RB 1OZ0A 3LSSA 1DF4A 2WLKA 1BHBA 4WFEA 4WFHA 4MTGA 3GWOA 4WF9V 5LBQA 1KP3A 5B1NA 3FYEB 3B8NA 1H8EG 1QR9A 1RPRA 1S3JA 2OCCC 4JPRA 3ABMC 4RUEA 2MK3A 4U7NA 5LHHA 1MABG 3K0GA 3ABKC 3OEHG 3ZRSA 1QCEA 2IJJA 2XASA 5IY5C 4DXWA 1AI6A 1S72V 3OW2U 1SRYA 3MD0A 1QVFU 4MVOA 2DYSC 2Q69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KFM A;  5KUM A;  3E83 A;  2WLJ A;  3E8F A;  5CBH A;  4I9W A;  1ORQ C;  2WLI A;  4P9P A;  3E8G A;  3TCU A;  3STL C;  2Q67 A;  3SYQ A;  5CBF A;  1S5H C;  3FB5 C;  4R6Z A;  2HFE C;  1K4C C;  3ABL C;  3LDD A;  3SYA A;  2YEV A;  3AG3 C;  4MS2 A;  1R3K C;  3VOU A;  2P7T C;  1QLE C;  1R3J C;  2HJF C;  3OR7 C;  3STZ C;  4LP8 A;  4F4L A;  4MVU A;  2HG5 C;  1R3L C;  3LUT B;  4P9O A;  3X2Q C;  3K06 A;  4JTA B;  4PA3 A;  4X88 A;  4WFF A;  5B1B C;  3OGC C;  4GX5 A;  2EIN C;  4GX0 A;  2ZD9 A;  4H33 A;  3HPL C;  4RAI A;  5EBM C;  1BL8 A;  2R9R B;  4R7C A;  4X89 A;  2Y69 C;  3SPG A;  3WG7 C;  3E86 A;  1G4Y B;  2QKS A;  2EIL C;  2QTO A;  2JK5 C;  4J9Y B;  4MTO A;  5EC1 C;  2ITD C;  2X6A A;  3K0D A;  3K08 A;  3PJS K;  4P30 A;  2KB1 A;  5EK0 A;  4XDK A;  2WLN A;  4LCU C;  4MW8 A;  1M57 C;  5EC2 C;  4J9Z B;  3AG2 C;  2DYR C;  2DWE C;  3E89 A;  3FB7 C;  2Q6A A;  4HYO A;  2HVK C;  2ATK C;  3IFX A;  2EIJ C;  3RVY A;  2AHZ A;  3SJQ C;  3K03 A;  3F7V C;  1M56 C;  4XDJ A;  3F5W C;  2K1E A;  2IH3 C;  4R50 A;  4MTF A;  3RVZ A;  3T2M A;  4MVM A;  4MW3 A;  4LBE C;  3F7Y C;  2BOC C;  3SPI A;  1KKD A;  5B1A C;  2H8P C;  1XL6 A;  4PDR A;  4H37 A;  4RO2 A;  5B3S C;  2HVJ C;  1OCC C;  4PA4 A;  3SYP A;  5IY5 C;  4WFG A;  1J95 A;  4OXS A;  3OUF A;  3LNM B;  4BW5 A;  4QNH B;  2ITC C;  2A0L A;  1XL4 A;  1K4D C;  4MVS A;  2NLJ C;  1OCR C;  3RW0 A;  1JVM A;  1P7B A;  3SYC A;  3SPJ A;  3T4D A;  3SPC A;  3UM7 A;  1V54 C;  3OUS A;  3T4Z A;  5J9P C;  3JYC A;  4QE7 A;  3SYO A;  1OCO C;  2Q68 A;  3ASN C;  3LDC A;  3TET A;  2X6B A;  5EBW C;  4MVQ A;  4PDV A;  1LNQ A;  4X8A A;  2WLL B;  1V55 C;  3E8B A;  4JTC B;  4XDL A;  3LDE A;  4MSW C;  1OCZ C;  2AHY A;  3UKM A;  3OR6 C;  4QE9 A;  5EBL C;  3IGA C;  4TWK A;  2A79 B;  5KUK A;  3T1C A;  2WLH A;  4EKW A;  4RUF A;  2ZXW C;  4ZBM A;  2WLK A;  4UUJ C;  2A9H A;  3ZJZ A;  2EIK C;  4PA6 A;  5BZB A;  4WFE A;  2EIM C;  2WLM A;  2WLL A;  4GX1 A;  4PDL A;  4MTG A;  1R3I C;  3KG2 A;  4WFH A;  2IH1 C;  1ZWI C;  3AG1 C;  4MVR A;  4PA9 A;  3RBZ A;  3FB6 C;  3AG4 C;  4PA7 A;  4P2Z A;  4PDM A;  4G27 B;  2OCC C;  4G28 B;  2W0F C;  3ABM C;  4RUE A;  4CBC A;  4MVZ A;  2WLI B;  3R65 A;  3K0G A;  3ABK C;  3ZRS A;  3ASO C;  2X6C A;  3EFF K;  3K04 A;  3BEH A;  3E8H A;  3GB7 C;  4JTD B;  4R8C A;  5E1A C;  3SPH A;  4DXW A;  2BOB C;  2DWD C;  3FB8 C;  4GX2 A;  4HZ3 A;  5CBG A;  4MVO A;  2DYS C;  2Q69 A; 
#chains in the Genus database with same CATH topology
 4KFM A;  3D36 C;  1TVK B;  3ZX6 A;  4I9W A;  4K8Z A;  4DV7 B;  4O2B B;  2JIZ G;  4MS2 A;  1TVK A;  2QGN A;  3OR7 C;  4B3R O;  1QBZ A;  3EVK A;  2QWN B;  2LW7 A;  4PI2 A;  4X88 A;  3ZCC A;  2EZP A;  4GX5 A;  4H33 A;  4TUY B;  2Y69 C;  5JJN B;  4ZIB A;  1OHH G;  2JK5 C;  2ITD C;  1NVP B;  2IBZ H;  4F6E A;  3L72 H;  4J9Z B;  4TUY A;  2M7W A;  3ZIA G;  4FLU A;  2WSS G;  4JI8 O;  4B3M B;  2RDC A;  4FLZ A;  3F5W C;  1I7F A;  2IH3 C;  4LBE C;  3F7Y C;  2P4V A;  3SPI A;  1E1Q G;  1NBM G;  4UVB A;  4ZOL B;  2ZE7 A;  5JJJ B;  4WFG A;  4H0L B;  1RM1 B;  4TQD A;  3BHP A;  5LXT B;  1D5N A;  3OTO O;  4ZOL A;  3JSL A;  3UM7 A;  3BA9 A;  2KG7 A;  3JYC A;  4I0X B;  3ZRV A;  4NXN O;  4CS2 A;  3CRC A;  3K59 A;  4Z2W A;  5LXT A;  5IY5 B;  3CXC U;  5D5Q A;  2A3Q A;  3N2K B;  4I0X A;  4DR3 O;  1A32 A;  2YS8 A;  2WAM A;  3C90 A;  1YTF D;  2GV9 A;  4TV8 B;  2A9H A;  3P32 A;  2RQ6 A;  1HWY A;  1SET A;  3N2K A;  3Q4H B;  3RGB A;  2EZO A;  1BE3 H;  3MAQ A;  4TV8 A;  1MMM A;  2KQX A;  2WLI B;  2CH7 B;  3WG7 B;  3A0B Z;  3K04 A;  2DWD C;  2LFS A;  3Q4H A;  1KB9 F;  2WLJ A;  2WLI A;  2CH7 A;  2XOK G;  1SZT A;  4MT8 A;  2WWW A;  2YXL A;  2JDI G;  4JI1 B;  4I55 B;  1DF5 A;  2ZDI C;  4O2A B;  1K8A W;  3CCQ V;  4GYC B;  4B08 A;  4B3S O;  4LFB O;  3CRR A;  1XBL A;  3HPL C;  2R9R B;  2QKS A;  3ZMZ A;  4E4E A;  4O2A A;  3JAM N;  3K08 A;  3M7M X;  1WAZ A;  5EK0 A;  2LGQ A;  3G67 A;  4O4L B;  3DC6 A;  1O9H A;  3QO5 A;  4DUY B;  4LFA B;  1OCO B;  1BSM A;  1IZ3 A;  1YHQ V;  3MDS A;  1H2N A;  3RVZ A;  1OCZ B;  4RQE A;  4O4L A;  4LNU B;  4LF5 O;  1FFT B;  1WP8 A;  1THZ A;  4BWA A;  1M1K W;  2EIK B;  5BR8 B;  4YJ3 A;  3AEI A;  4LNU A;  1OCR C;  3N2G B;  5KHJ A;  3O65 A;  1R1B A;  4LFC O;  2IJK A;  1V54 C;  2ZQM A;  4AQY O;  4YXW G;  1KMI Z;  4MVQ A;  1JCH A;  2YIB D;  3E8B A;  3N2G A;  5JWP A;  3UKM A;  4DR6 B;  5EBL C;  2W6I G;  2UXN A;  2ZIN A;  4YY3 B;  5KUK A;  1ARO P;  4RQF A;  1M57 B;  4EKW A;  4RUF A;  3UT5 A;  2UXD O;  5FL7 G;  2BCC H;  2JJ1 G;  1SS3 A;  2DE0 X;  2YI9 A;  4JAV A;  1LUW A;  1K33 A;  3TK1 A;  1L1F A;  1VF6 C;  4G28 B;  4DR4 B;  4LF7 O;  2EX3 A;  1BMF G;  1QHT A;  3RWR D;  5JCO C;  3BEH A;  1AI4 A;  2EIL B;  3EHB B;  2UUC B;  3E8F A;  4DV2 O;  4JAU A;  1RP3 B;  3ZRX A;  1XEQ A;  3G80 A;  3CJH B;  2EIJ B;  3B2E E;  4FLW A;  5CB4 A;  4LP8 A;  1XQ8 A;  2ARH A;  2HG5 C;  2FL4 A;  3X2Q C;  4X1Y B;  3ML0 A;  3CC2 V;  1AJQ A;  1XIL A;  1S77 D;  2EIN C;  1GN6 A;  4UCS A;  2HR3 A;  5KHH A;  3JSN A;  3B40 A;  3FYI B;  4A5U B;  3C3S A;  1LR1 A;  4JI2 O;  2QDO A;  2DYR C;  1COW G;  2N04 A;  1VF7 A;  1FD9 A;  3OMN B;  2JEU A;  3F7V C;  4FFK A;  1ENV A;  5FNV A;  3KZI Z;  1XMO B;  5CA1 B;  3RYH B;  2YXH A;  1J5E O;  2HVJ C;  1I94 O;  2F66 C;  2OCH A;  3P30 A;  3BPZ A;  4BW5 A;  2ITC C;  2X0L A;  5CA1 A;  3RYH A;  4CS3 A;  1YDX A;  4IL6 Z;  4ASU G;  1MSW D;  1GN2 A;  4DV7 O;  5FPO A;  1EN5 A;  2WA3 A;  1WA8 B;  1H2S B;  1N33 B;  4LF4 B;  1JJO A;  2IU3 A;  2A79 B;  1US6 A;  3W7S A;  5CMU A;  1WA8 A;  4DV0 O;  4PA6 A;  3JAL B;  3OMI B;  3JCZ A;  3AG1 C;  3H1J H;  2KKW A;  1PP9 H;  3H1L H;  2IU0 A;  3VQX A;  5B66 Z;  4UCR A;  4LF9 B;  4B3M O;  3JAL A;  5DN6 G;  2OIG A;  4JTD B;  1VQ8 V;  4HZ3 A;  4DR2 O;  2GHY A;  4FJC C;  2AXT Z;  5HFL A;  3L9D A;  3OE7 G;  1DLB A;  4YHH B;  5EIB C;  2P7T C;  3WB2 A;  3K06 A;  3E35 A;  3HKE B;  4G2K A;  4PD4 F;  3KCX A;  2AZ0 A;  1UPG A;  4UV9 A;  3U11 A;  3VQV A;  2QTO A;  4CH3 A;  1SZX A;  2XT9 A;  1MOF A;  1YEW A;  1WJZ A;  2HLD G;  4LF6 B;  5EC2 C;  1Q86 W;  3HKE A;  2OT5 A;  1JQ0 A;  3ABU A;  3BFR A;  3G4S V;  2K1E A;  4NR1 A;  1MZF A;  2ILM A;  2BOC C;  1EZJ A;  1ZL8 A;  4QPK A;  3AK3 A;  4H37 A;  5B3S C;  1TUB B;  1FKA O;  5H6Q A;  3QF7 A;  3KKY A;  2ZR3 A;  4NTW A;  1TUB A;  3FAV A;  2DW4 A;  4JI1 O;  1URF A;  1AJP A;  1Q6I A;  4X64 O;  1IXB A;  4TWK A;  3A8T A;  1VQ7 V;  4CH5 A;  4WFH A;  1SQF A;  3P3N A;  1BGY H;  2OCC C;  4JPR A;  5LMN O;  4RUE A;  1GRJ A;  2ZNJ A;  4LFA O;  2Q0O C;  3K58 A;  1QCE A;  2XAS A;  1SRY A;  1QVF U;  1FFX B;  1HDJ A;  1JMK C;  2UU9 B;  3CCJ V;  1JFF B;  2Q67 A;  5IJ9 B;  5CBF A;  2WA4 A;  1BHA A;  3CX5 F;  1OJH A;  3ABL C;  5K1P A;  1FFX A;  3TXS A;  5EZY A;  3JAW B;  4GLX A;  1XRE A;  5D5P A;  2CGO A;  3LSQ A;  1JFF A;  1K3E A;  5B1A B;  4DUZ B;  4PA3 A;  5IJ9 A;  1H2M A;  5B1B C;  1KBH A;  4RAI A;  2R72 A;  3CB2 A;  1Q5O A;  4W4L A;  3JAW A;  5LA6 B;  4DR6 O;  1YF2 A;  3ZMV A;  2XTA A;  4YY3 O;  1W0K G;  1TAE A;  2RNB A;  4XBF A;  3S3X A;  3S3W A;  1PKX A;  2XHB A;  3E22 B;  3UO3 A;  3M8A A;  4X20 B;  2Y4U A;  1QU7 A;  5IYD O;  1JPX A;  4JI3 O;  3A2F A;  3ZBH A;  5KX5 B;  1E79 G;  4MVM A;  4FK5 C;  5EYP B;  1MZE A;  4NB5 A;  2ADP A;  3E22 A;  2VQF O;  4DR4 O;  3K5O A;  4X20 A;  2UUA B;  3OUF A;  5KX5 A;  1XL4 A;  1VQM V;  4MVS A;  5EYP A;  3D3Q A;  5IDJ A;  2YIC A;  1I0H A;  1KUQ A;  2R9I A;  5C8Y A;  3ABK B;  1R6T A;  1LNQ A;  2WLL B;  4JYY A;  2PYL A;  4FZ0 A;  1NTM H;  4I5S A;  4DV3 O;  3CCM V;  4JAS A;  1QQC A;  3A0R A;  2NR5 A;  3C3T A;  1WB7 A;  1GKF A;  1CP9 A;  3CCU V;  1PPJ H;  2F1M A;  3DSQ A;  4HNA A;  2Q7G A;  2EIM C;  2WLL A;  2Z5U A;  4PA7 A;  5H2F Z;  1NR7 A;  3H1I H;  4G27 B;  3U0Z A;  4MVZ A;  1NU1 H;  3SJA C;  3SJB C;  1XMO O;  3CRM A;  2F23 A;  1VQK V;  2NN4 A;  1PL0 A;  1GTO A;  1V54 B;  1VMG A;  1S5H C;  1NTZ H;  1NJI W;  1NTK H;  5KHK A;  3AG3 C;  4TOI A;  4F4L A;  3ZHV A;  2JS3 A;  4WFF A;  3APO A;  1HNZ O;  1OCC B;  1IX9 A;  2ZD9 A;  4UCO A;  2W6J G;  1N33 O;  4KP4 A;  1Q81 W;  4LF4 O;  2X6A A;  1Y4M A;  2Q0A A;  5CA0 B;  4OX9 B;  4MW8 A;  4NYK A;  2Q6A A;  1HNW B;  2ATK C;  3ASN B;  1HR0 O;  3D8C A;  5LP6 C;  5DED A;  1MG1 A;  2IW5 A;  5CA3 A;  2XAF A;  3B09 A;  1YIJ V;  5CA0 A;  5BXZ A;  4I50 B;  1GM9 A;  4O2B A;  1DTO A;  2UUB O;  2RMK B;  3K5M A;  1R73 A;  1VIB A;  5L3B A;  5B1O A;  2LW1 A;  3AG4 B;  1AI5 A;  3SYC A;  1K97 A;  3APQ A;  5JH7 B;  1UFI A;  2ETN A;  2MW2 B;  1YIT V;  4YHH O;  2OYQ A;  1XHZ A;  2IM9 A;  1V55 C;  2GTS A;  3P3P A;  4GCZ A;  2XAQ A;  1GO3 F;  5JH7 A;  3TJT A;  1NH2 B;  2LO1 A;  2YIB A;  5AG2 A;  3KG2 A;  5A2Q N;  1NQT A;  1ZWI C;  4PA9 A;  5LGN A;  1MNG A;  2F93 B;  3CME V;  4OGQ B;  1L8D A;  4LF6 O;  1BZK A;  4GZR B;  1TUE B;  3R65 A;  2GTA A;  3ASO C;  3OM3 B;  2P67 A;  1M4U A;  4R8C A;  4FM1 A;  2E5L O;  2BOB C;  1H2G A;  5CBG A;  3CXH F;  2Q9L A;  1PD3 A;  1ORQ C;  3TCU A;  4B3T O;  1QNM A;  1R3K C;  1Q43 A;  4MVU A;  1R3L C;  2DOS A;  3ZS8 C;  4DR7 B;  3W7X A;  3IJ4 A;  3ZHR A;  1XMQ O;  2KB1 A;  4DV6 O;  4GUN A;  1HNX B;  1VQ4 V;  2A7W A;  3BVO A;  3FB7 C;  2QKA A;  5DM6 V;  1PNM A;  3CYO A;  5L3D A;  2P90 A;  2R9A A;  4YJ2 B;  4JI6 B;  4MW3 A;  2G38 A;  5JJE B;  1KKD A;  4TQF A;  4J10 A;  4JI5 B;  4X66 B;  4I55 A;  2CDY A;  4OXS A;  1YI2 V;  4YJ2 A;  1QLN A;  2QM4 A;  1PL4 A;  4Z1V A;  5TIS Z;  1SES A;  4K0K B;  1WPX A;  2PTM A;  1KP2 A;  4DO2 A;  1G8M A;  1VQN V;  4X8A A;  1SKV A;  3BRC A;  3OAA G;  3OR6 C;  4QE9 A;  1K9M W;  4DUZ O;  3I55 V;  2M6Y A;  4X1I B;  4BIZ A;  4GX1 A;  3NR7 A;  1R3I C;  2CGN A;  3W7W A;  5J2T B;  1NS1 A;  1QLE B;  4RWU A;  3WB1 A;  3IC7 A;  4K3A A;  4U7O A;  1Y74 B;  3MHS C;  1SQX H;  3AG7 A;  4X1I A;  2ZE5 A;  3GB7 C;  4KUM A;  4FLY A;  4TT3 G;  3G6B A;  1Y74 A;  4UVC A;  4I9Q A;  5KUM A;  2YI8 A;  1IBM B;  1I5X A;  1NH2 D;  3STL C;  4FPP A;  4JYA B;  3E2E A;  3FB5 C;  4R6Z A;  1EM1 A;  3GVM A;  4AI8 A;  4F6R B;  1ZSP A;  1M56 B;  1M5I A;  3ZRW B;  5IWA B;  2QWP B;  4JGS A;  2ZIO A;  1FJG B;  1X4T A;  5K1X A;  3CCL V;  1M93 A;  2HP8 A;  5H6R A;  4KHP O;  2ADQ B;  1WPB A;  4R7C A;  3SPG A;  3HB3 B;  3ZRW A;  4F6R A;  2QM7 A;  4B7K A;  3BAA A;  1FXK B;  3VQY A;  1FXV A;  1H8H G;  4LCU C;  5BY1 A;  2F4V O;  1Q7Y W;  4DW1 A;  1YXB A;  1N36 B;  2JGD B;  1L0N H;  2ZM6 B;  2OWO A;  1XNQ B;  1FXK A;  3T2M A;  3JD3 A;  1FS0 G;  1XL6 A;  2JGD A;  3CJH A;  4RO2 A;  2RJZ A;  1P4R A;  1Q90 D;  2E3C A;  2ZXW B;  5H9C A;  1SA0 B;  4O4J B;  3L74 H;  4IYI A;  4JYC A;  4X1Y A;  2Z3Y A;  1LUV A;  2XAH A;  4HBN A;  2AGA A;  1CPY A;  3SPC A;  3SJC C;  3T4Z A;  1BQ0 A;  3IC9 A;  4O4J A;  2QKC A;  3H1K H;  3FX7 A;  4WFB V;  2LFR A;  3UCS C;  2P4K A;  1I08 A;  3DXR B;  3LSS A;  2O57 A;  5BMV B;  2WLK A;  4WBN B;  2Y4T A;  3TXQ A;  1B3Q A;  5B1N A;  3FYE B;  5IYZ B;  1QR9 A;  2ZKO A;  4OX9 O;  5EIB D;  1HNW O;  2CAZ C;  1SF9 A;  3K0G A;  3ZRS A;  2IJJ A;  5IY5 C;  2BTO A;  3OW2 U;  4JTC B;  2Q69 A;  4YIO A;  1N0N A;  1ZTE A;  4N21 A;  1SQG A;  3OTF A;  4EFE A;  3JAR B;  1XHX A;  2B1G A;  5KLV H;  3CCR V;  4B7E A;  1EBO A;  3OGC C;  4NXM B;  1Z2G A;  3WG7 C;  4LF8 B;  1Q3E A;  1N4C A;  2Z0A A;  2ODM A;  1WLE A;  1GN3 A;  5B5E Z;  2R70 A;  3T1Y B;  4JI4 B;  3CWB H;  3JD1 A;  4DV5 B;  2IJH A;  3HKD B;  1S5L Z;  1KKC A;  4AIL C;  5KA5 A;  3OGI B;  2ZR2 A;  4OPA A;  3HKD A;  4JI8 B;  1ROP A;  4UXN A;  3RW0 A;  4H44 B;  2P06 A;  1JVM A;  4H13 B;  3ZN1 A;  3RYC B;  5KHG A;  3ABM B;  4U3J B;  3SR2 C;  1OCO C;  2X6B A;  3DTU B;  5EBW C;  2HHH B;  4JV5 B;  1PM9 A;  2EJ7 A;  1AJN A;  1YVW A;  3CSX A;  3LDE A;  3RYC A;  1W0J G;  1OCZ C;  2DYS B;  2AHY A;  2YEV B;  3IGA C;  4U3J A;  3ZN0 A;  5IE9 A;  3CRA A;  4KXR A;  4ZBM A;  1XOU A;  2EIK C;  2XND G;  2NNU A;  2WLM A;  3RBZ A;  1NI8 A;  1KQS U;  4PDM A;  2W0F C;  3I5D A;  3ZHT A;  5LYJ B;  4J7K A;  1D2D A;  1AB3 A;  2Y69 B;  2ZE6 A;  4PI0 A;  4ICG A;  5GTI Z;  5IYC O;  1D5A A;  1NR1 A;  2CE4 A;  2D2C B;  2YID A;  2UXB B;  5LYJ A;  5FLX N;  4BW9 A;  4JI5 O;  4X66 O;  4BAY A;  2OTJ V;  1IDS A;  4AHC A;  1PNK A;  5KAI Z;  1N0J A;  3VOU A;  3M99 B;  2H3O A;  5LGT A;  2B9Z A;  2A06 H;  2VQE B;  3K9A A;  3RT3 C;  3LUT B;  4DUY O;  3FD9 A;  1JOY A;  2K9P A;  3ETQ A;  1YJN V;  2Q5Z A;  3QO8 A;  2EIL C;  4K8X A;  3CC7 V;  4MTO A;  4P30 A;  4IHJ B;  3G6E V;  2PF4 E;  4JI0 B;  5BR8 O;  4HYO A;  4X65 B;  3IFX A;  2EIJ C;  2AHZ A;  3ETD A;  5KA6 A;  4R50 A;  4X62 B;  2GUZ B;  4IHJ A;  2CK3 G;  4FIP C;  2P22 C;  3HKB B;  2BE3 A;  5JQG B;  4DK1 A;  3UQ8 A;  3LNM B;  4QNH B;  2GUZ A;  4N23 A;  2PZS A;  5H5N A;  1N34 B;  3HKB A;  1AI7 A;  1QVG U;  4K35 A;  4JAA A;  3OUS A;  1F23 A;  3DC5 A;  4D7S A;  2N05 A;  4JZ2 A;  3CPW U;  4LF5 B;  4Q6G A;  5LA6 A;  3TET A;  1IBL B;  3ZMU A;  3L71 H;  3TGU H;  2UUC O;  1N32 B;  3JAS B;  3FB6 C;  4P2Z A;  2V4D A;  2F43 G;  3T1H B;  4LC1 A;  4PV1 B;  2V7Q G;  2LQT A;  2ZM6 O;  1AP6 A;  3RYF B;  3KCY A;  1W2B U;  3JAS A;  2ZDI A;  2FML A;  4FM2 A;  2QE7 G;  1SQP H;  1K5S A;  4FMT A;  4ZI7 B;  4NTX A;  3THO A;  5LOV B;  1WP7 A;  2HFE C;  1K4C C;  3STZ C;  1K34 A;  4ZI7 A;  5LOV A;  4OPH A;  4DV2 B;  5ITZ B;  3RVY A;  2ZNI A;  2C2A A;  1G4Y B;  2PUS A;  4JZG A;  1IXM A;  1HW7 A;  1G6U A;  2XAG A;  1OCR B;  1EN4 A;  1H2K A;  1K92 A;  5ITZ A;  2PYJ A;  5KHI A;  3PN1 A;  3O9O A;  5LL6 Y;  4FLV A;  1L0L H;  1U97 A;  2E76 B;  4J42 A;  4DR1 B;  4CH6 A;  1BT8 A;  3JD0 A;  4ZHQ B;  2PGG A;  3CCV V;  3W7U A;  4LR3 A;  3B4S A;  2CTP A;  4X1K B;  1MSD A;  5F2V O;  1YZB A;  2NLJ C;  3A0H Z;  4HAM A;  3T4D A;  4ZHQ A;  2Q68 A;  1M90 W;  4X1K A;  4FFB B;  1J5E B;  4LH6 A;  1K5Q A;  2JRI A;  4XDL A;  4CC5 A;  1VF6 A;  3IAY A;  4LF9 O;  2DMX A;  4NXM O;  4FFB A;  4O4I B;  3NXS A;  4UUJ C;  5JCO A;  1B04 A;  4LF8 O;  3W7T A;  4I50 A;  4QGP A;  1Y6X A;  3T1Y O;  3H01 A;  4ABM A;  4JI4 O;  3X2Q B;  3D3I A;  4O4I A;  5FPR A;  2EIN B;  4DV5 O;  4MTX A;  3LNN A;  2X6C A;  3EFF K;  2Y48 A;  4DV0 B;  4GX2 A;  4DR5 B;  3ZMS A;  2BTQ B;  1TGO A;  2Y0I A;  2DYR B;  3SYQ A;  1VQ6 V;  4IIJ B;  3AK2 A;  2QWO B;  2E74 B;  3LDD A;  3K3W A;  3SYA A;  2D3O W;  1Q8I A;  4D6T H;  2CTW A;  4JF3 A;  4Z1M G;  2BTQ A;  1K7D A;  1B6Q A;  2RCV A;  4DR2 B;  2F95 B;  1GMG A;  4JTA B;  4IIJ A;  1IVS A;  1VQL V;  4CH4 A;  2VWK A;  2HHH O;  4JV5 O;  2KG7 B;  3CS5 A;  4IT5 A;  1SC5 B;  4J9Y B;  5EC1 C;  1KD1 W;  3K0D A;  4QPJ A;  2OIE A;  3AG2 C;  2OTL V;  3CEI A;  4YIP A;  3JAT B;  1VF5 B;  1CEZ A;  2HKO A;  3BY6 A;  1WN7 A;  1PV0 A;  1VEW A;  1JX9 A;  3F5T A;  2EBO A;  3JAT A;  4JI7 B;  5B1A C;  2CUG A;  1EZV H;  4PDR A;  4CC6 A;  3JAK B;  1AR4 A;  4PA4 A;  3SYP A;  3ZMT A;  1J95 A;  1KYO F;  3AG1 B;  4GKJ B;  1K4D C;  4J80 A;  4CS4 A;  5L3G A;  2IJI A;  4BR6 A;  2UXB O;  1V9P A;  4EEQ A;  4DV1 B;  3SPJ A;  3JAK A;  2VS0 A;  1YCI A;  3RYI B;  1BCC H;  5L3F A;  1ZX3 A;  4UVA A;  4DK0 A;  5LHG A;  4J11 A;  2VQE O;  5LHI A;  1G1X B;  1EFR G;  1IBK B;  1OZ0 A;  1AIL A;  3RYI A;  3H1H H;  4WFE A;  3GWO A;  5LBQ A;  3B8N A;  2L6L A;  2QR4 A;  1H8E G;  2UU9 O;  1RPR A;  4J41 A;  2MK3 A;  4JI0 O;  4X64 B;  4X65 O;  1MAB G;  4UCT A;  3ABK C;  3OEH G;  4X62 O;  3BCC H;  4MVO A;  1P7G A;  4UFZ A;  1Y67 A;  4PJ0 Z;  5LMN B;  4PEL A;  1N34 O;  4TV9 B;  4UCV A;  2HJF C;  4YJ3 B;  4P9O A;  4DV4 B;  1R6K A;  4DYL A;  5B3S B;  1IBL O;  1KU9 A;  4QJF B;  5J2T A;  4TV9 A;  2VRZ A;  3RN4 A;  1TA8 A;  1P84 F;  5GW7 A;  2FTK A;  2UUA O;  4C7U A;  1NVP D;  1W59 A;  3SJQ C;  5IT9 N;  4XDJ A;  4U3F H;  3UT5 B;  1N32 O;  4GKK B;  1AR5 A;  1E1R G;  3CMA V;  1CXZ B;  3T1H O;  1OCC C;  3QTC A;  1RSO B;  5JVD B;  1S0V A;  4NKG B;  3CD6 V;  1RFY A;  1SQB H;  1GK9 A;  1P7B A;  1MA1 A;  4JI3 B;  2OCC B;  1RSO A;  1OV9 A;  5JVD A;  1VQ5 V;  5LMU B;  3ASN C;  2VQF B;  5E79 Z;  4W4K A;  4ZKI A;  2YUA A;  5CB4 B;  3T1C A;  2B1I A;  2BSK B;  3ZJZ A;  5BZB A;  2JGU A;  4PDL A;  3ABL B;  2IH1 C;  3QNE A;  3ETG A;  3AG4 C;  1XUQ A;  3J7A U;  3J81 N;  3WU2 Z;  4DV3 B;  1SA0 A;  1Q6U A;  1Y76 B;  1GN4 A;  4J7J A;  2BSK A;  5B1B B;  3OD4 A;  3FFQ A;  3SPH A;  1ZAU A;  3FB8 C;  4DR1 O;  2DWE C;  3CP1 A;  1F7Y A;  3G71 V;  1Y76 A;  3E83 A;  5FNV B;  1AVM A;  1BS3 A;  3WB0 A;  1HP8 A;  3OEE G;  2QJ1 A;  2QM8 A;  3J80 N;  1XNR B;  1RM1 C;  2V1D A;  2PI4 A;  2WPD G;  4UCU A;  4WFA V;  4FM0 A;  1WB8 A;  3CCS V;  3DXR A;  5BMV A;  5DEC A;  1JR9 A;  4WBN A;  2PY5 A;  3AK1 A;  3FKS G;  4WCE V;  1H2L A;  4GX0 A;  4EB6 B;  1NKD A;  5IYZ A;  2N74 A;  3E86 A;  3CRQ A;  5CN0 A;  3QO7 A;  1GM7 A;  3CC4 V;  1K73 W;  1JA8 A;  5HFM A;  2ZT9 B;  2UXC B;  2WLN A;  5A9G A;  1Q6H A;  2LJ2 A;  3E89 A;  4KL1 A;  4EB6 A;  1XI1 A;  2Q4P A;  1HNZ B;  2ZIM A;  3OT7 A;  3HR0 A;  2LP7 A;  2LGW A;  2H8P C;  3ZHQ A;  1NZ6 A;  2JS5 A;  1H38 A;  1BQZ A;  1SQQ H;  2EIM B;  3JAR A;  3L70 H;  4FLT A;  1HR0 B;  3BA8 A;  3LSU A;  4DR5 O;  4EFB A;  1WNS A;  4B3R B;  4QE7 A;  2RN9 A;  2HEP A;  2UUB B;  1T5E A;  1F4M A;  4MSW C;  4QIW F;  4FLX A;  5KMG B;  2QWQ B;  3ABT A;  1GH6 A;  1P49 A;  1YSC A;  1RPO A;  1DK1 A;  2JJ2 G;  3N27 A;  4IYH A;  4O4H B;  3AG3 B;  4MVR A;  5KMG A;  1PNL A;  1O9G A;  2E75 B;  1VQO V;  2DN9 A;  1EN6 A;  3VQW A;  1KEC A;  4GT1 A;  4O4H A;  2H94 A;  5KAF Z;  2JVD A;  3OTO B;  2XAJ A;  4JI7 O;  2CTQ A;  5CBH A;  2P6J A;  3QVN A;  5IJ0 B;  2QWR B;  1ZL8 B;  1FPO A;  4DR7 O;  1Q82 W;  4NXN B;  2B5U A;  2FKX A;  2JEX A;  3L73 H;  2YEV A;  2Q7E A;  1I5Y A;  3D36 A;  1NT2 B;  5LP6 B;  4GKJ O;  1QLE C;  1HNX O;  2E5L B;  4DV1 O;  5IJ0 A;  1YJW V;  4BIO A;  4DR3 B;  1FXH A;  5EBM C;  1BL8 A;  4X89 A;  5LP6 A;  4JI6 O;  4B3T B;  4L87 A;  3FAV B;  3B77 A;  1F4N A;  4Q20 A;  2KSD A;  4PHZ A;  3PJS K;  5GTH Z;  4CZZ A;  1VAR A;  1S76 D;  1M57 C;  3GWK C;  1IBK O;  1F51 A;  2DQ3 A;  2AZ2 A;  1VQP V;  1M56 C;  1V55 B;  5C93 A;  4MTF A;  4BIU A;  1XMQ B;  2P5O A;  4LWS B;  1M9N A;  2UXX A;  3JCU Z;  4UV8 A;  4K0K O;  4DV6 B;  4LH7 A;  4E2L A;  2FB5 A;  5J2U B;  2A0L A;  3SGI A;  3UO2 A;  4TSF G;  1FXK C;  3OFN G;  4LWS A;  1AP5 A;  1DGS A;  5J9P C;  1SQV H;  1VQ9 V;  3EXA A;  4B3S B;  2YSU B;  3B8M A;  5J2U A;  4LFB B;  3ASO B;  1FAF A;  3I56 V;  2L35 A;  3JD4 A;  2GSM B;  4JYB A;  2FYU H;  3ZHS A;  4DV4 O;  2QTS A;  3ICX A;  5EZY B;  2QSA A;  4DW0 A;  2WLH A;  2XUM A;  3AG2 B;  5L3C A;  2ZXW C;  4FZ1 A;  5LGU A;  3K79 A;  2ZCE A;  2GBO A;  1IBM O;  4L8J A;  5JQG A;  1GAX A;  4CBC A;  4DRX B;  4JYA O;  1X59 A;  2CTR A;  3VBB A;  5IWA O;  1Y66 A;  1FJG O;  1Z5W A;  5E1A C;  3E8H A;  4GKK O;  4DRX A;  4LFC B;  2ZE8 A;  4P9P A;  3E8G A;  4AQY B;  1AR1 B;  1S5J A;  3CHX A;  2Q7H A;  1R3J C;  3DGE A;  2Y0P A;  1B06 A;  1N36 O;  1JJ2 U;  2Q8V A;  5LMU O;  4FVM A;  4IGG A;  3JD2 A;  2DJV A;  1XNQ O;  2UXD B;  5C8Y B;  2YXY A;  3OMA B;  3SDL A;  1GM8 A;  3ETE A;  1R6N A;  3U10 A;  5L3E A;  4XDK A;  4UB6 Z;  2YIA A;  4NVP A;  3RYF A;  1Z5V A;  2DQ0 A;  3WFV A;  3QG5 A;  2HVK C;  2QA4 V;  4KHP B;  4LF7 B;  3K03 A;  1UJW B;  5IYB O;  4HNA B;  4I7Z B;  1N8R W;  1YTF B;  3L75 H;  1FYJ A;  1ZUQ A;  1XDC A;  2F4V B;  2YDE A;  2VWJ A;  3K5N A;  4J7Z A;  3CCE V;  4X9Q A;  4D7T A;  2YC0 A;  1ZLZ A;  4UB8 Z;  3SYO A;  1QR8 A;  3HKC B;  2EJR A;  3CE2 A;  1XNR O;  3LDC A;  2HJD A;  3K5L A;  2PI5 A;  3MHH C;  1KC8 W;  2AW9 A;  4PDV A;  3K57 A;  3ZED A;  2QEX V;  4NTY A;  2GDS A;  3HKC A;  3BAB A;  4JI2 B;  1YJ9 V;  3H9V A;  1SER A;  4I4T B;  1VP7 A;  3R66 A;  2X7R B;  1DF4 A;  2EUL A;  1BHB A;  4WF9 V;  4MTG A;  1KP3 A;  1IUR A;  5GON B;  2UXC O;  3RFR A;  2W0X A;  1S3J A;  4I4T A;  3ABM C;  4U7N A;  5LHH A;  1I94 B;  3K9S A;  5GON A;  2Q73 A;  4DXW A;  1AI6 A;  1S72 V;  1U96 A;  3MD0 A;  2DYS C;  3ZHU A; 
#chains in the Genus database with same CATH homology
 4KFM A;  3CCJ V;  4I9W A;  4N21 A;  2Q67 A;  4PEL A;  5CBF A;  1BHA A;  3ABL C;  2JIZ G;  4MS2 A;  2HJF C;  3OR7 C;  1QBZ A;  3LSQ A;  4P9O A;  2B1G A;  1K3E A;  5B1A B;  3CCR V;  4PA3 A;  4X88 A;  3ZCC A;  2EZP A;  5B1B C;  1EBO A;  1R6K A;  5B3S B;  3OGC C;  4GX5 A;  4H33 A;  4RAI A;  3WG7 C;  4QJF B;  2Y69 C;  1OHH G;  2JK5 C;  1WLE A;  2ITD C;  1NVP B;  3ZMV A;  5GW7 A;  4J9Z B;  1W0K G;  2FTK A;  4XBF A;  1NVP D;  1PKX A;  2M7W A;  3ZIA G;  2WSS G;  3JD1 A;  3SJQ C;  2IJH A;  5IYD O;  4XDJ A;  3F5W C;  1JPX A;  2IH3 C;  1E79 G;  4MVM A;  4LBE C;  3F7Y C;  3SPI A;  1E1Q G;  4FK5 C;  1E1R G;  1NBM G;  4UVB A;  3CMA V;  5KA5 A;  1OCC C;  2ZR2 A;  1S0V A;  4WFG A;  1RM1 B;  3OUF A;  1ROP A;  3CD6 V;  1XL4 A;  1VQM V;  4UXN A;  3RW0 A;  4MVS A;  1JVM A;  3ZN1 A;  1GK9 A;  1P7B A;  5IDJ A;  2OCC B;  3UM7 A;  3ABM B;  2R9I A;  3JYC A;  3ZRV A;  1VQ5 V;  1OCO C;  3ABK B;  3ASN C;  2X6B A;  3DTU B;  5EBW C;  5IY5 B;  3CXC U;  1LNQ A;  2WLL B;  1AJN A;  3LDE A;  1W0J G;  1OCZ C;  2DYS B;  2AHY A;  4I5S A;  3CCM V;  4JAS A;  4ZKI A;  2YEV B;  3A0R A;  3IGA C;  3ZN0 A;  1GKF A;  1CP9 A;  2WAM A;  3T1C A;  1YTF D;  3CCU V;  2B1I A;  4ZBM A;  3ZJZ A;  2A9H A;  2EIK C;  2XND G;  3P32 A;  5BZB A;  2EIM C;  2NNU A;  2WLL A;  2WLM A;  2Z5U A;  4PDL A;  3ABL B;  3RBZ A;  2IH1 C;  3QNE A;  1HWY A;  3ETG A;  3AG4 C;  4PA7 A;  1SET A;  1KQS U;  1NR7 A;  4PDM A;  4G27 B;  2W0F C;  2EZO A;  5B1B B;  4MVZ A;  2WLI B;  3WG7 B;  2Y69 B;  3K04 A;  3SPH A;  2DWD C;  3FB8 C;  5IYC O;  2LFS A;  2DWE C;  1NR1 A;  3CP1 A;  3G71 V;  3E83 A;  2WLJ A;  1VQK V;  3OEE G;  2WLI A;  1PL0 A;  2QM8 A;  1GTO A;  1V54 B;  2XOK G;  4MT8 A;  1SZT A;  4BAY A;  2WWW A;  1RM1 C;  1S5H C;  2V1D A;  2PI4 A;  2JDI G;  1NJI W;  2OTJ V;  2WPD G;  3AG3 C;  4WFA V;  1PNK A;  1DF5 A;  3VOU A;  2ZDI C;  3M99 B;  3CCS V;  5LGT A;  1K8A W;  4F4L A;  3K9A A;  3CCQ V;  3LUT B;  4WFF A;  1JOY A;  3FKS G;  4WCE V;  1OCC B;  1YJN V;  4GX0 A;  2ZD9 A;  3HPL C;  1NKD A;  2R9R B;  3QO8 A;  3E86 A;  2QKS A;  5CN0 A;  2EIL C;  3QO7 A;  1GM7 A;  3ZMZ A;  2W6J G;  3CC7 V;  4KP4 A;  1Q81 W;  3CC4 V;  1K73 W;  4MTO A;  5HFM A;  2X6A A;  3K08 A;  4P30 A;  1Y4M A;  5EK0 A;  3G6E V;  2WLN A;  4MW8 A;  3QO5 A;  3E89 A;  2Q6A A;  4HYO A;  1OCO B;  2ATK C;  3IFX A;  3ASN B;  2EIJ C;  2AHZ A;  1YHQ V;  3ETD A;  5KA6 A;  1MG1 A;  4R50 A;  2IW5 A;  3RVZ A;  5CA3 A;  1OCZ B;  2XAF A;  2CK3 G;  4FIP C;  4RQE A;  1YIJ V;  1GM9 A;  2LP7 A;  2H8P C;  1DTO A;  1FFT B;  1THZ A;  1H38 A;  1M1K W;  2EIK B;  1R73 A;  2EIM B;  5L3B A;  3LNM B;  5B1O A;  4QNH B;  4N23 A;  3AEI A;  1OCR C;  3AG4 B;  1AI7 A;  1AI5 A;  3SYC A;  1QVG U;  1K97 A;  2IJK A;  1V54 C;  1F23 A;  3OUS A;  4QE7 A;  2ZQM A;  3CPW U;  1YIT V;  3TET A;  4YXW G;  4MVQ A;  1F4M A;  1JCH A;  1V55 C;  3E8B A;  4JTC B;  4MSW C;  4QIW F;  4GCZ A;  2XAQ A;  1GO3 F;  3UKM A;  5EBL C;  2W6I G;  3ABT A;  3ZMU A;  2UXN A;  1NH2 B;  5KUK A;  1YSC A;  1ARO P;  1RPO A;  4RQF A;  1M57 B;  4EKW A;  4RUF A;  5FL7 G;  2JJ2 G;  2JJ1 G;  4JAV A;  3KG2 A;  1NQT A;  1ZWI C;  3AG3 B;  4MVR A;  4PA9 A;  5LGN A;  1K33 A;  3TK1 A;  1L1F A;  3FB6 C;  1PNL A;  3CME V;  4P2Z A;  4G28 B;  1VQO V;  2F43 G;  1KEC A;  1TUE B;  3R65 A;  4LC1 A;  2V7Q G;  4GT1 A;  3ASO C;  1BMF G;  3BEH A;  1AI4 A;  2EIL B;  2P67 A;  2ZDI A;  3OM3 B;  4R8C A;  1W2B U;  2BOB C;  1H2G A;  5CBG A;  2H94 A;  3EHB B;  2XAJ A;  2QE7 G;  3E8F A;  1PD3 A;  1K5S A;  2P6J A;  5CBH A;  4JAU A;  1ORQ C;  4FMT A;  3TCU A;  3ZRX A;  1Q82 W;  2B5U A;  2EIJ B;  2JEX A;  2HFE C;  1K4C C;  2YEV A;  1I5Y A;  3D36 A;  1R3K C;  1QLE C;  3STZ C;  4LP8 A;  1K34 A;  4MVU A;  2HG5 C;  1R3L C;  3X2Q C;  3ML0 A;  3CC2 V;  1YJW V;  1AJQ A;  1FXH A;  1S77 D;  2EIN C;  3RVY A;  5EBM C;  1BL8 A;  2HR3 A;  4X89 A;  2C2A A;  1G4Y B;  4L87 A;  3W7X A;  3B77 A;  1IXM A;  1F4N A;  4Q20 A;  2XAG A;  1OCR B;  3FYI B;  3PJS K;  2KB1 A;  4CZZ A;  1S76 D;  1M57 C;  2DYR C;  1COW G;  1K92 A;  1VQ4 V;  3OMN B;  3FB7 C;  2JEU A;  5DM6 V;  1F51 A;  1PNM A;  2DQ3 A;  3CYO A;  3F7V C;  1VQP V;  1M56 C;  1ENV A;  2P90 A;  5L3D A;  1V55 B;  5C93 A;  4MTF A;  4MW3 A;  4BIU A;  3JD0 A;  1KKD A;  1M9N A;  2UXX A;  4UV8 A;  2HVJ C;  3CCV V;  4E2L A;  3W7U A;  3P30 A;  4OXS A;  1YI2 V;  4BW5 A;  1QLN A;  2ITC C;  2A0L A;  2X0L A;  2NLJ C;  4TSF G;  4HAM A;  1FXK C;  3OFN G;  4ASU G;  1MSW D;  3T4D A;  5J9P C;  1VQ9 V;  1SES A;  2YSU B;  1WPX A;  2Q68 A;  3B8M A;  1KP2 A;  4DO2 A;  3ASO B;  1G8M A;  3I56 V;  1M90 W;  1VQN V;  4X8A A;  1K5Q A;  4XDL A;  3JD4 A;  2GSM B;  3OAA G;  4JYB A;  3OR6 C;  4QE9 A;  1K9M W;  2IU3 A;  3I55 V;  2A79 B;  3W7S A;  2WLH A;  5CMU A;  3AG2 B;  5L3C A;  2ZXW C;  4UUJ C;  3NXS A;  4PA6 A;  4BIZ A;  5LGU A;  4GX1 A;  3K79 A;  3OMI B;  1R3I C;  3JCZ A;  3AG1 C;  3W7W A;  3W7T A;  1QLE B;  2IU0 A;  3H01 A;  3IC7 A;  4U7O A;  3X2Q B;  4CBC A;  3D3I A;  3MHS C;  2EIN B;  3VBB A;  4MTX A;  1Y66 A;  5DN6 G;  2X6C A;  3EFF K;  5E1A C;  2Y48 A;  3E8H A;  3GB7 C;  4JTD B;  4KUM A;  4TT3 G;  4GX2 A;  1VQ8 V;  4HZ3 A;  2GHY A;  4UVC A;  3ZMS A;  4FJC C;  5KUM A;  1I5X A;  2DYR B;  4P9P A;  3E8G A;  1NH2 D;  3STL C;  3SYQ A;  4FPP A;  1VQ6 V;  5HFL A;  1AR1 B;  3E2E A;  3FB5 C;  4R6Z A;  3LDD A;  3OE7 G;  1DLB A;  3K3W A;  3SYA A;  2D3O W;  3ZRW B;  1M56 B;  4JGS A;  2P7T C;  4JF3 A;  1R3J C;  4Z1M G;  3DGE A;  1K7D A;  1B6Q A;  3CCL V;  1GMG A;  1JJ2 U;  3K06 A;  4JTA B;  5H6R A;  1VQL V;  3E35 A;  3JD2 A;  4G2K A;  4R7C A;  3SPG A;  3HB3 B;  3ZRW A;  4UV9 A;  2QM7 A;  2QTO A;  3OMA B;  1GM8 A;  3ETE A;  4J9Y B;  5EC1 C;  1KD1 W;  1R6N A;  3K0D A;  1MOF A;  1FXK B;  4QPJ A;  5L3E A;  4XDK A;  1FXV A;  1H8H G;  2HLD G;  4LCU C;  5EC2 C;  1Q86 W;  3AG2 C;  2OTL V;  2DQ0 A;  3WFV A;  1Q7Y W;  2OT5 A;  3ABU A;  1JQ0 A;  2HVK C;  2QA4 V;  1CEZ A;  2HKO A;  3BY6 A;  3K03 A;  1UJW B;  5IYB O;  3G4S V;  2K1E A;  1FXK A;  3T2M A;  1JX9 A;  1N8R W;  3JD3 A;  2EBO A;  1FS0 G;  2BOC C;  1EZJ A;  1YTF B;  5B1A C;  1XL6 A;  4PDR A;  4QPK A;  4H37 A;  4RO2 A;  5B3S C;  3SYP A;  4PA4 A;  1P4R A;  2ZXW B;  5H9C A;  3ZMT A;  3CCE V;  1J95 A;  3AG1 B;  5H6Q A;  4JYC A;  1K4D C;  2Z3Y A;  5L3G A;  2XAH A;  2IJI A;  1CPY A;  3SPJ A;  3SPC A;  3T4Z A;  2ZR3 A;  3SYO A;  1QR8 A;  2EJR A;  3LDC A;  2DW4 A;  2PI5 A;  3MHH C;  1KC8 W;  4PDV A;  5L3F A;  4UVA A;  4WFB V;  2QEX V;  5LHG A;  1AJP A;  4TWK A;  2LFR A;  5LHI A;  1YJ9 V;  1VQ7 V;  1SER A;  1EFR G;  2X7R B;  1OZ0 A;  3LSS A;  1DF4 A;  2WLK A;  1BHB A;  4WFE A;  4WFH A;  4MTG A;  3GWO A;  4WF9 V;  5LBQ A;  1KP3 A;  5B1N A;  3FYE B;  3B8N A;  1H8E G;  1QR9 A;  1RPR A;  1S3J A;  2OCC C;  4JPR A;  3ABM C;  4RUE A;  2MK3 A;  4U7N A;  5LHH A;  1MAB G;  3K0G A;  3ABK C;  3OEH G;  3ZRS A;  1QCE A;  2IJJ A;  2XAS A;  5IY5 C;  4DXW A;  1AI6 A;  1S72 V;  3OW2 U;  1SRY A;  3MD0 A;  1QVF U;  4MVO A;  2DYS C;  2Q69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...