4G27B

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and phenylurea
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
b'GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
publication title Identification of the functional binding pocket for compounds targeting small-conductance Ca(2+)-activated potassium channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport/calcium binding protein
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g27B00
4XDKA 4QE9A 3SPHA 4KFMA 3E89A 4WFGA 2X6BA 3ABLC 2YEVA 4H33A 1OCZC 1OCRC 3OUSA 3E83A 1V55C 3E86A 4CBCA 1BL8A 1XL4A 4PDRA 3FB7C 2A0LA 4RUFA 2AHZA 3ABMC 3HPLC 2ATKC 3ASNC 4MVOA 2DWDC 3AG1C 2EIJC 3OR6C 2A79B 4I9WA 2HVJC 4R7CA 3UM7A 3RBZA 3F5WC 4HYOA 2WLIA 4X8AA 4DXWA 2X6AA 4MS2A 5IY5C 1P7BA 4TWKA 3T1CA 4R50A 5EBWC 3TETA 3LNMB 2WLJA 5B1BC 2EILC 2EIKC 4JTAB 4MTFA 4UUJC 1M57C 1JVMA 2JK5C 2WLMA 2ZD9A 2ZXWC 3F7VC 3K0GA 2HFEC 4GX5A 3SJQC 3K06A 3FB6C 4PA9A 2WLHA 3T4DA 4PDMA 4WFEA 3IGAC 3ZRSA 4XDJA 1XL6A 5EBMC 4ZBMA 4RO2A 2EIMC 3LDDA 1J95A 4MVRA 5EBLC 3AG2C 4PDVA 3T2MA 2ITCC 2BOBC 3OGCC 4WFFA 3FB8C 4MVSA 4R6ZA 3ASOC 3K0DA 3SYPA 3RVZA 5BZBA 1OCOC 1ZWIC 2EINC 3KG2A 3RW0A 4MVMA 1S5HC 3IFXA 5KUMA 5J9PC 3BEHA 1R3IC 4XDLA 4MTGA 1ORQC 4PA7A 2HG5C 3LDCA 4F4LA 1V54C 4QE7A 4LCUC 4RUEA 3SPIA 3SYQA 4P9PA 5CBFA 3FB5C 1M56C 2QTOA 5E1AC 4P9OA 5B1AC 3TCUA 4QNHB 3LDEA 2NLJC 4MVZA 2H8PC 4PDLA 2WLLB 2QKSA 3ZJZA 2IH3C 2Q69A 2HVKC 5KUKA 1K4CC 3E8FA 2KB1A 3PJSK 3X2QC 4PA3A 1OCCC 4OXSA 3AG4C 3LUTB 3OR7C 1R3JC 4X88A 5CBGA 5EC2C 4JTCB 3JYCA 4P30A 4X89A 1R3KC 2Y69C 4J9ZB 1K4DC 4PA6A 2DYSC 5EC1C 1R3LC 4MVUA 3UKMA 3F7YC 3SPGA 3SYCA 2IH1C 4RAIA 3STLC 2AHYA 4G27B 3SPJA 3VOUA 4BW5A 3SPCA 4GX2A 3AG3C 2X6CA 2A9HA 3E8HA 5EK0A 2HJFC 3K04A 2DWEC 4MW3A 3K03A 2R9RB 3SYOA 3GB7C 4GX0A 2Q67A 4EKWA 2WLIB 4MSWC 3SYAA 4G28B 4MVQA 3RVYA 3E8BA 3EFFK 3E8GA 2OCCC 3K08A 4HZ3A 4JTDB 4WFHA 1KKDA 4MTOA 3OUFA 5B3SC 2WLNA 4J9YB 2BOCC 3ABKC 2WLKA 2WLLA 1LNQA 2K1EA 4GX1A 3T4ZA 4R8CA 4P2ZA 2Q68A 2P7TC 2W0FC 3R65A 2Q6AA 1QLEC 4LBEC 2ITDC 4LP8A 4H37A 1G4YB 2DYRC 4MW8A 3STZC 3WG7C 5CBHA 4PA4A
chains in the Genus database with same CATH superfamily
2QJ1A 3APQA 3ZRWB 3U0ZA 3B40A 1YCIA 1VQOV 3CC2V 2CTRA 3JAWB 4DR2B 1XNQB 4JI5B 1EN5A 2ATKC 3C3SA 5IDJA 4YJ2A 1NS1A 1GMGA 3HKEB 3WB0A 1XUQA 1N36O 2IM9A 2EIKC 4MTFA 4DK1A 3CE2A 3W7WA 1M1KW 3K58A 1OCRB 1J5EO 4K35A 4WF9V 4RQFA 1IBMO 2QKCA 2XAJA 4ZBMA 5H6RA 5JWPA 4I9QA 2OCCB 5C8YA 4I50A 5IJ0A 1KD1W 1AROP 1KUQA 4JYAO 4WFBV 4NXMB 2F23A 3QVNA 3ZS8C 3ML0A 3QTCA 2VQEB 5BR8B 4GKJO 3LDEA 1N34O 1SQPH 3DC5A 1P84F 2IH3C 1NTKH 3X2QC 5JQGA 1OCCC 1BHAA 1QNMA 2MK3A 4FLZA 4X89A 1XDCA 4NYKA 4BW5A 4AQYO 2ZXWB 3K04A 3RYFA 3SYOA 2R9RB 1HNZO 5LMNO 4JTDB 4O2AA 3IAYA 5L3GA 1Y76A 4WBNA 4J9YB 4DR5B 1FJGB 1NH2B 5LYJB 3T1HO 1JPXA 2ZE6A 5EZYA 5FNVB 2OYQA 1Q43A 5KAFZ 2XAFA 2X6BA 4X9QA 2BTOA 2GTAA 3ZMZA 2N74A 4EEQA 4DR1B 3E22B 3ZHRA 4ZHQA 3RWRD 1GM7A 1FXKB 1TGOA 2JEXA 1MG1A 1FPOA 2HVJC 3FKSG 1N0NA 1DGSA 4PELA 5LHGA 5D5QA 4JAUA 4YHHB 4PI0A 4TSFG 2OTLV 2UUAO 1KU9A 4GLXA 3FB6C 1BQ0A 3BCCH 3N2GA 4JYYA 4HNAB 4ASUG 1Q90D 1LUVA 4N21A 1AJPA 4B3MB 5BZBA 1THZA 2EINC 3RW0A 4MVMA 4JGSA 5B1BB 5KHKA 2PY5A 5JJNB 4FLXA 3OEHG 2N05A 4O4JA 2OIGA 4LCUC 1GM9A 1EN6A 1Y74A 1S5JA 5KLVH 2AZ2A 2WLLB 1NU1H 2HVKC 1KBHA 1K5QA 3AG4C 5GONB 4FZ0A 1KP3A 4JTCB 2W6IG 5EC1C 1BQZA 4FVMA 1K97A 2UXXA 3C90A 3BRCA 3DC6A 3SPJA 1A32A 5GTHZ 2LGWA 4DR3O 1SKVA 1WN7A 4JI2B 1SQGA 1E1QG 1M4UA 1KMIZ 2ZQMA 1O9GA 1PNLA 2Y4UA 1Q86W 3M8AA 2CTQA 4WFHA 1TVKB 2A7WA 5H9CA 1IBLO 2LFSA 3B8MA 3G71V 3OAAG 2K1EA 4X66B 1Z5WA 3CCEV 3JASA 2ITDC 5IYZA 2DYRC 2CTWA 4XDKA 3SPHA 1AI7A 2UXBO 3L73H 2P22C 3E83A 1V55C 5KMGA 4CBCA 1MSWD 3CJHA 3AG7A 3RYHB 1JJOA 3N2KB 4RUFA 1S5LZ 1IX9A 2A79B 1YITV 4FIPC 3I55V 4EB6B 5CB4A 2EULA 1NZ6A 1VQPV 3EHBB 3PN1A 1IVSA 1P7BA 3OD4A 1SF9A 5FPOA 4GUNA 4I55A 1JVMA 2XASA 4U3JB 2FL4A 1NH2D 1SZXA 1VARA 2Q0OC 1YHQV 5JJEB 2YIBA 4PA9A 4IT5A 4NB5A 1R6TA 1URFA 3ZHVA 2Z5UA 2ITCC 3OGCC 1H8HG 3IC7A 2HLDG 2BSKB 1JQ0A 3BEHA 1QLEB 1NJIW 2CH7B 4F4LA 1RPRA 2GBOA 3W7TA 1PM9A 3UT5A 3CCMV 1SA0A 4JI6O 2QWNB 3FD9A 3ABTA 4I5SA 2R70A 1XILA 1GKFA 1AJNA 4B7KA 4UCVA 1HR0B 3HR0A 4K0KO 1K34A 4Z2WA 2O57A 4MVUA 1KECA 3EVKA 2JGDA 3WB2A 1M57B 4UB8Z 1M56B 3FFQA 3P3PA 3SYAA 3RVYA 3RYCA 3EFFK 2XHBA 1F7YA 3B4SA 2OCCC 1KKDA 3R66A 5KHHA 2Y69B 3T4ZA 1YTFB 2P7TC 1JR9A 4UCUA 3BHPA 1XEQA 4MW8A 1MNGA 3AG3B 3ZX6A 4DV7B 3CYOA 2GUZA 2YXHA 5LHHA 5CMUA 1H2NA 4LFCO 2UXDO 3ASNC 4AHCA 2DWDC 4J41A 4X65O 4JI0O 5GW7A 4DV1B 2OTJV 2WLIA 5IWAB 1SERA 3OTFA 1GO3F 2P5OA 2WLJA 2QWRB 3W7XA 1Y67A 1G8MA 2ZXWC 1HNWO 2WPDG 1XHZA 4BIOA 4PDMA 1Q5OA 2L6LA 3IGAC 1XL6A 4YXWG 4O2BA 4JI7O 1N33O 3AG1B 4UVCA 4EFEA 5F2VO 2ZM6B 4B3TB 1U96A 3WFVA 2W0XA 4CH6A 4YY3O 1WA8B 1EZVH 1LR1A 2JGUA 1SS3A 2PUSA 1S5HC 1FAFA 3D3QA 1YJ9V 1K8AW 3CCVV 1SC5B 3TXQA 3K5MA 5KUKA 3AG2B 2DQ0A 3DXRB 4UCOA 1F4MA 5L3EA 5BMVB 4NVPA 4L8JA 2ARHA 3SPGA 3CB2A 3ZEDA 2P67A 4JAVA 5EYPB 2RN9A 4TV9A 1BZKA 4FK5C 3HKCB 2PTMA 3ZBHA 4MW3A 5IYBO 4QJFB 2EIMB 3BVOA 1K9MW 4LFBO 2RMKB 4MTOA 5D5PA 5B3SC 1ZAUA 1SQFA 1Q3EA 3JATB 2Q68A 4Z1VA 1QU7A 3K5LA 1WP8A 1IXBA 4TV8B 4QE9A 4QIWF 1XQ8A 2F93B 2NNUA 1L0NH 2P6JA 3FYIB 1OCZC 3SJAC 3HKDA 3QO7A 2PI4A 4J7JA 2EIJC 1O9HA 1PL4A 1JOYA 2ETNA 5ITZB 1XNRB 5KAIZ 1VQ6V 1HW7A 2QKAA 4JTAB 1RPOA 2D3OW 1S77D 4DR4O 2PGGA 3K79A 5LP6B 5K1XA 1YTFD 4YJ3A 4DV0O 2F4VO 2QWQB 4PDVA 2YS8A 1TUBB 4WFFA 4FFBA 2IJIA 1VF6C 3LSUA 1NTMH 1L0LH 1L8DA 4OGQB 1VF7A 3WG7B 3P3NA 4DV2O 4LF4O 4NTXA 1YVWA 3K9SA 2QTOA 4P9OA 2P90A 1FS0G 4UXNA 4KXRA 3MAQA 1QHTA 3DTUB 4JI8B 1JFFB 2LGQA 1R3KC 4DV4B 5CA1A 1AI5A 1BCCH 2LW7A 3S3WA 2NN4A 1AI4A 1H2LA 1VQ9V 4G27B 2GV9A 1AILA 1VMGA 1AR1B 1QVGU 1N32B 2DOSA 4OPAA 2DJVA 4YJ2B 4ZIBA 2R72A 4NXNO 1R1BA 2UUCO 3BA9A 4DV5B 1QLEC 4TQDA 1R6KA 4LWSA 2Z0AA 2E3CA 3CRCA 1XNQO 4JI5O 5C8YB 1BT8A 4I50B 3AK3A 2ADPA 1K7DA 5IJ0B 1P49A 3Q4HA 2V1DA 4U3FH 1WAZA 2F66C 3RFRA 2AHZA 3A0BZ 3A8TA 3CS5A 1ZL8A 3BAAA 3ICXA 4O4IA 3NXSA 1EBOA 3F5WC 1XBLA 4DXWA 5FPRA 1N0JA 3WU2Z 3LNMB 4MTXA 4KUMA 3ABUA 1M57C 3CXHF 4DRXA 4IL6Z 3OW2U 1BSMA 1KQSU 1YF2A 2JIZG 2RJZA 3A0HZ 2GTSA 2Q0AA 1IBKB 1WJZA 3ZMUA 3UO3A 3W7UA 1J95A 1Q7YW 4I0XA 4NXMO 2L35A 2ODMA 4I4TA 3SYPA 3RYFB 2VQEO 5BR8O 3BPZA 4IIJA 1SQVH 1ORQC 5JVDA 4CS3A 4O2AB 1S72V 5KX5A 3DGEA 2QE7G 1AP6A 4UB6Z 4WBNB 3K59A 2RNBA 1VEWA 4WFAV 1K4CC 2FYUH 5EZYB 3E8FA 3PJSK 4K3AA 4DR7B 4OXSA 1COWG 5KHJA 2QGNA 3E2EA 1OCOB 1RSOA 3STLC 4JPRA 2EILB 5EK0A 3ZHQA 1Y6XA 2IBZH 4IHJA 4DR5O 1FJGO 4G28B 4C7UA 3E8BA 2F1MA 2RQ6A 4O4LB 1N8RW 4D7TA 5HFLA 1Q82W 1SETA 3RGBA 4UFZA 3CMAV 5J2TA 2YEVB 4DR1O 1IDSA 3CMEV 1FFTB 3CWBH 1VQ8V 2LQTA 3N2GB 3JCUZ 4KFMA 2VQFO 3CCJV 4LF8B 1M90W 1JA8A 3ZRWA 2Y0IA 2ZE5A 4O4JB 1Y74B 4YHHO 1HP8A 4CH4A 4X62B 2CUGA 2AXTZ 3LNNA 5H2FZ 3TETA 2PYLA 1VF5B 2YIAA 3I56V 2P06A 2E74B 3K0GA 3JARA 2AGAA 3P32A 2WLHA 1Y4MA 2UXCB 4B3MO 1TAEA 1EZJA 2EIMC 3KKYA 1EM1A 3A0RA 2VQFB 2HR3A 3FB8C 4PI2A 5DECA 1AB3A 2D2CB 4MTGA 3RN4A 4PA7A 2BTQA 3LDCA 3ZHTA 3B2EE 4JASA 4A5UB 5CBFA 3H1IH 4MVZA 1GM8A 3B77A 2VWJA 3CC7V 4TOIA 4B3SO 3JASB 5IYZB 1R3JC 2GHYA 5BY1A 3QNEA 4LC1A 4JI2O 2DYSC 1XREA 5KMGB 3CHXA 4CH3A 2QSAA 3SPCA 1HWYA 4GX2A 4X1YA 3BA8A 4FLYA 2HP8A 5LP6C 4CC5A 3K03A 5CB4B 2PF4E 3H1LH 4X66O 5LA6A 4RWUA 4RQEA 1DF5A 4I55B 1XMQO 4I7ZB 3BFRA 4B3SB 4FZ1A 1TA8A 5JJJB 2VRZA 3WG7C 5CBHA 4X64B 2DMXA 4FLTA 1V54B 3CC4V 4LNUA 3ABLC 4ZKIA 4YIOA 4JF3A 1BL8A 1CP9A 4UVAA 1W2BU 2YSUB 2Z3YA 3ABMC 2H3OA 4PJ0Z 4I9WA 4R7CA 3UM7A 1NTZH 2Q7HA 2C2AA 3UT5B 5LMUB 1NT2B 4GCZA 1D5AA 1SA0B 1GTOA 4R50A 4AI8A 5FLXN 3ZMVA 3SGIA 3JAKA 4JV5B 2ZNJA 1PKXA 1XMQB 3ZHUA 4ZI7A 2YUAA 1OJHA 5CA0A 4JYBA 4MVRA 4TUYB 3OTOB 1I08A 1QQCA 1GN4A 2KG7A 1H2GA 3CSXA 4HBNA 3IFXA 3VQVA 4FM0A 1QR8A 4XDLA 5JH7A 2HG5C 3RYCB 2DW4A 4P9PA 5E1AC 2HHHB 1HR0O 1YZBA 3TXSA 2HEPA 4PDLA 4CZZA 1NI8A 3B09A 4UCRA 1D2DA 2KB1A 4BIUA 2OWOA 4E4EA 2YXLA 3L75H 1FFXA 2QEXV 3K57A 1YSCA 2H94A 2GUZB 2XTAA 1YJNV 1VQ5V 4CH5A 4IYHA 5LOVA 1Q6UA 4BW9A 1FXVA 1L1FA 3SR2C 5B1AB 1YJWV 4UCTA 1NR7A 1WNSA 2WLIB 3D8CA 4OX9B 4KHPB 1WPXA 4IGGA 3OE7G 3RYIA 3JAMN 2CGOA 5L3BA 1ZSPA 4FLWA 4DV7O 2IJKA 3ETDA 5J2UA 1TVKA 2ZIMA 1G4YB 4O2BB 2AW9A 4PD4F 1VF6A 1I94B 4H33A 1OCRC 4DV1O 1S0VA 4LF6B 4PDRA 4JI1B 4DV3B 5IWAO 3HKBB 1N4CA 2DQ3A 3FAVA 1CPYA 1MMMA 1VIBA 4GZRB 3DSQA 1GAXA 2EILC 3E35A 2JK5C 2YDEA 2ZM6O 4B3TO 4Q20A 2YIBD 3ZRSA 5EBMC 1M5IA 2EZPA 3LDDA 4U3JA 5AG2A 1F23A 1NVPB 5E79Z 4LF9B 4U7OA 4TV9B 3MHSC 3MHHC 1I5XA 1I5YA 3KG2A 3OEEG 2UUBB 2DE0X 3ZN0A 2EIKB 1JX9A 3TJTA 3FB5C 2CE4A 2ZINA 2Q4PA 2YI8A 5B66Z 1Y66A 1AI6A 1ZX3A 5L3CA 2QTSA 2ZIOA 4BR6A 2QDOA 1F4NA 3CCSV 3G80A 2WA4A 2IU0A 3OR7C 1B6QA 1GN6A 4U7NA 2Q7GA 4DUYB 1H2MA 2ZKOA 1SQXH 1T5EA 1IXMA 3L72H 5IY5B 1JJ2U 3E8HA 2YI9A 1MOFA 3O65A 3SDLA 4YIPA 4JI4B 3QG5A 5H5NA 3X2QB 5EIBD 1OCCB 1FXKC 2UU9B 4NTWA 1GRJA 4LF5O 1BMFG 2LO1A 2Y48A 1BS3A 5LXTA 4P2ZA 1UPGA 2W0FC 4YJ3B 4H37A 1K3EA 5IYCO 4CS4A 3IC9A 4LF7B 4ZOLB 4FFBB 4DUZB 1XNRO 5LGUA 3U10A 4MVOA 5DEDA 3K3WA 1R6NA 4LR3A 1PV0A 4J7ZA 2X6AA 4JZ2A 4B3RB 5B1BC 2ZT9B 5CA3A 1Z2GA 4LF5B 3K06A 4H44B 2HJDA 2KQXA 1PPJH 4X1KB 3M99B 3T2MA 3UCSC 1GN2A 1HNXB 1ENVA 3ABKB 2QM8A 3H1HH 3G6BA 5BXZA 3RVZA 1ZWIC 1PNKA 2PYJA 1V54C 2IU3A 1K92A 4RUEA 1YI2V 1UFIA 4JI8O 3OMNB 4DV4O 2MW2B 2A06H 1MSDA 4JZGA 4O4HB 2A3QA 4F6RA 3AK1A 4UCSA 4LWSB 1BGYH 5CBGA 5B5EZ 1OV9A 2ILMA 1N32O 4GKKB 4J10A 3Q4HB 3IJ4A 1GK9A 1NVPD 5IJ9B 1ZL8B 1RFYA 3CRRA 2FKXA 2IW5A 4PV1B 1V9PA 2X7RB 4QPJA 4JI3B 4DV5O 2WSSG 3AG4B 4TQFA 3T1YB 4KP4A 1VQNV 3HB3B 1SQBH 4NKGB 2BOCC 1SRYA 4DRXB 3G4SV 4GX1A 1XMOB 4LFAB 4J7KA 4LBEC 3CRAA 2YICA 3STZC 1P7GA 2ZR2A 4I0XB 1FXHA 3OMIB 3ETEA 4FM2A 4I4TB 4UV8A 4TV8A 4J11A 3OFNG 4IIJB 2G38A 2IJJA 1H2SB 2RDCA 1XI1A 1IBKO 1R73A 3FX7A 2ZDIC 3B8NA 3QF7A 2DN9A 1M9NA 5JCOC 1WLEA 2Q8VA 3J81N 3D36C 3RT3C 2JRIA 5C93A 1ZUQA 1JCHA 5LP6A 4X20A 4DR6B 5IT9N 5KUMA 1BHBA 1TUBA 1E79G 1RM1B 4DR7O 2XAHA 3SYQA 5JQGB 1K33A 2LJ2A 1M56C 2ZE7A 4XBFA 5LGTA 2H8PC 2NR5A 5J2TB 3I5DA 4X88A 2LFRA 3JYCA 2PZSA 2Y69C 1Q81W 3MDSA 4RAIA 3MD0A 3AEIA 4D7SA 2AHYA 2F43G 4DV6B 3SJCC 3AG3C 2X6CA 1Y76B 2CK3G 2B1IA 4MT8A 2EBOA 3CD6V 4HZ3A 4NR1A 4FJCC 1X59A 2XNDG 2X0LA 4ICGA 5A2QN 2E5LB 2VWKA 3JARB 3ASOB 1ZTEA 1KB9F 1MZEA 4LF8O 5H6QA 4ZHQB 3U11A 5IYDO 5FL7G 3WB1A 2ZNIA 4X62O 1CXZB 2V7QG 3AG1C 1AJQA 2BTQB 3JALA 4X8AA 4X1IA 2ZCEA 5IY5C 2B5UA 4TWKA 5EBWC 1HDJA 2UXCO 4F6EA 2ZD9A 2HFEC 1M93A 1SQQH 1NBMG 2YIDA 2FB5A 3T4DA 1N36B 2CGNA 4J80A 3ASNB 3AG2C 1AVMA 1J5EB 2Q9LA 1AR5A 5DN6G 4X1YB 1I0HA 1IBMB 3JAWA 4BIZA 1U97A 5KHIA 2JS5A 3CPWU 3SPIA 5LA6B 3CCRV 3UQ8A 3HKEA 4JYAB 2QM7A 3ZJZA 1QVFU 4D6TH 2M6YA 1VQKV 4PA3A 3H1JH 4GKJB 1N34B 4J9ZB 3QO8A 4LNUB 3VOUA 1YIJV 2B9ZA 2PI5A 3H9VA 1JMKC 1NKDA 3W7SA 2XAQA 3LSQA 3K9AA 4MVQA 2B1GA 4AQYB 1PP9H 1UJWB 3JAKB 1HNZB 4X64O 4BAYA 3ABKC 5LMNB 4ZI7B 2XT9A 2Q6AA 4O4LA 5CA0B 3CJHB 1MABG 2EJ7A 3BY6A 3T1HB 5LHIA 1SESA 2YEVA 2N04A 3CCUV 4FM1A 1XHXA 2KG7B 3OMAB 1P4RA 1WPBA 2YXYA 3CRMA 1PL0A 2A0LA 5LMUO 5B3SB 2ZE8A 5JH7B 3CXCU 1FYJA 2WA3A 3RBZA 4JV5O 3UO2A 3GVMA 4W4LA 4QPKA 1KYOF 2YC0A 1H38A 5LYJA 2QR4A 2P4KA 1LUWA 3OTOO 3NR7A 1FFXB 1OCZB 3EXAA 5FNVA 1FKAO 2UUAB 3K5NA 2EIJB 1MZFA 3FYEB 5LOVB 2BOBC 2RCVA 3OT7A 1PD3A 3E22A 3K0DA 2V4DA 4PHZA 1YXBA 3N27A 1F51A 2HHHO 5J9PC 3ZRXA 1FXKA 3JD3A 2HKOA 3CX5F 1VQ4V 2VS0A 2XAGA 3RYIB 4QNHB 3JD2A 3ZHSA 3JSNA 5J2UB 3TK1A 4FFKA 2OT5A 4K8XA 2EJRA 4CS2A 3LUTB 4WCEV 3KCXA 1B06A 5L3FA 2JGDB 3KCYA 1RP3B 1K4DC 2XUMA 1US6A 3J7AU 4L87A 3F7YC 3SYCA 4B08A 4HNAA 3GWOA 2E75B 1IZ3A 4OX9O 4KHPO 2HJFC 1KKCA 3CEIA 3KZIZ 1ZLZA 3FAVB 2Y0PA 3CCQV 1QCEA 1XOUA 5TISZ 1H2KA 4DR3B 4H13B 1DTOA 2WLLA 1I94O 1OZ0A 1S76D 1S3JA 3L70H 3ZN1A 1IBLB 3QO5A 4LF6O 2QWOB 4IYIA 5GONA 4JI1O 4DV3O 1RM1C 3OM3B 3E89A 3G6EV 3OUSA 3E86A 1VP7A 2F95B 1DF4A 4H0LB 1AP5A 2CTPA 4N23A 1Q6HA 3VQXA 2AZ0A 1PNMA 3TGUH 1FD9A 3JCZA 2UXBB 3L71H 3M7MX 4LH7A 1EFRG 4MS2A 1DLBA 4KL1A 3J80N 1B04A 5GTIZ 3SJQC 2WLMA 3F7VC 3CCLV 3THOA 4LF9O 2WWWA 3F5TA 1Q6IA 2QM4A 2UXNA 2UUBO 1IURA 1KP2A 4DW0A 1VQ7V 3ASOC 1OCOC 3RYHA 4TUYA 3N2KA 2WAMA 2CAZC 4GT1A 4EB6A 2QA4V 4DUYO 4FPPA 1GN3A 2QKSA 2Y4TA 1Q8IA 3JD1A 1WP7A 3G67A 5LXTB 2CDYA 5K1PA 4FLVA 4JI6B 4P30A 1SZTA 3LSSA 4JYCA 4PA6A 5HFMA 1TUEB 4HAMA 4JI4O 3JD0A 4W4KA 2FTKA 4K0KB 1I7FA 1VQLV 2BSKA 2UU9O 2DWEC 1AR4A 5L3DA 5A9GA 3GB7C 4GX0A 2XOKG 2CH7A 1NQTA 3K08A 2ZDIA 5JCOA 1K5SA 2WLKA 3AK2A 4LF7O 2ZR3A 3D36A 4DUZO 4LP8A 3O9OA 4DYLA 2JVDA 3HKDB 3K5OA 1E1RG 4BWAA 2OCHA 1QBZA 1XL4A 3ZMSA 1W59A 3HPLC 1H8EG 4B3RO 1W0JG 4QGPA 1G6UA 4LH6A 4HYOA 3HKBA 4LFCB 4Q6GA 2IJHA 2UXDB 1ROPA 3T1CA 5LGNA 4X65B 4JI0B 5KA5A 2JDIG 4F6RB 2LP7A 1CEZA 5KA6A 1HNXO 4WFEA 3D3IA 2QWPB 4NTYA 1HNWB 2GSMB 4CC6A 4R6ZA 2R9AA 3JD4A 4JI7B 1N33B 2BCCH 1R3IC 2JS3A 3ZRVA 4QE7A 2OIEA 4YY3B 1VQMV 4DW1A 1D5NA 3TCUA 2JJ1G 5LBQA 2Q69A 5CA1B 3VQYA 4GKKO 2KKWA 5EC2C 4FMTA 2E76B 3H01A 1R3LC 2JJ2G 3UKMA 3L74H 2IH1C 1WB7A 4JI3O 5IE9A 2A9HA 1WA8A 1KC8W 4G2KA 3T1YO 2GDSA 3ETGA 4MSWC 3ZIAG 1XMOO 4LFAO 4TT3G 1B3QA 3CP1A 3VBBA 3ETQA 2DYSB 1LNQA 2K9PA 4R8CA 2EINB 5B1NA 4UVBA 1GH6A 4LFBB 2Q5ZA 3DXRA 2ADQB 4DO2A 4PA4A 2M7WA 5BMVA 4WFGA 4X20B 1X4TA 4O4IB 5CN0A 2EX3A 5EYPA 4Z1MG 3FB7C 3HKCA 4ZOLA 3OR6C 3ZCCA 4ABMA 5KHGA 2FMLA 5EIBC 3GWKC 4UUJC 1YEWA 4K8ZA 4GX5A 3JATA 3ABLB 4UV9A 3L9DA 4XDJA 4JAAA 4RO2A 4DR4B 4DR6O 1Z5VA 3ABMB 2EZOA 5EBLC 1OHHG 1NR1A 3APOA 4MVSA 3VQWA 5JVDB 1EN4A 4X1KA 5KX5B 1QLNA 4OPHA 4DV0B 2F4VB 3BABA 1JFFA 2DYRB 3OGIB 3P30A 5ITZA 4EFBA 5B1AC 2NLJC 1V55B 2Q73A 1MA1A 1G1XB 4DV2B 4LF4B 3ZMTA 1RSOB 4GYCB 4DV6O 3SJBC 3C3TA 4AILC 4O4HA 4DK0A 4IHJB 5B1OA 1QR9A 4DR2O 2W6JG 1BE3H 1K73W 4E2LA 3JALB 2Q7EA 4B7EA 3H1KH 2Q67A 2R9IA 4EKWA 2E5LO 3JSLA 1YDXA 5LL6Y 4X1IB 3CRQA 4FLUA 2P4VA 2BE3A 3E8GA 4J42A 5IJ9A 1DK1A 3OUFA 1WB8A 2JEUA 2WLNA 2KSDA 3S3XA 3R65A 4NXNB 3A2FA 5DM6V 2UUCB 1W0KG 2LW1A
chains in the Genus database with same CATH topology
1MABG 3BY6A 4QE9A 4QIWF 3ZRWB 5LHIA 2NNUA 1SESA 2P6JA 3FYIB 2YEVA 4H33A 1OCZC 1OCRC 3CCUV 3OMAB 1S0VA 1P4RA 4PDRA 1VQOV 3CC2V 3QO7A 1PL0A 2A0LA 2ATKC 5B3SB 2PI4A 2DQ3A 3CXCU 2EIJC 5IDJA 1CPYA 3RBZA 1GMGA 1JOYA 1VQ6V 4QPKA 2EILC 2EIKC 4JTAB 1RPOA 3E35A 4MTFA 2D3OW 1H38A 1S77D 3W7WA 2JK5C 3K79A 1M1KW 1OCZB 1OCRB 4Q20A 1YTFD 3ZRSA 4WF9V 5EBMC 4RQFA 2XAJA 4ZBMA 5H6RA 2EZPA 3LDDA 2OCCB 2EIJB 1F23A 3FYEB 4PDVA 1NVPB 4WFFA 2BOBC 4U7OA 3MHSC 3MHHC 1PD3A 1KD1W 1AROP 2IJIA 3K0DA 1I5XA 1I5YA 3KG2A 1F51A 3OEEG 5J9PC 3ZRXA 4WFBV 1FXKA 3ZN0A 2EIKB 1JX9A 3JD3A 3WG7B 2HKOA 1VQ4V 2XAGA 3ML0A 3FB5C 2QTOA 4P9OA 2P90A 1FS0G 4QNHB 3LDEA 1Y66A 1AI6A 4UXNA 3JD2A 5L3CA 2IH3C 3X2QC 3TK1A 2OT5A 2EJRA 1F4NA 1OCCC 3CCSV 1BHAA 2IU0A 3LUTB 3OR7C 4WCEV 3DTUB 1B6QA 4U7NA 2MK3A 5L3FA 4X89A 1R3KC 1K4DC 1AI5A 1IXMA 4L87A 1AI4A 3F7YC 3SYCA 5IY5B 1JJ2U 1VQ9V 3GWOA 4G27B 4BW5A 3E8HA 1MOFA 2HJFC 2ZXWB 1AR1B 1QVGU 3K04A 3SYOA 2R9RB 3CCQV 1QCEA 3X2QB 4JTDB 1OCCB 1FXKC 5L3GA 4J9YB 1NH2B 1DTOA 1BMFG 2WLLA 2Y48A 1JPXA 1OZ0A 1S76D 1S3JA 4P2ZA 2W0FC 1QLEC 3ZN1A 4H37A 3QO5A 1K3EA 1R6KA 1RM1C 5IYCO 3OM3B 3E89A 2XAFA 2X6BA 3ZMZA 3G6EV 3OUSA 1K7DA 3E86A 5LGUA 2V1DA 1DF4A 4N23A 2AHZA 1PNMA 1GM7A 1FXKB 3JCZA 3K3WA 4MVOA 2JEXA 1MG1A 2HVJC 3FKSG 3NXSA 1EBOA 3F5WC 1R6NA 4PELA 1EFRG 4DXWA 2X6AA 4MS2A 5LHGA 1DLBA 4JAUA 3LNMB 4MTXA 5B1BC 4KUMA 3ABUA 1M57C 3SJQC 2WLMA 3F7VC 5CA3A 4TSFG 2OTLV 3OW2U 3CCLV 1KQSU 2JIZG 3K06A 3FB6C 2WWWA 3ZMUA 3M99B 3W7UA 1J95A 2UXNA 1Q7YW 1KP2A 4ASUG 3T2MA 1ENVA 1VQ7V 4N21A 1AJPA 3ABKB 2QM8A 3ASOC 3SYPA 3RVZA 5BZBA 1OCOC 1THZA 1ZWIC 2EINC 3RW0A 1PNKA 4MVMA 2WAMA 4JGSA 5B1BB 1ORQC 4GT1A 3OEHG 1V54C 2IU3A 1K92A 4LCUC 1GM9A 4RUEA 1S72V 3DGEA 2QE7G 2QA4V 1YI2V 3OMNB 4FPPA 2WLLB 2QKSA 2HVKC 3JD1A 4WFAV 1K4CC 3E8FA 3PJSK 1K5QA 4OXSA 3AG4C 1COWG 5CBGA 3E2EA 1KP3A 4JTCB 4P30A 1SZTA 2W6IG 3LSSA 4JYCA 4PA6A 1OCOB 1TUEB 4HAMA 5HFMA 5EC1C 1K97A 2UXXA 3STLC 3JD0A 4JPRA 1GK9A 3SPJA 2EILB 1NVPD 2FTKA 5EK0A 1E1QG 1VQLV 2DWEC 2ZQMA 5L3DA 1PNLA 3GB7C 4GX0A 2XOKG 1Q86W 2IW5A 4G28B 2X7RB 1NQTA 4QPJA 3E8BA 2WSSG 3K08A 3AG4B 2ZDIA 4WFHA 5H9CA 2LFSA 4KP4A 1VQNV 1N8RW 3HB3B 3B8MA 2BOCC 1SRYA 3G71V 1K5SA 2WLKA 5HFLA 3G4SV 3OAAG 2K1EA 1SETA 4GX1A 1Q82W 3CMAV 2ZR3A 3D36A 3CCEV 4LBEC 2YEVB 2ITDC 4LP8A 3CMEV 1FFTB 2DYRC 3STZC 1VQ8V 4XDKA 3SPHA 2ZR2A 4KFMA 1AI7A 1E1RG 1FXHA 3CCJV 1QBZA 3OMIB 3E83A 1V55C 3ETEA 1M90W 4CBCA 1XL4A 4UV8A 3ZMSA 1MSWD 4RUFA 3ZRWA 3HPLC 1H8EG 3OFNG 1W0JG 2A79B 1YITV 4FIPC 3I55V 4HYOA 2IJJA 1VQPV 3EHBB 2IJHA 1P7BA 1ROPA 3T1CA 5LGNA 3TETA 1R73A 5KA5A 2JDIG 1JVMA 2XASA 3I56V 2ZDIC 3B8NA 3K0GA 2LP7A 1NH2D 5KA6A 1CEZA 1M9NA 3P32A 1YHQV 4PA9A 2WLHA 1Y4MA 4WFEA 3D3IA 1WLEA 1EZJA 2EIMC 2Z5UA 3A0RA 5C93A 2GSMB 1JCHA 2ITCC 3OGCC 1H8HG 2HR3A 3FB8C 3IC7A 2HLDG 4R6ZA 3JD4A 5KUMA 1JQ0A 3BEHA 1QLEB 1BHBA 1R3IC 1NJIW 1E79G 4MTGA 4PA7A 3LDCA 4F4LA 3ZRVA 1RM1B 1RPRA 4QE7A 4JASA 1VQMV 3W7TA 2XAHA 3SYQA 5CBFA 1K33A 1M56C 3TCUA 2JJ1G 5LBQA 3CCMV 4XBFA 5LGTA 4MVZA 1GM8A 2H8PC 3B77A 2Q69A 3ABTA 4I5SA 3CC7V 1GKFA 1AJNA 1R3JC 2GHYA 4X88A 2LFRA 5EC2C 3JYCA 2Y69C 3QNEA 4LC1A 4FMTA 2DYSC 1K34A 3H01A 1R3LC 2JJ2G 1Q81W 4MVUA 3UKMA 1KECA 2IH1C 4RAIA 3MD0A 3AEIA 2AHYA 2F43G 3SPCA 1HWYA 4GX2A 3AG3C 1M57B 2A9HA 2X6CA 1M56B 1KC8W 4G2KA 3K03A 3ETGA 2CK3G 2B1IA 4MSWC 4MT8A 3SYAA 3RVYA 2EBOA 3ZIAG 3CD6V 3EFFK 2OCCC 4HZ3A 4TT3G 1KKDA 4FJCC 3CP1A 2XNDG 2X0LA 3VBBA 4RQEA 1DF5A 2Y69B 2DYSB 1LNQA 3ASOB 3T4ZA 4R8CA 1YTFB 2EINB 2P7TC 5B1NA 4UVBA 4MW8A 3WG7C 5CBHA 4DO2A 5H6QA 4PA4A 1V54B 3AG3B 2M7WA 5IYDO 3CC4V 5FL7G 3CYOA 4WFGA 3ABLC 4ZKIA 5CMUA 5LHHA 4JF3A 1BL8A 1CP9A 5CN0A 4UVAA 1W2BU 4Z1MG 2YSUB 3FB7C 2V7QG 2Z3YA 3ABMC 3ASNC 2DWDC 3AG1C 1AJQA 3OR6C 3ZCCA 4I9WA 5GW7A 4R7CA 3UM7A 2OTJV 2WLIA 2C2AA 4X8AA 1SERA 4GCZA 5IY5C 1GTOA 2B5UA 1GO3F 4R50A 4TWKA 5EBWC 3ZMVA 2WLJA 4UUJC 2ZD9A 3W7XA 1G8MA 2ZXWC 4GX5A 2HFEC 1PKXA 3ABLB 2WPDG 4UV9A 1NBMG 3T4DA 4PDMA 3IGAC 4XDJA 1XL6A 4YXWG 4RO2A 3ABMB 2EZOA 3ASNB 4JYBA 4MVRA 5EBLC 3AG1B 4UVCA 3AG2C 1OHHG 1NR1A 3WFVA 4MVSA 5DN6G 1QLNA 1H2GA 4BIZA 1S5HC 3IFXA 1QR8A 4XDLA 1YJ9V 1K8AW 3CPWU 2HG5C 2DYRB 3CCVV 3P30A 3SPIA 3CCRV 2DW4A 4P9PA 5E1AC 5B1AC 2NLJC 2QM7A 4PDLA 1V55B 4CZZA 3ZJZA 5KUKA 1QVFU 2KB1A 4BIUA 1VQKV 4PA3A 3ZMTA 3AG2B 2DQ0A 1F4MA 2QEXV 5L3EA 4J9ZB 1YSCA 3QO8A 2H94A 1YJNV 1VQ5V 3SPGA 2P67A 5B1OA 3VOUA 1QR9A 4JAVA 1YIJV 1FXVA 1L1FA 2W6JG 2PI5A 4FK5C 1K73W 4E2LA 1NKDA 5B1AB 1YJWV 1NR7A 4MW3A 3W7SA 2XAQA 2Q67A 2R9IA 2WLIB 4EKWA 3LSQA 5IYBO 4QJFB 3K9AA 4MVQA 2B1GA 2EIMB 1WPXA 3E8GA 1K9MW 1UJWB 4MTOA 3OUFA 5B3SC 3OE7G 2JEUA 2WLNA 4BAYA 3ABKC 5L3BA 2IJKA 3ETDA 2Q68A 3R65A 2Q6AA 5DM6V 1G4YB 1W0KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDK A;  4QE9 A;  3SPH A;  4KFM A;  3E89 A;  4WFG A;  2X6B A;  3ABL C;  2YEV A;  4H33 A;  1OCZ C;  1OCR C;  3OUS A;  3E83 A;  1V55 C;  3E86 A;  4CBC A;  1BL8 A;  1XL4 A;  4PDR A;  3FB7 C;  2A0L A;  4RUF A;  2AHZ A;  3ABM C;  3HPL C;  2ATK C;  3ASN C;  4MVO A;  2DWD C;  3AG1 C;  2EIJ C;  3OR6 C;  2A79 B;  4I9W A;  2HVJ C;  4R7C A;  3UM7 A;  3RBZ A;  3F5W C;  4HYO A;  2WLI A;  4X8A A;  4DXW A;  2X6A A;  4MS2 A;  5IY5 C;  1P7B A;  4TWK A;  3T1C A;  4R50 A;  5EBW C;  3TET A;  3LNM B;  2WLJ A;  5B1B C;  2EIL C;  2EIK C;  4JTA B;  4MTF A;  4UUJ C;  1M57 C;  1JVM A;  2JK5 C;  2WLM A;  2ZD9 A;  2ZXW C;  3F7V C;  3K0G A;  2HFE C;  4GX5 A;  3SJQ C;  3K06 A;  3FB6 C;  4PA9 A;  2WLH A;  3T4D A;  4PDM A;  4WFE A;  3IGA C;  3ZRS A;  4XDJ A;  1XL6 A;  5EBM C;  4ZBM A;  4RO2 A;  2EIM C;  3LDD A;  1J95 A;  4MVR A;  5EBL C;  3AG2 C;  4PDV A;  3T2M A;  2ITC C;  2BOB C;  3OGC C;  4WFF A;  3FB8 C;  4MVS A;  4R6Z A;  3ASO C;  3K0D A;  3SYP A;  3RVZ A;  5BZB A;  1OCO C;  1ZWI C;  2EIN C;  3KG2 A;  3RW0 A;  4MVM A;  1S5H C;  3IFX A;  5KUM A;  5J9P C;  3BEH A;  1R3I C;  4XDL A;  4MTG A;  1ORQ C;  4PA7 A;  2HG5 C;  3LDC A;  4F4L A;  1V54 C;  4QE7 A;  4LCU C;  4RUE A;  3SPI A;  3SYQ A;  4P9P A;  5CBF A;  3FB5 C;  1M56 C;  2QTO A;  5E1A C;  4P9O A;  5B1A C;  3TCU A;  4QNH B;  3LDE A;  2NLJ C;  4MVZ A;  2H8P C;  4PDL A;  2WLL B;  2QKS A;  3ZJZ A;  2IH3 C;  2Q69 A;  2HVK C;  5KUK A;  1K4C C;  3E8F A;  2KB1 A;  3PJS K;  3X2Q C;  4PA3 A;  1OCC C;  4OXS A;  3AG4 C;  3LUT B;  3OR7 C;  1R3J C;  4X88 A;  5CBG A;  5EC2 C;  4JTC B;  3JYC A;  4P30 A;  4X89 A;  1R3K C;  2Y69 C;  4J9Z B;  1K4D C;  4PA6 A;  2DYS C;  5EC1 C;  1R3L C;  4MVU A;  3UKM A;  3F7Y C;  3SPG A;  3SYC A;  2IH1 C;  4RAI A;  3STL C;  2AHY A;  4G27 B;  3SPJ A;  3VOU A;  4BW5 A;  3SPC A;  4GX2 A;  3AG3 C;  2X6C A;  2A9H A;  3E8H A;  5EK0 A;  2HJF C;  3K04 A;  2DWE C;  4MW3 A;  3K03 A;  2R9R B;  3SYO A;  3GB7 C;  4GX0 A;  2Q67 A;  4EKW A;  2WLI B;  4MSW C;  3SYA A;  4G28 B;  4MVQ A;  3RVY A;  3E8B A;  3EFF K;  3E8G A;  2OCC C;  3K08 A;  4HZ3 A;  4JTD B;  4WFH A;  1KKD A;  4MTO A;  3OUF A;  5B3S C;  2WLN A;  4J9Y B;  2BOC C;  3ABK C;  2WLK A;  2WLL A;  1LNQ A;  2K1E A;  4GX1 A;  3T4Z A;  4R8C A;  4P2Z A;  2Q68 A;  2P7T C;  2W0F C;  3R65 A;  2Q6A A;  1QLE C;  4LBE C;  2ITD C;  4LP8 A;  4H37 A;  1G4Y B;  2DYR C;  4MW8 A;  3STZ C;  3WG7 C;  5CBH A;  4PA4 A; 
#chains in the Genus database with same CATH topology
 2QJ1 A;  3APQ A;  3ZRW B;  3U0Z A;  3B40 A;  1YCI A;  1VQO V;  3CC2 V;  2CTR A;  3JAW B;  4DR2 B;  1XNQ B;  4JI5 B;  1EN5 A;  2ATK C;  3C3S A;  5IDJ A;  4YJ2 A;  1NS1 A;  1GMG A;  3HKE B;  3WB0 A;  1XUQ A;  1N36 O;  2IM9 A;  2EIK C;  4MTF A;  4DK1 A;  3CE2 A;  3W7W A;  1M1K W;  3K58 A;  1OCR B;  1J5E O;  4K35 A;  4WF9 V;  4RQF A;  1IBM O;  2QKC A;  2XAJ A;  4ZBM A;  5H6R A;  5JWP A;  4I9Q A;  2OCC B;  5C8Y A;  4I50 A;  5IJ0 A;  1KD1 W;  1ARO P;  1KUQ A;  4JYA O;  4WFB V;  4NXM B;  2F23 A;  3QVN A;  3ZS8 C;  3ML0 A;  3QTC A;  2VQE B;  5BR8 B;  4GKJ O;  3LDE A;  1N34 O;  1SQP H;  3DC5 A;  1P84 F;  2IH3 C;  1NTK H;  3X2Q C;  5JQG A;  1OCC C;  1BHA A;  1QNM A;  2MK3 A;  4FLZ A;  4X89 A;  1XDC A;  4NYK A;  4BW5 A;  4AQY O;  2ZXW B;  3K04 A;  3RYF A;  3SYO A;  2R9R B;  1HNZ O;  5LMN O;  4JTD B;  4O2A A;  3IAY A;  5L3G A;  1Y76 A;  4WBN A;  4J9Y B;  4DR5 B;  1FJG B;  1NH2 B;  5LYJ B;  3T1H O;  1JPX A;  2ZE6 A;  5EZY A;  5FNV B;  2OYQ A;  1Q43 A;  5KAF Z;  2XAF A;  2X6B A;  4X9Q A;  2BTO A;  2GTA A;  3ZMZ A;  2N74 A;  4EEQ A;  4DR1 B;  3E22 B;  3ZHR A;  4ZHQ A;  3RWR D;  1GM7 A;  1FXK B;  1TGO A;  2JEX A;  1MG1 A;  1FPO A;  2HVJ C;  3FKS G;  1N0N A;  1DGS A;  4PEL A;  5LHG A;  5D5Q A;  4JAU A;  4YHH B;  4PI0 A;  4TSF G;  2OTL V;  2UUA O;  1KU9 A;  4GLX A;  3FB6 C;  1BQ0 A;  3BCC H;  3N2G A;  4JYY A;  4HNA B;  4ASU G;  1Q90 D;  1LUV A;  4N21 A;  1AJP A;  4B3M B;  5BZB A;  1THZ A;  2EIN C;  3RW0 A;  4MVM A;  4JGS A;  5B1B B;  5KHK A;  2PY5 A;  5JJN B;  4FLX A;  3OEH G;  2N05 A;  4O4J A;  2OIG A;  4LCU C;  1GM9 A;  1EN6 A;  1Y74 A;  1S5J A;  5KLV H;  2AZ2 A;  2WLL B;  1NU1 H;  2HVK C;  1KBH A;  1K5Q A;  3AG4 C;  5GON B;  4FZ0 A;  1KP3 A;  4JTC B;  2W6I G;  5EC1 C;  1BQZ A;  4FVM A;  1K97 A;  2UXX A;  3C90 A;  3BRC A;  3DC6 A;  3SPJ A;  1A32 A;  5GTH Z;  2LGW A;  4DR3 O;  1SKV A;  1WN7 A;  4JI2 B;  1SQG A;  1E1Q G;  1M4U A;  1KMI Z;  2ZQM A;  1O9G A;  1PNL A;  2Y4U A;  1Q86 W;  3M8A A;  2CTQ A;  4WFH A;  1TVK B;  2A7W A;  5H9C A;  1IBL O;  2LFS A;  3B8M A;  3G71 V;  3OAA G;  2K1E A;  4X66 B;  1Z5W A;  3CCE V;  3JAS A;  2ITD C;  5IYZ A;  2DYR C;  2CTW A;  4XDK A;  3SPH A;  1AI7 A;  2UXB O;  3L73 H;  2P22 C;  3E83 A;  1V55 C;  5KMG A;  4CBC A;  1MSW D;  3CJH A;  3AG7 A;  3RYH B;  1JJO A;  3N2K B;  4RUF A;  1S5L Z;  1IX9 A;  2A79 B;  1YIT V;  4FIP C;  3I55 V;  4EB6 B;  5CB4 A;  2EUL A;  1NZ6 A;  1VQP V;  3EHB B;  3PN1 A;  1IVS A;  1P7B A;  3OD4 A;  1SF9 A;  5FPO A;  4GUN A;  4I55 A;  1JVM A;  2XAS A;  4U3J B;  2FL4 A;  1NH2 D;  1SZX A;  1VAR A;  2Q0O C;  1YHQ V;  5JJE B;  2YIB A;  4PA9 A;  4IT5 A;  4NB5 A;  1R6T A;  1URF A;  3ZHV A;  2Z5U A;  2ITC C;  3OGC C;  1H8H G;  3IC7 A;  2HLD G;  2BSK B;  1JQ0 A;  3BEH A;  1QLE B;  1NJI W;  2CH7 B;  4F4L A;  1RPR A;  2GBO A;  3W7T A;  1PM9 A;  3UT5 A;  3CCM V;  1SA0 A;  4JI6 O;  2QWN B;  3FD9 A;  3ABT A;  4I5S A;  2R70 A;  1XIL A;  1GKF A;  1AJN A;  4B7K A;  4UCV A;  1HR0 B;  3HR0 A;  4K0K O;  1K34 A;  4Z2W A;  2O57 A;  4MVU A;  1KEC A;  3EVK A;  2JGD A;  3WB2 A;  1M57 B;  4UB8 Z;  1M56 B;  3FFQ A;  3P3P A;  3SYA A;  3RVY A;  3RYC A;  3EFF K;  2XHB A;  1F7Y A;  3B4S A;  2OCC C;  1KKD A;  3R66 A;  5KHH A;  2Y69 B;  3T4Z A;  1YTF B;  2P7T C;  1JR9 A;  4UCU A;  3BHP A;  1XEQ A;  4MW8 A;  1MNG A;  3AG3 B;  3ZX6 A;  4DV7 B;  3CYO A;  2GUZ A;  2YXH A;  5LHH A;  5CMU A;  1H2N A;  4LFC O;  2UXD O;  3ASN C;  4AHC A;  2DWD C;  4J41 A;  4X65 O;  4JI0 O;  5GW7 A;  4DV1 B;  2OTJ V;  2WLI A;  5IWA B;  1SER A;  3OTF A;  1GO3 F;  2P5O A;  2WLJ A;  2QWR B;  3W7X A;  1Y67 A;  1G8M A;  2ZXW C;  1HNW O;  2WPD G;  1XHZ A;  4BIO A;  4PDM A;  1Q5O A;  2L6L A;  3IGA C;  1XL6 A;  4YXW G;  4O2B A;  4JI7 O;  1N33 O;  3AG1 B;  4UVC A;  4EFE A;  5F2V O;  2ZM6 B;  4B3T B;  1U96 A;  3WFV A;  2W0X A;  4CH6 A;  4YY3 O;  1WA8 B;  1EZV H;  1LR1 A;  2JGU A;  1SS3 A;  2PUS A;  1S5H C;  1FAF A;  3D3Q A;  1YJ9 V;  1K8A W;  3CCV V;  1SC5 B;  3TXQ A;  3K5M A;  5KUK A;  3AG2 B;  2DQ0 A;  3DXR B;  4UCO A;  1F4M A;  5L3E A;  5BMV B;  4NVP A;  4L8J A;  2ARH A;  3SPG A;  3CB2 A;  3ZED A;  2P67 A;  4JAV A;  5EYP B;  2RN9 A;  4TV9 A;  1BZK A;  4FK5 C;  3HKC B;  2PTM A;  3ZBH A;  4MW3 A;  5IYB O;  4QJF B;  2EIM B;  3BVO A;  1K9M W;  4LFB O;  2RMK B;  4MTO A;  5D5P A;  5B3S C;  1ZAU A;  1SQF A;  1Q3E A;  3JAT B;  2Q68 A;  4Z1V A;  1QU7 A;  3K5L A;  1WP8 A;  1IXB A;  4TV8 B;  4QE9 A;  4QIW F;  1XQ8 A;  2F93 B;  2NNU A;  1L0N H;  2P6J A;  3FYI B;  1OCZ C;  3SJA C;  3HKD A;  3QO7 A;  2PI4 A;  4J7J A;  2EIJ C;  1O9H A;  1PL4 A;  1JOY A;  2ETN A;  5ITZ B;  1XNR B;  5KAI Z;  1VQ6 V;  1HW7 A;  2QKA A;  4JTA B;  1RPO A;  2D3O W;  1S77 D;  4DR4 O;  2PGG A;  3K79 A;  5LP6 B;  5K1X A;  1YTF D;  4YJ3 A;  4DV0 O;  2F4V O;  2QWQ B;  4PDV A;  2YS8 A;  1TUB B;  4WFF A;  4FFB A;  2IJI A;  1VF6 C;  3LSU A;  1NTM H;  1L0L H;  1L8D A;  4OGQ B;  1VF7 A;  3WG7 B;  3P3N A;  4DV2 O;  4LF4 O;  4NTX A;  1YVW A;  3K9S A;  2QTO A;  4P9O A;  2P90 A;  1FS0 G;  4UXN A;  4KXR A;  3MAQ A;  1QHT A;  3DTU B;  4JI8 B;  1JFF B;  2LGQ A;  1R3K C;  4DV4 B;  5CA1 A;  1AI5 A;  1BCC H;  2LW7 A;  3S3W A;  2NN4 A;  1AI4 A;  1H2L A;  1VQ9 V;  4G27 B;  2GV9 A;  1AIL A;  1VMG A;  1AR1 B;  1QVG U;  1N32 B;  2DOS A;  4OPA A;  2DJV A;  4YJ2 B;  4ZIB A;  2R72 A;  4NXN O;  1R1B A;  2UUC O;  3BA9 A;  4DV5 B;  1QLE C;  4TQD A;  1R6K A;  4LWS A;  2Z0A A;  2E3C A;  3CRC A;  1XNQ O;  4JI5 O;  5C8Y B;  1BT8 A;  4I50 B;  3AK3 A;  2ADP A;  1K7D A;  5IJ0 B;  1P49 A;  3Q4H A;  2V1D A;  4U3F H;  1WAZ A;  2F66 C;  3RFR A;  2AHZ A;  3A0B Z;  3A8T A;  3CS5 A;  1ZL8 A;  3BAA A;  3ICX A;  4O4I A;  3NXS A;  1EBO A;  3F5W C;  1XBL A;  4DXW A;  5FPR A;  1N0J A;  3WU2 Z;  3LNM B;  4MTX A;  4KUM A;  3ABU A;  1M57 C;  3CXH F;  4DRX A;  4IL6 Z;  3OW2 U;  1BSM A;  1KQS U;  1YF2 A;  2JIZ G;  2RJZ A;  3A0H Z;  2GTS A;  2Q0A A;  1IBK B;  1WJZ A;  3ZMU A;  3UO3 A;  3W7U A;  1J95 A;  1Q7Y W;  4I0X A;  4NXM O;  2L35 A;  2ODM A;  4I4T A;  3SYP A;  3RYF B;  2VQE O;  5BR8 O;  3BPZ A;  4IIJ A;  1SQV H;  1ORQ C;  5JVD A;  4CS3 A;  4O2A B;  1S72 V;  5KX5 A;  3DGE A;  2QE7 G;  1AP6 A;  4UB6 Z;  4WBN B;  3K59 A;  2RNB A;  1VEW A;  4WFA V;  1K4C C;  2FYU H;  5EZY B;  3E8F A;  3PJS K;  4K3A A;  4DR7 B;  4OXS A;  1COW G;  5KHJ A;  2QGN A;  3E2E A;  1OCO B;  1RSO A;  3STL C;  4JPR A;  2EIL B;  5EK0 A;  3ZHQ A;  1Y6X A;  2IBZ H;  4IHJ A;  4DR5 O;  1FJG O;  4G28 B;  4C7U A;  3E8B A;  2F1M A;  2RQ6 A;  4O4L B;  1N8R W;  4D7T A;  5HFL A;  1Q82 W;  1SET A;  3RGB A;  4UFZ A;  3CMA V;  5J2T A;  2YEV B;  4DR1 O;  1IDS A;  3CME V;  1FFT B;  3CWB H;  1VQ8 V;  2LQT A;  3N2G B;  3JCU Z;  4KFM A;  2VQF O;  3CCJ V;  4LF8 B;  1M90 W;  1JA8 A;  3ZRW A;  2Y0I A;  2ZE5 A;  4O4J B;  1Y74 B;  4YHH O;  1HP8 A;  4CH4 A;  4X62 B;  2CUG A;  2AXT Z;  3LNN A;  5H2F Z;  3TET A;  2PYL A;  1VF5 B;  2YIA A;  3I56 V;  2P06 A;  2E74 B;  3K0G A;  3JAR A;  2AGA A;  3P32 A;  2WLH A;  1Y4M A;  2UXC B;  4B3M O;  1TAE A;  1EZJ A;  2EIM C;  3KKY A;  1EM1 A;  3A0R A;  2VQF B;  2HR3 A;  3FB8 C;  4PI2 A;  5DEC A;  1AB3 A;  2D2C B;  4MTG A;  3RN4 A;  4PA7 A;  2BTQ A;  3LDC A;  3ZHT A;  3B2E E;  4JAS A;  4A5U B;  5CBF A;  3H1I H;  4MVZ A;  1GM8 A;  3B77 A;  2VWJ A;  3CC7 V;  4TOI A;  4B3S O;  3JAS B;  5IYZ B;  1R3J C;  2GHY A;  5BY1 A;  3QNE A;  4LC1 A;  4JI2 O;  2DYS C;  1XRE A;  5KMG B;  3CHX A;  4CH3 A;  2QSA A;  3SPC A;  1HWY A;  4GX2 A;  4X1Y A;  3BA8 A;  4FLY A;  2HP8 A;  5LP6 C;  4CC5 A;  3K03 A;  5CB4 B;  2PF4 E;  3H1L H;  4X66 O;  5LA6 A;  4RWU A;  4RQE A;  1DF5 A;  4I55 B;  1XMQ O;  4I7Z B;  3BFR A;  4B3S B;  4FZ1 A;  1TA8 A;  5JJJ B;  2VRZ A;  3WG7 C;  5CBH A;  4X64 B;  2DMX A;  4FLT A;  1V54 B;  3CC4 V;  4LNU A;  3ABL C;  4ZKI A;  4YIO A;  4JF3 A;  1BL8 A;  1CP9 A;  4UVA A;  1W2B U;  2YSU B;  2Z3Y A;  3ABM C;  2H3O A;  4PJ0 Z;  4I9W A;  4R7C A;  3UM7 A;  1NTZ H;  2Q7H A;  2C2A A;  3UT5 B;  5LMU B;  1NT2 B;  4GCZ A;  1D5A A;  1SA0 B;  1GTO A;  4R50 A;  4AI8 A;  5FLX N;  3ZMV A;  3SGI A;  3JAK A;  4JV5 B;  2ZNJ A;  1PKX A;  1XMQ B;  3ZHU A;  4ZI7 A;  2YUA A;  1OJH A;  5CA0 A;  4JYB A;  4MVR A;  4TUY B;  3OTO B;  1I08 A;  1QQC A;  1GN4 A;  2KG7 A;  1H2G A;  3CSX A;  4HBN A;  3IFX A;  3VQV A;  4FM0 A;  1QR8 A;  4XDL A;  5JH7 A;  2HG5 C;  3RYC B;  2DW4 A;  4P9P A;  5E1A C;  2HHH B;  1HR0 O;  1YZB A;  3TXS A;  2HEP A;  4PDL A;  4CZZ A;  1NI8 A;  3B09 A;  4UCR A;  1D2D A;  2KB1 A;  4BIU A;  2OWO A;  4E4E A;  2YXL A;  3L75 H;  1FFX A;  2QEX V;  3K57 A;  1YSC A;  2H94 A;  2GUZ B;  2XTA A;  1YJN V;  1VQ5 V;  4CH5 A;  4IYH A;  5LOV A;  1Q6U A;  4BW9 A;  1FXV A;  1L1F A;  3SR2 C;  5B1A B;  1YJW V;  4UCT A;  1NR7 A;  1WNS A;  2WLI B;  3D8C A;  4OX9 B;  4KHP B;  1WPX A;  4IGG A;  3OE7 G;  3RYI A;  3JAM N;  2CGO A;  5L3B A;  1ZSP A;  4FLW A;  4DV7 O;  2IJK A;  3ETD A;  5J2U A;  1TVK A;  2ZIM A;  1G4Y B;  4O2B B;  2AW9 A;  4PD4 F;  1VF6 A;  1I94 B;  4H33 A;  1OCR C;  4DV1 O;  1S0V A;  4LF6 B;  4PDR A;  4JI1 B;  4DV3 B;  5IWA O;  3HKB B;  1N4C A;  2DQ3 A;  3FAV A;  1CPY A;  1MMM A;  1VIB A;  4GZR B;  3DSQ A;  1GAX A;  2EIL C;  3E35 A;  2JK5 C;  2YDE A;  2ZM6 O;  4B3T O;  4Q20 A;  2YIB D;  3ZRS A;  5EBM C;  1M5I A;  2EZP A;  3LDD A;  4U3J A;  5AG2 A;  1F23 A;  1NVP B;  5E79 Z;  4LF9 B;  4U7O A;  4TV9 B;  3MHS C;  3MHH C;  1I5X A;  1I5Y A;  3KG2 A;  3OEE G;  2UUB B;  2DE0 X;  3ZN0 A;  2EIK B;  1JX9 A;  3TJT A;  3FB5 C;  2CE4 A;  2ZIN A;  2Q4P A;  2YI8 A;  5B66 Z;  1Y66 A;  1AI6 A;  1ZX3 A;  5L3C A;  2QTS A;  2ZIO A;  4BR6 A;  2QDO A;  1F4N A;  3CCS V;  3G80 A;  2WA4 A;  2IU0 A;  3OR7 C;  1B6Q A;  1GN6 A;  4U7N A;  2Q7G A;  4DUY B;  1H2M A;  2ZKO A;  1SQX H;  1T5E A;  1IXM A;  3L72 H;  5IY5 B;  1JJ2 U;  3E8H A;  2YI9 A;  1MOF A;  3O65 A;  3SDL A;  4YIP A;  4JI4 B;  3QG5 A;  5H5N A;  3X2Q B;  5EIB D;  1OCC B;  1FXK C;  2UU9 B;  4NTW A;  1GRJ A;  4LF5 O;  1BMF G;  2LO1 A;  2Y48 A;  1BS3 A;  5LXT A;  4P2Z A;  1UPG A;  2W0F C;  4YJ3 B;  4H37 A;  1K3E A;  5IYC O;  4CS4 A;  3IC9 A;  4LF7 B;  4ZOL B;  4FFB B;  4DUZ B;  1XNR O;  5LGU A;  3U10 A;  4MVO A;  5DED A;  3K3W A;  1R6N A;  4LR3 A;  1PV0 A;  4J7Z A;  2X6A A;  4JZ2 A;  4B3R B;  5B1B C;  2ZT9 B;  5CA3 A;  1Z2G A;  4LF5 B;  3K06 A;  4H44 B;  2HJD A;  2KQX A;  1PPJ H;  4X1K B;  3M99 B;  3T2M A;  3UCS C;  1GN2 A;  1HNX B;  1ENV A;  3ABK B;  2QM8 A;  3H1H H;  3G6B A;  5BXZ A;  3RVZ A;  1ZWI C;  1PNK A;  2PYJ A;  1V54 C;  2IU3 A;  1K92 A;  4RUE A;  1YI2 V;  1UFI A;  4JI8 O;  3OMN B;  4DV4 O;  2MW2 B;  2A06 H;  1MSD A;  4JZG A;  4O4H B;  2A3Q A;  4F6R A;  3AK1 A;  4UCS A;  4LWS B;  1BGY H;  5CBG A;  5B5E Z;  1OV9 A;  2ILM A;  1N32 O;  4GKK B;  4J10 A;  3Q4H B;  3IJ4 A;  1GK9 A;  1NVP D;  5IJ9 B;  1ZL8 B;  1RFY A;  3CRR A;  2FKX A;  2IW5 A;  4PV1 B;  1V9P A;  2X7R B;  4QPJ A;  4JI3 B;  4DV5 O;  2WSS G;  3AG4 B;  4TQF A;  3T1Y B;  4KP4 A;  1VQN V;  3HB3 B;  1SQB H;  4NKG B;  2BOC C;  1SRY A;  4DRX B;  3G4S V;  4GX1 A;  1XMO B;  4LFA B;  4J7K A;  4LBE C;  3CRA A;  2YIC A;  3STZ C;  1P7G A;  2ZR2 A;  4I0X B;  1FXH A;  3OMI B;  3ETE A;  4FM2 A;  4I4T B;  4UV8 A;  4TV8 A;  4J11 A;  3OFN G;  4IIJ B;  2G38 A;  2IJJ A;  1H2S B;  2RDC A;  1XI1 A;  1IBK O;  1R73 A;  3FX7 A;  2ZDI C;  3B8N A;  3QF7 A;  2DN9 A;  1M9N A;  5JCO C;  1WLE A;  2Q8V A;  3J81 N;  3D36 C;  3RT3 C;  2JRI A;  5C93 A;  1ZUQ A;  1JCH A;  5LP6 A;  4X20 A;  4DR6 B;  5IT9 N;  5KUM A;  1BHB A;  1TUB A;  1E79 G;  1RM1 B;  4DR7 O;  2XAH A;  3SYQ A;  5JQG B;  1K33 A;  2LJ2 A;  1M56 C;  2ZE7 A;  4XBF A;  5LGT A;  2H8P C;  2NR5 A;  5J2T B;  3I5D A;  4X88 A;  2LFR A;  3JYC A;  2PZS A;  2Y69 C;  1Q81 W;  3MDS A;  4RAI A;  3MD0 A;  3AEI A;  4D7S A;  2AHY A;  2F43 G;  4DV6 B;  3SJC C;  3AG3 C;  2X6C A;  1Y76 B;  2CK3 G;  2B1I A;  4MT8 A;  2EBO A;  3CD6 V;  4HZ3 A;  4NR1 A;  4FJC C;  1X59 A;  2XND G;  2X0L A;  4ICG A;  5A2Q N;  2E5L B;  2VWK A;  3JAR B;  3ASO B;  1ZTE A;  1KB9 F;  1MZE A;  4LF8 O;  5H6Q A;  4ZHQ B;  3U11 A;  5IYD O;  5FL7 G;  3WB1 A;  2ZNI A;  4X62 O;  1CXZ B;  2V7Q G;  3AG1 C;  1AJQ A;  2BTQ B;  3JAL A;  4X8A A;  4X1I A;  2ZCE A;  5IY5 C;  2B5U A;  4TWK A;  5EBW C;  1HDJ A;  2UXC O;  4F6E A;  2ZD9 A;  2HFE C;  1M93 A;  1SQQ H;  1NBM G;  2YID A;  2FB5 A;  3T4D A;  1N36 B;  2CGN A;  4J80 A;  3ASN B;  3AG2 C;  1AVM A;  1J5E B;  2Q9L A;  1AR5 A;  5DN6 G;  4X1Y B;  1I0H A;  1IBM B;  3JAW A;  4BIZ A;  1U97 A;  5KHI A;  2JS5 A;  3CPW U;  3SPI A;  5LA6 B;  3CCR V;  3UQ8 A;  3HKE A;  4JYA B;  2QM7 A;  3ZJZ A;  1QVF U;  4D6T H;  2M6Y A;  1VQK V;  4PA3 A;  3H1J H;  4GKJ B;  1N34 B;  4J9Z B;  3QO8 A;  4LNU B;  3VOU A;  1YIJ V;  2B9Z A;  2PI5 A;  3H9V A;  1JMK C;  1NKD A;  3W7S A;  2XAQ A;  3LSQ A;  3K9A A;  4MVQ A;  2B1G A;  4AQY B;  1PP9 H;  1UJW B;  3JAK B;  1HNZ B;  4X64 O;  4BAY A;  3ABK C;  5LMN B;  4ZI7 B;  2XT9 A;  2Q6A A;  4O4L A;  5CA0 B;  3CJH B;  1MAB G;  2EJ7 A;  3BY6 A;  3T1H B;  5LHI A;  1SES A;  2YEV A;  2N04 A;  3CCU V;  4FM1 A;  1XHX A;  2KG7 B;  3OMA B;  1P4R A;  1WPB A;  2YXY A;  3CRM A;  1PL0 A;  2A0L A;  5LMU O;  5B3S B;  2ZE8 A;  5JH7 B;  3CXC U;  1FYJ A;  2WA3 A;  3RBZ A;  4JV5 O;  3UO2 A;  3GVM A;  4W4L A;  4QPK A;  1KYO F;  2YC0 A;  1H38 A;  5LYJ A;  2QR4 A;  2P4K A;  1LUW A;  3OTO O;  3NR7 A;  1FFX B;  1OCZ B;  3EXA A;  5FNV A;  1FKA O;  2UUA B;  3K5N A;  2EIJ B;  1MZF A;  3FYE B;  5LOV B;  2BOB C;  2RCV A;  3OT7 A;  1PD3 A;  3E22 A;  3K0D A;  2V4D A;  4PHZ A;  1YXB A;  3N27 A;  1F51 A;  2HHH O;  5J9P C;  3ZRX A;  1FXK A;  3JD3 A;  2HKO A;  3CX5 F;  1VQ4 V;  2VS0 A;  2XAG A;  3RYI B;  4QNH B;  3JD2 A;  3ZHS A;  3JSN A;  5J2U B;  3TK1 A;  4FFK A;  2OT5 A;  4K8X A;  2EJR A;  4CS2 A;  3LUT B;  4WCE V;  3KCX A;  1B06 A;  5L3F A;  2JGD B;  3KCY A;  1RP3 B;  1K4D C;  2XUM A;  1US6 A;  3J7A U;  4L87 A;  3F7Y C;  3SYC A;  4B08 A;  4HNA A;  3GWO A;  2E75 B;  1IZ3 A;  4OX9 O;  4KHP O;  2HJF C;  1KKC A;  3CEI A;  3KZI Z;  1ZLZ A;  3FAV B;  2Y0P A;  3CCQ V;  1QCE A;  1XOU A;  5TIS Z;  1H2K A;  4DR3 B;  4H13 B;  1DTO A;  2WLL A;  1I94 O;  1OZ0 A;  1S76 D;  1S3J A;  3L70 H;  3ZN1 A;  1IBL B;  3QO5 A;  4LF6 O;  2QWO B;  4IYI A;  5GON A;  4JI1 O;  4DV3 O;  1RM1 C;  3OM3 B;  3E89 A;  3G6E V;  3OUS A;  3E86 A;  1VP7 A;  2F95 B;  1DF4 A;  4H0L B;  1AP5 A;  2CTP A;  4N23 A;  1Q6H A;  3VQX A;  2AZ0 A;  1PNM A;  3TGU H;  1FD9 A;  3JCZ A;  2UXB B;  3L71 H;  3M7M X;  4LH7 A;  1EFR G;  4MS2 A;  1DLB A;  4KL1 A;  3J80 N;  1B04 A;  5GTI Z;  3SJQ C;  2WLM A;  3F7V C;  3CCL V;  3THO A;  4LF9 O;  2WWW A;  3F5T A;  1Q6I A;  2QM4 A;  2UXN A;  2UUB O;  1IUR A;  1KP2 A;  4DW0 A;  1VQ7 V;  3ASO C;  1OCO C;  3RYH A;  4TUY A;  3N2K A;  2WAM A;  2CAZ C;  4GT1 A;  4EB6 A;  2QA4 V;  4DUY O;  4FPP A;  1GN3 A;  2QKS A;  2Y4T A;  1Q8I A;  3JD1 A;  1WP7 A;  3G67 A;  5LXT B;  2CDY A;  5K1P A;  4FLV A;  4JI6 B;  4P30 A;  1SZT A;  3LSS A;  4JYC A;  4PA6 A;  5HFM A;  1TUE B;  4HAM A;  4JI4 O;  3JD0 A;  4W4K A;  2FTK A;  4K0K B;  1I7F A;  1VQL V;  2BSK A;  2UU9 O;  2DWE C;  1AR4 A;  5L3D A;  5A9G A;  3GB7 C;  4GX0 A;  2XOK G;  2CH7 A;  1NQT A;  3K08 A;  2ZDI A;  5JCO A;  1K5S A;  2WLK A;  3AK2 A;  4LF7 O;  2ZR3 A;  3D36 A;  4DUZ O;  4LP8 A;  3O9O A;  4DYL A;  2JVD A;  3HKD B;  3K5O A;  1E1R G;  4BWA A;  2OCH A;  1QBZ A;  1XL4 A;  3ZMS A;  1W59 A;  3HPL C;  1H8E G;  4B3R O;  1W0J G;  4QGP A;  1G6U A;  4LH6 A;  4HYO A;  3HKB A;  4LFC B;  4Q6G A;  2IJH A;  2UXD B;  1ROP A;  3T1C A;  5LGN A;  4X65 B;  4JI0 B;  5KA5 A;  2JDI G;  4F6R B;  2LP7 A;  1CEZ A;  5KA6 A;  1HNX O;  4WFE A;  3D3I A;  2QWP B;  4NTY A;  1HNW B;  2GSM B;  4CC6 A;  4R6Z A;  2R9A A;  3JD4 A;  4JI7 B;  1N33 B;  2BCC H;  1R3I C;  2JS3 A;  3ZRV A;  4QE7 A;  2OIE A;  4YY3 B;  1VQM V;  4DW1 A;  1D5N A;  3TCU A;  2JJ1 G;  5LBQ A;  2Q69 A;  5CA1 B;  3VQY A;  4GKK O;  2KKW A;  5EC2 C;  4FMT A;  2E76 B;  3H01 A;  1R3L C;  2JJ2 G;  3UKM A;  3L74 H;  2IH1 C;  1WB7 A;  4JI3 O;  5IE9 A;  2A9H A;  1WA8 A;  1KC8 W;  4G2K A;  3T1Y O;  2GDS A;  3ETG A;  4MSW C;  3ZIA G;  1XMO O;  4LFA O;  4TT3 G;  1B3Q A;  3CP1 A;  3VBB A;  3ETQ A;  2DYS B;  1LNQ A;  2K9P A;  4R8C A;  2EIN B;  5B1N A;  4UVB A;  1GH6 A;  4LFB B;  2Q5Z A;  3DXR A;  2ADQ B;  4DO2 A;  4PA4 A;  2M7W A;  5BMV A;  4WFG A;  4X20 B;  1X4T A;  4O4I B;  5CN0 A;  2EX3 A;  5EYP A;  4Z1M G;  3FB7 C;  3HKC A;  4ZOL A;  3OR6 C;  3ZCC A;  4ABM A;  5KHG A;  2FML A;  5EIB C;  3GWK C;  4UUJ C;  1YEW A;  4K8Z A;  4GX5 A;  3JAT A;  3ABL B;  4UV9 A;  3L9D A;  4XDJ A;  4JAA A;  4RO2 A;  4DR4 B;  4DR6 O;  1Z5V A;  3ABM B;  2EZO A;  5EBL C;  1OHH G;  1NR1 A;  3APO A;  4MVS A;  3VQW A;  5JVD B;  1EN4 A;  4X1K A;  5KX5 B;  1QLN A;  4OPH A;  4DV0 B;  2F4V B;  3BAB A;  1JFF A;  2DYR B;  3OGI B;  3P30 A;  5ITZ A;  4EFB A;  5B1A C;  2NLJ C;  1V55 B;  2Q73 A;  1MA1 A;  1G1X B;  4DV2 B;  4LF4 B;  3ZMT A;  1RSO B;  4GYC B;  4DV6 O;  3SJB C;  3C3T A;  4AIL C;  4O4H A;  4DK0 A;  4IHJ B;  5B1O A;  1QR9 A;  4DR2 O;  2W6J G;  1BE3 H;  1K73 W;  4E2L A;  3JAL B;  2Q7E A;  4B7E A;  3H1K H;  2Q67 A;  2R9I A;  4EKW A;  2E5L O;  3JSL A;  1YDX A;  5LL6 Y;  4X1I B;  3CRQ A;  4FLU A;  2P4V A;  2BE3 A;  3E8G A;  4J42 A;  5IJ9 A;  1DK1 A;  3OUF A;  1WB8 A;  2JEU A;  2WLN A;  2KSD A;  3S3X A;  3R65 A;  4NXN B;  3A2F A;  5DM6 V;  2UUC B;  1W0K G;  2LW1 A; 
#chains in the Genus database with same CATH homology
 1MAB G;  3BY6 A;  4QE9 A;  4QIW F;  3ZRW B;  5LHI A;  2NNU A;  1SES A;  2P6J A;  3FYI B;  2YEV A;  4H33 A;  1OCZ C;  1OCR C;  3CCU V;  3OMA B;  1S0V A;  1P4R A;  4PDR A;  1VQO V;  3CC2 V;  3QO7 A;  1PL0 A;  2A0L A;  2ATK C;  5B3S B;  2PI4 A;  2DQ3 A;  3CXC U;  2EIJ C;  5IDJ A;  1CPY A;  3RBZ A;  1GMG A;  1JOY A;  1VQ6 V;  4QPK A;  2EIL C;  2EIK C;  4JTA B;  1RPO A;  3E35 A;  4MTF A;  2D3O W;  1H38 A;  1S77 D;  3W7W A;  2JK5 C;  3K79 A;  1M1K W;  1OCZ B;  1OCR B;  4Q20 A;  1YTF D;  3ZRS A;  4WF9 V;  5EBM C;  4RQF A;  2XAJ A;  4ZBM A;  5H6R A;  2EZP A;  3LDD A;  2OCC B;  2EIJ B;  1F23 A;  3FYE B;  4PDV A;  1NVP B;  4WFF A;  2BOB C;  4U7O A;  3MHS C;  3MHH C;  1PD3 A;  1KD1 W;  1ARO P;  2IJI A;  3K0D A;  1I5X A;  1I5Y A;  3KG2 A;  1F51 A;  3OEE G;  5J9P C;  3ZRX A;  4WFB V;  1FXK A;  3ZN0 A;  2EIK B;  1JX9 A;  3JD3 A;  3WG7 B;  2HKO A;  1VQ4 V;  2XAG A;  3ML0 A;  3FB5 C;  2QTO A;  4P9O A;  2P90 A;  1FS0 G;  4QNH B;  3LDE A;  1Y66 A;  1AI6 A;  4UXN A;  3JD2 A;  5L3C A;  2IH3 C;  3X2Q C;  3TK1 A;  2OT5 A;  2EJR A;  1F4N A;  1OCC C;  3CCS V;  1BHA A;  2IU0 A;  3LUT B;  3OR7 C;  4WCE V;  3DTU B;  1B6Q A;  4U7N A;  2MK3 A;  5L3F A;  4X89 A;  1R3K C;  1K4D C;  1AI5 A;  1IXM A;  4L87 A;  1AI4 A;  3F7Y C;  3SYC A;  5IY5 B;  1JJ2 U;  1VQ9 V;  3GWO A;  4G27 B;  4BW5 A;  3E8H A;  1MOF A;  2HJF C;  2ZXW B;  1AR1 B;  1QVG U;  3K04 A;  3SYO A;  2R9R B;  3CCQ V;  1QCE A;  3X2Q B;  4JTD B;  1OCC B;  1FXK C;  5L3G A;  4J9Y B;  1NH2 B;  1DTO A;  1BMF G;  2WLL A;  2Y48 A;  1JPX A;  1OZ0 A;  1S76 D;  1S3J A;  4P2Z A;  2W0F C;  1QLE C;  3ZN1 A;  4H37 A;  3QO5 A;  1K3E A;  1R6K A;  1RM1 C;  5IYC O;  3OM3 B;  3E89 A;  2XAF A;  2X6B A;  3ZMZ A;  3G6E V;  3OUS A;  1K7D A;  3E86 A;  5LGU A;  2V1D A;  1DF4 A;  4N23 A;  2AHZ A;  1PNM A;  1GM7 A;  1FXK B;  3JCZ A;  3K3W A;  4MVO A;  2JEX A;  1MG1 A;  2HVJ C;  3FKS G;  3NXS A;  1EBO A;  3F5W C;  1R6N A;  4PEL A;  1EFR G;  4DXW A;  2X6A A;  4MS2 A;  5LHG A;  1DLB A;  4JAU A;  3LNM B;  4MTX A;  5B1B C;  4KUM A;  3ABU A;  1M57 C;  3SJQ C;  2WLM A;  3F7V C;  5CA3 A;  4TSF G;  2OTL V;  3OW2 U;  3CCL V;  1KQS U;  2JIZ G;  3K06 A;  3FB6 C;  2WWW A;  3ZMU A;  3M99 B;  3W7U A;  1J95 A;  2UXN A;  1Q7Y W;  1KP2 A;  4ASU G;  3T2M A;  1ENV A;  1VQ7 V;  4N21 A;  1AJP A;  3ABK B;  2QM8 A;  3ASO C;  3SYP A;  3RVZ A;  5BZB A;  1OCO C;  1THZ A;  1ZWI C;  2EIN C;  3RW0 A;  1PNK A;  4MVM A;  2WAM A;  4JGS A;  5B1B B;  1ORQ C;  4GT1 A;  3OEH G;  1V54 C;  2IU3 A;  1K92 A;  4LCU C;  1GM9 A;  4RUE A;  1S72 V;  3DGE A;  2QE7 G;  2QA4 V;  1YI2 V;  3OMN B;  4FPP A;  2WLL B;  2QKS A;  2HVK C;  3JD1 A;  4WFA V;  1K4C C;  3E8F A;  3PJS K;  1K5Q A;  4OXS A;  3AG4 C;  1COW G;  5CBG A;  3E2E A;  1KP3 A;  4JTC B;  4P30 A;  1SZT A;  2W6I G;  3LSS A;  4JYC A;  4PA6 A;  1OCO B;  1TUE B;  4HAM A;  5HFM A;  5EC1 C;  1K97 A;  2UXX A;  3STL C;  3JD0 A;  4JPR A;  1GK9 A;  3SPJ A;  2EIL B;  1NVP D;  2FTK A;  5EK0 A;  1E1Q G;  1VQL V;  2DWE C;  2ZQM A;  5L3D A;  1PNL A;  3GB7 C;  4GX0 A;  2XOK G;  1Q86 W;  2IW5 A;  4G28 B;  2X7R B;  1NQT A;  4QPJ A;  3E8B A;  2WSS G;  3K08 A;  3AG4 B;  2ZDI A;  4WFH A;  5H9C A;  2LFS A;  4KP4 A;  1VQN V;  1N8R W;  3HB3 B;  3B8M A;  2BOC C;  1SRY A;  3G71 V;  1K5S A;  2WLK A;  5HFL A;  3G4S V;  3OAA G;  2K1E A;  1SET A;  4GX1 A;  1Q82 W;  3CMA V;  2ZR3 A;  3D36 A;  3CCE V;  4LBE C;  2YEV B;  2ITD C;  4LP8 A;  3CME V;  1FFT B;  2DYR C;  3STZ C;  1VQ8 V;  4XDK A;  3SPH A;  2ZR2 A;  4KFM A;  1AI7 A;  1E1R G;  1FXH A;  3CCJ V;  1QBZ A;  3OMI B;  3E83 A;  1V55 C;  3ETE A;  1M90 W;  4CBC A;  1XL4 A;  4UV8 A;  3ZMS A;  1MSW D;  4RUF A;  3ZRW A;  3HPL C;  1H8E G;  3OFN G;  1W0J G;  2A79 B;  1YIT V;  4FIP C;  3I55 V;  4HYO A;  2IJJ A;  1VQP V;  3EHB B;  2IJH A;  1P7B A;  1ROP A;  3T1C A;  5LGN A;  3TET A;  1R73 A;  5KA5 A;  2JDI G;  1JVM A;  2XAS A;  3I56 V;  2ZDI C;  3B8N A;  3K0G A;  2LP7 A;  1NH2 D;  5KA6 A;  1CEZ A;  1M9N A;  3P32 A;  1YHQ V;  4PA9 A;  2WLH A;  1Y4M A;  4WFE A;  3D3I A;  1WLE A;  1EZJ A;  2EIM C;  2Z5U A;  3A0R A;  5C93 A;  2GSM B;  1JCH A;  2ITC C;  3OGC C;  1H8H G;  2HR3 A;  3FB8 C;  3IC7 A;  2HLD G;  4R6Z A;  3JD4 A;  5KUM A;  1JQ0 A;  3BEH A;  1QLE B;  1BHB A;  1R3I C;  1NJI W;  1E79 G;  4MTG A;  4PA7 A;  3LDC A;  4F4L A;  3ZRV A;  1RM1 B;  1RPR A;  4QE7 A;  4JAS A;  1VQM V;  3W7T A;  2XAH A;  3SYQ A;  5CBF A;  1K33 A;  1M56 C;  3TCU A;  2JJ1 G;  5LBQ A;  3CCM V;  4XBF A;  5LGT A;  4MVZ A;  1GM8 A;  2H8P C;  3B77 A;  2Q69 A;  3ABT A;  4I5S A;  3CC7 V;  1GKF A;  1AJN A;  1R3J C;  2GHY A;  4X88 A;  2LFR A;  5EC2 C;  3JYC A;  2Y69 C;  3QNE A;  4LC1 A;  4FMT A;  2DYS C;  1K34 A;  3H01 A;  1R3L C;  2JJ2 G;  1Q81 W;  4MVU A;  3UKM A;  1KEC A;  2IH1 C;  4RAI A;  3MD0 A;  3AEI A;  2AHY A;  2F43 G;  3SPC A;  1HWY A;  4GX2 A;  3AG3 C;  1M57 B;  2A9H A;  2X6C A;  1M56 B;  1KC8 W;  4G2K A;  3K03 A;  3ETG A;  2CK3 G;  2B1I A;  4MSW C;  4MT8 A;  3SYA A;  3RVY A;  2EBO A;  3ZIA G;  3CD6 V;  3EFF K;  2OCC C;  4HZ3 A;  4TT3 G;  1KKD A;  4FJC C;  3CP1 A;  2XND G;  2X0L A;  3VBB A;  4RQE A;  1DF5 A;  2Y69 B;  2DYS B;  1LNQ A;  3ASO B;  3T4Z A;  4R8C A;  1YTF B;  2EIN B;  2P7T C;  5B1N A;  4UVB A;  4MW8 A;  3WG7 C;  5CBH A;  4DO2 A;  5H6Q A;  4PA4 A;  1V54 B;  3AG3 B;  2M7W A;  5IYD O;  3CC4 V;  5FL7 G;  3CYO A;  4WFG A;  3ABL C;  4ZKI A;  5CMU A;  5LHH A;  4JF3 A;  1BL8 A;  1CP9 A;  5CN0 A;  4UVA A;  1W2B U;  4Z1M G;  2YSU B;  3FB7 C;  2V7Q G;  2Z3Y A;  3ABM C;  3ASN C;  2DWD C;  3AG1 C;  1AJQ A;  3OR6 C;  3ZCC A;  4I9W A;  5GW7 A;  4R7C A;  3UM7 A;  2OTJ V;  2WLI A;  2C2A A;  4X8A A;  1SER A;  4GCZ A;  5IY5 C;  1GTO A;  2B5U A;  1GO3 F;  4R50 A;  4TWK A;  5EBW C;  3ZMV A;  2WLJ A;  4UUJ C;  2ZD9 A;  3W7X A;  1G8M A;  2ZXW C;  4GX5 A;  2HFE C;  1PKX A;  3ABL B;  2WPD G;  4UV9 A;  1NBM G;  3T4D A;  4PDM A;  3IGA C;  4XDJ A;  1XL6 A;  4YXW G;  4RO2 A;  3ABM B;  2EZO A;  3ASN B;  4JYB A;  4MVR A;  5EBL C;  3AG1 B;  4UVC A;  3AG2 C;  1OHH G;  1NR1 A;  3WFV A;  4MVS A;  5DN6 G;  1QLN A;  1H2G A;  4BIZ A;  1S5H C;  3IFX A;  1QR8 A;  4XDL A;  1YJ9 V;  1K8A W;  3CPW U;  2HG5 C;  2DYR B;  3CCV V;  3P30 A;  3SPI A;  3CCR V;  2DW4 A;  4P9P A;  5E1A C;  5B1A C;  2NLJ C;  2QM7 A;  4PDL A;  1V55 B;  4CZZ A;  3ZJZ A;  5KUK A;  1QVF U;  2KB1 A;  4BIU A;  1VQK V;  4PA3 A;  3ZMT A;  3AG2 B;  2DQ0 A;  1F4M A;  2QEX V;  5L3E A;  4J9Z B;  1YSC A;  3QO8 A;  2H94 A;  1YJN V;  1VQ5 V;  3SPG A;  2P67 A;  5B1O A;  3VOU A;  1QR9 A;  4JAV A;  1YIJ V;  1FXV A;  1L1F A;  2W6J G;  2PI5 A;  4FK5 C;  1K73 W;  4E2L A;  1NKD A;  5B1A B;  1YJW V;  1NR7 A;  4MW3 A;  3W7S A;  2XAQ A;  2Q67 A;  2R9I A;  2WLI B;  4EKW A;  3LSQ A;  5IYB O;  4QJF B;  3K9A A;  4MVQ A;  2B1G A;  2EIM B;  1WPX A;  3E8G A;  1K9M W;  1UJW B;  4MTO A;  3OUF A;  5B3S C;  3OE7 G;  2JEU A;  2WLN A;  4BAY A;  3ABK C;  5L3B A;  2IJK A;  3ETD A;  2Q68 A;  3R65 A;  2Q6A A;  5DM6 V;  1G4Y B;  1W0K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...