4G27B

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and phenylurea
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
publication title Identification of the functional binding pocket for compounds targeting small-conductance Ca(2+)-activated potassium channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport/calcium binding protein
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g27B00
4J9ZB 2HVKC 2ZD9A 2A0LA 2HFEC 4MTOA 3SPCA 4R7CA 3SYAA 2ZXWC 4PDVA 1JVMA 4GX1A 4MS2A 3IFXA 3K0DA 4PA4A 4OXSA 2DYRC 3K08A 2P7TC 3F7YC 4P9OA 3LUTB 4WFGA 4J9YB 4MVMA 3LNMB 3FB8C 5BZBA 5EC1C 3AG4C 3VOUA 4MSWC 1ZWIC 3K06A 4QE9A 3RVZA 3SYQA 4QNHB 4WFEA 2EIKC 4G28B 4R6ZA 4R8CA 1OCRC 2A9HA 3FB6C 1XL6A 5EBWC 3ASNC 3K0GA 4P9PA 4MVSA 2WLMA 3BEHA 1K4DC 3E83A 4ZBMA 3AG1C 4XDLA 3OUFA 3K03A 2WLIB 4LBEC 2X6BA 4XDJA 5KUKA 4X8AA 5E1AC 2OCCC 2JK5C 1P7BA 3UM7A 3T4ZA 1R3IC 1BL8A 3SPGA 1S5HC 4MW3A 5B1BC 5B1AC 4MVUA 3X2QC 2DWEC 3R65A 3ZJZA 3RVYA 2X6CA 5IY5C 2EINC 1G4YB 2H8PC 4X89A 3E8GA 4HZ3A 3JYCA 4GX5A 2WLIA 5J9PC 2Q6AA 3OR6C 4RO2A 3PJSK 4RAIA 5EK0A 3UKMA 1OCCC 4MW8A 4PDRA 4LCUC 3K04A 1ORQC 2R9RB 4WFHA 1XL4A 2NLJC 3SYOA 4H37A 2IH1C 2WLLB 4PA3A 2Q68A 1R3JC 4EKWA 5CBFA 2K1EA 4LP8A 2AHYA 2DYSC 3T4DA 5CBGA 4XDKA 4UUJC 4MVRA 4GX0A 3TCUA 4I9WA 1OCOC 2EIMC 2ITCC 2QKSA 3E8FA 4MVQA 4X88A 3EFFK 4WFFA 2Q69A 2DWDC 2WLLA 3AG3C 3FB5C 4MVOA 1M57C 1QLEC 3F7VC 3OR7C 4PA7A 5EC2C 2AHZA 3RW0A 4P30A 4RUEA 3GB7C 3SYCA 3IGAC 2A79B 4PDMA 3KG2A 2ATKC 3E8BA 4HYOA 3SPHA 2YEVA 1R3KC 5EBMC 1V55C 4BW5A 5CBHA 2WLJA 2IH3C 2W0FC 2KB1A 3OGCC 3STLC 3T1CA 2HJFC 1KKDA 2ITDC 3E89A 3LDCA 2HG5C 3AG2C 3SPJA 4G27B 3ASOC 3FB7C 4QE7A 3WG7C 4F4LA 2Q67A 1V54C 3E86A 2Y69C 1M56C 4CBCA 3TETA 3LDEA 1R3LC 5EBLC 3OUSA 4PDLA 1J95A 4R50A 3T2MA 5B3SC 4JTDB 2WLNA 4PA9A 4RUFA 4H33A 4PA6A 2WLHA 2BOBC 3E8HA 3STZC 2WLKA 2EIJC 3SYPA 3HPLC 2X6AA 5KUMA 3SJQC 4GX2A 2HVJC 4JTAB 2EILC 1K4CC 4DXWA 1OCZC 3ZRSA 3LDDA 4TWKA 2BOCC 4JTCB 3F5WC 2QTOA 3ABKC 3ABLC 4MVZA 3ABMC 4MTGA 4P2ZA 3RBZA 1LNQA 4KFMA 4MTFA 3SPIA
chains in the Genus database with same CATH superfamily
4J9ZB 2ZD9A 3BCCH 2HFEC 2KQXA 3SYAA 3T1HB 2A7WA 2QJ1A 4J7KA 4UCTA 2FB5A 3VQYA 2F43G 2Q8VA 2P7TC 1HNZO 4WBNB 3BAAA 5K1PA 1M5IA 4JI5B 2Q7GA 2OCHA 2VWJA 1KUQA 1KBHA 1U97A 5IJ9B 1VQ9V 4U7NA 2VQFB 2X6BA 1YJ9V 4JYCA 5IYZA 1B6QA 1PNMA 2IJKA 2OWOA 1PKXA 1Y74A 3CRCA 4J11A 1VQLV 3A0RA 1OCCC 4L87A 2W6IG 3CCRV 4X1YA 1AVMA 3FAVB 2E75B 3C3SA 2RCVA 2Q73A 4DW0A 4LF6O 4DR5O 1HW7A 3QO5A 1AROP 3T1HO 3LSSA 3T4DA 5IY5B 2YIDA 4DR4B 2QKSA 1OJHA 3SDLA 2EZOA 4JI5O 3JCUZ 4GKKB 1GRJA 4CZZA 4J10A 1MZFA 5LOVA 4UCVA 1MA1A 3JALB 4LF4B 2VQFO 2XTAA 1M9NA 4JYYA 1I08A 2MK3A 5EYPB 2DOSA 1GK9A 4IYIA 1IZ3A 1MMMA 4KHPB 1J95A 4X1IB 3JSLA 3CCSV 3W7XA 1Q8IA 2IM9A 4CH4A 5KMGA 4MT8A 4LWSA 2F93B 3LNNA 4N21A 2FYUH 3HKDA 1YZBA 4QPKA 4TQDA 2JEXA 2P4KA 1S5LZ 2F95B 4J41A 4UXNA 4DR4O 2EULA 3JD4A 4PDVA 5H6QA 4K8XA 1YDXA 4P9OA 1ROPA 4GKKO 4MSWC 3K06A 1VARA 5IYZB 3AG1B 4G28B 5TISZ 4LF4O 1WP7A 1XNRB 1Y74B 4JI3B 3K03A 4X8AA 5E1AC 4KHPO 3SPGA 1SQFA 4X1YB 3NXSA 2K9PA 1ENVA 4X89A 3JYCA 1AB3A 1HR0B 4LCUC 1ORQC 1TVKA 4H37A 1K97A 4BIZA 1Y76A 5LOVB 2ZNJA 4MVRA 2KKWA 4IGGA 4WFFA 2LW7A 4FMTA 5LGNA 4FFKA 1FXKC 3ETGA 2CGNA 2XAHA 3OMAB 3SYCA 2A79B 4PDMA 1XNRO 1Q90D 4F6EA 3DSQA 4JI3O 4O4HA 4JPRA 1E79G 5KMGB 4LWSB 3ZBHA 4DR6B 4PHZA 5LGTA 1M90W 2PYJA 5CA0A 1PPJH 1Y4MA 3HKDB 3R66A 5CA3A 3PN1A 2D2CB 4NXNB 4JI8B 1S76D 3WFVA 3HKEA 1HR0O 2X6AA 1JOYA 2OT5A 1YXBA 3CJHA 2YDEA 2CAZC 3OEEG 3CMEV 4JTCB 3U11A 3KCYA 4MTGA 1PNKA 2DW4A 3W7UA 1DF5A 2X7RB 2OTLV 2DQ3A 3ETQA 4TQFA 2CTPA 4CS2A 3ASNB 4D6TH 1W0JG 1DF4A 2BSKA 3FFQA 1VQKV 2GTSA 4K35A 1WB7A 2WAMA 3ZHTA 1JPXA 4JI1B 1ZL8A 3AG1C 5B1AB 3A8TA 4DR6O 2EINB 5LMUB 1TVKB 4NXNO 1EFRG 4JI8O 4HZ3A 4DO2A 4YIOA 3RWRD 2WLIA 1Q86W 1NJIW 1Q43A 1GN2A 3PJSK 3AK3A 4EFBA 3L75H 5DN6G 2Q68A 2A06H 4B3RB 3N27A 4UUJC 5KHHA 1QLEB 4I9WA 1R6KA 3L72H 2YIBD 4NYKA 4O4HB 3CB2A 2B1GA 4TV8A 2QWNB 3E22A 3F7VC 4FM2A 5HFMA 2FMLA 5CA0B 4I55A 1Q5OA 3SJBC 2ATKC 3ZHUA 4Z1MG 4JI1O 1F23A 5IDJA 5CBHA 2DYSB 2IH3C 3TJTA 3HKEB 1LR1A 1QBZA 5LMUO 2Q67A 3CJHB 1R6TA 5L3GA 3DXRA 2QGNA 4H33A 4JI6B 2ZM6B 2BOBC 3STZC 1BCCH 1AI5A 4TOIA 5CN0A 4CH3A 4JTAB 4LR3A 5AG2A 1JJ2U 4B3SB 2G38A 3G80A 1LNQA 4B3RO 2RN9A 3CEIA 1Y6XA 2BSKB 2HVKC 1N34B 2A0LA 3B77A 3ZHRA 1JVMA 4U3JA 3UCSC 5JWPA 1ZL8B 4JGSA 1YF2A 4QPJA 4BAYA 1G1XB 2YIAA 1OCRC 3ASNC 3JAKA 3OE7G 1SETA 1K4DC 3U10A 1X4TA 3CRQA 2QEXV 2WLIB 4XDJA 2WWWA 3UM7A 5B1AC 1XBLA 4JI6O 2EINC 2ZM6O 4X64B 4ZI7A 1A32A 1BHBA 1IBLB 1Q3EA 1B3QA 2ZE7A 4B3SO 3IC9A 4TV8B 2PF4E 4PA3A 3E22B 1I5XA 1IURA 4IHJA 1N34O 4B3TB 1HNWB 3EXAA 3VQVA 3KKYA 1GM7A 4I55B 3TCUA 1OCOC 1MOFA 3E35A 2ZNIA 4I5SA 1KD1W 4CH6A 1QLEC 1UPGA 2WA3A 2ETNA 4FFBA 2YI9A 1L0NH 3J7AU 2B5UA 4ZHQA 1YVWA 3K5MA 1B04A 1KYOF 1SQQH 3A2FA 3ZX6A 1MNGA 3FKSG 3TETA 5JJNB 1NVPD 4X64O 1IBLO 4X65O 3O65A 1AR1B 4U3JB 1DK1A 5D5QA 2BTOA 2IJIA 5EIBD 4B3TO 1HNWO 2GUZA 4MTOA 1US6A 3JAKB 1FD9A 2M7WA 1FAFA 3K08A 1SC5B 4J9YB 3ZCCA 4QIWF 3FB8C 1NH2B 3AG7A 5FNVA 4BIOA 4E4EA 3CYOA 1KB9F 4DV1B 5JH7A 1CXZB 4R8CA 4DR7B 2PUSA 1TUEB 5LBQA 4DV0B 4DV5B 4NB5A 1Z5VA 3VBBA 1WN7A 3UO3A 3OUFA 1H2KA 4ZI7B 5L3BA 4I7ZB 2QWRB 1JFFA 1GO3F 2IJHA 1MSWD 1Y67A 2E76B 2QKCA 4IHJB 1BSMA 3KCXA 4GX5A 3CPWU 4YY3B 1JQ0A 1VIBA 1R3JC 2EX3A 3JCZA 4FFBB 1MZEA 5CBGA 4F6RA 4W4KA 4CC5A 4PELA 1LUWA 2QM8A 4UCOA 1AR4A 3LSUA 4ZHQB 3RYHA 5HFLA 1SZXA 3SJCC 2WLLA 4DV1O 1V55B 1G6UA 1NTMH 3ZHVA 3RYIA 4DR7O 5H5NA 4GKJB 5LGUA 4DV0O 4DV5O 3E8BA 1R3KC 3WG7B 1RFYA 5KX5A 1VQ8V 1GMGA 1SS3A 4X9QA 3FB7C 1XHXA 4PDLA 1H2LA 2XAFA 4GYCB 1XNQB 2WLNA 1OHHG 1N8RW 2EILB 1U96A 2GUZB 4JF3A 4WF9V 4HNAA 3ABLB 4YY3O 3ABMB 5KUMA 1BS3A 4JI0B 2E74B 2R9IA 3ZRSA 1FXKA 4LFAB 5FNVB 3N2GA 3G6EV 2DYRB 5JH7B 4MS2A 3ZMSA 4X62B 1Q6HA 3IFXA 4OXSA 2YXHA 3B09A 3THOA 4DR2B 1BQZA 1JFFB 4GKJO 2A9HA 2ODMA 3U0ZA 3W7TA 1OZ0A 1O9HA 3CE2A 3K0GA 4P9PA 1L0LH 5LYJA 4YJ2A 3K5LA 2GSMB 2LGQA 3BPZA 1AI6A 1HNXB 1VEWA 1ZAUA 2DN9A 5C8YA 1THZA 1N0NA 2QWPB 1BL8A 3CCLV 1XNQO 2CTQA 5BR8B 3GVMA 2GTAA 4FLZA 3ICXA 4AQYB 4F6RB 4KUMA 4JI0O 1WAZA 4H44B 4PI2A 4PDRA 1H8HG 2CK3G 4LFAO 1FXHA 4I50A 3RYHB 3L70H 5E79Z 4DUYB 2WLLB 4FLTA 1CEZA 2NN4A 3RYIB 5KA5A 4LFBB 4X62O 4WCEV 2CTWA 2Y48A 4FPPA 5KHGA 3OTOB 4X88A 1AJNA 5KX5B 4DR2O 4LNUB 1QR8A 2X0LA 1P49A 3S3XA 3IGAC 1K7DA 3H1IH 1V55C 1M56B 1R6NA 2B9ZA 3STLC 1HNXO 4DV2B 2O57A 4HNAB 4DUZB 3WG7C 3K5NA 2XASA 1FXKB 1H2SB 5BR8O 1I7FA 2IBZH 2F1MA 3N2GB 4KL1A 4AQYO 3MHSC 1PP9H 3K79A 2EILC 3TXQA 4DXWA 2PYLA 4DUYO 1URFA 3ABLC 3ETDA 3ABMC 1N4CA 5IYDO 4MTFA 3CWBH 2Y0PA 3FYEB 5C93A 4LFBO 1TAEA 3K9AA 4YJ3A 1SRYA 5B66Z 3OTOO 2DYRC 4YJ2B 5LYJB 1PL4A 1BZKA 4IYHA 4FZ0A 1YSCA 1FYJA 2YSUB 2LFRA 5EC1C 5C8YB 4WFEA 1N36B 2PZSA 2JJ1G 4UV9A 4MVSA 4DV2O 3QO7A 4ASUG 5B1BB 3FX7A 4LH6A 4J7ZA 4DUZO 4GT1A 2OIGA 4I50B 5GTHZ 2Z0AA 3EVKA 3CCJV 5L3EA 5KA6A 4EB6A 4U7OA 1H38A 4WFBV 2R9RB 4AI8A 1ZTEA 5L3FA 2UXXA 5D5PA 4BW9A 3JD3A 4RQFA 5LL6Y 4B7EA 2AHYA 3P3NA 1EZJA 3K59A 2ITCC 4I9QA 5LHGA 4MVQA 1XILA 3K58A 2CDYA 3B8MA 3JD2A 1D5AA 3H1KH 4P30A 1N36O 1XEQA 3ABTA 3LSQA 1VQ7V 2GV9A 5KHJA 3ASOB 3A0HZ 2P67A 2HJFC 2XUMA 1JA8A 2RDCA 3BABA 2RJZA 2EZPA 1M56C 2UXCB 3H1LH 1R3LC 2ZCEA 1XQ8A 3K9SA 1ZUQA 4FLVA 5L3DA 2ADPA 2H3OA 1L8DA 4YJ3B 1GTOA 1NBMG 1MSDA 4FM1A 2ADQB 3LDDA 2ZXWB 3L71H 3ML0A 2F4VB 2JGUA 1F7YA 1G8MA 2Z5UA 1YJNV 2D3OW 4EFEA 5J2TA 1KQSU 3ZRXA 3VQXA 2EIKB 2P6JA 2P06A 3TXSA 2V7QG 3RVZA 3J80N 1YCIA 3GWOA 5A9GA 3OD4A 1NI8A 3BEHA 5DEDA 3ZHQA 1KU9A 4UB6Z 2QTSA 3X2QB 4EB6B 1I0HA 1HP8A 2UXCO 4UFZA 2JVDA 1R1BA 5B1BC 3R65A 5JCOC 1PV0A 1OCRB 1PM9A 2XT9A 4OX9B 2XAGA 2YIBA 3UKMA 2KSDA 3E2EA 4KP4A 2YXLA 5BXZA 1XL4A 3SYOA 5JJJB 1XMQB 2ZIMA 1IXBA 2KG7A 4QGPA 4UVAA 5DECA 2F4VO 1WB8A 4FIPC 1K33A 1M1KW 3M99B 2UUBB 5H6RA 1S0VA 1YJWV 3ZRVA 2HP8A 3QNEA 5IYBO 3JAMN 1Q6UA 1SZTA 5F2VO 4YHHB 2GDSA 3RYCA 3P32A 2F66C 1AP6A 1OCOB 2QE7G 3LDCA 1EZVH 1WLEA 1YITV 4LF9B 3ASOC 4CBCA 3G71V 4DV3B 4DK1A 5EBLC 2EIJB 1NQTA 5B3SC 3QO8A 2WLHA 4OX9O 3L73H 2UUAB 3ZMZA 5J2TB 3SJQC 4GX2A 2UXNA 2QDOA 2UUCB 5JQGA 1XMQO 3FYIB 3IC7A 1GN6A 1XHZA 4JI7O 2UUBO 1P84F 2ZXWC 1ZSPA 2VRZA 4NKGB 2VQEB 4GX1A 5IT9N 3N2KA 4BWAA 1H2MA 3D3IA 2WSSG 3RGBA 1ZWIC 3CD6V 4YHHO 2EIKC 4FLYA 1XL6A 3OEHG 2ILMA 1AILA 2WLMA 1RM1B 4LF9O 3OAAG 1Q81W 4DV3O 2LGWA 3RYFA 3X2QC 2EJ7A 2KG7B 1E1RG 4JV5B 2ZDIC 2UUAO 3WB2A 4FVMA 2Q6AA 1EBOA 4RO2A 2PGGA 3K04A 2UUCO 2CGOA 1AP5A 4J80A 5LA6A 3G6BA 2ZQMA 2EIMB 3ZRWA 1K5SA 2K1EA 5GONA 2VQEO 3RYCB 4TT3G 1FXVA 2N05A 3O9OA 1KMIZ 1RPOA 3FB5C 3MHHC 4OPAA 4X65B 2GBOA 1GAXA 2QWQB 3CCVV 2KB1A 1RSOA 3ABUA 3F5TA 2ITDC 1YI2V 3DTUB 5CB4A 2ZINA 2W6JG 2QR4A 2IJJA 3OT7A 1Y66A 3OUSA 1BMFG 3JAWB 5JQGB 4JTDB 1WNSA 3CC4V 4JV5O 4BIUA 2EBOA 2YUAA 1RPRA 2EIJC 4OGQB 4UCSA 2HVJC 1Z5WA 3N2KB 4JAUA 3UT5A 4B08A 5IYCO 3BVOA 4UCUA 3CXHF 4O4IA 5FPOA 1KP2A 4LF8B 2BE3A 1GN4A 1H8EG 4CH5A 1SQVH 2DE0X 1NH2D 4R6ZA 4O4LA 3RYFB 3WB0A 2ZKOA 3G67A 2GHYA 2Q7EA 2OCCB 4FM0A 3IAYA 4XDLA 3JATA 1K3EA 3CRMA 1RM1C 2ZR3A 4MW3A 2DWEC 4X66B 2JS3A 5LA6B 3ZJZA 1DLBA 5H9CA 1XMOB 3ZRWB 1BT8A 3E8GA 1B06A 5GONB 4CC6A 5EK0A 3CCUV 4JYBA 1FKAO 1KP3A 1N0JA 1S77D 3OGIB 3OTFA 5FLXN 4DV4B 4LF5B 4AHCA 4J42A 4LP8A 1H2GA 2Q0OC 1QHTA 2EIMC 4LF8O 1CPYA 4JI4B 4IT5A 1RSOB 3QF7A 4X1KA 5CB4B 3B4SA 5KAFZ 2R9AA 3CX5F 3K57A 2VWKA 1SKVA 3KG2A 2JDIG 2UXBB 4BW5A 1V54B 1S3JA 4Z1VA 3D8CA 4QE7A 4XBFA 4X66O 1D5NA 2F23A 2P5OA 1O9GA 1XMOO 1VQ4V 3UT5B 2Y4TA 2DMXA 3ZMUA 4RWUA 4DV7B 4O4IB 1EN5A 1YTFB 1FFTB 2QTOA 4JI2B 4DV4O 3RBZA 4LF5O 3D36A 2ZE8A 4LNUA 4O4LB 5DM6V 1NZ6A 1IBMB 4JI4O 3BY6A 3F7YC 1RP3B 4MVMA 3APQA 3JATB 1M93A 1S72V 3VOUA 5JVDA 3A0BZ 2WPDG 4QNHB 4PJ0Z 4YXWG 1W59A 2FKXA 2ZT9B 2UXBO 2L6LA 3ZS8C 4Z2WA 2Y4UA 4LH7A 2Q4PA 1VQNV 2OCCC 2B1IA 2LJ2A 1NTKH 1R3IC 2HLDG 1S5HC 2RMKB 1WJZA 4G2KA 1G4YB 4CS3A 4DV7O 4JI2O 4D7SA 4X1KB 2AW9A 3APOA 2Q0AA 2HR3A 5CBFA 1IBMO 1AI7A 1YIJV 2R70A 1SQBH 4ZIBA 2JRIA 1SESA 4FLWA 1XDCA 5EC2C 4MVOA 3CP1A 4N23A 2HEPA 5JCOA 1SF9A 1YHQV 2PI5A 3ZMVA 4HYOA 3AG2B 2YEVA 3JARA 4IIJA 4TUYA 4C7UA 1R73A 5EIBC 3HKCA 4B3MB 3E86A 1V54C 2Q7HA 1S5JA 3QG5A 1PNLA 4UB8Z 4PA6A 1OCZB 4D7TA 2WLKA 3KZIZ 1TA8A 2ARHA 4FK5C 4ZOLA 3WU2Z 1M4UA 3AEIA 3CXCU 5JVDB 3SPIA 1WPBA 4R7CA 2FTKA 3J81N 4PA4A 1NKDA 2Z3YA 2NNUA 2RNBA 3EHBB 5BZBA 3SYQA 3RT3C 5EBWC 1QVGU 1GM9A 3UO2A 3JD1A 1MABG 1JX9A 4B3MO 1AJPA 2XAJA 1BQ0A 4RQEA 3VQWA 4AILC 3OW2U 2YXYA 3OFNG 5KAIZ 1OV9A 4ICGA 4MW8A 3B40A 4PI0A 5H2FZ 3FD9A 3JD0A 5KHKA 1K34A 4JASA 2QSAA 4EEQA 2XHBA 2IU0A 4DYLA 1QLNA 2HKOA 1NR1A 3W7WA 4K3AA 3MAQA 4I0XA 1VQOV 1VP7A 4JZGA 3MDSA 2Y0IA 3AG3B 1K5QA 1M57B 4B7KA 2YEVB 4W4LA 3E8FA 3JARB 4IIJB 5GTIZ 4TV9A 4TUYB 4K0KB 5IJ0A 4K8ZA 2QWOB 3HKCB 1Q82W 3RW0A 5B1NA 1GN3A 1NTZH 2ZDIA 3ZIAG 2AGAA 2W0FC 4KXRA 3E89A 3AG2C 3RN4A 4ZOLB 4DRXA 3HR0A 2EJRA 3T2MA 4NTXA 1HWYA 3H1HH 1D2DA 3SYPA 3HPLC 5FPRA 3D36C 3M8AA 1OCZC 1VQ6V 3ZEDA 4MTXA 3BRCA 5KLVH 3I55V 4NVPA 4DR3B 4KFMA 3TGUH 1V9PA 1QNMA 5B3SB 2MW2B 4TSFG 3AG4B 1XREA 3K0DA 4K0KO 2YICA 4WFGA 3LUTB 4H13B 1E1QG 1KECA 1ZX3A 5K1XA 2BCCH 4QE9A 1Z2GA 2LP7A 1JCHA 4ZKIA 3FB6C 3SR2C 1J5EB 5CMUA 2QKAA 3L74H 4FLXA 3K5OA 4ZBMA 2Q9LA 3M7MX 3CC7V 3NR7A 1P7BA 4O2AA 4MVUA 2AZ2A 5IY5C 5IWAB 2H8PC 4I0XB 2N74A 2FL4A 2CE4A 4NTYA 3CCQV 4JYAB 2BTQA 1IBKB 4TV9B 1F4MA 5CA1A 1SA0A 2ZE6A 3H9VA 5IJ0B 4DR3O 2V4DA 1BGYH 3CRAA 1IVSA 3UQ8A 4GX0A 4HBNA 2XAQA 2IU3A 2QA4V 4NR1A 1AR5A 3AG3C 1M57C 2XOKG 4HAMA 1J5EO 4DRXB 1COWG 1N33B 3CSXA 2RQ6A 3QTCA 5KHIA 2Y69B 3GWKC 2E5LB 2HG5C 1EN4A 3HKBA 1MG1A 4JI7B 1QQCA 3BA8A 5IWAO 4PA9A 3BA9A 1VQPV 5B5EZ 1DTOA 5LP6A 4I4TA 3ABKB 3SJAC 4WFAV 4JYAO 1JMKC 1IBKO 1K4CC 4UVBA 2BOCC 1K8AW 4P2ZA 1TGOA 1QCEA 2H94A 2UU9B 1I5YA 3ZHSA 3C3TA 4OPHA 1NS1A 4DR1B 2AZ0A 2JS5A 1Y76B 3AG4C 4H0LB 3IJ4A 2IW5A 4O2BA 1N33O 4O2AB 2PY5A 2QM7A 3W7SA 1JR9A 4NTWA 1VF5B 2WA4A 3JAWA 2E5LO 4LBEC 5LXTA 2JK5C 3CRRA 3CMAV 4DV6B 1CP9A 2BTQB 5CA1B 1SA0B 4PV1B 3RVYA 2HJDA 1BE3H 2R72A 1IDSA 1YEWA 5J9PC 2CH7A 3OR6C 2JJ2G 4RAIA 4BR6A 3JASA 1UFIA 3C90A 1X59A 3D3QA 5ITZA 2UU9O 2LFSA 1XUQA 4DR1O 1VF6A 3OR7C 3OMIB 3HKBB 3DGEA 4YIPA 1SQXH 1PD3A 3GB7C 2C2AA 3I56V 1GKFA 1K92A 1XOUA 2L35A 4NXMB 3Q4HA 3T1CA 1XI1A 2ZIOA 5LP6B 1FPOA 1IX9A 4I4TB 5BY1A 1LUVA 4G27B 4DV6O 1Q6IA 5A2QN 2Y69C 4UCRA 4Q6GA 1VF7A 1EM1A 4GCZA 3CCMV 3P3PA 1F4NA 4JAAA 3SGIA 3ZN1A 2OTJV 4TWKA 1FFXA 4O4JA 2V1DA 3ABKC 4MVZA 3OM3B 3G4SV 4O2BB 1PL0A 4FLUA 2QM4A 4L8JA 2ZE5A 1VQMV 2ZR2A 1WPXA 3LNMB 5LXTB 4LF7B 2LO1A 3AK2A 3T1YB 4DK0A 4UV8A 3S3WA 4NXMO 3E83A 3HB3B 3B2EE 3AK1A 2CH7B 4Q20A 1JJOA 2DJVA 1I94B 3JASB 3DC6A 3ZMTA 3B8NA 3CHXA 1HDJA 3P30A 5ITZB 1AI4A 1L1FA 3WB1A 2PI4A 4E2LA 3DXRB 2NLJC 2A3QA 2IH1C 2HHHB 4A5UB 1GM8A 5FL7G 4EKWA 2DYSC 2OYQA 1P7GA 1NT2B 4U3FH 4GUNA 3ZN0A 1FJGB 1SQPH 3BFRA 3Q4HB 2Q69A 1GH6A 1SERA 4LC1A 4LF7O 2P4VA 3ETEA 1N32B 1IXMA 2AHZA 3T1YO 3DC5A 1QU7A 5EBMC 2WLJA 4X20A 4J7JA 3OGCC 1WA8A 3I5DA 3SPJA 1I94O 4F4LA 1NVPB 2M6YA 1NR7A 4CS4A 5LP6C 1DGSA 1FFXB 4O4JB 1TUBA 5J2UA 4JAVA 2JGDA 4FJCC 2HHHO 5EZYA 3F5WC 1T5EA 1YTFD 4LFCB 1P4RA 3SPCA 1F51A 5GW7A 5B1OA 1UJWB 1FJGO 2PTMA 1KKCA 2W0XA 1BHAA 2Q5ZA 3K3WA 1W0KG 5BMVA 3H1JH 1N32O 4GLXA 4JZ2A 2NR5A 2P22C 5LMNB 5IE9A 2YS8A 4ABMA 4WBNA 1EN6A 3QVNA 1W2BU 5KUKA 3BHPA 3T4ZA 3CC2V 2P90A 1H2NA 5JJEB 1KC8W 5IJ9A 4GZRB 1OCCB 2X6CA 1VQ5V 2YC0A 2LW1A 2YI8A 3CCEV 2N04A 2VS0A 5LHIA 4WFHA 3L9DA 1K73W 2JEUA 2UXDB 4LFCO 4DW1A 4QJFB 1QVFU 4UVCA 1VF6C 4XDKA 5L3CA 3TK1A 1Q7YW 2DQ0A 1FS0G 4X20B 3EFFK 3FAVA 1ZLZA 1HNZB 1WA8B 2DWDC 1VMGA 4PA7A 2CTRA 2OIEA 4RUEA 3CS5A 4IL6Z 5LMNO 3MD0A 3SPHA 1TUBB 2AXTZ 5J2UB 1KKDA 2JGDB 1SQGA 3RFRA 3LDEA 2XNDG 4R50A 3JALA 4FZ1A 5EZYB 1WP8A 4RUFA 2CUGA 2E3CA 2JIZG 3E8HA 3JSNA 4PD4F 5EYPA 3OMNB 1K9MW 1QR9A 4X1IA 2UXDO 5LHHA 1AJQA 2LQTA 1NU1H 4LF6B 5BMVB 3H01A 4DR5B
chains in the Genus database with same CATH topology
4J9ZB 2ZD9A 4MTOA 2HFEC 5B3SB 3SYAA 2ZXWC 4TSFG 3AG4B 4GX1A 3K0DA 2M7WA 2F43G 3K08A 2P7TC 4WFGA 3LUTB 4J9YB 3ZCCA 3D3IA 4QIWF 3FB8C 1E1QG 1KECA 1NH2B 2WSSG 1ZWIC 3CD6V 3CYOA 4QE9A 2LP7A 1JCHA 2EIKC 4R8CA 3FB6C 4ZKIA 1XL6A 3OEHG 5CMUA 1TUEB 5LBQA 2WLMA 4U7NA 1RM1B 1VQ9V 4ZBMA 3VBBA 3OUFA 3CC7V 2X6BA 5L3BA 1YJ9V 3OAAG 4JYCA 1P7BA 1Q81W 1GO3F 2IJHA 1B6QA 1PNMA 1MSWD 2IJKA 4MVUA 3X2QC 1PKXA 1E1RG 5IY5C 2H8PC 2ZDIC 1VQLV 4GX5A 2Q6AA 1EBOA 4RO2A 3CPWU 3A0RA 1OCCC 3K04A 1JQ0A 4L87A 3CCQV 2W6IG 3CCRV 1F4MA 2ZQMA 2EIMB 3ZRWA 3QO5A 1R3JC 1K5SA 3JCZA 1AROP 2K1EA 3LSSA 3T4DA 5CBGA 5IY5B 4PELA 4GX0A 2QM8A 2XAQA 2IU3A 4TT3G 2QKSA 1FXVA 2QA4V 5HFLA 2EZOA 4CZZA 1RPOA 2WLLA 3AG3C 3FB5C 1M57C 1V55B 2XOKG 3MHHC 4HAMA 1COWG 5LGUA 3E8BA 1R3KC 3CCVV 3WG7B 2Y69B 2KB1A 3ABUA 1M9NA 2ITDC 1YI2V 3DTUB 1VQ8V 1GMGA 2HG5C 2MK3A 3FB7C 1GK9A 2W6JG 2IJJA 1MG1A 1Y66A 3OUSA 1BMFG 1J95A 4PDLA 2XAFA 4JTDB 2WLNA 1OHHG 4PA9A 3CCSV 1VQPV 1N8RW 3W7XA 3CC4V 2EILB 4BIUA 2EBOA 1RPRA 1DTOA 4JF3A 4MT8A 2EIJC 4WF9V 3ABKB 3ABLB 3ABMB 5KUMA 4WFAV 4N21A 2HVJC 1K4CC 4QPKA 4UVBA 2R9IA 3ZRSA 1FXKA 2JEXA 2BOCC 1K8AW 4P2ZA 4JAUA 3G6EV 1QCEA 2DYRB 2H94A 4UXNA 5IYCO 3JD4A 4PDVA 1I5YA 4MS2A 3ZMSA 3IFXA 4OXSA 1KP2A 5H6QA 4P9OA 1ROPA 1H8EG 3AG4C 4MSWC 3K06A 1NH2D 2IW5A 3AG1B 4G28B 4R6ZA 2A9HA 3W7TA 2QM7A 1OZ0A 2GHYA 3W7SA 3K0GA 4P9PA 2OCCB 2GSMB 4XDLA 1AI6A 3K03A 4LBEC 4X8AA 5E1AC 1K3EA 2JK5C 1RM1C 1THZA 3CMAV 1CP9A 2ZR3A 1BL8A 3SPGA 4MW3A 3CCLV 2DWEC 3NXSA 3ZJZA 3RVYA 1DLBA 5H9CA 1ENVA 3ZRWB 4X89A 3E8GA 3JYCA 5J9PC 3OR6C 2JJ2G 4KUMA 4RAIA 5EK0A 3CCUV 4PDRA 1H8HG 4LCUC 2CK3G 1ORQC 4JYBA 1FXHA 1KP3A 4H37A 1S77D 1S0VA 2WLLB 1K97A 1CEZA 4BIZA 4LP8A 5KA5A 1H2GA 4MVRA 4WCEV 2Y48A 4FPPA 2LFSA 2EIMC 1CPYA 4X88A 4WFFA 1AJNA 4FMTA 5LGNA 1FXKC 1QR8A 3OR7C 3OMIB 2X0LA 3ETGA 3DGEA 2XAHA 1PD3A 3OMAB 3GB7C 3SYCA 3IGAC 2C2AA 1K7DA 2A79B 4PDMA 3KG2A 2JDIG 3I56V 1GKFA 4BW5A 1V55C 1K92A 1V54B 1S3JA 1M56B 4JPRA 1R6NA 3STLC 3T1CA 1E79G 4G27B 4QE7A 3WG7C 4XBFA 5LGTA 1M90W 2XASA 2Y69C 1Y4MA 1FXKB 5CA3A 4GCZA 3CCMV 1VQ4V 1S76D 3WFVA 1F4NA 3MHSC 2X6AA 3ZMUA 3K79A 1JOYA 2OT5A 2EILC 3ZN1A 4DXWA 1YTFB 2OTJV 1FFTB 3OEEG 4TWKA 3CMEV 4JTCB 2QTOA 2V1DA 3ABKC 3ABLC 3ABMC 3ETDA 4MVZA 4MTGA 3RBZA 3OM3B 3D36A 5IYDO 4MTFA 1PNKA 3FYEB 3G4SV 5C93A 3K9AA 2DW4A 1PL0A 3W7UA 5DM6V 1SRYA 1DF5A 2X7RB 3BY6A 2OTLV 2DQ3A 2DYRC 3F7YC 1VQMV 2ZR2A 4MVMA 1YSCA 1WPXA 3LNMB 3ASNB 2YSUB 2LFRA 5EC1C 1S72V 1W0JG 3VOUA 1DF4A 2WPDG 4QNHB 4WFEA 4YXWG 1VQKV 2WAMA 2JJ1G 4UV9A 4UV8A 4MVSA 1JPXA 3E83A 3HB3B 3QO7A 3AG1C 4ASUG 5B1BB 5B1AB 4Q20A 1VQNV 4GT1A 2OCCC 2EINB 2B1IA 1R3IC 2HLDG 1S5HC 3ZMTA 1EFRG 3B8NA 4G2KA 1G4YB 3P30A 4HZ3A 4DO2A 2WLIA 3CCJV 5L3EA 5KA6A 1Q86W 1NJIW 4U7OA 1AI4A 3PJSK 1H38A 4WFBV 1L1FA 2R9RB 5L3FA 2PI4A 4E2LA 2UXXA 2NLJC 5DN6G 2IH1C 2Q68A 1GM8A 3JD3A 5FL7G 4RQFA 2HR3A 4EKWA 5CBFA 2AHYA 2DYSC 4UUJC 1QLEB 1AI7A 1EZJA 1R6KA 4I9WA 2ITCC 1YIJV 3ZN0A 4MVQA 5LHGA 2B1GA 1SESA 2Q69A 1SERA 3B8MA 5EC2C 4MVOA 4LC1A 3F7VC 3JD2A 3CP1A 5HFMA 3ETEA 1IXMA 4N23A 2AHZA 4P30A 3ABTA 3LSQA 1YHQV 2PI5A 3ZMVA 1VQ7V 4HYOA 2ATKC 3AG2B 4Z1MG 1F23A 2YEVA 5IDJA 3ASOB 5EBMC 5CBHA 2WLJA 2DYSB 2IH3C 2P67A 3OGCC 2HJFC 1R73A 3SPJA 1QBZA 4F4LA 1NVPB 2Q67A 1V54C 2EZPA 3E86A 1M56C 1R3LC 1NR7A 5L3GA 1PNLA 4H33A 4PA6A 2BOBC 1OCZB 4JAVA 5L3DA 3STZC 1AI5A 2WLKA 5CN0A 1GTOA 1NBMG 4FJCC 4JTAB 4FK5C 1JJ2U 3LDDA 2ZXWB 3F5WC 3CXCU 3AEIA 1YTFD 1LNQA 3ML0A 1P4RA 3SPIA 2HVKC 2A0LA 3B77A 3SPCA 1F51A 1G8MA 2Z5UA 4R7CA 5GW7A 1YJNV 2D3OW 2FTKA 1JVMA 1KQSU 5B1OA 3ZRXA 4PA4A 1UJWB 2EIKB 1NKDA 1BHAA 4JGSA 4QPJA 2Z3YA 2P6JA 2NNUA 3K3WA 5BZBA 1W0KG 3EHBB 2V7QG 4BAYA 3RVZA 3SYQA 3GWOA 5EBWC 1OCRC 1GM9A 1QVGU 3ASNC 3OE7G 1SETA 3BEHA 3JD1A 1K4DC 1MABG 2QEXV 2WLIB 3X2QB 1W2BU 4XDJA 5KUKA 1JX9A 1AJPA 2WWWA 3UM7A 3T4ZA 2XAJA 3CC2V 2P90A 5B1BC 5B1AC 1KC8W 4RQEA 3R65A 1OCCB 2X6CA 2EINC 1VQ5V 1OCRB 1BHBA 3OW2U 2XAGA 3OFNG 3UKMA 3CCEV 4MW8A 5LHIA 3E2EA 4KP4A 4WFHA 3JD0A 1K34A 1XL4A 4JASA 3SYOA 1K73W 2JEUA 4PA3A 4UVAA 2IU0A 1I5XA 4QJFB 2HKOA 1NR1A 4FIPC 1QVFU 3W7WA 1QLNA 4UVCA 1K33A 1M1KW 3M99B 1VQOV 1GM7A 4XDKA 3AG3B 3TCUA 1K5QA 1M57B 1OCOC 5H6RA 2YEVB 5L3CA 3TK1A 3ZRVA 3E8FA 1YJWV 2DQ0A 1Q7YW 1FS0G 3QNEA 3EFFK 5IYBO 1MOFA 3E35A 2DWDC 1SZTA 4I5SA 1KD1W 4PA7A 1QLEC 1Q82W 3RW0A 4RUEA 5B1NA 2B5UA 2ZDIA 3MD0A 3SPHA 3P32A 3ZIAG 2W0FC 1KKDA 3E89A 1OCOB 2QE7G 3LDCA 3AG2C 1WLEA 1YITV 3ASOC 3FKSG 3TETA 4CBCA 3G71V 3LDEA 5EBLC 2XNDG 3T2MA 2EJRA 2EIJB 4R50A 1NQTA 1NVPD 5B3SC 4RUFA 3QO8A 1HWYA 2WLHA 2JIZG 3E8HA 3SYPA 3ZMZA 3HPLC 1AR1B 3OMNB 3SJQC 1K9MW 4GX2A 1QR9A 2UXNA 1OCZC 2IJIA 5LHHA 1AJQA 1VQ6V 4MTXA 3FYIB 3I55V 3IC7A 3H01A 4KFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9Z B;  2HVK C;  2ZD9 A;  2A0L A;  2HFE C;  4MTO A;  3SPC A;  4R7C A;  3SYA A;  2ZXW C;  4PDV A;  1JVM A;  4GX1 A;  4MS2 A;  3IFX A;  3K0D A;  4PA4 A;  4OXS A;  2DYR C;  3K08 A;  2P7T C;  3F7Y C;  4P9O A;  3LUT B;  4WFG A;  4J9Y B;  4MVM A;  3LNM B;  3FB8 C;  5BZB A;  5EC1 C;  3AG4 C;  3VOU A;  4MSW C;  1ZWI C;  3K06 A;  4QE9 A;  3RVZ A;  3SYQ A;  4QNH B;  4WFE A;  2EIK C;  4G28 B;  4R6Z A;  4R8C A;  1OCR C;  2A9H A;  3FB6 C;  1XL6 A;  5EBW C;  3ASN C;  3K0G A;  4P9P A;  4MVS A;  2WLM A;  3BEH A;  1K4D C;  3E83 A;  4ZBM A;  3AG1 C;  4XDL A;  3OUF A;  3K03 A;  2WLI B;  4LBE C;  2X6B A;  4XDJ A;  5KUK A;  4X8A A;  5E1A C;  2OCC C;  2JK5 C;  1P7B A;  3UM7 A;  3T4Z A;  1R3I C;  1BL8 A;  3SPG A;  1S5H C;  4MW3 A;  5B1B C;  5B1A C;  4MVU A;  3X2Q C;  2DWE C;  3R65 A;  3ZJZ A;  3RVY A;  2X6C A;  5IY5 C;  2EIN C;  1G4Y B;  2H8P C;  4X89 A;  3E8G A;  4HZ3 A;  3JYC A;  4GX5 A;  2WLI A;  5J9P C;  2Q6A A;  3OR6 C;  4RO2 A;  3PJS K;  4RAI A;  5EK0 A;  3UKM A;  1OCC C;  4MW8 A;  4PDR A;  4LCU C;  3K04 A;  1ORQ C;  2R9R B;  4WFH A;  1XL4 A;  2NLJ C;  3SYO A;  4H37 A;  2IH1 C;  2WLL B;  4PA3 A;  2Q68 A;  1R3J C;  4EKW A;  5CBF A;  2K1E A;  4LP8 A;  2AHY A;  2DYS C;  3T4D A;  5CBG A;  4XDK A;  4UUJ C;  4MVR A;  4GX0 A;  3TCU A;  4I9W A;  1OCO C;  2EIM C;  2ITC C;  2QKS A;  3E8F A;  4MVQ A;  4X88 A;  3EFF K;  4WFF A;  2Q69 A;  2DWD C;  2WLL A;  3AG3 C;  3FB5 C;  4MVO A;  1M57 C;  1QLE C;  3F7V C;  3OR7 C;  4PA7 A;  5EC2 C;  2AHZ A;  3RW0 A;  4P30 A;  4RUE A;  3GB7 C;  3SYC A;  3IGA C;  2A79 B;  4PDM A;  3KG2 A;  2ATK C;  3E8B A;  4HYO A;  3SPH A;  2YEV A;  1R3K C;  5EBM C;  1V55 C;  4BW5 A;  5CBH A;  2WLJ A;  2IH3 C;  2W0F C;  2KB1 A;  3OGC C;  3STL C;  3T1C A;  2HJF C;  1KKD A;  2ITD C;  3E89 A;  3LDC A;  2HG5 C;  3AG2 C;  3SPJ A;  4G27 B;  3ASO C;  3FB7 C;  4QE7 A;  3WG7 C;  4F4L A;  2Q67 A;  1V54 C;  3E86 A;  2Y69 C;  1M56 C;  4CBC A;  3TET A;  3LDE A;  1R3L C;  5EBL C;  3OUS A;  4PDL A;  1J95 A;  4R50 A;  3T2M A;  5B3S C;  4JTD B;  2WLN A;  4PA9 A;  4RUF A;  4H33 A;  4PA6 A;  2WLH A;  2BOB C;  3E8H A;  3STZ C;  2WLK A;  2EIJ C;  3SYP A;  3HPL C;  2X6A A;  5KUM A;  3SJQ C;  4GX2 A;  2HVJ C;  4JTA B;  2EIL C;  1K4C C;  4DXW A;  1OCZ C;  3ZRS A;  3LDD A;  4TWK A;  2BOC C;  4JTC B;  3F5W C;  2QTO A;  3ABK C;  3ABL C;  4MVZ A;  3ABM C;  4MTG A;  4P2Z A;  3RBZ A;  1LNQ A;  4KFM A;  4MTF A;  3SPI A; 
#chains in the Genus database with same CATH topology
 4J9Z B;  2ZD9 A;  3BCC H;  2HFE C;  2KQX A;  3SYA A;  3T1H B;  2A7W A;  2QJ1 A;  4J7K A;  4UCT A;  2FB5 A;  3VQY A;  2F43 G;  2Q8V A;  2P7T C;  1HNZ O;  4WBN B;  3BAA A;  5K1P A;  1M5I A;  4JI5 B;  2Q7G A;  2OCH A;  2VWJ A;  1KUQ A;  1KBH A;  1U97 A;  5IJ9 B;  1VQ9 V;  4U7N A;  2VQF B;  2X6B A;  1YJ9 V;  4JYC A;  5IYZ A;  1B6Q A;  1PNM A;  2IJK A;  2OWO A;  1PKX A;  1Y74 A;  3CRC A;  4J11 A;  1VQL V;  3A0R A;  1OCC C;  4L87 A;  2W6I G;  3CCR V;  4X1Y A;  1AVM A;  3FAV B;  2E75 B;  3C3S A;  2RCV A;  2Q73 A;  4DW0 A;  4LF6 O;  4DR5 O;  1HW7 A;  3QO5 A;  1ARO P;  3T1H O;  3LSS A;  3T4D A;  5IY5 B;  2YID A;  4DR4 B;  2QKS A;  1OJH A;  3SDL A;  2EZO A;  4JI5 O;  3JCU Z;  4GKK B;  1GRJ A;  4CZZ A;  4J10 A;  1MZF A;  5LOV A;  4UCV A;  1MA1 A;  3JAL B;  4LF4 B;  2VQF O;  2XTA A;  1M9N A;  4JYY A;  1I08 A;  2MK3 A;  5EYP B;  2DOS A;  1GK9 A;  4IYI A;  1IZ3 A;  1MMM A;  4KHP B;  1J95 A;  4X1I B;  3JSL A;  3CCS V;  3W7X A;  1Q8I A;  2IM9 A;  4CH4 A;  5KMG A;  4MT8 A;  4LWS A;  2F93 B;  3LNN A;  4N21 A;  2FYU H;  3HKD A;  1YZB A;  4QPK A;  4TQD A;  2JEX A;  2P4K A;  1S5L Z;  2F95 B;  4J41 A;  4UXN A;  4DR4 O;  2EUL A;  3JD4 A;  4PDV A;  5H6Q A;  4K8X A;  1YDX A;  4P9O A;  1ROP A;  4GKK O;  4MSW C;  3K06 A;  1VAR A;  5IYZ B;  3AG1 B;  4G28 B;  5TIS Z;  4LF4 O;  1WP7 A;  1XNR B;  1Y74 B;  4JI3 B;  3K03 A;  4X8A A;  5E1A C;  4KHP O;  3SPG A;  1SQF A;  4X1Y B;  3NXS A;  2K9P A;  1ENV A;  4X89 A;  3JYC A;  1AB3 A;  1HR0 B;  4LCU C;  1ORQ C;  1TVK A;  4H37 A;  1K97 A;  4BIZ A;  1Y76 A;  5LOV B;  2ZNJ A;  4MVR A;  2KKW A;  4IGG A;  4WFF A;  2LW7 A;  4FMT A;  5LGN A;  4FFK A;  1FXK C;  3ETG A;  2CGN A;  2XAH A;  3OMA B;  3SYC A;  2A79 B;  4PDM A;  1XNR O;  1Q90 D;  4F6E A;  3DSQ A;  4JI3 O;  4O4H A;  4JPR A;  1E79 G;  5KMG B;  4LWS B;  3ZBH A;  4DR6 B;  4PHZ A;  5LGT A;  1M90 W;  2PYJ A;  5CA0 A;  1PPJ H;  1Y4M A;  3HKD B;  3R66 A;  5CA3 A;  3PN1 A;  2D2C B;  4NXN B;  4JI8 B;  1S76 D;  3WFV A;  3HKE A;  1HR0 O;  2X6A A;  1JOY A;  2OT5 A;  1YXB A;  3CJH A;  2YDE A;  2CAZ C;  3OEE G;  3CME V;  4JTC B;  3U11 A;  3KCY A;  4MTG A;  1PNK A;  2DW4 A;  3W7U A;  1DF5 A;  2X7R B;  2OTL V;  2DQ3 A;  3ETQ A;  4TQF A;  2CTP A;  4CS2 A;  3ASN B;  4D6T H;  1W0J G;  1DF4 A;  2BSK A;  3FFQ A;  1VQK V;  2GTS A;  4K35 A;  1WB7 A;  2WAM A;  3ZHT A;  1JPX A;  4JI1 B;  1ZL8 A;  3AG1 C;  5B1A B;  3A8T A;  4DR6 O;  2EIN B;  5LMU B;  1TVK B;  4NXN O;  1EFR G;  4JI8 O;  4HZ3 A;  4DO2 A;  4YIO A;  3RWR D;  2WLI A;  1Q86 W;  1NJI W;  1Q43 A;  1GN2 A;  3PJS K;  3AK3 A;  4EFB A;  3L75 H;  5DN6 G;  2Q68 A;  2A06 H;  4B3R B;  3N27 A;  4UUJ C;  5KHH A;  1QLE B;  4I9W A;  1R6K A;  3L72 H;  2YIB D;  4NYK A;  4O4H B;  3CB2 A;  2B1G A;  4TV8 A;  2QWN B;  3E22 A;  3F7V C;  4FM2 A;  5HFM A;  2FML A;  5CA0 B;  4I55 A;  1Q5O A;  3SJB C;  2ATK C;  3ZHU A;  4Z1M G;  4JI1 O;  1F23 A;  5IDJ A;  5CBH A;  2DYS B;  2IH3 C;  3TJT A;  3HKE B;  1LR1 A;  1QBZ A;  5LMU O;  2Q67 A;  3CJH B;  1R6T A;  5L3G A;  3DXR A;  2QGN A;  4H33 A;  4JI6 B;  2ZM6 B;  2BOB C;  3STZ C;  1BCC H;  1AI5 A;  4TOI A;  5CN0 A;  4CH3 A;  4JTA B;  4LR3 A;  5AG2 A;  1JJ2 U;  4B3S B;  2G38 A;  3G80 A;  1LNQ A;  4B3R O;  2RN9 A;  3CEI A;  1Y6X A;  2BSK B;  2HVK C;  1N34 B;  2A0L A;  3B77 A;  3ZHR A;  1JVM A;  4U3J A;  3UCS C;  5JWP A;  1ZL8 B;  4JGS A;  1YF2 A;  4QPJ A;  4BAY A;  1G1X B;  2YIA A;  1OCR C;  3ASN C;  3JAK A;  3OE7 G;  1SET A;  1K4D C;  3U10 A;  1X4T A;  3CRQ A;  2QEX V;  2WLI B;  4XDJ A;  2WWW A;  3UM7 A;  5B1A C;  1XBL A;  4JI6 O;  2EIN C;  2ZM6 O;  4X64 B;  4ZI7 A;  1A32 A;  1BHB A;  1IBL B;  1Q3E A;  1B3Q A;  2ZE7 A;  4B3S O;  3IC9 A;  4TV8 B;  2PF4 E;  4PA3 A;  3E22 B;  1I5X A;  1IUR A;  4IHJ A;  1N34 O;  4B3T B;  1HNW B;  3EXA A;  3VQV A;  3KKY A;  1GM7 A;  4I55 B;  3TCU A;  1OCO C;  1MOF A;  3E35 A;  2ZNI A;  4I5S A;  1KD1 W;  4CH6 A;  1QLE C;  1UPG A;  2WA3 A;  2ETN A;  4FFB A;  2YI9 A;  1L0N H;  3J7A U;  2B5U A;  4ZHQ A;  1YVW A;  3K5M A;  1B04 A;  1KYO F;  1SQQ H;  3A2F A;  3ZX6 A;  1MNG A;  3FKS G;  3TET A;  5JJN B;  1NVP D;  4X64 O;  1IBL O;  4X65 O;  3O65 A;  1AR1 B;  4U3J B;  1DK1 A;  5D5Q A;  2BTO A;  2IJI A;  5EIB D;  4B3T O;  1HNW O;  2GUZ A;  4MTO A;  1US6 A;  3JAK B;  1FD9 A;  2M7W A;  1FAF A;  3K08 A;  1SC5 B;  4J9Y B;  3ZCC A;  4QIW F;  3FB8 C;  1NH2 B;  3AG7 A;  5FNV A;  4BIO A;  4E4E A;  3CYO A;  1KB9 F;  4DV1 B;  5JH7 A;  1CXZ B;  4R8C A;  4DR7 B;  2PUS A;  1TUE B;  5LBQ A;  4DV0 B;  4DV5 B;  4NB5 A;  1Z5V A;  3VBB A;  1WN7 A;  3UO3 A;  3OUF A;  1H2K A;  4ZI7 B;  5L3B A;  4I7Z B;  2QWR B;  1JFF A;  1GO3 F;  2IJH A;  1MSW D;  1Y67 A;  2E76 B;  2QKC A;  4IHJ B;  1BSM A;  3KCX A;  4GX5 A;  3CPW U;  4YY3 B;  1JQ0 A;  1VIB A;  1R3J C;  2EX3 A;  3JCZ A;  4FFB B;  1MZE A;  5CBG A;  4F6R A;  4W4K A;  4CC5 A;  4PEL A;  1LUW A;  2QM8 A;  4UCO A;  1AR4 A;  3LSU A;  4ZHQ B;  3RYH A;  5HFL A;  1SZX A;  3SJC C;  2WLL A;  4DV1 O;  1V55 B;  1G6U A;  1NTM H;  3ZHV A;  3RYI A;  4DR7 O;  5H5N A;  4GKJ B;  5LGU A;  4DV0 O;  4DV5 O;  3E8B A;  1R3K C;  3WG7 B;  1RFY A;  5KX5 A;  1VQ8 V;  1GMG A;  1SS3 A;  4X9Q A;  3FB7 C;  1XHX A;  4PDL A;  1H2L A;  2XAF A;  4GYC B;  1XNQ B;  2WLN A;  1OHH G;  1N8R W;  2EIL B;  1U96 A;  2GUZ B;  4JF3 A;  4WF9 V;  4HNA A;  3ABL B;  4YY3 O;  3ABM B;  5KUM A;  1BS3 A;  4JI0 B;  2E74 B;  2R9I A;  3ZRS A;  1FXK A;  4LFA B;  5FNV B;  3N2G A;  3G6E V;  2DYR B;  5JH7 B;  4MS2 A;  3ZMS A;  4X62 B;  1Q6H A;  3IFX A;  4OXS A;  2YXH A;  3B09 A;  3THO A;  4DR2 B;  1BQZ A;  1JFF B;  4GKJ O;  2A9H A;  2ODM A;  3U0Z A;  3W7T A;  1OZ0 A;  1O9H A;  3CE2 A;  3K0G A;  4P9P A;  1L0L H;  5LYJ A;  4YJ2 A;  3K5L A;  2GSM B;  2LGQ A;  3BPZ A;  1AI6 A;  1HNX B;  1VEW A;  1ZAU A;  2DN9 A;  5C8Y A;  1THZ A;  1N0N A;  2QWP B;  1BL8 A;  3CCL V;  1XNQ O;  2CTQ A;  5BR8 B;  3GVM A;  2GTA A;  4FLZ A;  3ICX A;  4AQY B;  4F6R B;  4KUM A;  4JI0 O;  1WAZ A;  4H44 B;  4PI2 A;  4PDR A;  1H8H G;  2CK3 G;  4LFA O;  1FXH A;  4I50 A;  3RYH B;  3L70 H;  5E79 Z;  4DUY B;  2WLL B;  4FLT A;  1CEZ A;  2NN4 A;  3RYI B;  5KA5 A;  4LFB B;  4X62 O;  4WCE V;  2CTW A;  2Y48 A;  4FPP A;  5KHG A;  3OTO B;  4X88 A;  1AJN A;  5KX5 B;  4DR2 O;  4LNU B;  1QR8 A;  2X0L A;  1P49 A;  3S3X A;  3IGA C;  1K7D A;  3H1I H;  1V55 C;  1M56 B;  1R6N A;  2B9Z A;  3STL C;  1HNX O;  4DV2 B;  2O57 A;  4HNA B;  4DUZ B;  3WG7 C;  3K5N A;  2XAS A;  1FXK B;  1H2S B;  5BR8 O;  1I7F A;  2IBZ H;  2F1M A;  3N2G B;  4KL1 A;  4AQY O;  3MHS C;  1PP9 H;  3K79 A;  2EIL C;  3TXQ A;  4DXW A;  2PYL A;  4DUY O;  1URF A;  3ABL C;  3ETD A;  3ABM C;  1N4C A;  5IYD O;  4MTF A;  3CWB H;  2Y0P A;  3FYE B;  5C93 A;  4LFB O;  1TAE A;  3K9A A;  4YJ3 A;  1SRY A;  5B66 Z;  3OTO O;  2DYR C;  4YJ2 B;  5LYJ B;  1PL4 A;  1BZK A;  4IYH A;  4FZ0 A;  1YSC A;  1FYJ A;  2YSU B;  2LFR A;  5EC1 C;  5C8Y B;  4WFE A;  1N36 B;  2PZS A;  2JJ1 G;  4UV9 A;  4MVS A;  4DV2 O;  3QO7 A;  4ASU G;  5B1B B;  3FX7 A;  4LH6 A;  4J7Z A;  4DUZ O;  4GT1 A;  2OIG A;  4I50 B;  5GTH Z;  2Z0A A;  3EVK A;  3CCJ V;  5L3E A;  5KA6 A;  4EB6 A;  4U7O A;  1H38 A;  4WFB V;  2R9R B;  4AI8 A;  1ZTE A;  5L3F A;  2UXX A;  5D5P A;  4BW9 A;  3JD3 A;  4RQF A;  5LL6 Y;  4B7E A;  2AHY A;  3P3N A;  1EZJ A;  3K59 A;  2ITC C;  4I9Q A;  5LHG A;  4MVQ A;  1XIL A;  3K58 A;  2CDY A;  3B8M A;  3JD2 A;  1D5A A;  3H1K H;  4P30 A;  1N36 O;  1XEQ A;  3ABT A;  3LSQ A;  1VQ7 V;  2GV9 A;  5KHJ A;  3ASO B;  3A0H Z;  2P67 A;  2HJF C;  2XUM A;  1JA8 A;  2RDC A;  3BAB A;  2RJZ A;  2EZP A;  1M56 C;  2UXC B;  3H1L H;  1R3L C;  2ZCE A;  1XQ8 A;  3K9S A;  1ZUQ A;  4FLV A;  5L3D A;  2ADP A;  2H3O A;  1L8D A;  4YJ3 B;  1GTO A;  1NBM G;  1MSD A;  4FM1 A;  2ADQ B;  3LDD A;  2ZXW B;  3L71 H;  3ML0 A;  2F4V B;  2JGU A;  1F7Y A;  1G8M A;  2Z5U A;  1YJN V;  2D3O W;  4EFE A;  5J2T A;  1KQS U;  3ZRX A;  3VQX A;  2EIK B;  2P6J A;  2P06 A;  3TXS A;  2V7Q G;  3RVZ A;  3J80 N;  1YCI A;  3GWO A;  5A9G A;  3OD4 A;  1NI8 A;  3BEH A;  5DED A;  3ZHQ A;  1KU9 A;  4UB6 Z;  2QTS A;  3X2Q B;  4EB6 B;  1I0H A;  1HP8 A;  2UXC O;  4UFZ A;  2JVD A;  1R1B A;  5B1B C;  3R65 A;  5JCO C;  1PV0 A;  1OCR B;  1PM9 A;  2XT9 A;  4OX9 B;  2XAG A;  2YIB A;  3UKM A;  2KSD A;  3E2E A;  4KP4 A;  2YXL A;  5BXZ A;  1XL4 A;  3SYO A;  5JJJ B;  1XMQ B;  2ZIM A;  1IXB A;  2KG7 A;  4QGP A;  4UVA A;  5DEC A;  2F4V O;  1WB8 A;  4FIP C;  1K33 A;  1M1K W;  3M99 B;  2UUB B;  5H6R A;  1S0V A;  1YJW V;  3ZRV A;  2HP8 A;  3QNE A;  5IYB O;  3JAM N;  1Q6U A;  1SZT A;  5F2V O;  4YHH B;  2GDS A;  3RYC A;  3P32 A;  2F66 C;  1AP6 A;  1OCO B;  2QE7 G;  3LDC A;  1EZV H;  1WLE A;  1YIT V;  4LF9 B;  3ASO C;  4CBC A;  3G71 V;  4DV3 B;  4DK1 A;  5EBL C;  2EIJ B;  1NQT A;  5B3S C;  3QO8 A;  2WLH A;  4OX9 O;  3L73 H;  2UUA B;  3ZMZ A;  5J2T B;  3SJQ C;  4GX2 A;  2UXN A;  2QDO A;  2UUC B;  5JQG A;  1XMQ O;  3FYI B;  3IC7 A;  1GN6 A;  1XHZ A;  4JI7 O;  2UUB O;  1P84 F;  2ZXW C;  1ZSP A;  2VRZ A;  4NKG B;  2VQE B;  4GX1 A;  5IT9 N;  3N2K A;  4BWA A;  1H2M A;  3D3I A;  2WSS G;  3RGB A;  1ZWI C;  3CD6 V;  4YHH O;  2EIK C;  4FLY A;  1XL6 A;  3OEH G;  2ILM A;  1AIL A;  2WLM A;  1RM1 B;  4LF9 O;  3OAA G;  1Q81 W;  4DV3 O;  2LGW A;  3RYF A;  3X2Q C;  2EJ7 A;  2KG7 B;  1E1R G;  4JV5 B;  2ZDI C;  2UUA O;  3WB2 A;  4FVM A;  2Q6A A;  1EBO A;  4RO2 A;  2PGG A;  3K04 A;  2UUC O;  2CGO A;  1AP5 A;  4J80 A;  5LA6 A;  3G6B A;  2ZQM A;  2EIM B;  3ZRW A;  1K5S A;  2K1E A;  5GON A;  2VQE O;  3RYC B;  4TT3 G;  1FXV A;  2N05 A;  3O9O A;  1KMI Z;  1RPO A;  3FB5 C;  3MHH C;  4OPA A;  4X65 B;  2GBO A;  1GAX A;  2QWQ B;  3CCV V;  2KB1 A;  1RSO A;  3ABU A;  3F5T A;  2ITD C;  1YI2 V;  3DTU B;  5CB4 A;  2ZIN A;  2W6J G;  2QR4 A;  2IJJ A;  3OT7 A;  1Y66 A;  3OUS A;  1BMF G;  3JAW B;  5JQG B;  4JTD B;  1WNS A;  3CC4 V;  4JV5 O;  4BIU A;  2EBO A;  2YUA A;  1RPR A;  2EIJ C;  4OGQ B;  4UCS A;  2HVJ C;  1Z5W A;  3N2K B;  4JAU A;  3UT5 A;  4B08 A;  5IYC O;  3BVO A;  4UCU A;  3CXH F;  4O4I A;  5FPO A;  1KP2 A;  4LF8 B;  2BE3 A;  1GN4 A;  1H8E G;  4CH5 A;  1SQV H;  2DE0 X;  1NH2 D;  4R6Z A;  4O4L A;  3RYF B;  3WB0 A;  2ZKO A;  3G67 A;  2GHY A;  2Q7E A;  2OCC B;  4FM0 A;  3IAY A;  4XDL A;  3JAT A;  1K3E A;  3CRM A;  1RM1 C;  2ZR3 A;  4MW3 A;  2DWE C;  4X66 B;  2JS3 A;  5LA6 B;  3ZJZ A;  1DLB A;  5H9C A;  1XMO B;  3ZRW B;  1BT8 A;  3E8G A;  1B06 A;  5GON B;  4CC6 A;  5EK0 A;  3CCU V;  4JYB A;  1FKA O;  1KP3 A;  1N0J A;  1S77 D;  3OGI B;  3OTF A;  5FLX N;  4DV4 B;  4LF5 B;  4AHC A;  4J42 A;  4LP8 A;  1H2G A;  2Q0O C;  1QHT A;  2EIM C;  4LF8 O;  1CPY A;  4JI4 B;  4IT5 A;  1RSO B;  3QF7 A;  4X1K A;  5CB4 B;  3B4S A;  5KAF Z;  2R9A A;  3CX5 F;  3K57 A;  2VWK A;  1SKV A;  3KG2 A;  2JDI G;  2UXB B;  4BW5 A;  1V54 B;  1S3J A;  4Z1V A;  3D8C A;  4QE7 A;  4XBF A;  4X66 O;  1D5N A;  2F23 A;  2P5O A;  1O9G A;  1XMO O;  1VQ4 V;  3UT5 B;  2Y4T A;  2DMX A;  3ZMU A;  4RWU A;  4DV7 B;  4O4I B;  1EN5 A;  1YTF B;  1FFT B;  2QTO A;  4JI2 B;  4DV4 O;  3RBZ A;  4LF5 O;  3D36 A;  2ZE8 A;  4LNU A;  4O4L B;  5DM6 V;  1NZ6 A;  1IBM B;  4JI4 O;  3BY6 A;  3F7Y C;  1RP3 B;  4MVM A;  3APQ A;  3JAT B;  1M93 A;  1S72 V;  3VOU A;  5JVD A;  3A0B Z;  2WPD G;  4QNH B;  4PJ0 Z;  4YXW G;  1W59 A;  2FKX A;  2ZT9 B;  2UXB O;  2L6L A;  3ZS8 C;  4Z2W A;  2Y4U A;  4LH7 A;  2Q4P A;  1VQN V;  2OCC C;  2B1I A;  2LJ2 A;  1NTK H;  1R3I C;  2HLD G;  1S5H C;  2RMK B;  1WJZ A;  4G2K A;  1G4Y B;  4CS3 A;  4DV7 O;  4JI2 O;  4D7S A;  4X1K B;  2AW9 A;  3APO A;  2Q0A A;  2HR3 A;  5CBF A;  1IBM O;  1AI7 A;  1YIJ V;  2R70 A;  1SQB H;  4ZIB A;  2JRI A;  1SES A;  4FLW A;  1XDC A;  5EC2 C;  4MVO A;  3CP1 A;  4N23 A;  2HEP A;  5JCO A;  1SF9 A;  1YHQ V;  2PI5 A;  3ZMV A;  4HYO A;  3AG2 B;  2YEV A;  3JAR A;  4IIJ A;  4TUY A;  4C7U A;  1R73 A;  5EIB C;  3HKC A;  4B3M B;  3E86 A;  1V54 C;  2Q7H A;  1S5J A;  3QG5 A;  1PNL A;  4UB8 Z;  4PA6 A;  1OCZ B;  4D7T A;  2WLK A;  3KZI Z;  1TA8 A;  2ARH A;  4FK5 C;  4ZOL A;  3WU2 Z;  1M4U A;  3AEI A;  3CXC U;  5JVD B;  3SPI A;  1WPB A;  4R7C A;  2FTK A;  3J81 N;  4PA4 A;  1NKD A;  2Z3Y A;  2NNU A;  2RNB A;  3EHB B;  5BZB A;  3SYQ A;  3RT3 C;  5EBW C;  1QVG U;  1GM9 A;  3UO2 A;  3JD1 A;  1MAB G;  1JX9 A;  4B3M O;  1AJP A;  2XAJ A;  1BQ0 A;  4RQE A;  3VQW A;  4AIL C;  3OW2 U;  2YXY A;  3OFN G;  5KAI Z;  1OV9 A;  4ICG A;  4MW8 A;  3B40 A;  4PI0 A;  5H2F Z;  3FD9 A;  3JD0 A;  5KHK A;  1K34 A;  4JAS A;  2QSA A;  4EEQ A;  2XHB A;  2IU0 A;  4DYL A;  1QLN A;  2HKO A;  1NR1 A;  3W7W A;  4K3A A;  3MAQ A;  4I0X A;  1VQO V;  1VP7 A;  4JZG A;  3MDS A;  2Y0I A;  3AG3 B;  1K5Q A;  1M57 B;  4B7K A;  2YEV B;  4W4L A;  3E8F A;  3JAR B;  4IIJ B;  5GTI Z;  4TV9 A;  4TUY B;  4K0K B;  5IJ0 A;  4K8Z A;  2QWO B;  3HKC B;  1Q82 W;  3RW0 A;  5B1N A;  1GN3 A;  1NTZ H;  2ZDI A;  3ZIA G;  2AGA A;  2W0F C;  4KXR A;  3E89 A;  3AG2 C;  3RN4 A;  4ZOL B;  4DRX A;  3HR0 A;  2EJR A;  3T2M A;  4NTX A;  1HWY A;  3H1H H;  1D2D A;  3SYP A;  3HPL C;  5FPR A;  3D36 C;  3M8A A;  1OCZ C;  1VQ6 V;  3ZED A;  4MTX A;  3BRC A;  5KLV H;  3I55 V;  4NVP A;  4DR3 B;  4KFM A;  3TGU H;  1V9P A;  1QNM A;  5B3S B;  2MW2 B;  4TSF G;  3AG4 B;  1XRE A;  3K0D A;  4K0K O;  2YIC A;  4WFG A;  3LUT B;  4H13 B;  1E1Q G;  1KEC A;  1ZX3 A;  5K1X A;  2BCC H;  4QE9 A;  1Z2G A;  2LP7 A;  1JCH A;  4ZKI A;  3FB6 C;  3SR2 C;  1J5E B;  5CMU A;  2QKA A;  3L74 H;  4FLX A;  3K5O A;  4ZBM A;  2Q9L A;  3M7M X;  3CC7 V;  3NR7 A;  1P7B A;  4O2A A;  4MVU A;  2AZ2 A;  5IY5 C;  5IWA B;  2H8P C;  4I0X B;  2N74 A;  2FL4 A;  2CE4 A;  4NTY A;  3CCQ V;  4JYA B;  2BTQ A;  1IBK B;  4TV9 B;  1F4M A;  5CA1 A;  1SA0 A;  2ZE6 A;  3H9V A;  5IJ0 B;  4DR3 O;  2V4D A;  1BGY H;  3CRA A;  1IVS A;  3UQ8 A;  4GX0 A;  4HBN A;  2XAQ A;  2IU3 A;  2QA4 V;  4NR1 A;  1AR5 A;  3AG3 C;  1M57 C;  2XOK G;  4HAM A;  1J5E O;  4DRX B;  1COW G;  1N33 B;  3CSX A;  2RQ6 A;  3QTC A;  5KHI A;  2Y69 B;  3GWK C;  2E5L B;  2HG5 C;  1EN4 A;  3HKB A;  1MG1 A;  4JI7 B;  1QQC A;  3BA8 A;  5IWA O;  4PA9 A;  3BA9 A;  1VQP V;  5B5E Z;  1DTO A;  5LP6 A;  4I4T A;  3ABK B;  3SJA C;  4WFA V;  4JYA O;  1JMK C;  1IBK O;  1K4C C;  4UVB A;  2BOC C;  1K8A W;  4P2Z A;  1TGO A;  1QCE A;  2H94 A;  2UU9 B;  1I5Y A;  3ZHS A;  3C3T A;  4OPH A;  1NS1 A;  4DR1 B;  2AZ0 A;  2JS5 A;  1Y76 B;  3AG4 C;  4H0L B;  3IJ4 A;  2IW5 A;  4O2B A;  1N33 O;  4O2A B;  2PY5 A;  2QM7 A;  3W7S A;  1JR9 A;  4NTW A;  1VF5 B;  2WA4 A;  3JAW A;  2E5L O;  4LBE C;  5LXT A;  2JK5 C;  3CRR A;  3CMA V;  4DV6 B;  1CP9 A;  2BTQ B;  5CA1 B;  1SA0 B;  4PV1 B;  3RVY A;  2HJD A;  1BE3 H;  2R72 A;  1IDS A;  1YEW A;  5J9P C;  2CH7 A;  3OR6 C;  2JJ2 G;  4RAI A;  4BR6 A;  3JAS A;  1UFI A;  3C90 A;  1X59 A;  3D3Q A;  5ITZ A;  2UU9 O;  2LFS A;  1XUQ A;  4DR1 O;  1VF6 A;  3OR7 C;  3OMI B;  3HKB B;  3DGE A;  4YIP A;  1SQX H;  1PD3 A;  3GB7 C;  2C2A A;  3I56 V;  1GKF A;  1K92 A;  1XOU A;  2L35 A;  4NXM B;  3Q4H A;  3T1C A;  1XI1 A;  2ZIO A;  5LP6 B;  1FPO A;  1IX9 A;  4I4T B;  5BY1 A;  1LUV A;  4G27 B;  4DV6 O;  1Q6I A;  5A2Q N;  2Y69 C;  4UCR A;  4Q6G A;  1VF7 A;  1EM1 A;  4GCZ A;  3CCM V;  3P3P A;  1F4N A;  4JAA A;  3SGI A;  3ZN1 A;  2OTJ V;  4TWK A;  1FFX A;  4O4J A;  2V1D A;  3ABK C;  4MVZ A;  3OM3 B;  3G4S V;  4O2B B;  1PL0 A;  4FLU A;  2QM4 A;  4L8J A;  2ZE5 A;  1VQM V;  2ZR2 A;  1WPX A;  3LNM B;  5LXT B;  4LF7 B;  2LO1 A;  3AK2 A;  3T1Y B;  4DK0 A;  4UV8 A;  3S3W A;  4NXM O;  3E83 A;  3HB3 B;  3B2E E;  3AK1 A;  2CH7 B;  4Q20 A;  1JJO A;  2DJV A;  1I94 B;  3JAS B;  3DC6 A;  3ZMT A;  3B8N A;  3CHX A;  1HDJ A;  3P30 A;  5ITZ B;  1AI4 A;  1L1F A;  3WB1 A;  2PI4 A;  4E2L A;  3DXR B;  2NLJ C;  2A3Q A;  2IH1 C;  2HHH B;  4A5U B;  1GM8 A;  5FL7 G;  4EKW A;  2DYS C;  2OYQ A;  1P7G A;  1NT2 B;  4U3F H;  4GUN A;  3ZN0 A;  1FJG B;  1SQP H;  3BFR A;  3Q4H B;  2Q69 A;  1GH6 A;  1SER A;  4LC1 A;  4LF7 O;  2P4V A;  3ETE A;  1N32 B;  1IXM A;  2AHZ A;  3T1Y O;  3DC5 A;  1QU7 A;  5EBM C;  2WLJ A;  4X20 A;  4J7J A;  3OGC C;  1WA8 A;  3I5D A;  3SPJ A;  1I94 O;  4F4L A;  1NVP B;  2M6Y A;  1NR7 A;  4CS4 A;  5LP6 C;  1DGS A;  1FFX B;  4O4J B;  1TUB A;  5J2U A;  4JAV A;  2JGD A;  4FJC C;  2HHH O;  5EZY A;  3F5W C;  1T5E A;  1YTF D;  4LFC B;  1P4R A;  3SPC A;  1F51 A;  5GW7 A;  5B1O A;  1UJW B;  1FJG O;  2PTM A;  1KKC A;  2W0X A;  1BHA A;  2Q5Z A;  3K3W A;  1W0K G;  5BMV A;  3H1J H;  1N32 O;  4GLX A;  4JZ2 A;  2NR5 A;  2P22 C;  5LMN B;  5IE9 A;  2YS8 A;  4ABM A;  4WBN A;  1EN6 A;  3QVN A;  1W2B U;  5KUK A;  3BHP A;  3T4Z A;  3CC2 V;  2P90 A;  1H2N A;  5JJE B;  1KC8 W;  5IJ9 A;  4GZR B;  1OCC B;  2X6C A;  1VQ5 V;  2YC0 A;  2LW1 A;  2YI8 A;  3CCE V;  2N04 A;  2VS0 A;  5LHI A;  4WFH A;  3L9D A;  1K73 W;  2JEU A;  2UXD B;  4LFC O;  4DW1 A;  4QJF B;  1QVF U;  4UVC A;  1VF6 C;  4XDK A;  5L3C A;  3TK1 A;  1Q7Y W;  2DQ0 A;  1FS0 G;  4X20 B;  3EFF K;  3FAV A;  1ZLZ A;  1HNZ B;  1WA8 B;  2DWD C;  1VMG A;  4PA7 A;  2CTR A;  2OIE A;  4RUE A;  3CS5 A;  4IL6 Z;  5LMN O;  3MD0 A;  3SPH A;  1TUB B;  2AXT Z;  5J2U B;  1KKD A;  2JGD B;  1SQG A;  3RFR A;  3LDE A;  2XND G;  4R50 A;  3JAL A;  4FZ1 A;  5EZY B;  1WP8 A;  4RUF A;  2CUG A;  2E3C A;  2JIZ G;  3E8H A;  3JSN A;  4PD4 F;  5EYP A;  3OMN B;  1K9M W;  1QR9 A;  4X1I A;  2UXD O;  5LHH A;  1AJQ A;  2LQT A;  1NU1 H;  4LF6 B;  5BMV B;  3H01 A;  4DR5 B; 
#chains in the Genus database with same CATH homology
 4J9Z B;  2ZD9 A;  4MTO A;  2HFE C;  5B3S B;  3SYA A;  2ZXW C;  4TSF G;  3AG4 B;  4GX1 A;  3K0D A;  2M7W A;  2F43 G;  3K08 A;  2P7T C;  4WFG A;  3LUT B;  4J9Y B;  3ZCC A;  3D3I A;  4QIW F;  3FB8 C;  1E1Q G;  1KEC A;  1NH2 B;  2WSS G;  1ZWI C;  3CD6 V;  3CYO A;  4QE9 A;  2LP7 A;  1JCH A;  2EIK C;  4R8C A;  3FB6 C;  4ZKI A;  1XL6 A;  3OEH G;  5CMU A;  1TUE B;  5LBQ A;  2WLM A;  4U7N A;  1RM1 B;  1VQ9 V;  4ZBM A;  3VBB A;  3OUF A;  3CC7 V;  2X6B A;  5L3B A;  1YJ9 V;  3OAA G;  4JYC A;  1P7B A;  1Q81 W;  1GO3 F;  2IJH A;  1B6Q A;  1PNM A;  1MSW D;  2IJK A;  4MVU A;  3X2Q C;  1PKX A;  1E1R G;  5IY5 C;  2H8P C;  2ZDI C;  1VQL V;  4GX5 A;  2Q6A A;  1EBO A;  4RO2 A;  3CPW U;  3A0R A;  1OCC C;  3K04 A;  1JQ0 A;  4L87 A;  3CCQ V;  2W6I G;  3CCR V;  1F4M A;  2ZQM A;  2EIM B;  3ZRW A;  3QO5 A;  1R3J C;  1K5S A;  3JCZ A;  1ARO P;  2K1E A;  3LSS A;  3T4D A;  5CBG A;  5IY5 B;  4PEL A;  4GX0 A;  2QM8 A;  2XAQ A;  2IU3 A;  4TT3 G;  2QKS A;  1FXV A;  2QA4 V;  5HFL A;  2EZO A;  4CZZ A;  1RPO A;  2WLL A;  3AG3 C;  3FB5 C;  1M57 C;  1V55 B;  2XOK G;  3MHH C;  4HAM A;  1COW G;  5LGU A;  3E8B A;  1R3K C;  3CCV V;  3WG7 B;  2Y69 B;  2KB1 A;  3ABU A;  1M9N A;  2ITD C;  1YI2 V;  3DTU B;  1VQ8 V;  1GMG A;  2HG5 C;  2MK3 A;  3FB7 C;  1GK9 A;  2W6J G;  2IJJ A;  1MG1 A;  1Y66 A;  3OUS A;  1BMF G;  1J95 A;  4PDL A;  2XAF A;  4JTD B;  2WLN A;  1OHH G;  4PA9 A;  3CCS V;  1VQP V;  1N8R W;  3W7X A;  3CC4 V;  2EIL B;  4BIU A;  2EBO A;  1RPR A;  1DTO A;  4JF3 A;  4MT8 A;  2EIJ C;  4WF9 V;  3ABK B;  3ABL B;  3ABM B;  5KUM A;  4WFA V;  4N21 A;  2HVJ C;  1K4C C;  4QPK A;  4UVB A;  2R9I A;  3ZRS A;  1FXK A;  2JEX A;  2BOC C;  1K8A W;  4P2Z A;  4JAU A;  3G6E V;  1QCE A;  2DYR B;  2H94 A;  4UXN A;  5IYC O;  3JD4 A;  4PDV A;  1I5Y A;  4MS2 A;  3ZMS A;  3IFX A;  4OXS A;  1KP2 A;  5H6Q A;  4P9O A;  1ROP A;  1H8E G;  3AG4 C;  4MSW C;  3K06 A;  1NH2 D;  2IW5 A;  3AG1 B;  4G28 B;  4R6Z A;  2A9H A;  3W7T A;  2QM7 A;  1OZ0 A;  2GHY A;  3W7S A;  3K0G A;  4P9P A;  2OCC B;  2GSM B;  4XDL A;  1AI6 A;  3K03 A;  4LBE C;  4X8A A;  5E1A C;  1K3E A;  2JK5 C;  1RM1 C;  1THZ A;  3CMA V;  1CP9 A;  2ZR3 A;  1BL8 A;  3SPG A;  4MW3 A;  3CCL V;  2DWE C;  3NXS A;  3ZJZ A;  3RVY A;  1DLB A;  5H9C A;  1ENV A;  3ZRW B;  4X89 A;  3E8G A;  3JYC A;  5J9P C;  3OR6 C;  2JJ2 G;  4KUM A;  4RAI A;  5EK0 A;  3CCU V;  4PDR A;  1H8H G;  4LCU C;  2CK3 G;  1ORQ C;  4JYB A;  1FXH A;  1KP3 A;  4H37 A;  1S77 D;  1S0V A;  2WLL B;  1K97 A;  1CEZ A;  4BIZ A;  4LP8 A;  5KA5 A;  1H2G A;  4MVR A;  4WCE V;  2Y48 A;  4FPP A;  2LFS A;  2EIM C;  1CPY A;  4X88 A;  4WFF A;  1AJN A;  4FMT A;  5LGN A;  1FXK C;  1QR8 A;  3OR7 C;  3OMI B;  2X0L A;  3ETG A;  3DGE A;  2XAH A;  1PD3 A;  3OMA B;  3GB7 C;  3SYC A;  3IGA C;  2C2A A;  1K7D A;  2A79 B;  4PDM A;  3KG2 A;  2JDI G;  3I56 V;  1GKF A;  4BW5 A;  1V55 C;  1K92 A;  1V54 B;  1S3J A;  1M56 B;  4JPR A;  1R6N A;  3STL C;  3T1C A;  1E79 G;  4G27 B;  4QE7 A;  3WG7 C;  4XBF A;  5LGT A;  1M90 W;  2XAS A;  2Y69 C;  1Y4M A;  1FXK B;  5CA3 A;  4GCZ A;  3CCM V;  1VQ4 V;  1S76 D;  3WFV A;  1F4N A;  3MHS C;  2X6A A;  3ZMU A;  3K79 A;  1JOY A;  2OT5 A;  2EIL C;  3ZN1 A;  4DXW A;  1YTF B;  2OTJ V;  1FFT B;  3OEE G;  4TWK A;  3CME V;  4JTC B;  2QTO A;  2V1D A;  3ABK C;  3ABL C;  3ABM C;  3ETD A;  4MVZ A;  4MTG A;  3RBZ A;  3OM3 B;  3D36 A;  5IYD O;  4MTF A;  1PNK A;  3FYE B;  3G4S V;  5C93 A;  3K9A A;  2DW4 A;  1PL0 A;  3W7U A;  5DM6 V;  1SRY A;  1DF5 A;  2X7R B;  3BY6 A;  2OTL V;  2DQ3 A;  2DYR C;  3F7Y C;  1VQM V;  2ZR2 A;  4MVM A;  1YSC A;  1WPX A;  3LNM B;  3ASN B;  2YSU B;  2LFR A;  5EC1 C;  1S72 V;  1W0J G;  3VOU A;  1DF4 A;  2WPD G;  4QNH B;  4WFE A;  4YXW G;  1VQK V;  2WAM A;  2JJ1 G;  4UV9 A;  4UV8 A;  4MVS A;  1JPX A;  3E83 A;  3HB3 B;  3QO7 A;  3AG1 C;  4ASU G;  5B1B B;  5B1A B;  4Q20 A;  1VQN V;  4GT1 A;  2OCC C;  2EIN B;  2B1I A;  1R3I C;  2HLD G;  1S5H C;  3ZMT A;  1EFR G;  3B8N A;  4G2K A;  1G4Y B;  3P30 A;  4HZ3 A;  4DO2 A;  2WLI A;  3CCJ V;  5L3E A;  5KA6 A;  1Q86 W;  1NJI W;  4U7O A;  1AI4 A;  3PJS K;  1H38 A;  4WFB V;  1L1F A;  2R9R B;  5L3F A;  2PI4 A;  4E2L A;  2UXX A;  2NLJ C;  5DN6 G;  2IH1 C;  2Q68 A;  1GM8 A;  3JD3 A;  5FL7 G;  4RQF A;  2HR3 A;  4EKW A;  5CBF A;  2AHY A;  2DYS C;  4UUJ C;  1QLE B;  1AI7 A;  1EZJ A;  1R6K A;  4I9W A;  2ITC C;  1YIJ V;  3ZN0 A;  4MVQ A;  5LHG A;  2B1G A;  1SES A;  2Q69 A;  1SER A;  3B8M A;  5EC2 C;  4MVO A;  4LC1 A;  3F7V C;  3JD2 A;  3CP1 A;  5HFM A;  3ETE A;  1IXM A;  4N23 A;  2AHZ A;  4P30 A;  3ABT A;  3LSQ A;  1YHQ V;  2PI5 A;  3ZMV A;  1VQ7 V;  4HYO A;  2ATK C;  3AG2 B;  4Z1M G;  1F23 A;  2YEV A;  5IDJ A;  3ASO B;  5EBM C;  5CBH A;  2WLJ A;  2DYS B;  2IH3 C;  2P67 A;  3OGC C;  2HJF C;  1R73 A;  3SPJ A;  1QBZ A;  4F4L A;  1NVP B;  2Q67 A;  1V54 C;  2EZP A;  3E86 A;  1M56 C;  1R3L C;  1NR7 A;  5L3G A;  1PNL A;  4H33 A;  4PA6 A;  2BOB C;  1OCZ B;  4JAV A;  5L3D A;  3STZ C;  1AI5 A;  2WLK A;  5CN0 A;  1GTO A;  1NBM G;  4FJC C;  4JTA B;  4FK5 C;  1JJ2 U;  3LDD A;  2ZXW B;  3F5W C;  3CXC U;  3AEI A;  1YTF D;  1LNQ A;  3ML0 A;  1P4R A;  3SPI A;  2HVK C;  2A0L A;  3B77 A;  3SPC A;  1F51 A;  1G8M A;  2Z5U A;  4R7C A;  5GW7 A;  1YJN V;  2D3O W;  2FTK A;  1JVM A;  1KQS U;  5B1O A;  3ZRX A;  4PA4 A;  1UJW B;  2EIK B;  1NKD A;  1BHA A;  4JGS A;  4QPJ A;  2Z3Y A;  2P6J A;  2NNU A;  3K3W A;  5BZB A;  1W0K G;  3EHB B;  2V7Q G;  4BAY A;  3RVZ A;  3SYQ A;  3GWO A;  5EBW C;  1OCR C;  1GM9 A;  1QVG U;  3ASN C;  3OE7 G;  1SET A;  3BEH A;  3JD1 A;  1K4D C;  1MAB G;  2QEX V;  2WLI B;  3X2Q B;  1W2B U;  4XDJ A;  5KUK A;  1JX9 A;  1AJP A;  2WWW A;  3UM7 A;  3T4Z A;  2XAJ A;  3CC2 V;  2P90 A;  5B1B C;  5B1A C;  1KC8 W;  4RQE A;  3R65 A;  1OCC B;  2X6C A;  2EIN C;  1VQ5 V;  1OCR B;  1BHB A;  3OW2 U;  2XAG A;  3OFN G;  3UKM A;  3CCE V;  4MW8 A;  5LHI A;  3E2E A;  4KP4 A;  4WFH A;  3JD0 A;  1K34 A;  1XL4 A;  4JAS A;  3SYO A;  1K73 W;  2JEU A;  4PA3 A;  4UVA A;  2IU0 A;  1I5X A;  4QJF B;  2HKO A;  1NR1 A;  4FIP C;  1QVF U;  3W7W A;  1QLN A;  4UVC A;  1K33 A;  1M1K W;  3M99 B;  1VQO V;  1GM7 A;  4XDK A;  3AG3 B;  3TCU A;  1K5Q A;  1M57 B;  1OCO C;  5H6R A;  2YEV B;  5L3C A;  3TK1 A;  3ZRV A;  3E8F A;  1YJW V;  2DQ0 A;  1Q7Y W;  1FS0 G;  3QNE A;  3EFF K;  5IYB O;  1MOF A;  3E35 A;  2DWD C;  1SZT A;  4I5S A;  1KD1 W;  4PA7 A;  1QLE C;  1Q82 W;  3RW0 A;  4RUE A;  5B1N A;  2B5U A;  2ZDI A;  3MD0 A;  3SPH A;  3P32 A;  3ZIA G;  2W0F C;  1KKD A;  3E89 A;  1OCO B;  2QE7 G;  3LDC A;  3AG2 C;  1WLE A;  1YIT V;  3ASO C;  3FKS G;  3TET A;  4CBC A;  3G71 V;  3LDE A;  5EBL C;  2XND G;  3T2M A;  2EJR A;  2EIJ B;  4R50 A;  1NQT A;  1NVP D;  5B3S C;  4RUF A;  3QO8 A;  1HWY A;  2WLH A;  2JIZ G;  3E8H A;  3SYP A;  3ZMZ A;  3HPL C;  1AR1 B;  3OMN B;  3SJQ C;  1K9M W;  4GX2 A;  1QR9 A;  2UXN A;  1OCZ C;  2IJI A;  5LHH A;  1AJQ A;  1VQ6 V;  4MTX A;  3FYI B;  3I55 V;  3IC7 A;  3H01 A;  4KFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...