4G2AA

Crystal structure of a putative nutrient binding protein (lpg2210) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.33 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
321
structure length
321
Chain Sequence
NDTAVGGEGSLPIPVSQPHIKMVSELIRISGKNLNEPQMNGSWHYNCNFTFKNTLNKEVTISMAFPFPINDGNSEIALPAGQQTNVGQALVYDFLVTVNDKQVSAQRGNIAPDQNKGLYYEDAYFWKTTFPPLATVNIHHDYSTGATYDVMGYHWVRYVLKTGALWQDSSIGHTRLEVIPNTPTRLCSEIDQKADYLNPTPSGMSISGSRADRKYIWDLRHFQPQADLSLCLFTGISYVRYKVIYPWLNSDDALSKLARLSNKELRFLRNTIYAQYGRQFQSPDLQEYFSKKWWYVPNPDYSDRMLNEEDKKLLSMINQAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (lpg2210) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 2.33 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 77
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13308 YARHG YARHG domain
A PF14415 DUF4424 Domain of unknown function (DUF4424)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1690 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4g2aA02
2.60.40.3680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g2aA01
4G2AA
chains in the Genus database with same CATH superfamily
1ZMYA 3C5XA 5E2TH 3UGXA 2NW7A 3GNMH 3LNGA 3NCXA 5FYLH 4A2GA 5C0JA 3IYLW 4H20H 3UERA 4AQ1A 1QWHA 1KTJA 2AXFB 4TOYH 1IVLA 3OB0H 3SZKC 3DX8A 3KYMA 4U7IA 1JZGA 4DZBA 1Y7VA 1FHGA 2E5EA 2F5BH 2LU3A 4PUBH 3D39A 2ITCA 1AQMA 15C8H 3HR5B 2E27H 3WIHL 2Y1YA 2IPUK 1M9WA 4N0RA 4E9YA 4CI3B 3HAEH 4NUJA 1XF5B 1OP4A 2DM7A 1WGOA 3HKFA 3GSNL 1BM3H 2BP8A 3RY6A 4PVMA 4PJFE 1L3NA 1WYJA 2OR9H 2J1ZA 4FFZA 1WLXA 4X7SH 1EERB 3Q6GH 2EP6A 5JXEA 1PIGA 4MAYA 5IHZB 4XO9A 2Y7NA 3QORC 5AFAA 3D85B 1E7UA 3TBWB 1I8AA 1T7ZA 4P5MA 2XI9A 3EFFB 2CJSA 3GSXB 1DQJA 4EKXA 1E9QB 2BRRL 1NBYB 3E8UH 3QDGE 3QFJA 4Y1AB 2EDKA 2VR6A 2XBZA 4S1RL 3S4SB 3TBVB 1DBBH 4FQCL 3LOWA 1QEXA 4N8PA 1ACXA 3T0EB 3CVHB 2XQBL 2I60L 5BRZE 4TVPD 2Y8DA 4XPHL 4KO9A 3T4AB 4DKAA 4Z78A 3G6DL 4NNPH 5DD1L 4CZZB 5F1SA 1MVUA 1IV8A 4UB0L 1NUNB 4OAWB 3W9DB 1QI3A 3X11B 4HPHA 3II3A 1NKRA 5KVEL 3MFGB 3J9X1 2HJKB 5JIMA 3ABGA 5BCAA 4PVNA 3U6RA 4OCRH 1OIOA 4I7ZC 5TFSL 1CG9B 2CRZA 4NSKB 1THAA 3WE1A 4JJOA 1NOFA 2O5ZL 1CF8H 4OF3A 5DUBB 1K3IA 7FABH 1H5BB 4MYWB 1SEQH 2IPTL 4C83B 4WSKA 3VYOA 3APMA 5GRWA 4ANJA 2Q0ZX 2LHRA 3VYNA 3WS3A 3C9NA 4L9LC 4OZHB 1DBKH 1SYVA 2OMUA 4PREA 1DE4A 4MNQE 3QG7H 2AQQA 3MNZB 2C3HA 3WHE0 3PUSA 2QQQA 5GRVK 3DSNB 4ETQB 5D7LA 1E42A 2HUHA 1CCZA 4NAMA 1I1YB 1QZNA 5F9DC 3OJ2C 3ARGB 3EH2A 4PD4J 5B1KA 2OSLA 2WO3B 4I9XA 2NY2D 2FX9H 1HN1A 2ZXGA 2NNAB 3D18A 4EKJA 5KYUB 4AI6A 3NSCA 3GMLA 4G43A 2RQ8A 1LVFA 4JFOB 1LVKA 3OB8A 2GSMB 3IMBA 4UT7H 1TTBA 5J11C 3BUDA 3S5YA 4CSZA 1KNOA 3I6KA 4E0RB 1P4LB 1DEEB 4GSUA 1D5IH 4NOBA 3W5NA 2FTAA 2KZ7B 4HIIB 4RWHA 3JWNC 4RMQA 1YYCA 3D9AL 2XQAA 2OMTB 1U91B 4W6XB 4DETA 4YNYB 2H41A 1Y64B 2W5PA 3TOPA 3FTGA 3DOSB 2JMHA 5I71B 4LU5H 4FLQA 4ZYKA 5JRCB 3HUJA 4PI0A 1JWUA 3H9SD 5H6RB 3MV9E 5CJQH 2QYWA 1CIUA 3RHWA 2AEIT 3NJXA 1DVFC 5DRNB 3QAZC 5CKGA 3LJCA 5FXCH 4PJEE 1JNLL 2M6BA 1FYTA 1MNUH 4TRPH 5D5MA 3RKPA 1OV8A 4KJYB 3ZTNL 2D3LA 3P4MA 2YD3A 4AH2A 3ZMTB 1KC5H 3UJIL 4IOSA 3ZRSA 4YHZL 1A9EA 5F7EL 4JPKH 3WFHA 5DJ2B 3QFGA 5FYKL 2X0WA 3PV7A 1G9MC 3LPPA 4S0TD 4BK5A 5LGYA 2F7RA 3VD1A 4FAAB 4JV5T 2XG5A 4P2QA 2WZ6A 1OQXA 3BLKA 2B1EA 3KYOA 1PLGH 2X67A 1ET8A 15C8L 5J3HC 4Q74A 5ISZA 4QY8B 3FN0L 3D2TA 3ILQD 1CLZH 3LKNB 4PRDB 4J23A 4YHNA 4X5WA 1UACH 4JZJA 5C08D 1TR7A 3CPLA 3OXRB 5EMYA 1EQWA 1IBHA 5ANMA 3WY1A 1EXGA 1G6RB 2H8PA 3O2WH 1G7LA 5EZPA 5I8KL 3WO4C 6CGTA 2JRKA 4PRHD 3AQXA 3LRSB 5DVNA 5C0AD 1MVYA 4O2CA 2CPUA 2XVKA 4GP4B 2W9DH 1BBDL 4LL4A 5DT1H 3SDXF 4N3UA 3CZNA 3K91A 1ZHCA 3LK2B 3U79A 1UZ8B 4TKWA 5GRYA 4JQXA 2BIQA 4KQ3L 1L0PA 3H53A 1PD0A 1TEFA 5C3LD 1QWNA 4DUWA 1DN2A 1EANA 4Y4KB 5FW6A 2PBIA 4WRLA 4I77L 1A6VH 3HE7D 2XTJC 1JHKL 1AC6A 1O3XA 5L7XH 2QDVA 5FLUA 1EVUA 1NEPA 1BQ5A 2FH6A 1JVLA 3KD4A 3HZVB 3P4OB 5KYYB 2CK0L 3S2CA 1JWMA 2J1KA 1I8LC 2VJ8A 1N7MH 1FNLA 2ZOKA 5F72S 2AC0A 1QFHA 5KSUA 2H6OA 1ZPUA 3WL9A 3QYCA 4XMUA 1IT9L 5I76B 1RK1A 2J44A 2GJZB 3UJJH 1CGSH 4KPHL 1JF6A 4X50A 2FQEA 3EBAA 4AKRB 3OKDA 3KPRE 3QZMA 2BVMA 3CQQA 3MX0B 5IB5B 1QFWI 4MNGE 1JV2B 1QQDA 1MRDL 4NPJA 4YHLH 4D9RD 4DV4T 2N7BA 2LSIA 3W0WA 4LFHG 2WCPA 3LMJH 3RUGB 3U0PB 3Q8EA 1LILA 4JQIL 5CIPA 5BPPA 4P07A 1QFUH 4JLRB 4GBXB 4I0PC 1MJUH 3IJHB 4MX7B 4QWNB 5GGTA 3FQ2A 1V54B 1F8TH 4HFDA 3L3PA 2WBJA 2IH1A 3K0YA 5AW6B 1A4BA 4B9JA 3RGVB 3C5JB 5IWAT 1U8LB 1O7SA 1Y18B 3CAFA 3L3DA 3FU8A 2AVFA 2D7MA 2ZUQB 3V4PH 2ADIA 1JNNL 4KKBC 2WVTA 4PRBA 4S2SA 3TU6A 5I8OH 1SDYA 1T5XA 4BH7B 1U93B 3HR5A 2WWKT 2HKFL 2MKWA 5C0GA 3GQFA 1FVEA 3Q8BA 5JW5B 4AJVA 1U8NB 5IW6B 2MWCA 4PJJA 1DZ0A 1PQZB 3GSVB 1SXCA 4XMPL 3G9VA 3LK42 3OHMB 3MGAA 1XF4A 3UP1A 1LQBC 5E23A 3ULUL 4M3HA 4NWTH 1N2RA 4N8UA 3BJ91 3B37A 1OD7A 4ZMNA 4XNDA 3O2DH 1E2AA 4B53A 1PIFA 1XGTB 2JKWA 1SFDA 2WGNB 2ENSA 3MCLL 1T21A 1HHKA 3OAWA 4KROD 3S36H 1MZYA 4DV1T 3T6VA 3MRBA 1UHVA 2G3ZA 5E6ZA 4RGMB 1UJ3A 2VQUA 3TEUA 2VM4A 4NP9A 2X3AA 3OKLB 3MLVH 5TK4A 4JFYA 2C26A 2R7EA 2L7QA 4WQOA 1CDGA 2WUBL 3D87B 4U1SB 3SDAD 5CBAA 3EJTA 1Y6MR 3FO1B 5G4NA 2WO2B 3MBXH 3EJZC 2BWIA 2EABA 2DH3A 3AY4A 1BGXH 1ORQA 2MTQA 4L3EA 5J0BA 3IDNA 2QQLL 4E7ZA 5IB2B 5KX5E 3HI1B 4I3GA 4X9IA 5FWRA 5FO7A 1S78D 4XBEL 1XGYL 3QORA 4QYOB 1P6FA 4YWGH 3H54A 2R8SL 2V3EA 3C08L 4R7VA 5F93C 3KPNB 4HGKC 3APFA 4FNQA 5DA4A 3SE9L 5IB3A 1SMAA 4XOAA 5GGRB 2NQCA 3IXAA 4AGMA 1OARL 3MRDA 4FTVA 3KDMB 2NRDA 3QI9D 4DTGH 4E42B 2XAJB 5L4IA 1R17A 2FIKB 5IBLC 4WF7A 4RFEB 3IJEB 1XIWB 1N68A 1TYRA 2ZP9A 2V0AA 5B3NA 2VURA 4RDBA 4Z8XA 4Z91A 4CADA 3ATBA 1WVZA 1BD2D 3EJSA 3NRXA 4MMXC 4WI0A 4ZW3A 2VDKB 2W67A 4BH8B 5DJ0B 3AA1B 3U7YH 4ALAL 2Q10A 3DVGA 3OBAA 4K94L 4O58H 3FQXA 3OMNB 3QP3A 3DVNB 4ZDHB 5IHUL 3KYMB 2D7QA 4TV8E 2B1OA 5HYIA 4X1IE 5IUXA 2OMNA 2Z6EA 3PNWB 1QYGL 3AADB 3MRKB 4HLJA 1NAFA 2EE6A 4JMXA 2ZQKA 3ZHLA 3MGOA 2W9LA 2XNAB 3BSHA 2I7SA 1X5XA 3NRFA 1CICC 2H5UA 5AQUB 2Y7MA 1T98A 1GZPB 4F91B 2XWEA 1OM3L 1CLZL 3LQAC 4XN9A 1U8MB 2VE6B 1NCIA 3PXLA 1W2KT 3CC1A 3AS0A 2VKDA 3IU4L 4UT6A 3QJSB 4L1SA 3BCDA 1TOXA 3F62A 4GI8A 4ZHQE 4KROC 1BMGA 3I85A 4C90A 4XWGL 4XBPB 2TRHA 2AXGA 2HAZA 2X70A 1DO5A 1IQWL 3L2LA 3VG0H 1WZ1L 4PUBL 2P24B 2P26A 1XCQB 1TJIH 5CCJA 5HVHC 3K8PC 2KZBA 3NIGB 5K39A 1USQA 1BFOB 3TWCH 3KNBA 4QHKI 4Y19E 2E8IA 3SDCC 5JPNB 3UBXI 1IFHH 4GMSL 4CU7A 3WHXB 2VERA 1XGUA 2R2EB 5FB8A 1A7BA 4OZHF 2GJRA 3KWTA 2IC6A 1D9KD 1HJCA 2JJSC 2M2DA 2YD6A 4Y9GA 3U2JA 3CLEL 3O1HA 5EFIB 2CBIA 1QTYT 4NO0A 3SKNA 2DWTA 2EZ0D 1S7QB 1GY1A 5LAXA 5B7FA 1CLYH 1B0WA 1DDTA 2BERA 3NZSA 3HMXH 4K71B 5GGVL 3VSUA 4Z3TA 1T1XB 2VIRB 4NO5A 5E0OA 1YMMA 3RU8H 4K9EH 4ODXA 4ODSH 2F54E 2EHOC 3SOLA 3ESPA 4OZ4B 1WUZA 1AC0A 2IQAA 2R4SH 3RYFE 4KPHH 4P2QE 4MSWB 4LHQB 4B27A 3PS6A 2YUXA 1BX2B 2V6YB 3P3TA 1KYAA 2EDJA 3LIZH 3ZT6A 1DVYA 1KY7A 3IDUA 2ZKMX 4XCCH 3G5VA 5M94B 1VSCA 3U78A 2R23B 5E5UB 3ZKRA 4N22A 1FNSH 5E00B 3H7LA 3RB5A 3UTOA 3A4EA 2O5ZH 3RAJH 3P4LA 5GONE 4HFHA 3BZFB 2L04A 1XH2A 3CVHA 3QJHB 2WXPA 2YZ8A 4JQIA 3UZEC 1MI5E 2YOAA 1ECZA 3RUGF 4L05A 4NXSA 3CH8A 4KDWA 5ETUA 4QRQB 5JA9A 4JVPA 1BA9A 3A47A 4JQVC 4LCCB 4NC1E 3L1OL 4QJ4B 4HDIA 3ZR5A 4DF9A 3FHEA 3IBPA 4I55E 1NCHA 2DM2A 2ZSVB 4XBEH 1XBDA 1T1YB 2OMYA 4IW4C 4KHPT 2A9BA 4AKGA 4OCMC 1V3LA 2IDOB 3PP3H 5E9DA 4HC1A 4GAGH 4O02L 5C0RL 2H2SC 2YEQA 3I6LD 4M8VA 5HGAA 5GSVB 3UQ4A 4MDJA 4CMHB 2VT0A 3CVRA 2H0EA 2BNQD 5GS1C 3KH3A 4PJXF 3UC0H 1QSED 3QNYA 4HIXL 1KNOB 3I6KB 1GYAA 3BT2L 1BF8A 2PJQA 3IA3A 1CFSB 1FVCA 5AQGB 3EDFA 3SD5A 3BZEA 5KSBE 4MKTA 4PJDA 1EZUA 1UZGA 3PPEA 5B4MC 5FW7A 5IMMB 4IDZA 4XOCA 4AQFA 3A8YC 1WA2X 4U1LA 3WIFB 4UXNB 3SGDI 3O9WC 3CHXA 4YBLC 5ADOL 4G5AA 1I53A 1RUPL 2BCKA 4RESB 5LBVA 1Z9OA 2GFBB 2HG0A 4XWOC 1AD9B 3KL3A 1HQRB 4Q97A 3P11H 3KLAB 3QZBA 4HJEA 2NLJB 1RZIB 1L7TH 1KBGL 1Y6NR 4HUWA 4PVLA 1U42A 1XR8B 1EXHA 3KV5A 3QJOA 1URLA 1U93A 4JPWH 4UQDA 3VWJA 2QSTA 1N10A 4NQED 3FULA 4R2GD 4AQYT 3BN9D 4LOEA 2ZWZA 4Z7QF 4JX0A 1RQ5A 1FVDB 4QGTA 4WO0A 3AW5A 2DBLH 2H3NB 2VL0A 1E6JH 1K4DB 4XZUA 1S8DA 2EDLA 3L7FB 5BRZB 5BZZA 2CBQA 3T8VA 4P0BA 3MV11 1RI8A 1H6TA 5EK3A 4WEBL 5DHYA 5FXWA 2WGXA 5FIEA 1HXYB 2XUEA 4EYUA 1BZOA 5FGBC 3DX9B 5DTFB 4L9LA 1HI6B 4OLVL 3AMLA 3OR7A 4JM4L 1J05B 2ZUTA 5DHDA 3MLRL 1J8HE 1PX3A 3QJUB 4IKIA 3ZTDC 4ANXA 3UFGA 1YUHA 3N9GH 4C83A 1P1VA 2W95A 3CHRA 3ZYOA 1OAXL 1TJGL 3ECVA 4X83A 2CM0A 2A9MH 1AIZA 1S7RB 2MCAA 4QYOA 5JQIB 4I88A 1XD0A 1Q90A 3DUSA 2V7JA 3GBMH 4CC4A 3EAMA 5IV2B 1OM3H 3KGSA 4X5TA 4ZO6A 1XH3A 1A14L 5DUJA 2ERJC 2FEDC 4AJWA 5MP6L 2DI9A 4LP8A 4LOUC 1JZIA 3DP7A 2MPAH 1FCGA 3NBXX 4HZ1A 4WFED 5DFVC 4P4KC 3TN0C 3WTVA 1A9VA 4LPTA 3M1OA 3UBXB 2QHRL 4GKKT 4X9BA 3PWVB 3QFDB 4N9OB 4E41A 4LPUA 2HMIC 1YEDB 3QA3A 1QNZH 3HNVH 2WC7A 3X1DA 2GTQA 2Z35A 4DNDA 2WWVA 1WCBB 1XF2A 4YE0A 3O3BA 1EMTH 3IM1A 4KNTA 5CZXC 1CFVL 2Y1ZA 5I5JA 5C86A 2Q9QD 4EJ1C 4HFCA 1UH3A 3GB7A 4H8WC 3EYQC 1SFHA 1IC7H 1I9JL 4OLUL 4XOBA 3GMRA 1A66A 4M29A 2EUXA 3IRZA 2FLMA 1N8ZA 3LFMA 1U8NA 5IW6A 4EMZA 3D0VA 3A5XA 5FYKD 4NUJB 1CDHA 1G5GA 5KYNA 1YEWA 4KGLA 1FE8H 2I59A 4L8SC 5LHDA 4AKIA 5GGUA 3T1HT 2CO4A 5AW2B 2Z3FA 1E4XH 1IC1A 4K23L 5I1GL 4FFYL 4P3DB 4G5ZL 3OMAB 1KYOK 4M62H 2R4SL 1IIKA 4XHJD 2A3DA 2R29A 5FPIA 4UM8B 1NDMA 4KKCC 4XPBH 4N1EA 2NY0C 1VADA 3CFKA 4HJSA 4PY7A 3BVWA 2Z92B 2Z93A 1FF5A 4QCIA 4R84A 5DJ2A 1QW8A 2P24A 3LQAL 3T2NL 4XCCL 4JRLA 4MB5A 3N44B 4Y5VA 4F9PC 3IDYB 3R19A 3V0VA 1B4JH 1KG0A 2B77A 5D7KD 2F9BT 3ULVH 5MEOA 3FO1A 1HH9A 5CNHA 1PKOA 5JPNA 1HL4A 3VD3A 2WXQA 3P9LB 3EHBB 4QTHB 5IW3A 1P4UA 1TTUA 1KCLA 4PJAF 2ZWSA 1JHLL 2QADC 3CVHL 3RY6C 4YHNB 2VKJA 4OM0H 5IBUG 3LN9A 3O8XC 3WLWD 3PHQA 1YA5A 3R0MA 3BKYL 5LQBL 4GRMB 3S37X 1OE1A 3IDGB 3JC6C 4JM2F 5EO9B 4JFED 5KVDH 4KUZH 3MSPA 3HMXA 5CMAA 4OFIA 4UIKL 4XZCA 4LMJA 3ENEA 1NC2D 1HCZA 1C8QA 2PCFB 4LBAA 5IFHH 4DW2H 1R9FA 1AGDB 2BS2A 3C4XA 4UEMA 4V1DB 4KV5F 4UINH 3QOFA 5DK3A 3UYRL 1T4WA 3QBTB 3QUZB 2OL3H 5ICUA 1E90A 3DVGB 4BHUI 2EQDA 3ANWB 3RIUA 3RFRA 5I0WA 5IVXA 1H5BC 3GYRA 4KQ3H 1I1YA 1VPOH 4KXZI 3CFDA 2XN9E 4G8EB 4X6BB 3OGOE 1R0AL 3T0ED 4E42A 3E6FB 1IKNA 4DV2T 3WD5L 1X79A 2L8KA 4NQXA 2VXUL 4MS6A 3UPCA 2JKXA 3IJSB 3A4FA 4JM4H 2AJVH 1INQA 2OZNA 4JFWA 5BOJA 1EEYB 1FNEB 1B0RA 4JJ5B 1WBZA 4KZ0A 4PHXA 5FM5O 4AX3A 2LM2A 2IXQB 4LCWD 2OI9C 1P5UC 4JFFA 2PCXA 2A3TA 1EJ6A 4ZUWA 1I75A 3HI1A 2IIJA 5D1ZC 2KQNA 1HX1B 4W93A 3HFFA 4PGCB 3ATFA 4GQRA 4V11A 4ZQTA 2CDEB 1J8SA 5D6CA 4F2EA 1T83C 3DHMA 2NOYA 4Y5XA 1L9TA 4NZDA 2CLYB 4TNVA 3HC4L 1HQ4B 1OGTB 3QJVB 4LF6T 4XVOA 2BDEA 3NSDA 2DKSA 4LEXL 5LHIB 1NEUA 4KVCL 2JKIS 1DFBL 4MYPA 4XH2B 4OZIF 5DUML 4U2ZA 3SGEH 4GO6B 4LKCB 2NW2B 1WHOA 3DX6A 2D3JA 5DRXB 5ACZA 4UBDD 3FJTA 2Q20A 1K2DB 4Y2LA 1T66C 4N2EA 2P5ED 2ZXDA 1LDPL 2IDCA 1D1AA 2YKKA 1WIPA 1SLVA 3BUPA 3CLWA 3PHOA 4OV5A 1AHWB 3L13A 1LVEA 3L3OC 5G4MA 2AJXL 3WDHA 1Z66A 4YPGB 1ZGLM 3UC2A 2R69H 2XSKA 3NCEB 1MLBB 1FZKB 5ENWB 1E7VA 4IE5A 1G9NH 2XRAH 3G04A 1J11A 1S2EA 2HJFA 2IDFA 2OYPA 5F3BB 3BIKB 1V3JA 4ZO9A 4CKQA 1PQZA 3GSVA 3HRZA 1GOHA 1KIRA 5TF1H 2AEPH 4IMLA 4K5PA 4LLWB 4BFIB 3TO4C 3N5LA 3ARUA 4G6JL 1OAXH 1TJGH 1QSFA 2GC4C 5GS0L 4BA8A 2X2JA 1JP5A 2M1KA 3R4DA 1PAZA 4DBQA 3PAVA 5F7AA 1EZSA 4PJCF 2XY8B 4NUPA 4NPPA 3D7PA 4NQEA 4QHUA 1SPDA 4XPGH 1ZRUA 3IN0A 3OKEB 2C3VB 3KZ8A 1L9NA 2XKNA 2PN5A 5CLXA 4D0BA 2C5DC 1S9XA 1RY7B 4JDTL 1YJDL 1FI8C 2JQAA 3JV0A 5TK2A 3FTXA 3HW7A 4A7UA 1ORQB 3KHQA 4HFUH 1WFOA 4HDIB 3PE0A 4UBDC 1RUQH 1DEDA 1NCAL 1MRFH 1SNRA 3UQ7A 3FUDA 5T3XD 2LLNA 3EYFA 2JLPA 5DHMC 4FQLH 5E8DH 3UG5A 3ESOA 4WY7L 1DUZA 4WW2B 3IMTA 4P5TD 2AXJA 2EEAA 5G5DB 4P46A 4PW8A 5KBLA 1I1AD 2QQLH 3TV3H 2Q3ZA 3MRDB 2I5YH 4OKVB 4N2BA 2BP0B 1CICA 2P7TA 4XP6L 2Y7OA 4L1HA 3HC2A 1OF2A 5DFAA 4HBCL 4AW7A 1UJTA 4FXGA 2AV7A 1KCWA 3NA4A 1GPOH 5KYXB 3DO4A 1MJ7H 3UUXB 1FPTH 4QRRE 4XN4A 1BFVH 3RX8A 1IKFL 4KI1A 5DQ9A 1WTLA 1J0YA 5EUOF 1JTPA 2DWEB 2X28A 3BN3B 3JT0A 1IEAB 2O30A 5LP6E 1YN7B 3NCYS 4PJ7F 4DQOL 5J6HB 4P09A 3B2UD 1NGYA 4UQEA 1XHHA 3DMMB 5DD0L 2W65A 3T0EC 3VH8G 3CD4A 4HKBA 1M53A 1YNTB 4NZJA 4DV3T 3T2NH 3QUMB 1M7IB 5F9JA 3O8XB 3FCSB 4O58L 5AWNH 5MHSE 4AQGA 4LMKA 5C6TH 4QHMB 3RGVA 4WGVB 5F89B 3I3DA 3V55A 3QJTB 4ADJA 5HHVH 1N32T 3UTPE 1NKOA 1OCWH 5HDLA 1KZQA 2BZ7A 3D07A 1I3GH 3V0EA 4UNUA 5DGQA 3JC6D 2HN1A 2OMWA 1OWRM 4YDKL 1RH8A 2F5AH 4G71B 1XZ0A 3SY0B 5LYJE 2OXHB 1JK8B 5KW9L 3L8RA 1WPCA 4UAOB 1AE6H 1BQHG 1XIWC 4GKLA 5CD3A 4GLRI 4I3SL 3R7QA 3SOBL 4EV6A 2MAWA 3P7IA 1ZHKA 2A74C 2YR3A 1XF5A 3QZLA 4ZTPL 2FWOB 4NN6B 1JTTA 4M7LL 5D96C 1L4IA 2E6PA 4KKRA 2Q6WB 3HJEA 4A2DA 4LIQH 4MJJA 1IM9D 2XVBA 2CGRL 3C98B 4YBQD 4KK5C 2QR0A 1OTUC 1G9MH 2OTUA 5FO9B 4JL1A 4OD1L 2DRUA 4ENEC 4JFSA 4YO0A 1H15A 5DVPA 1QSDA 3GMMA 1DBBL 2FE0A 2HLAB 2X4UB 4HD9A 5I74B 3VUAA 5BRZA 5TDOA 4JLEA 4PK5A 3ME0A 3KPOB 2XQ7A 2I26N 2XQBH 4UDUB 4Y4FA 4YPJA 5HGHA 4H13C 4KAQH 3KLHC 4KXBA 4ZS7H 1E2WA 1LWRA 3KXFA 2FJHB 2ZUVA 3ZO9A 2VIRA 4XMZA 1IGTB 1UB6B 2UVEA 2ZCHL 4BWWA 3RRCA 2YOEA 4MMXA 2J47A 5E03A 4RLDA 3CVBA 3IU3B 4CSTA 2PR4L 2GBTA 1KBVA 3D39D 3QZPA 2BG9A 4X5PA 2Y07H 3IDGA 1OEDE 2DKMA 3HS0A 3ZW3A 4DK6A 4U3SB 4AV0A 3MJ9H 3GD1C 4YIQB 4M5YL 1JGUL 2MOZA 3RI5K 4LHUA 2ADJA 1WFMA 5ESVA 3MLRH 4U7KA 2PYFB 4DPBX 2X5PA 4FTVB 2Z64C 4LEBA 1ZV9A 4P48A 1S5HB 3FCTB 1CTOA 2WS3A 3CGTA 3RVVD 3KJ6L 3WUWB 4ZD3L 5I82A 4PLNC 5I1EH 1ZS2A 4X7FC 1E5YA 4U05A 2IWGA 4Y1AE 3UXFA 1T0OA 1AI1L 3GPEA 4X62T 4GAYA 5HGGS 3AY4C 4PJDB 1YJDH 3WS3B 1SY6A 3WJLC 5EU3A 5EUOE 1INEL 1A7OH 2BSBA 1ZEAH 4OHFA 3QZWG 3RWHB 3FOLB 2WP3O 3S3SA 4BKSC 3TJHC 5D72H 3FUEA 1X7QB 3GJFH 2V4LA 2WP3T 3P4QA 1XTLA 1ZLWK 3HG5A 5DMGD 5I1IL 1S9YA 4CQIA 4UQCA 3MA7A 3GXNA 3N9LA 1GSMA 3OJVC 1CDCA 2QHRH 2AQTA 2Z35B 5KBKA 3DSFL 3M17B 2CK2A 2AJ3A 2BVTA 2DOCA 3EVYA 3RYIE 3D5OF 3OQ3B 4OFZA 1BJ1H 1X5IA 3CSTA 1OVZA 4OLYH 2YWZA 4PJ7B 2YUWA 1BFVL 4HV8B 4I2XB 3Q43A 4JRXE 1QO3B 4QR7A 3RL2B 3NFPA 3UCQA 2XQYA 1FVDA 4BFFA 4PJAB 3DX6B 3F2EA 1U3HC 1EEZB 1OT4A 5L4EA 3QULB 3QXWA 5FK9A 5AB0A 3N2OA 3V2AR 4Y2DB 4HBQA 3C75A 5KSAC 3SGJC 3MKKA 3S34H 2Y7LA 5EC1A 1KLUA 5CLTA 3P4RA 1WR6A 3H9SA 1FO0A 3MMEB 1Z5LA 4F2ME 1XNQT 4XVUD 5EH1A 3M1BB 1GJWA 4YUEL 2HKHH 4NIQA 3GHPA 3ZJAA 3OAUH 5E08H 3LHAA 5C6TL 3ZVVA 3IRCA 1DQKA 5MEPB 3MLXH 2XX1A 4JANA 4JO5A 2YU1A 3W5MA 5MERA 3QDJD 2JB5L 3B9KA 4JM2A 4MLSA 3WKPA 1T7YA 2F8IA 3B7SA 2VITB 3RYCE 3BVUA 3O2VH 5TJWK 3WEXB 4AK2A 5DLLA 1OP5K 4RVBA 4JEHB 5HXEA 3V4VH 4ODXB 1IGJA 3ZMSB 4YEEA 5LXTE 3DJ9A 2XWZA 5FKPA 3C12A 1VGKA 1AO7D 2D9CA 1J1XL 1WWBX 3POCA 4KJQD 5ACMA 5MEQA 5F70A 4UF7C 1KTCA 2DQFB 3VFNA 5T1DL 2BSRB 2J20A 1AXTL 3IMUA 4NFDA 3UUNA 2H8PB 3VFSB 4TMPA 3O9WB 2XKNB 2PCFA 4BFKA 4KMLB 2UXVA 4HJGA 1LEGB 2IQ9L 4WO4A 1TITA 5CU5A 2LKHA 1I8UA 4IBSA 4JVWA 5EZOH 3VXME 3WS6C 4OLZL 5FUCC 5I1KH 3IFNH 3L4ZA 1MFAL 3CBRA 3ZDZE 1JNJA 1OP9A 1CXEA 1OSPH 1YNKL 1MAML 3QZOA 4MA8H 4O2FB 4ZPVA 1JHKH 2AE9A 3ARBD 4ZXBC 3F00A 5C0IB 4CW1A 2VUYA 3U2IA 2BHUA 2AERT 3TKLB 1DQML 2BY1A 1BFTA 2H32H 3HC3H 5D7SL 2MMXA 3LSOA 3F7VA 4Z7OB 5LN4A 3RIUC 4NZFA 5DO2C 3W39B 4B9PA 3CFBA 2R0KH 1X5AA 5L9DL 1IAIH 5HP5A 3GSWA 2AI0H 4D0CB 4NZTL 1GGBL 4K15A 2Q86B 3J07A 5CILH 2WANA 3OYZA 4Y16D 5ALBL 1FAIH 1BEYH 3CVIH 5EBMB 5AOLA 5JPMB 5K9KA 3TH3T 2P5WD 4B3VA 3QEGL 2G5RA 1AHWA 2LV4A 2BVPB 3UYPB 1GYCA 4O9HL 4WU5B 5AVTB 2LJLA 3VG9B 1WBYB 4AUJA 2R83A 4HAFA 1N67A 1F56A 3CDGA 2FO1A 3EGXB 2JE8A 3TFKC 2OL3B 3QPKA 4X5QA 5JNYB 2X12A 2L8AA 5J1TC 4AKOA 4BJLA 3LEYH 1VESA 4WENB 3P9LA 2XETA 3P0YL 4ZO7A 3N0AA 5J13C 2AJZB 4TUOA 3KLQA 2YAFA 2FB4H 3QQXA 4YHPA 2XA8H 2XZZA 3FU6A 3RI5F 1ACYH 1FORH 4DCQB 2OR9L 3VFMB 2H32B 4RMBA 1GZQA 1NGPH 5D1QE 1BXXA 2MQGA 2P80A 4ZI3C 2FEEL 2EILB 4QMEA 3GXIA 4XP9H 2IDUA 4NQEB 1BSIA 1LK2A 3QARA 4S1DD 2M67A 1KGCE 1D2PA 3RGBA 3RGLA 2JKNA 3BWZA 4AKHA 3L3OA 4OGYH 5JIHA 3VQLA 1TYJA 1EDHA 1HXMB 2C8NA 1BQRA 4K0OA 2JNZA 2W00A 4BRJA 2HLFC 2WTRB 1Q38A 5LNDA 4LVHC 4ZO8A 4S0SD 4XNMA 3CSPA 3N9NA 1MDTA 4H9OC 4BKLA 3K71B 3ANWA 3VGAB 5DYOA 1TT6A 4ZX5A 5JREA 3RRQA 1MKFA 4YUEH 1MN4A 3TBYB 3FZUD 2C3VA 4GXVL 1UM6H 4BE5A 4B5EA 2G9KA 3K46A 2ZLYA 1QUNB 4HX1A 3G6AA 5C9KA 4WWKD 1WLHA 3K5RA 1CICB 2XQ8A 3HKZA 3QRGL 4LBEB 4LF8T 1SQMA 2HPOA 4QRPE 3WFCL 1JUFB 1JFHA 1KBPA 3MUZ1 2GBUA 3DV4A 4YXHH 5E6IC 4CMMA 4ERSH 2H3RA 3PV6A 2NTXA 1I8KB 1Y1UA 3VFUA 1G43A 1YSOA 4HMCA 2DLTA 3LPOA 1EHNA 1BOGA 3ZRFC 4RRPA 5CF3A 1NWMX 4N3TA 3RC3A 3QG7L 5CD5C 1ZLDA 4XVTH 3F83A 4K5MA 1AGBB 3HI5L 1KXTA 3QORB 4M61B 1RULL 1CD8A 4NP4H 3EYSL 2P45B 4PV8B 2LM9A 4HKXB 5L3EB 1IUZA 1R3IL 3ZGHA 4PCYA 4IT4A 3PP4L 2K9UA 1KJMA 2CRMA 2C5IT 2DMCA 2X4OA 5GIRB 5ITFB 3S5LA 3DJRA 4QXGH 2VDPH 1IBLT 1F41A 3MA9A 4M8RA 4QRUB 3A4DA 3II1A 4LAQL 5JHBA 2NR4A 3T65B 3ASNB 1Z5HA 3L3JA 4JO3H 3F05A 3DURA 3GRWH 1HEJC 3DXAA 1BREA 1TO5A 4NHUA 5DD6B 1ZY9A 3VHLA 5J9PA 2G5BA 2X9HA 1M7IA 4LZKA 3LHPL 3TJPA 1KIUA 1BR4A 1QTSA 1U8OA 4ANWA 3FYIB 2V8SV 1KIRB 2X89D 4J3WA 4AZ8B 1YQ4A 4GW4B 5EUOA 1S78C 3P1VA 1OHQA 3KPRB 1OF2B 3Q8CA 5IESL 5EV7A 2XNAA 2B1AL 5JXED 2O5XL 1Q9OA 4HCRH 1TZHB 4F9LA 4U74A 3M7FB 2QKIB 2ESVE 4M6MH 4OV5B 2FRGP 2IGTA 2VH5L 3P11L 4R0LA 4HZLB 5CBEB 5FO9A 4CI2B 4BFOA 3BQUC 1ODUA 1P69B 1QAWA 4UR9A 4X6EB 1XR9B 3B2UC 4PP2A 4S1QH 1BD2A 4JHWL 4LHUD 43C9A 2JQQA 1PY0A 2X41A 3NCMA 2DDQL 3TESA 4KHXH 4IU3A 3Q3GA 1TPXC 4DV6T 4HCIA 3ZKNC 3V6OA 5AENA 1XB8A 2K24A 2A2FX 3Q8AA 3ZE0B 4PU2A 1O7DC 4MNQD 5MEPA 3HN8A 4JDVA 4J2XA 2B1HH 4UU9A 1IL1A 5E8NB 4KXDA 1DHKA 2BVYA 1I1AC 1ZTXH 1D9KA 1MY5A 5L0QC 2X53A 4S11A 3VGGA 4OT1L 5ESVB 4JGNA 1XSIA 5T3ZL 3GXTA 5IR1A 1V9DA 1OTTD 3BSZH 5ISZB 3RJOA 2LSKA 5AW8B 5AQVB 4PJDF 4TL5A 5JIIA 2HFFA 2FECL 3WEMA 2DM4A 5EIIA 4ZUSA 2J4GA 3X17A 2EVJA 4NZTH 2DEYX 4JO1L 2G60L 1CTNA 4M7ZC 1JPEA 2AZUA 4KTGA 2Z1PA 2UZYB 1O5PA 3AGVA 4PJ6A 1J1JA 1F90H 4XNZB 4Y1TA 3UTTD 1MCPH 4LSVL 3V0JA 2EDXA 4N1CA 5L7XL 4P23B 2JVUA 1JAEA 3CFDB 4X6BA 5FOJA 4DVRH 5EK2A 2ZCLL 3ARZA 3DI2B 2EEDA 4A63A 4WW1A 3QR0A 1EHLH 3FU7A 4ILDA 5DURD 4PBWD 2IF7A 1JVOA 3NMEA 2DQJH 2N01B 2EIEA 5C08E 3LNFA 2NUPB 3WNLA 2ZOUA 3SDDC 4YSUA 2WW8A 3DV6A 4ZNEE 2G2PA 3TLUA 2K7PA 1M7XA 1T7WA 3Q6FB 3QRGH 4R7LA 4JZOA 5DLMH 1A02N 4B9FA 4UT6L 2ZP0T 1QVOA 1UT9A 2APSA 4N20A 4YJ2E 1HHJA 2AXHA 1VRBA 2WXHA 1BVZA 5HGDB 3ULUF 1OLZA 1FG2B 1P4BH 4OY9A 2BRQA 1ID2A 4K7FB 3V0WL 4RZCA 3R7RA 1MLCB 1U92A 4PWHA 1MXGA 4PS8A 2YN6A 1PY4A 3CZGA 4FNLH 3ZL4H 2GVYA 4F92B 1J0KA 1MIYA 1PTZA 1VGEH 5D9SB 1BFSA 5D8JH 3UDWC 2WWOA 5I66A 3MLSL 1ZT4B 4HC1L 2DTML 5FO8B 3LQZA 5HDBF 3EUUA 2HVJA 2FL5A 2EUZA 2BH0A 2GABA 3WXWL 5TDNA 3GF8A 2P5WA 3NZHH 3FONA 3U0WL 3VDCA 4GRLC 3IVKB 3HC0B 3JADA 4WTQA 3W3BA 4B96A 1FLRL 4KHTL 2OK0L 3B9KB 3MUGB 3D39B 5LCVH 3BRFA 3P3YA 3A24A 1ZANL 3MFFB 5INDB 2VITA 1UOWA 4XAKE 1IAIM 5KJRH 1HILA 1TZ8A 3KPMB 4TQ8A 2JIXB 1YCSA 2HT2D 4ANKA 1C08A 2VAJA 2FD6L 3EO9L 1BG1A 4HF5H 3M1BA 2R1XA 2VN4A 1BQHA 1SHMA 5DF0A 4QNPF 3D4CA 2NSXA 3MLZL 4CXWA 5DFTA 2BSTA 4P9HL 3ZDYE 5J12C 1A6TA 5HHQA 2DQTH 3R06B 1CQYA 3ARGD 4PRHA 4H4NA 2Z0UA 2ZG3A 1XWVA 3M46A 3MLVL 3SO3B 2R51A 1KGUA 3MCLH 5DEGA 1CXFA 1UZ8A 1X5YA 2IAMA 4GRWE 3NEOA 3V0IA 1ZT7B 3DBXA 3SKOB 3PPSA 3ULVC 1EEZA 3QULA 1IGFH 2CRYA 2ZCKH 2GT9A 4NQTA 4DPAX 3SSGA 1HS7A 1L9PA 1MCSA 4H2CA 4JQXC 3TIEB 3ARPA 4NYLB 4ZS6C 1NMCB 5HGHB 5JW4M 3L3HA 4MBOA 3IKKA 2KSRA 3LQMA 1XZYA 3K4AA 5JQGE 2LRKA 3ROLB 5KVGE 2WIMA 1IM3D 4J4PC 1MHPL 1EUTA 4XXCC 1JF1A 1DU2A 4EUPB 2D0FA 4X4ME 1RZQA 1NBZB 3LKPB 3NCWA 4O4YH 3BAJA 1EV2E 4I9WD 4MQXC 1T72A 4DTGL 2QVTA 1D5XB 1E9PB 3FXIC 1R1CA 3CXDH 3V6FA 2B59A 1CUOA 4RBPH 1SVZA 3L8QA 1L6XA 5IJCC 1NBVL 5F9WC 3UTSE 1LEIB 4UINL 3VFUB 4Z8FH 4NQCA 4KU1A 3RWJA 5I8CA 3WMPA 1ZHBA 1R5VB 2RCSL 3AACA 3MYZA 4JI5T 2PFVA 4WWID 1CHUA 3QXDB 3UYPA 4F5CE 4MCZB 2I0MA 3U7WL 2ICWA 4LPXA 4F20A 4JZNA 3FCUB 3L4VA 1CGVA 4I2XA 4KVNH 3RL2A 3NA9H 3DA0A 1ED3A 3BPCB 4ZYKB 1CGWA 3UTSD 5ID1A 3I3BA 4DR2T 3GMNB 4JN1H 4WUUA 5ABHA 4EB6E 4WWKA 2VLRE 4KMTL 5C09E 3OF6A 3QEUA 1MHHA 5FHBH 4BH8A 1E5CA 1MIVA 1INDH 3EFDL 3SDXB 2CLYC 4S2SB 5IYZE 3C6SB 4UM9A 1A25A 1XMQT 4ISTA 1YHPA 1F0LA 4G72B 3KPPB 5MEND 1PG7H 2VLKD 5HI3C 4LCYB 1DVTA 1NFDA 4H25B 4N9GB 2ETWA 3LPFA 4ONFL 3L3OB 4TSCH 3AEBA 2IANB 4UIMA 4ENZA 4HN9A 3EDDA 3QZWB 4ABWA 1H6EA 1Z9NA 4HKJB 2OW6A 1CFQA 1AZRA 3OXRA 1IFHL 5K59F 1QHPA 2VXTH 2H32A 4W9FC 3X1EA 3OBVE 2DLGA 1NAMB 1ZHKB 4CSPA 1TZGL 3ONXA 3QIUA 2X1XR 3K6FA 4AY0A 4JO4L 2IG2H 1R46A 5IOPB 3MLTA 3EJCA 2J6EH 5AB1A 3FZLB 1J9TA 4HUXA 4KRMB 4FQQA 4HUMB 5DFVD 3IFOB 2NY1C 4TNVK 5AZUA 1G9NC 4EUPG 2X68A 1Q8MA 1WCRA 3X14B 5CR1A 2V3DA 2H6PA 4MCNA 4G3YL 1MF2H 3L81A 4LQFL 2XYCA 4MZIA 4WNSA 1CLYL 5SWZE 4ZEYA 3RGVD 2Y1VA 3STZB 3NN8A 3D3VA 4JKMA 4AVKA 4CAGA 3ECQA 5CA1E 3R1GH 2CALA 3RKDC 5JHLA 5AG9A 1UM5L 3V6OE 3G7TA 1JXGA 3LY6A 4U3SA 2E75C 1FVEB 3K81A 4LOFA 1PKQE 2PKDA 4IHJE 3LIUA 2WSKA 5I1HL 2MIZA 1MUJA 2NY5H 5DABA 4Y19D 3U9WA 3FCBA 2XAHB 4CBPA 3ZTNH 4GIWA 4OD2A 3X3GL 3K5SA 3OMIB 5F9OL 4L8BB 1MCWM 3BH8A 3BPLB 4ZPVB 5AW9B 1N33T 4JO2H 4D7PA 5C0IA 5J4MA 2IDSA 2YMXH 4TVPL 4GG8A 2WAUA 4G8FB 1FO0H 4LMQE 1FV1B 5HJ3A 1Q94A 3UGUA 3FB6A 3NIDF 5HYJE 4O2AE 3RH3A 3TBYA 3ZE2E 1MFUA 2HLEB 3CX5J 5EOQH 1EFXD 5J8OA 1N34T 2CD0A 4Y4FD 4WNQA 4LLYB 4ZUUA 4B3EA 3SFDA 4XXDB 3VE0A 2AJZA 2OMZA 3DV6B 4HT1H 1LO2L 4GIPD 2Y48B 2HTKD 4P2QD 4JG1L 1RZGA 5I8KH 2J56A 4HLEA 4NDMB 4EN3C 1D7DA 5LJMA 1NGXB 2W59A 4TF4A 2OJZH 4JPIA 3VKGA 4Q0XL 4HKZB 2WQYA 3ES6A 3C64A 1WAEA 4NRZA 2UXBT 1WP6A 4R4BB 2BOBA 2YPKB 1M7UA 3CDGB 4GAAA 3BP6B 1JGLL 4AM0A 3T2LA 4FTVE 2FYVA 4FZEL 4IBYA 1UVQA 3O9WD 4N2LA 1QR4A 1MCQA 4UT9L 4KK9D 4ORGA 3MJ8A 5JQ6L 3DGCR 4ERRA 3QAQA 3TLTA 3L39A 5IJKA 3EZJB 3HRPA 1OSZA 3GSQA 1TZHA 3QWRA 4HIEB 4JFDB 2WUCH 1UASA 1MCIA 5TE6L 4YJ3E 4H44C 3RVTD 5TE4H 1S9KC 5EU5A 4EBQL 1RP8A 1JZDC 5TGBA 5ANME 3TT3H 3EDUA 1YEHH 2P5EA 3A6BL 2G75A 4PSRA 4YL9A 3VFGH 4PJBE 4UUJB 1KPUB 5JHLH 2B7DT 3A67H 1T5XB 3NACL 1FRGH 2NY4D 5I19L 1NEZG 1ZT1A 2DQGL 3ZKXC 1NBYA 1K5WA 4YTMA 2LOEA 3CIAA 2O6EA 1HXKA 3QI9B 4MVBD 4JGMA 1TTCA 2CAKA 2ZXWB 1U6AH 1FLTX 4IBTA 1A9BA 2VQ1A 3KMDA 5DMYA 4HUWB 1XB6A 3AJ7A 2VXVH 3N06B 1G9HA 2R1XB 2YAHA 3E8VA 2ICEA 2WINB 2WLMA 2ZYHA 4ONHB 1AR1C 1BGXL 3GM0A 3QIBD 3IPEA 4N90D 4HFWB 4XP1H 2PW2B 4FLRA 1B90A 4IOSD 4YQXH 2K6ZA 3X13A 4D8PB 1HE8A 3H9HA 4NLHA 1ZLSL 3DYPA 3U46B 1M7KA 4XPTL 4ZTOL 1FZOB 3F64A 3KV6A 3QDAA 2GSGA 3SKMB 5LXVA 1J5WA 1CFNB 4RFEA 5F3FA 4JFYB 4KRPD 1KNRA 4YSTA 1KYUA 3SGEI 3ZLIA 4P2AA 1CXKA 1XF1A 2ZT9C 4UQIM 4C8XA 3WAKA 2GBAA 5IVOA 1MG3C 1JZ4A 3SQRA 5LGUB 2R2EA 3SYPA 1RD6A 2NW3B 1MNNA 4NN7B 2UU9T 3Q1EA 2OMYB 4P23C 4HFIA 1TTRA 4HIPA 4KOBA 3IDMA 4FFZL 3MCKB 2V2WB 2YXFA 4YDJB 3TJEH 2EC9T 2BX5A 5AAWA 3KPSD 3SDYH 3WSQL 4BZ1L 4RFNB 2IPUG 1MFCH 1NDGB 1VFAB 5CEYB 1ML0A 4P5TA 1V3KA 4PLKD 4TOYL 4MA7H 4YT0A 2WWMD 2PXYB 4F8QA 1MDAA 2A74B 4AG4H 3HEIB 5C0NC 4M1CD 1KJMB 5EEWA 3B5TA 2QDWA 2KH2B 3QUYD 5E94A 3RUGE 3TTSA 4XCEA 2XPKA 2FR4B 1DN0A 3LH2H 5FXZA 2Y24A 4XI5C 1QNZL 2UYLA 3WIHA 3IAGC 1UYWL 2AV7B 3QUXD 4DGVL 4UV8B 1QRNB 4JBSA 2OMTA 5DD0H 1UWXK 3DDGA 1SDDA 2IAMD 3G6JA 2EIKB 2GUYA 3SBRA 3MRJB 3SBPA 4DESA 2IBGA 1ZJBA 5IFJB 5C0CA 2PUQT 2A6DB 3C08H 3IF1B 4AWJC 3CDYA 1MVFA 3HMWL 2CBTA 4OTXL 5B38B 3OJDB 1SUJA 4OJAA 4APXB 1RJLA 3H2WA 3CBKB 5J6GA 2QQKH 4N0FB 3RX6A 1JZHA 4Z3EA 3AE6A 5CZVL 4JCWA 1FC1A 4FNTA 3UO1L 3FH5A 1AIFA 2AS5M 1N64L 1XMOT 4K4KA 4Z0XB 5TTRA 2X9XA 2UWEB 1OPGH 2VDML 5LCVL 2XG4A 5GRJL 3TM6A 5FECA 4FZEH 3Q7JA 5CP3A 2OMXA 1YMHA 2F7PA 3F6LA 4P57A 3ARFB 3L3HB 5BMFH 1G4RA 3FKUS 3ZMEA 2BG9E 3QH3B 1I8IB 2KS0A 3JV4A 4TVPE 3SPVB 5IJDC 2JJTA 4X80H 4LDOB 5IVZB 4OCYH 4CUCA 2JI3A 3ZMZB 1C16B 2J25A 3QIWD 2AKRA 1JHTA 1D5BA 5PAZA 1E5AA 3APNA 4PYGA 4YDIL 1HI6A 2WQVA 4L9IA 3GINA 2BM3A 4EXPX 4H20L 2CGRH 4X2UA 2VL5A 5IQNA 2VSKB 3QQ9C 5EF0A 3TLWA 5E8PA 4A37A 3KLSA 3SDAA 2X4QA 5GISL 5FHAL 1X4XA 4XAWH 5FYKE 1MEXH 3KVQA 2FBRA 2B14A 5AVYB 2Q7YA 3QNUA 2YBRB 4MXWL 3NP4A 1AD9A 4QAWA 5ABFB 4Z7QE 3KYKL 3EABA 3CSBA 2V2TA 2NY6D 3HAEB 3DOHA 1V5JA 3M86A 1OAUL 4XC1L 3NIFE 3P3RA 3BFOA 1JRHH 3QIUD 3NRPA 2F58L 4K9JA 4L1LA 5EIIG 4HFBA 4TL4A 3WHE1 4AM0Q 1F42A 5T1LD 4AYFB 4HCFA 3RZCA 4IOIB 3SJVA 3QEQA 1HAUA 2QKIC 5I1KL 1IM3B 3OZKA 3AE5A 4ZXBB 4XTRC 5DZPA 1PAMA 2VXUH 3HZVA 4F7EB 5FOBB 4QOKB 1HOCA 1R33A 4XRCA 4PJEB 5D7KE 3FHAA 4G63A 4WNJA 5HYFA 1VPOL 3PWVA 3QFDA 1CLCA 3FQTB 2BSSA 4YS4A 4OLZH 1IU1A 2X1WL 5T3ZD 5JQ6H 1I7RA 3ZQXA 2JJ9A 4EEDA 3GS0A 5DXWA 5BW7A 1SM3L 2P8PA 5FO8A 3S88H 3BRDA 4IDOA 2HVJB 2DYPB 2NPLX 2RR3A 3HB3B 4DR3T 1ZTMA 4DV7T 3P2TA 4HETA 5TDNB 4DP8X 5L4HA 4HUKB 4GG8B 4U1GC 5T5NF 5IWLC 4YL4A 4QT5B 5EWIL 1FDLL 1P9MA 1WFIA 5I6XC 1CXIA 3MU3A 8CGTA 5F3HB 4J3TA 1US7B 1YYLH 4FJ6A 4O5LH 4UOW1 4E9VA 1FNEA 1JD9A 1MCJA 4JJ5A 5F8QC 4KJWC 1IX2A 1YUHB 3ARDD 3HAEG 1U92B 5JDQA 3H9ZA 4NENB 1RCYA 3V0GA 5GJSL 5JPMC 2HT4C 2X1OA 2ITCB 4GKNA 5ICZA 4NQCB 3VFVA 3OG4B 3P77B 3SCMD 3U36B 4Y88A 4JPIB 4UT9A 3V5HB 4W6WB 3WV0A 4X5XA 2XN1A 5J13B 4U1KA 2WQUA 4ELKA 3CBJB 2R39A 4Y9BA 2QVFB 3LXCA 1K8IA 3RAJL 3E8UL 5F1NA 3GMPB 1JDDA 2E0PA 4M1GH 5E0QA 3MTRA 2VTFA 3RWDB 4ONFH 4NWUH 4WWKB 4BEIA 4DZ8B 5CEZH 2W63A 1M9SA 3B1TA 2HRLA 2DV6A 1KV7A 3NZHL 4BIKA 1C7TA 3MR9B 1O6SB 4LSTL 5GQBA 3UU6A 2HWZH 4Q89A 4ACPA 5HXSA 2AMUA 3DJSA 1WT5A 3G5ZA 4IRSC 3NN8B 1L0YA 1IEHA 3K3QC 1A22B 2BW5A 3HKCE 3RNQB 4ODSL 3PAZA 3OKYA 1T1ZB 1HH6A 3CSYA 3VR9A 5AQIB 1YEEL 3FT1A 5D1ZB 1TTAA 3UZVB 1HHHB 1V8HA 5GGVH 4AGLA 4XPGL 3B2XA 3MRRB 3O1IA 3FU5A 4W9HC 1D9KB 1HSBA 5K9JH 4NCC2 4W4NA 2VABB 3EJYD 3UAJC 1ZIBA 4KRLB 3QZWA 2JKSA 5C2TA 4HLZH 4TUKH 3EO0A 5CINL 4N26A 2MTPA 2GW5A 3HBZA 2P5EE 3RWCA 3CZFA 1Q0YH 5IK3A 3VG9C 5F8RC 3NJLA 4GKSB 4K7PX 3INUH 3K6NA 3FH7A 1VEMA 4L8SB 1MCDA 1YMME 4NIYE 2OBGA 5KSBA 2VDMB 2KNDA 3KGUA 2Q3XA 3CPLB 3EHZA 1NPNA 2KC0A 4V33A 4XAKD 1RLWA 3E08A 2EUWA 5D4JA 4HCRA 3L54A 1BLIA 1INQB 1HWWA 1YPZF 2C9PA 2FUQA 3DUUB 1U3HB 1U8HB 1E43A 3QT2A 1SOSA 4GSDH 3PUZF 4QX8B 4YHYB 2V17H 3N2KE 3P54A 2NY5L 2AV1A 5DEFA 3IDIA 3WTWA 2D4FA 2YDQA 2Y7QA 4MA8L 4L8CA 3NCCB 2YUZA 4YSAA 4I3RH 4HS3A 3GB7B 5DJ0A 2A9DA 4NQSA 5FGCE 1M42A 3BP5A 4OLWH 3VM5A 4JM2D 2F53A 4EI6A 4QUOA 4NKMA 3QUJA 2FBJL 1LK3L 1J18A 2UUBT 3MOAH 5B22A 5ANHA 3BPCA 1IAPA 2Y25A 2YFNA 3ARFC 2XZAL 5DJAB 5JIQA 5EZLB 3ZDWA 2SPCA 3RBGA 1K2DA 1UGKA 4LHUG 2CMRL 3MBEC 1Q4NX 1AO7A 4GBXC 4I0PB 1RZFL 2WD0A 4A6YL 3FN9A 5IT2L 1UXWA 1FAIL 3QPQC 1JWSB 4CJ1A 2BKPA 4RRPM 4ZAKB 1U8MA 4XPFL 1FH5H 1WD9A 3U1QA 3ULUH 4WFHE 2ZOLB 4A7VA 4E9SA 3CX6B 1GS6X 4F7KA 4IEFB 4UOZA 1KG0B 3X14A 3EJPA 5DI8B 2V3FA 4GXUM 2CUMA 3BLBA 3DX0A 4QRBA 3PFUA 2LU7A 2F15A 1Y0LA 3CWGA 1VFBB 3QDGB 4TYUA 3WI9A 2E9GA 3U0PA 4M6ML 4N68A 3SKJH 3CK0H 4QWWC 4EZJA 1FFQA 1ORSA 4Y2DC 2B1AH 1GHFL 3DX8B 5KVFE 3OJDA 3WENA 1X5HA 4HUUA 3W11C 4JEUB 5TE6H 4U6HA 5D1QA 5E8OB 2YUVA 3K6DA 5EOCH 4BFGA 4S0HA 5EU4A 2G2RA 5FB8B 1FL3B 2EH7L 2J88H 1IRAY 4Z76B 2A1WL 3JVGA 4ZQKB 4RGNC 5C0CE 5T3XE 1U58B 2X6VA 4COFA 1OGTA 1MRDH 4YHLL 1V55B 1IJ6A 1WDAA 4X9HA 2BY3A 3SY0A 2A6JA 2VQET 2K4AA 4YSRA 3V0HA 1AGDA 3BXNA 1C7SA 4BUGA 2LT9A 1GKEA 3MRGB 3RIAA 4CN1A 1YMMB 4XXWC 4FMFA 4ONOA 2GPZA 5GGSA 5TGBB 3ZZ1A 4KKAD 4B7LA 4G7VL 3ZDYF 1W9XA 1CBVH 1VF5C 5JDFA 4W9EC 3W37A 2E5LT 2V7IA 2V2WA 1AQDA 3ME0B 1T21B 3QHTC 4W81A 4XN2A 2PTFA 3ARDB 1H9DA 1SDAB 2D3VA 4YDVA 5E1AB 3RIAF 3VG0L 4LLYA 4YN3A 4ZUUB 3UAFA 2CKBA 2KXPB 4N25A 1SJVA 1Q9LB 1IGTA 1UB6A 5I0DA 4JY5H 3HKDE 3UPAA 1WWWX 2EE2A 5CWSB 4ABUA 2I85A 1NJ9A 3JT2A 1JBJA 2G60H 1NIAA 4ZZKA 2ZP8A 2CDEA 4HHAB 2KBGA 5DQ9B 1R5VA 1VENA 4TS6A 3ISYA 3KPLB 4Z7UE 1AG0A 4L8BA 4NB7A 4XMKH 2ZKYA 2XHNA 2Q8BH 4AENB 4OCRL 4W68A 5J6HA 1TVHB 1JK9A 2HN2A 1UQSB 4WK4B 3BVNB 5EO0A 2G0KA 2LU5A 2FGWH 2R0LH 3HTLX 1A0QL 4WW2F 4EN3A 4KZDH 3FQTA 1X44A 4HWIB 4O51B 3HC4H 1TO4A 1DQDH 4XNAA 4Z77B 4Y8DC 2NR6D 2WZIA 5F88B 3SDDB 4HWUA 3TA3A 5F44A 4TNWA 1KIPA 3LDBC 4OSUL 3OLEA 4JKPL 3DYMA 1MCRA 3QNXA 3H85A 4N6RA 2V9RA 2BS4A 3D4YA 3TNNB 1J1PL 2WLLA 5HJGA 4FP8L 4DMWA 2BVQB 3GSOA 2O4EA 3EG9B 3EH5B 4ZUTB 3FQXB 3BOVA 1W6WA 2A6IA 2P8LB 3PL6D 3QJFB 3NK3A 1G84A 2A83B 2DTSA 2R2BA 3RG1C 2HHHT 5D71H 4G7QB 5JTGA 1G7IB 5GZNA 4X4MA 4L5FL 2A74A 4N2IA 1N9PA 2R4RH 3V5HA 3FUJA 1OSZB 1S7TA 4HWEH 1J9QA 1LJMA 3TCXA 4FULA 3A22A 2YC1A 2JCCF 3UG4A 2OFQA 4PJ8A 5JOFB 4APQA 1TDQA 4MWFA 4QHUB 4BWUA 3MNVA 2OW7A 1QASA 3IDXL 1IAKB 1KJVB 3B56A 4QKXB 4NZRH 3LKOB 3SY6A 2YRLA 3GMIA 4JPVH 1LE9A 4DP1X 4CI1B 4MALA 5A7EA 1H9VA 5D2LE 4MQSB 3CQCB 5C08B 4L0YA 1PNDA 2Y5QA 4X6EA 4U72A 2EDRA 3MV8B 2BNUB 1NMBH 1BD2B 3Q2MA 4Q6KA 5I23A 5LLIC 2XJKA 2QMKA 3TBTB 4C47A 4KTEL 4KX6A 1LD9B 4MZ2A 3BAEL 5I73B 3LD8C 3N9MA 3J8F7 4D3CL 1GCYA 1N18A 3PL6C 1AP2A 2CPCA 3KPNA 2VLLB 3T4AC 4K2UH 4IDJL 4FCHA 4JZJB 4W9CC 5HPMA 5LGHL 1A1NA 1G1OA 5BZXA 3RWCB 4Y4HC 5M4YA 2XTLA 2XACC 5GS2H 5GS0D 2XWTA 5AQKB 4PS7A 2X51A 1TQCC 2FR4A 1AYRA 2YO3A 3IFNL 4UNIA 2UUDK 1HNWT 2IMNA 3RC8A 1Z9MA 3KPTA 4ZS3A 3KCPA 2HN7B 4GI6A 4NXMT 1YO4A 5DMKA 3F84A 2B2XH 3VQMA 3VXTB 2WMPB 4AVHA 2O61B 4XCYA 2XHEB 3UABA 3GZPA 3G08A 1X5JA 2R1WB 3Q06A 5KVEH 2JTDA 3G6JB 4PJ9B 4NENA 1IFGA 4P23A 2NWBA 3SZ6A 4PRID 4RDQF 3X1NA 1FCCA 1W0YT 3MGTA 4CU6A 4UVBB 1SMOA 2Y7QB 3QHFH 1J86A 4HH9B 5DUMH 5KBPA 2AJ3B 3MNMA 4M43L 1WWAX 4QHNB 3TGXA 1I1FA 4BQ6A 9CGTA 3JAEA 2J55A 4M5TA 5CJBA 4XCEB 4XODA 1PEZA 4AVJA 5LUMA 1DCEA 4HKZA 4TNEA 5FHBL 4PRIE 3L2MA 1TQUA 1DTUA 3SPJA 3HPJB 3QYMA 2G3XA 4LLMA 2W92A 1YNTA 3MACL 3MNDA 5L3DB 4WUKL 2B8OT 5ICZB 2JJUA 2J8UF 4NO0D 4WYVA 2C34A 3VFVB 4X7TA 4AMXA 3VD9A 2C1OA 3DRQB 2NZIA 5GSVA 2QZQA 3ZQ9A 4ZOEA 1NLDL 2BIMA 3DPDA 1J5OH 2A6DA 4TNVF 1MIEH 5K39B 4UNTA 4YSYA 4Q9RH 3RDJA 3GN5B 4WI9A 3TV8A 4JLRA 5EG6C 2NTSP 2GYSA 5MERB 2QSCL 4HGAA 3RPUA 3KPQB 2XV2A 4Z7NB 5I6LA 3HI2A 1KB5B 3QO1B 4Z7UF 3JZ7A 4HSAC 1P7KB 4WDIB 3KWWB 4KC3B 3P73B 4M1GL 4GSRA 4RH4A 5HDBB 4DKFH 3W82A 1FBIH 1E27A 3UCRA 3IBEA 4I18B 4WK2B 5A6LA 4I77H 3VXMD 4IGBC 3CN3A 5LHHB 1KYFA 2Z31A 1KN2H 3MRFB 4F58H 7CGTA 4IE6A 1AH1A 4X65T 4HFWA 2FO4B 4P5MB 2Y3NA 4XCFL 4ZXBA 2AKRB 4HHWA 1CMOA 1XXFC 2OTUB 4YAQA 1S7XB 5JR1H 2XTSA 2Z8WC 1A4KA 2A99A 4OF5A 1Z0NA 2HLAA 1T7VA 2CU9A 4WO4C 2AQSA 2PP7A 5TDOB 4X9FA 2WJ7A 2ZCKL 4X42A 3W0WE 4B5ZA 3T4AA 1AHKA 3GMQB 2QKSA 1FFNA 3FO0L 3BGAA 1OZUA 4LVOB 4F15C 4NC2B 4PTUA 3EXJA 4NN5B 1BQUA 3QJHA 4M5ZH 3QCTH 2C1PA 2B4CH 1GOGA 1X7SA 5C0BE 2UUAT 3M65A 4LASL 3V6BR 1BMZA 4JFVA 3S35X 4QRRA 5JW4R 4KNQA 2YAOA 2J62A 4DK5A 3VXSB 1GPOL 1BBJA 4JGJA 2KMFA 3N91A 3WL9B 3AE3A 3NWIA 1TVBB 2YPVA 2Y6TE 4Y0GA 3N04A 3LKPA 3HHRB 4MRBA 4KO5A 4P2CG 1T1YA 4LP5A 3AMKA 3N9PA 1E9OB 3IBOA 4GSDL 4IJ3C 4D7BA 4G6KH 1Q72L 4IDJH 4LF3A 1BOGB 1G7HB 4JFFB 5CXPA 1EO8H 5LBSA 5L4MA 2CSPA 5JYMA 1FSKC 4ZAKA 4U0RC 2FLBT 3ZT7A 3KAAA 1KB9K 5EK4A 2RQEA 5ID0A 1VEOA 4IDQA 4UV9B 3TT1L 4KWUA 2ZF8A 2M8XA 3E80A 1UKQA 2NCEA 5AQQB 3N1GC 4MD4B 5I8EB 3KINB 1LO3L 3OPUA 3RNKB 5EZLA 3WO3B 1ES0A 2WCSA 3MKGA 4PY8I 4GW1A 3WUWG 1LEGA 5DJ8A 4CKVX 4HT1L 5BS0B 4TUYE 2X0VA 1BR2A 4Z0BH 3RPKA 3ZDXB 2V33A 1HE7A 4QHOA 4A6YH 3VU1A 5GJTL 4Y4HA 1WAPA 1NCWL 2FK9A 1HQRA 1WS8A 4N8VB 4G6FB 5D7IF 1QKZH 3PHOB 5E99H 3BSGA 4K9EC 1KIUB 1SLWA 1WH0A 3FQNA 1JZ6A 1QBLH 1YYMH 4J1UA 5L2KE 4PJFA 2OAAA 4TSCL 2WY3B 4J5VA 3KPPA 1G8XA 2J1WA 3N6YA 1RMFH 3KDPB 3JV6A 1UB5A 1R3JB 4P49A 1N5AB 2BIOA 1WWCA 1WEJL 5LGHH 2Q86A 2YMTA 5FKPB 1P7QA 2YAEA 1ACCA 3QH3A 5B21A 3SPVA 1C5BL 4L8SA 4PG9B 3CH1B 4LMLA 4I48B 4JRXA 2PYEA 2HX7A 4DKEH 2HFTA 3QYNA 1KGJA 1WHPA 2K48A 1KJVA 1AR1B 4OFVA 2WBWB 1CR9H 2WB1A 4LP4A 3VRIB 1J5CA 4FQ2H 3VGBA 1AGEB 4Y7OC 4U2YA 1IC7L 2IH8A 1MCOH 4IU3B 4UCFA 5FVKA 2MFNA 5IBTL 3ZDZB 1HEZB 5C3JA 4L3EB 4ZMAT 5LWYL 4PGDA 1ZLSH 5C8YE 4O2FA 1U4QA 2YSTA 3IFOA 4HK0A 1DJIA 1I8KA 3VXQA 2K70A 3GC3A 5E2UH 1SF3A 3NTCH 4FLSA 2UZIL 5B1BB 3IFPB 1DQQA 1ODAA 1JYXA 2MYSA 4OCXH 5LXGH 1FFPB 3KJ6H 5DMIL 1F11B 2RBLA 3VI3E 4APQD 2HT4D 1XF3A 3DX1A 5AEAA 4FQCH 1GKOA 1AP2B 1P4IL 5IMLB 2JWYA 3ARDC 4L3AA 4TV9E 1NLBL 3T4YA 4P5SA 4E41E 2Y6SC 4F9PA 2Z9TA 4JCLA 1N12A 5GZOC 4KI5E 1X5ZA 1QUPA 2NXYC 2IPTH 4LCWE 3EXLA 1TPXB 4BGLA 2JQKA 1S7UA 5E8EB 2A77H 1T1WA 4J8QA 2X10A 1Z7JA 3PWPA 2V1DB 2LSJA 4AUUA 2W88A 3QDMD 1UEMA 3D69B 2AFNA 1CJYA 2YSSB 5F88A 2GIMA 4MB3A 2A6IB 2BBHA 2BC4B 3QDGA 4GAJL 4GUPB 4Q14A 3GS4A 5HYSA 2HTLD 5KZCB 1P4BL 2VSCA 3L2NA 2JQZA 3LKQA 2XJ7A 2YAMA 3IDJB 3BK9A 4NXNT 4JY6A 4OCSH 3U48A 3DECA 3D3VD 3QXAA 1MAJA 2FWUA 5DU7A 1JYNA 5AZEL 3QDME 1RL1A 1EEYA 2FBJH 3O6FC 5F7LB 1G9NL 2IXQA 5M7QA 2G2RB 4FQXC 4IBUA 3L16A 1G7MA 1UYWH 4OZHE 4APQB 1CI5A 2CR0A 4K7FA 4ZUWB 4FQIL 3T04D 3MV7B 2ALWA 3PNRB 1YEGH 4PJCA 5M95B 4DUZT 3A21A 5J56B 2OL3A 3OAUL 5E08L 5DVLA 2KI6A 3MJXA 3IS0X 5CJXA 3T1YT 4IRZH 4O51A 2BNQB 4AEEA 4HGWB 1V3MA 4ABVA 1XZWA 2WDQA 2F7QA 3CVDA 3QEQE 3VXRE 1DVQA 4OJDH 4TN7B 4FFVC 5K69A 3DETD 2E7LC 1XCWA 4KI0F 3QIWC 3OWEA 4PFPA 1A6PA 3JTTA 2R4RL 2V7HB 3ISWA 2E7BA 3QWRD 5IMKA 4DCQA 2APWA 2O6FA 2YD0A 1IAKA 3A6BH 2VDOL 3CFUA 4YX2H 1TF4A 3B13A 4HMDA 3K8MA 5J9PB 5F8PA 3UTTE 4LPCA 4JDTH 4LNVA 2WWUA 1HHIA 1HILB 5J2TE 5L4JA 1E3ZA 1AXTH 3T0EA 2IMMA 3QUHA 3NIGE 4HJ0C 1NFDF 3FO2B 2R9HC 1G7IA 4LNRB 1FZJA 3F5WB 3W9EA 2FX7L 1UH4A 3FFOA 3WGVB 3MRNA 4NGHL 3L6FA 1ZLUH 1A47A 1MEXL 1OAKH 2KLRA 6PAZA 4NJAL 2F74B 1PLGL 2I07B 2R1YB 2QFPA 1A6ZA 3BYYA 3G5VB 5BV7C 2VVNA 2XM1A 3OV6A 4FJOA 4A2HA 3BPNC 1ZK5A 5IHZA 2XSAA 1D7CA 3BD4A 1CL7H 3WGUB 4OZFH 1A1NB 2XWRA 1X6NA 4JZJC 1PZ5A 3EFOB 3Q2CA 3P4NA 4PFEA 3HC3L 2MNJB 4FEIA 4GFXA 1DLFL 4WEUD 5HDWA 4ES8A 3Q3GB 2JXMA 4WHDA 3FZMB 3SKMA 5LKNA 4PTUB 4HWBA 2VXSL 5IB2A 2OMUB 4PREB 4L9LB 4ESKA 5C0CD 3UBGA 3O41B 2VMJA 4AV5A 3AXJA 3CUPA 3K7UA 3S96B 1W0BA 1AY1H 1F6LL 1DSWA 3OZ9H 3KW8A 5JH7E 1N5YH 4YHOH 4HXAL 4NKMB 2YRZA 3MDJA 1Z0PA 4PJHA 1JK9B 5FC9A 2ATKB 3EGSA 4U6VL 4XGZB 4AOFA 2Q76A 3NPSB 4RISL 3CZJA 2V6XA 3D52A 1ZPLA 1QLEB 4IIQA 5T1JA 4ZI2C 3MRCA 1ZHBB 4XPAH 3D33A 4CADB 3VSVA 1ZSDA 4YDMA 2BP0A 4LMQI 3X3FH 3HZYA 3U9UA 5SWSE 2NSMA 5ABGA 2RD0A 1X9LA 4R83A 2V9TA 3FQUB 1M3IA 2BHZA 1FDLH 5D1QC 2WLZA 3EH3B 1A6AB 4EIWA 1IILE 2KZ1B 2XPGA 1WZAA 1X6LA 1CGUA 1Z0MA 5BVJA 4M4PA 2BO0A 3OKMB 2CJ3A 1JDCA 1A1MB 3ZDYB 4P06A 4XCYB 4ZTPH 3AVRA 5AFUL 4NO2B 1NCBH 4YLHA 2BW4A 2XRAL 3IGFA 4N2DA 2WYIA 4WV1A 4YHIA 3VJ6A 1OTSC 5CN1A 4A67A 3DDFA 3NZ8A 5KTEL 4S1QL 2HT3D 3DMMA 3I50H 3BKJH 3UGEA 1JYVA 2BMKB 2FATL 4QXTA 4F80A 3HL6A 4PH8A 3KPRA 1KTLA 2YN3A 5DEJA 1XSJA 1RUML 3AG4B 3QIBC 4G43B 5TPWL 3U83A 1LD9A 3QIWA 3KPQA 2YWYA 2CXDA 2MPVA 1XXDC 2BY2A 5IG7B 3PUAA 1JMXA 4IU2B 4ZQKA 5LBSH 1H3TA 4KK6C 5AYUH 3NESA 1MJUL 2OP4H 4XMXA 2VLRD 3RKOA 5C09D 5E0FA 1E4JA 1P4IH 4U7MA 2AANA 4HWEL 3C6LA 4PP2B 2GJPA 2HCZX 5TQ0H 4DP9X 2WU5A 4RX4D 3N55A 2VVSA 1W8NA 1JZFA 2Y07L 3T8XA 3MK7C 1ILSA 3LK3B 4V1DD 2W61A 5DHYB 2ESVA 1RKRA 2IGLA 3MJ9L 4BQBA 3S8FB 3MV8A 2FEJA 2WXIA 5K9JL 4BKTC 2OMXB 5IWLA 4P8QA 1XGRA 4OX9T 3AS1A 5EN2A 1BZEA 2WMPA 3MRQB 4X8GA 2UY7A 5KS9A 1W0AA 3AEFA 2PO6A 4C4KO 5I5IA 4HUVB 3ARGA 3VAEA 4V1DE 2BKNA 2IC2A 4I0KA 3EYFB 2Z7YA 4HPOL 5JR1L 1PDKB 4ODWA 1AJ7L 1MCBA 1I8MA 2AABL 3SDAB 3ULUC 1B88A 4OVVA 1YC7A 3UMTA 2XV0A 3H3KA 1YAZA 3VXUE 3FHQA 4RSVA 1NGQL 2JJSA 3K2MC 2GC7C 2JI1A 2WOYA 3CDCA 4RETB 4Z7WE 3ZC1A 3VWKA 1P1ZA 2WIIB 3P0VH 1IM9A 4KROB 1AZUA 5ANMB 3HR6A 4DUYT 5DUPL 5LJNA 3JWNG 4LSSH 5IQ7L 1G87A 4YGVB 4CILA 1MOEA 2ZX6A 1F00I 5D7JC 1NPUA 2VLKE 4PTTA 5FM8A 3SPGA 3UULA 5KVDL 3CX5K 2DIEA 5HHNA 3G5YB 4HS8L 5F6IC 1X5FA 1ZCRA 3O6LH 1HL8A 3SE9H 5DJZA 5FY0A 2ZOTA 3IKCB 3L5WA 5L3BB 2DF3A 4CVZB 2YLHA 5I28A 3ZTCC 4HC1H 3F7RA 5BXFA 2X2IA 1E28A 3WE6B 4N8CL 3H3MA 2PXYD 2ZSWB 2DQCH 3P4MB 5EWIH 3ZHNA 4G8IB 4FGMA 1PGRB 1WBYA 1T89A 5HCJA 2GJJA 2PP8A 3OAZH 4HSQA 3FQWB 2AXFA 4Q9BA 1SUMB 3N43F 3V8OA 3LDBB 2XZAH 2YKLL 3TH2T 3V6FB 2GEEA 4MXVE 4HKJA 2G3MA 3CPZA 2B4CC 3BEWA 5GRUH 4PR5A 1ETZA 3FB2A 1K6QL 3UJJL 4DGYH 4DSYA 3IFLH 4UILL 4WK0B 3ATDA 4OF8A 1YEIL 4Y5YA 3AREC 1KBBA 1A7PL 3V6OC 3O4LA 3QWOA 1K4CA 3RGVC 1M1XA 3V5DB 4B95C 3MAWA 4YSZA 5CCKH 4GO8A 5CFHA 1UA6H 2IDTA 4PJ8B 5JOFA 3DXAD 1NTDA 3C5ZD 1ZT7A 4TTDD 3ZX1A 4X8XA 3U36A 1HIML 4CDHA 2CKBL 5DSCB 2NR6C 3X1FA 4Q6IA 5EZYE 5BRPA 4JAMA 1RZKC 2NY1D 4Z3GA 2HZHA 3WMQA 1P7KA 2MEJB 2K3TA 1QO3A 2K45A 4JFDA 4M8UA 5EHFA 5FDYA 2N1GA 1N26A 4KKLD 1CFVH 5EULV 2BKOA 5KBNC 1E3XA 2NLJA 2IALA 3BE1H 2OXGA 5EDXA 4NUQA 3ZMUB 3GMMB 1YNLL 4AZUA 1OWAA 4LL9A 5EUKA 2IADA 5IIEB 1F6AA 4RGOL 1LRZA 3A3YB 3UUMA 3JWDL 4J4PA 3ML9A 4HWBL 5ENWA 3AE1A 2CUAA 4XX5A 3RVUD 1UXMA 2ZONA 2H3XC 4XE5B 3B1UA 1OAQL 4C56E 5L8JB 1H3UA 2WBKA 4AQ8C 1RU9H 3LRMA 4WHTA 2H88A 1EO5A 1DQVA 1IBGL 2LAGB 1G94A 2XFGB 5C92A 2VW7A 3RIFA 4HXBH 4DPRA 1KGYE 4C91A 2H9GB 4GYBA 3K72B 1WAAF 4NPKA 4F7PA 5GZND 4X6DE 2EICA 3AE9A 4PWKA 1EZ3A 5DHVB 1G7HA 2BSEA 4RAVA 4UTAL 1JUFA 3O6MH 2HVKA 4NRYB 3GMQA 1QATA 3Q13A 4NUUA 1ZVSB 4D8PA 4ZAKC 4E9QA 1F58H 3T8OA 3PV6B 3S34L 3FN3A 1V7NH 3BVTA 4HS6B 1S5HA 2MKLC 2JKJA 4QDGA 1TUPA 2Q9QB 4UT6H 5LGJB 2J57A 3P0GB 3REWA 3BQUB 2G0LA 2W9EH 4I85A 3LS5L 2UZXA 1IJ9A 3U0TA 5CA0E 4N2AA 2V17L 5I16A 1KLGA 3LSVA 3I50L 3GSUA 1ZV4X 4R4FH 4K8RL 3RIAK 3BGFB 1XGYH 1XGZA 3GMLB 3M88A 4KUZL 4YWGL 3W11D 2R8SH 4X4YA 4XE0A 1AFVL 2AJXH 4K3HA 1U8LA 1Y18A 4HPYH 4EZKA 4RGNB 4TLKA 1WBXA 1E4HA 2P5WE 4M7LT 3VH8B 5AAWC 5ESAB 2NX5E 3V0FA 7PCYA 4KDTA 2FO8A 2C9AA 2J1YA 4AL8C 3WO4B 3PGFH 2Y3AA 4GAJH 3FFDA 4EI6B 3QUZD 3WXVH 2WKOF 3NH7L 4XNXH 3HUJF 3HA4A 4RCAA 2VLJA 1XGPA 4X7TB 35C8H 4GW4A 5DWPA 1MHEB 3EGDB 2K8QA 4YSXA 3HUJB 5ICXB 1XMEB 2DLHA 2F54A 4R7DA 3ZKMC 1AKJA 4AYID 1E65A 2G75B 1WCBA 1XF2B 5CZVH 3DRTA 1B6UA 2WZ5A 1KYOJ 3FRUB 4LSRL 4QRTB 5B1JA 2Y36L 5H37H 3CMLA 1F4XH 2WVUA 4IBQA 4BV1A 3MLPA 1E7PA 1GGUA 1N19A 1MW1A 4JY6B 1SZNA 3B5HA 4W9ZA 1R8IA 2DD8H 5IOKA 4GS7C 1QKZL 3KNBB 3D3VB 5E99L 5HVFB 5EN3A 5F0MB 2H6UA 1TQBC 2RGSA 4JJHA 1BEYL 2QELA 4ATTA 4I87A 4KY1H 5AOIA 3TCLA 3WFCH 3EYUL 4GB9A 4PV1C 1HHIB 1J5ET 1H8OA 4PY7B 3ZPDA 2RHEA 4N8VG 3Q05A 3UROR 2H7VC 1MUJB 4J3UA 3GSNA 2APTA 1MI5B 4JKKA 3ZSSA 2DL2A 4L3CA 1PY9A 1CXHA 4GRLD 3RE0A 2WYTA 2VMCA 3Q5TA 4KVPA 5T1KB 4UYQA 3T6ZA 1RHHA 5JHDB 2FYYB 2YGPA 1J8RA 3K1DA 5CCHE 1BFOA 4R97B 5T5FA 4G8FA 3FT0A 1KTRL 2LHNA 3RRWA 4NFCA 3NQKA 4RSYA 4UQ2B 4AIOA 1ONQB 3EOYG 2GY7B 1UOKA 5IBTH 2AEPL 4B3MT 4JO8A 1NGPL 4FA7B 2WN3A 1R6VA 3EGSB 4XGZA 3OB0K 1VRSA 4XP9L 4YLQT 2JXMB 1P84J 2MTAA 4F7CA 3BDXA 4TV3A 1E8YA 4NO0B 3NZQA 2B5IC 5AD0B 1EAPA 3RA7H 5GZNC 4WFEE 2DQDL 5GGQL 2X4SB 1B6DA 3QRLA 2EINB 4AIEA 1CDYA 3SQBB 5K9QI 3BPLC 2L7UA 3KEHA 5DC0A 3JVFC 4D8OA 3Q48A 1J8KA 4UTAH 3ONJA 2EIBA 1NLBH 4IDNA 4Y5XC 1MMNA 3EDEA 1ZE3H 2NT1A 3DO7B 4NNYB 3VR8A 2WM0A 4ILCA 5A2AA 4N2KA 1H0DA 3QVAA 1FNAA 3MJ8B 5HHMD 5C2UB 1MF2L 3DIDA 1E5ZA 3MRHA 1I7RB 2IUBA 2BNRB 3RUGA 4LGSB 1O75A 1WC7A 5D9SA 4KKLC 2LVCA 3CDFA 3L5XH 2F7OA 1BVLA 3GRBA 3M6DA 5JYLA 3MA9L 4M43H 4JB9L 4M7LH 4XBFB 2Y4SA 3PUGA 4NDMA 3AQDA 2QPUA 1QLFA 3VXSE 5JW4Q 4YGAB 1GSKA 2VDNL 4TPRH 1OGAD 1U8JA 3JWDC 5IBUB 2PTUA 1K72A 4OCSL 3OR6A 3WEBA 2F8VA 2JB6A 1OTTC 3BP6A 3VXPB 1YD8G 1XBRA 3O6FD 1H8LA 2J5LC 3TNNA 2J6EL 1NZRA 2Y5TB 3CFMA 3ARED 3GS7A 4DN4L 3LTVA 3O3AB 2EHOB 1KYDA 3NSXA 3M17A 4PP1D 4HGWA 1RUKL 2HWZL 4PW3A 4L1BA 1GY2A 4R90L 4ONHA 3OKKA 4X6FA 5E9DB 3V10A 3KPMA 4L5FH 1A64A 1OGAE 1RZKL 2ODIA 2IC9A 1QA9A 4XBGB 3ROOA 1UD2A 1XF4B 2CIIA 3HIZA 4MDJB 3Q6GL 3NK4A 4FMVA 4OB5L 3PWLB 2VMFA 2QSCH 3EDVA 2F1BA 1A4AA 4HTEA 5D7IE 2XV6B 5HI5C 3GBML 4UUJA 4H9SE 4OZGF 5HCMA 3C5ZA 4HUVA 4KKNA 3O4LE 1H3VA 1PZ5B 3EFOA 5DEGB 4YFDB 4MJ6A 4JO1H 4XPTH 4ZTOH 4K3DL 1PKQA 1N0LA 5DFWH 4A2FA 3HI6H 4QRPA 3LHPH 5IR1B 1DLHB 1YEFH 1JZ3A 5B39G 5F96H 4FA6A 4ADZA 1Z5LB 2VLME 3FRPG 4PBXA 2WKOA 1HINH 32C2B 3VXOA 2BVOB 4G1EB 2EO7A 1CFBA 4FQHB 4XPHH 4D94A 5IIEA 2VZSA 5T33L 4K3JL 1DBML 2PWHA 1UC6A 1NMBL 1MFDH 2BIPA 1KXVC 2VC2L 2V2XB 4F8PA 1UZ6F 1H3PH 6FABL 2PETA 3MRNB 5D7JD 3WY2A 5FXXA 1A7OL 2C3GA 4JRYD 3MRRA 3NFSL 1MCCA 4F7EA 4K8RD 4B3ST 4W6YB 2X9YA 5I1AB 4R6UA 2DQUH 1WFUA 4OM0L 4JO2L 3QQ4A 5L88H 2LTQB 1WIUA 3U1SL 5H4ZA 5LHGB 4NT6A 4BCXA 3LX9A 3SRZA 1E6JL 4HWZA 3PWUA 4ATWA 3EYOB 4DERA 3LNHA 3RQ3A 4QEGA 4IIJE 2PCYA 5BUPA 4EIUA 4Q9CA 2BSED 4WFFE 5EU6E 2RTTA 5B7MA 3CDZB 2UYLB 2XN9A 5JHLL 2X7LB 4K55A 4PJBA 2P48B 4YGVA 5EBGA 5C0AB 2VDLB 1X9BA 1KFGA 1RIHL 4WIQA 5IROD 4R2GB 4OCWL 1FG9C 2UZYA 4EGWA 4QXBB 3RBSA 1FFOB 4WWNA 5HJBA 4U4BA 1HL5A 4EAEA 4N5EC 3V5SA 4RIRA 4P5TB 5DMKB 2CMRH 3L3GB 1DJYA 2QRXA 4FQJH 3SE8H 4IHOB 2E9IA 4Q0XH 2ZE0A 1O5DT 1KCSH 5JIKA 4ALAH 1RZIA 4HIIA 4PGEA 2E74C 2WJ5A 4JDZB 3DK2A 4FG6C 1D2OA 2DKUA 2FHBA 5CKAA 2VKHA 1XCTB 2LRLA 2Z65C 3AFLA 5IG7A 1JNHA 3N1MC 3S5ZA 1TZOA 1WRFA 3CZSA 2EVHA 4MNQA 1TNMA 1L0VA 4YSOA 3FTSA 4BFNA 1KJ2L 1ZA3A 1K8DB 1ETZB 4GRLB 1AANA 1VKXA 5DHEA 2ZCLH 4P57B 2VDRH 5ERWB 1JJUA 1ZA6B 3RX5A 5L3GB 2ESVB 3FCSA 3NZ8B 2BSCA 4L48A 3MRJA 2VZ3A 3BIBX 4LCVA 1Y07A 2NX5A 3K8KA 2EDBA 4PJ5E 3FMGH 3S4UA 1U9KA 3DRTB 1A7PH 1C12B 2ZUQC 4HMEA 2FJSA 5J1AB 1Q9WA 3PWPD 2PNDA 4O2EB 2WBLA 3QC5X 2FL5B 2WBJC 4G9FE 2PO6C 4KZCA 3C2SA 4JM2B 4GYSA 3MLTB 5KTEH 4U1MA 4Z7WB 2OSYA 5DJYB 4FQQB 4ADGA 1KEMH 4HKAA 4J27A 1HIMH 5ABFA 4OT1H 4ZOBA 1F3RB 4LCWA 5C0EB 4AQAA 4LCUB 4I13B 3DIVA 3DHPA 1M71A 3L17A 1T0PB 1I7TA 5E95B 4G7SB 4G9FD 2XUWA 2R0ZH 3WNKA 4DK3A 1GW6A 2QGCA 4U3XA 4B9ZA 5ACLA 3TCLB 2ATAA 2F19H 5LGTB 2ARJA 5EIIB 4M03A 4M00A 7PAZA 4GRMA 3MZGB 4DHLA 2BP3A 4NO3A 2NY3B 3FU3A 4P46D 2VB6A 2O5NA 3TFKD 3AXLB 5LMNT 3Q5OA 3KHOA 2ZOWA 2DQJL 4MFRA 3T3MF 2IAAC 4XCNB 1OP5H 1NC4B 3AECA 3D4GA 1HH9B 4PJ5B 2XU9A 1A6VL 3ETVA 1SJEB 2JB5H 2EIJB 1VFMA 4IGUA 12E8L 4B0MB 2K9FB 3ZE1B 3ARYA 4LVEA 3EOAB 1A6UH 1I1CA 5AYQA 1R5WB 5GRJH 5KZCD 1A3ZA 3ET9F 3CTTA 2J7LA 3NFSH 5HDBE 4M7JL 5HGDA 4XRCB 3OR7B 1P2CB 5AOJA 1NGQH 2W9EL 1N3NA 2XY2A 2NY4C 3VW3H 1CZ8H 3JTBA 2R9HD 5D8JL 2R2HB 2CHDA 1B0GB 5JPMA 1PG7L