4G2AA

Crystal structure of a putative nutrient binding protein (lpg2210) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.33 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
321
structure length
321
Chain Sequence
NDTAVGGEGSLPIPVSQPHIKMVSELIRISGKNLNEPQMNGSWHYNCNFTFKNTLNKEVTISMAFPFPINDGNSEIALPAGQQTNVGQALVYDFLVTVNDKQVSAQRGNIAPDQNKGLYYEDAYFWKTTFPPLATVNIHHDYSTGATYDVMGYHWVRYVLKTGALWQDSSIGHTRLEVIPNTPTRLCSEIDQKADYLNPTPSGMSISGSRADRKYIWDLRHFQPQADLSLCLFTGISYVRYKVIYPWLNSDDALSKLARLSNKELRFLRNTIYAQYGRQFQSPDLQEYFSKKWWYVPNPDYSDRMLNEEDKKLLSMINQAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (lpg2210) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 2.33 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 77
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13308 YARHG YARHG domain
A PF14415 DUF4424 Domain of unknown function (DUF4424)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1690 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4g2aA02
2.60.40.3680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g2aA01
4G2AA
chains in the Genus database with same CATH superfamily
2AV7B 4ABWA 1CF1A 2VZ3A 3PJSB 3MBEA 4PJ7B 4A7QA 1BEXA 4OLZL 5DZJA 3HE7A 4MCZB 1XGRA 4XOBA 1FNGB 1JXKA 1J1XH 3Q5DA 2F53A 4HIXL 1CYXA 2LT9A 3VFWA 3FT9A 4XPHH 5AAMC 5J9PA 1E6OH 1EZUA 4G70B 2B1HH 1MIEH 1FJGT 2OTWA 3D18B 4K8RC 4Y9BA 3WENA 1TETH 4YIQB 1YDPB 2RP4A 2WNXA 1BX2A 1RPQA 3O2WL 2WKOF 3QDGB 4PP1C 2W0KA 4PJ8A 2VYRE 3CQCB 3APCA 3QQXA 4OB5L 1A6UL 2FQDA 5KSUB 4NZRL 1QRNE 2Q7AA 2Y07H 3TOPA 4ORZC 1PNCA 2WC7A 1IIIA 4Y16C 4FFVD 4CRPA 3UTSA 2VJXA 3GT6A 4PWIA 4S2SB 3HG1B 4LKXA 3RGHA 1TOXA 1KUMA 2Q2LA 1JDCA 4WI5A 2CWOA 3CSFA 5CJXA 1Q1PA 1XD0A 3C4ZA 3JWOC 4JB9L 2IOMA 2VZUA 5DS8A 1NCBL 1OQOA 3MV11 3V0GA 4FF9A 2ACXA 5E1QA 1IBMT 2LTQB 3LBXB 3FT3A 1OAZL 3UAFA 4GG6F 1QVOB 2NY5L 3VACA 3AMKA 1UZGA 4XN4A 3PUXF 3QYCA 3ZC0A 2AI0H 5IM7B 1NEZA 2JCWA 2X67A 1HXMA 2DH3A 5C0RL 1P9MC 1NKRA 2J88H 4U1KA 1TLKA 3NP3A 4G6FB 2K70A 1JPGA 5EDXA 5DD3L 4RRPA 3GXNA 4Z7WE 5FX3A 4Y4KB 4EDWH 2BP0B 3O2DL 1HKLH 2IF7A 3NJHA 4W9ZA 3C2AH 4FTDA 3OHXB 4F15C 4GI6A 2R1WB 1PS3A 2D5UA 2XM2A 4U6YA 1KN2L 4BRVA 1B7TA 5C08E 1LE5A 3HR0A 2FEDC 2WAHA 4OZIE 1GGCH 2DWDB 3BO8A 2YLKA 4AEFA 4F1SA 2LE8A 1H5BA 2AEIT 1NCOA 2OJEA 3KW7A 4MAUH 5JLZB 1QSFD 2FX7L 4YLHA 3Q43A 2Y06H 1OTSC 1LDSA 3RKOA 3E9UA 2QKIC 1NDGA 2N7AA 4RAHA 4XPTH 3T9WA 1D1AA 2BS8A 1F2QA 2ENYA 3FCSB 4NQEA 4PS4H 4X7DC 3T8MA 2XRAL 3QWQB 4K3DH 4PJXA 3MXWH 5B4MC 1U58A 4TTDC 3UJIL 3PWPB 3ULUH 1U8CB 4ONGH 2FSEB 3BQUC 5ABFA 1FZOA 4XPAH 2BS2A 5CINL 5SWZD 1F6AB 2QVFB 2R2EA 3DSFH 5DI8B 3RWEB 3SKMB 5AYUL 5EU6A 2Z6EA 3IMVA 4MCYA 1WVZA 5H6QB 1A1OA 3NTCL 4NM8L 2WU2A 2F15A 3FFCE 3P77A 3NJLA 5B38G 4I18C 3KZ8A 3MV9E 4AGOA 1TO4A 4IRJD 4DEPC 1IBHA 3PDGA 2BIHA 2RGSA 3MNVA 4HFUL 4LVNC 1TEGA 1M71B 3RQ3A 2J12B 4YDLC 3QB5A 1LGVA 2MYSA 1ET8A 1W80A 5DJCB 4OV5B 3QH3A 4S1SL 2VLRA 5E8EA 1KNOB 4WDIA 5C09A 2ZYIA 1S9XA 3P4QA 3VJ6B 3EVYA 2X4SA 2FE0A 4HUXB 2JMKA 2ZX7A 2F6AA 4K3GA 5BVPH 5HBBA 1FUNA 1ETZA 2IPUG 2MTPA 2BHZA 5FO8B 1IVTA 4XI5C 2IADA 2QGCA 2MEJB 1RUMH 3A6BL 3L2MA 3FFDA 4GK5E 4FNUA 5E6ID 2OYLA 2PJQA 5TDPB 4C90A 2JMRA 4U6VH 4BZ2H 4OH2A 4PY7A 4CAGA 4Y2DA 2W9DL 1KCWA 3QFJA 4N0CC 3MJ9L 4FRWA 1FCGA 4UZGA 4Y4FA 3BFOA 2GSIB 4K9EH 3ONLC 1HI6B 2D31B 1WLHA 4QTIH 3BUBA 1M7XA 1FL6B 3QUMB 4JFXB 4OZHF 3ZXAC 2BVOA 2CUIA 5B1BB 2GPZA 5IQ7H 1YYML 4J2QA 2VLKA 3VFUA 1S5IH 5E5RB 1Z3GL 1KIPA 1E8ZA 2LSIA 1DJXA 3F7YA 1BQ5A 3RWJA 3CC5B 4R2GC 3KNBA 1ZSDA 1IU1A 1OAYH 1EUTA 1Q9LA 3LD8C 3UFIA 5JORA 3HI5H 4PV9B 4RRPM 3HVNA 3K2MC 3RVUC 1BR0A 3WD5L 3HW7A 1P7KB 3TIEB 4MJ2A 1ZHNB 4M61A 5ABDE 2IWGA 3BPLC 2FT6A 3S3JA 3PV6B 1PLGH 1NAMB 3INOA 4Q4EA 3KE0A 3GC3A 3L1OL 1R46A 3RGLA 1GPOH 1INQA 4Y8AA 3BMWA 3MV7D 4M6NH 1YPZE 1MVFA 4RH4A 4F7CB 3B8YA 1LO4H 3TNMA 3V4UH 1LD9B 2Y7MA 1QLRB 4GUCA 1LP9A 4FA6A 5J3HD 4Y4HA 5KBDA 3IXAA 3LN4B 3M1CA 2GG1A 5D70L 2VSDA 3OXRB 4ZTOH 1MHCA 3PWVB 2AXGB 3UC2A 2TRHA 2AAVA 3IDJA 2YQ2A 2YRPA 1G6RH 4CDHA 4I3SH 5AZUA 1YEKH 2ITFA 3VD5A 5PCYA 2CKBB 3NJIA 2FYYA 1T7WA 3GNMH 4OTXH 1KGUA 1CXLA 3RTQB 2HFGH 2DKSA 4KPHH 3U4KA 3BZFB 1ZLVH 1XH3A 1JZ2A 3MRLA 1N0XH 3HI2A 2CMRH 1WYBA 3OLGA 5BXFB 3CQQA 3ARED 2EDOA 1KTBA 3GBMH 1P0SE 3GSNA 1TZIA 3CSGA 3WNKA 4MZIA 1UH2A 4JVWA 1JNRA 1XIWC 3SDDD 3IN2A 2X6CA 1AC6A 1CFSB 4MA3A 5EFIB 4GW5B 1HHIB 4MDIB 1U8JA 2WSKA 1GC1L 1F8TH 1S2EA 3QEUA 4NUJB 1DN0B 3DIDA 4JE0A 5FB8A 1KCRL 3DROB 4DP0X 4WW2C 1WPCA 2VXQH 1I8LA 3NIFB 1GZHC 3B5HA 4I0CC 1E9QB 1HSBB 3JBG7 3O3AB 4LDEB 2AJVH 4Z7UA 1UJ3C 1QR1B 3HLAA 3ZBMA 3QORB 4HBCH 3FKUS 4PRAB 3T3ME 4JRYA 2VDMH 3S3DB 2WGXA 3BZDA 3FB5A 4LCYB 1GSKA 4E9RA 4AMWA 3SHSA 2J2ZB 3V7AE 1J87A 2AQNA 5H35B 4GKZA 5JHLH 2P48B 3UOAB 1C1EH 1NGQH 3LG7A 3EDFA 3HIZA 4G8GA 3M1BA 5LAXA 3WYRA 2YINA 1QBAA 1LL1A 2OMWB 1KJ2B 2I7OA 2X44D 5E5UB 5M95B 1Q9OB 2VDPL 4F15B 2BCMA 3BQVA 4XBPB 1JK9A 5FGCE 3VD0A 1XMEB 3OC5A 3M6DA 2R6GF 2MCMA 5I30L 2YDRA 4LSDA 5LHGB 3DUUA 3OYXA 2DQFB 3OKLB 4RLDA 2YMXL 4DR1T 4CMMB 4O2FB 4FFYA 2OL3B 4MBQA 3OWRA 4Y9FA 3US0A 3EUHA 1DDHA 4ABQA 4JPWH 4L8BA 1FFPA 4MMXC 5FNVE 2CCWA 3BVNB 2XWDA 1C08A 4R7NB 2PTFA 2QKIB 3BP4A 5IWAT 3ES6B 4HUNB 1M1SA 2JXMA 4UM8A 1MF2L 2BS3A 4XNBA 3B3IA 4LLUB 3VRIA 2QGDA 1VRSA 3EOBB 1BQKA 1N26A 1YNLH 4JFEE 3UU4A 2XKUA 4LASL 4MA8H 4OLUL 1CDUA 5CLTA 3Q5EA 4NBZB 3ZTNL 1I4FB 5AVUB 1MIWA 4KRNA 5H4ZA 2GTQA 2BIOA 5ALCL 4MB3A 4LCWB 2AS5M 3FONB 4X9GA 1ETJA 1QX1A 5CUSL 4R4BB 2BG9C 1QBMH 3IU4L 2APWA 3P9LB 3PQYA 3QAZC 4H1LG 1HX1B 1B4JL 4J3OH 1NICA 5IYZE 1O6TA 2ODUA 3MLPA 4B9CA 4LVNB 4QCIA 5E4IA 1VFOA 4KBMB 1EHLL 2EO1A 3AXLB 4HS8L 1CYWA 2RFXB 4P5KB 5B1KA 5AQOB 4P59H 1SUHA 2H5UA 4DBQA 1DQDH 3QCTL 5TDOB 4TZ4C 4ZHQE 3FTYA 4L8CA 4PRNA 1BDYA 1J1OL 4XBMA 5CR8A 3SQRA 1R24A 1R17A 4DAGH 5BMFH 3LKQB 4DGVL 2J1ZA 4WWOA 3OKOA 1ZOYA 2FGWH 1JNHB 2HLEB 2ADIA 2A9BA 1QTSA 2HPTA 1V7NL 1L0XA 2PG8A 3LRHA 1NFIA 4HV8A 5FIEA 3VM5A 1JHLL 1FN4B 2EDLA 4DR2T 3ESOA 3GIVA 4FS0A 1FG2B 3NIGF 1V3MA 5C0IA 5KSBB 3O3DA 4IOFD 5EZYE 2YK1H 1QR4A 3DBXA 3WELA 3ZMVB 1VZGA 5MEPB 4H63V 3QIUB 2ZOTA 1A2YB 4HOXA 3DI3B 3KEHA 2J8OA 3Q2MA 2DQEH 1ZV4X 3DRQA 3MV8A 1DU2A 3QJOA 1N2RA 4Q9RH 4KWUA 4J4PD 4C56E 2WXPA 2D0TA 1CGYA 3BQIA 4UMSA 3BSHA 3P2TA 2NR6A 3CX5K 4FOMA 3GUFA 4OFPA 4X8JA 4XB8A 3AECA 5C0CE 5TGBB 2BWIA 1NUGA 1EDQA 4R2GB 2DL1A 1I9EA 1ZEAL 3GRWL 5TQ0L 3U9PH 1WYJA 1C5CL 4LLMA 3LD8B 3V4PB 3KPQB 3CKDA 4FLRA 1YMMA 3T2NL 4XVJL 3AQXA 3BN9C 2JELL 1KC5H 3HKDE 2G30A 4WGVB 2AJ3A 2QBWA 5D7KD 2FYVA 5G5DB 3TFBA 3WE6A 2ITEA 4F92B 4RMBA 1WZLA 3IJHA 4Z7QB 4GBXA 1DLFL 1U8IA 4EOWL 2O5YL 1H3XA 3GM8A 3LNIA 4Z0BL 3VD7A 4DO6A 4BJNA 1PZ3A 1HHKB 5EU7E 5FM5M 3FT2A 2Q5BA 3QI9A 3E1F1 4JFFE 5EZJA 4DP4X 2PYFB 4BSVB 2H1PH 1TJHL 1O9VA 1TZOA 3TZVD 1C16A 4K3JH 3APNA 5E1IA 5GZND 3K8KA 3RWDB 2WBJD 4DPAX 2AXFA 5IWLA 2V7HA 4LSUH 1JIBA 4X5QA 1AGEB 1S9WB 4FI5A 4NUQA 5BVJA 1QW9A 2WXHA 3EI0A 1ETA1 1JYNA 2NSQA 5F3FA 1ZWIA 3RYIE 3ET9F 4KKBC 2YOEA 3UTPE 3MZTA 4HUVA 1EV2E 3FOMA 2VE6A 1TQUA 1JGVH 2V2WA 1QZ1A 4PIBA 2J5LC 4ODUB 4TNEA 1QACA 3NCEB 5I8KL 3LAFA 3QCVH 2HXAA 2YD0A 3FSZA 3MREB 1JK8B 3ZQXA 4N8CL 1ESOA 2YQBA 3DUSB 4HZAA 2FB4H 2ZXDA 1G7LB 4KI1A 5HHOD 4YDKL 5IFAH 1OLZA 5KMGP 4PRPA 5KYNA 1GYWA 1HL5A 2P5EA 5ICXB 1FL3A 5CNHA 1I8IB 4DV3T 5C7XL 2NP9A 4NUUA 1OGPA 2VUKA 4C91A 4ZG1A 4G5ZL 3CXDL 1Y07A 2C9SA 4NZUH 4NKMA 1URLA 3WIHH 2ZMAA 4BE6A 4DO0A 1KPRB 3U0WH 5ADOH 3NBXX 4EZKA 3SODB 3ARBD 4G9FA 4KBPA 2PP8A 3EABA 3KWXA 4H0GA 4HULB 4XN8A 3AU1A 3CXHJ 4WW2B 3BFWA 3BH8B 4PP2A 2JLLA 4O5LL 3L5XL 3EOAB 4X0KA 3DTXA 3D0VB 2JJWA 1UJ3B 2IGLA 2YPKB 3QC5X 4WUKH 5E5MA 1EUUA 3EJZD 4XCFH 3BK9A 2LFEA 4RCAA 3G06A 2VMFA 4XNYH 3SKNA 4YSEA 2OMVB 2OMXA 4PB0L 4PJCA 1CE1H 2D73A 2HA1A 3ASWA 3TEXA 2IDUA 3RZCB 4AV0A 1IJNA 5L2JB 5BZWA 2LGNA 1G5GA 4WKZB 1Z0PA 3NK3A 1DQMH 1FL5B 4S1RH 5CWSB 1PJ9A 1ND0A 1ECYA 1CFNB 5AFUL 4PJHF 4PGEB 2AJUL 2R0ZH 2ZKWA 4OFYD 4YE4H 4DN4H 2PCFB 2BY2A 1IRAY 4TSCH 3CAFA 5F3JA 4X5PA 5KS9B 2BBJA 3R06A 5CGYC 4OGZA 4QH1A 3F12B 6TAAA 3BXNA 1E4WL 1HQRB 3RVUD 1IZJA 2PWFA 4X5RA 4WJ5B 5A2LH 1BQLH 3BEVB 3TBSB 3B7SA 4HGMA 1T1ZA 4JDTL 1T6VN 2PW1B 4JI5T 1TJIL 1EGJL 2I9TA 1MFUA 1W72B 1RHHB 3UEQA 1WF5A 3BCFA 3EJPA 1UM6H 3KVPA 4W68A 1S9VA 2YBRB 4PRID 4P07A 5EEUA 3CVHA 3QO1A 5HXMA 4HUCA 1CD1B 2HRGA 1FLRL 4Z90A 2WCGA 3FTUA 3NYKA 2CEAA 4GS7C 4JFHE 4JVUA 3VRLF 4K0UA 1D6EA 4DKEH 4CVWA 2RR3A 4OYJA 3BE1H 2BG9B 3EO1B 4Q6IA 4K71C 4KU1A 5G2NA 1H0DA 4WUUE 3U48A 3UXFA 2P26A 3GSNH 4TMPA 5CN3A 4BFOA 3SPVA 5LGNB 3FO9B 2B0SH 1NGZB 4LSRL 4X5XB 1U93B 1OW0A 2EDJA 2AJYL 3C08H 3LB6C 2IC2A 5E2WL 4ZFOB 4A7TA 4APQA 1VEOA 2GT9A 5HHMB 5D7SH 3QEQE 4TWHA 1A4KA 1LO5A 3VD9A 4E2OA 3I9GL 4LSPH 5MENE 5KBLA 3RVVC 3DURA 3JWDH 3B9KA 3NABH 4LOVA 2GJ6B 5DWPA 2QSCL 3IF1B 2ZM0A 1TJXA 4QT5A 1OK8A 1SMDA 4TVPL 5AVSB 2YAEA 4LSTL 2KLRA 1ZT7A 4RZCA 3B6SB 2VDOH 4YJ2E 2Q3XA 4EAHA 5HXHA 2IDCA 1LNUA 5DJ8B 1ODUA 3ZE0F 2L3BA 2ZKXA 4ODWA 3TU6A 5IFHL 3D25A 1J9TA 3VXNA 2BRQA 3DPDA 3OC8A 1RIUH 4LF8T 2EDRA 2D7NA 1F3RB 3B5GA 4XWOC 4GG6B 1YA5A 4QOKD 3TBWB 3DSNB 2HWZH 4S0TD 4CNIB 3UTTE 2JQ9A 3HPLB 5GS2D 5HHXH 1N5AB 2X41A 4IBYA 4U1SB 3OKNA 3GBNH 3D48R 3KJ6H 1KEGL 5FL1A 4R3SA 2W80C 4F2MB 7FABH 1JZ4A 4ICWA 2WK2A 3NCYP 4FQXA 3I02B 2DLTA 2K9FB 2UYLA 2VL8A 2W0PA 3GHEH 3ATAA 4ZMAT 2JIXB 4H0HB 3V4LA 2OSWA 3TEZA 3KPMA 3TJPA 4CJ0A 3QCUL 2W81C 1VADB 2H1LM 3RURA 4W9KC 5ALBH 1O6SB 2I7SA 4TV8E 2VN7A 1UENA 1ZXKA 1VCBC 2BSCA 3FUHA 4LPWA 4XP6H 3BHBB 2SEBA 4J3OF 3IGLA 1PIGA 1EEQA 4PJ7E 3ECBB 3KPPB 4LFBT 1J9CT 4UU9A 4XZ4A 4C56D 1A3LH 4GQZA 4YR6B 2A6DB 4UQ3B 5C0CD 4RMSA 5E2UH 3UPRA 5EOQL 2BFVH 2Y5EA 4DQAA 3ZPOA 5E24E 3ZYZA 1C8PA 4BKLB 3QDGE 1DBBL 2XPGA 3VFPB 4LLDB 3AAAB 1EHKB 4LQFH 1X4ZA 3AS0A 2GAZB 5BRZB 4U0RB 4QRTA 4HJ0C 4JFTA 2CO7A 2P5WB 5D1XD 4XE0A 1OP5K 5I2IA 3AT8A 4R0LB 2Q86B 3HG1E 5AQNB 1G7HA 1DQLH 1JVLA 2BS4A 4DR6T 2CK0L 3DNKA 4B5ZA 3SQBB 3DOHA 5LGKA 4PBWD 1Q72L 4FERA 2D03H 4JFFD 5T1LA 6CGTA 3W9DB 3JQOB 2H0EA 3BEWA 2CA5A 4G1MB 4HIIA 5GGRY 3RVWC 5IOKA 4ZI2D 4XP5H 3IJSB 2DQJH 1KOAA 4HCRL 4Z5RB 1KDIA 3OKYA 3ZKNC 4IBTA 5FV1L 2KXPB 2EO9A 4B9GA 3B7TA 3G6JA 4NQUA 3PWNB 3QIBC 2IHR1 2EJ1A 5KVFE 1FIGH 2PWDA 5DD1L 3NIDF 3SD2A 1F42A 3H9YA 3FZMB 2BZ7A 4HISA 4ODTH 2NUTB 3FZFB 5IB3A 3KPLB 3NACL 5JR1L 2EYSB 1BYPA 2MTAA 3GGWB 5JXED 1IGYA 2YFNA 3J7HA 4H25A 1YECL 4OSUL 2HG5B 4YHLL 3D2TA 2EHOB 2I24N 3FRUB 4M3JA 3TTYA 2F74A 4HC1A 3NRPA 1RSYA 4GKNB 2AEOA 2FL5B 3GB7A 1ZT1B 5FPIA 4OM0L 2YS4A 2V7NA 4ANKA 2XDHA 1YYCA 1SNRA 3DX4A 3FYEB 2O61B 3N5AA 4OZHB 4G9DB 3R7RA 2JKWA 3P9MB 2JJTA 5DHDA 5FOJA 3ULUC 3P02A 2DAVA 4P23A 4Y5YC 4MNHA 5AQFB 3D52A 4R83A 1X7SA 5I82A 3FTGA 1M2VB 1WE5A 1DEDA 3EFDL 3ARGB 5LBSL 4HH9B 1JD7A 3OLEA 1ITCA 1KCVL 3DETC 3PWPE 1JZHA 3G08B 2Z8SA 4KI5E 4WEBL 4ZOAA 1KLUB 2ZKYA 4XMWA 2NY0C 3UBFA 4YY3T 1A0QH 5EOCL 4AKLA 1V3KA 3EOTL 2PFVA 4TUYE 4MQ7A 5ITBH 4QHPA 3L16A 4WTXA 4CVZB 5C9JA 1HILB 3AXHA 1OP3K 5JOFB 4LIQH 1OAQL 1USZA 4AEHH 2E5LT 1UK5A 5MP6H 3L3HA 1B0GA 3P4OA 3DJRA 4BFNA 1NWMX 3RWGB 4MB4A 3IEAA 4PTUA 3PNWA 2YD8A 3LRSB 2XN1A 3JAEA 1KIRA 4Y7MA 5LQBL 1IEAB 2ZSWA 1URIA 2ZYSA 4FQ2H 3I0OA 1SYVB 3QDJD 3AA6B 1UXWB 1J8HB 4DGIL 4PJIF 1AE6H 3UC0H 3BWZA 3QNFA 2BOBA 1E4HA 1N5YH 5TQ2H 3IDXH 1YN7B 3II3A 3LNGA 4N3UA 3DMMC 5FW7A 4UTBL 1CIUA 5EUOF 3OAZH 2WDVA 3AE2A 2KT6A 2VISB 4BWUA 3JSSA 4WV1A 5LMNT 1AXSA 3IKKA 4QIRA 3X1NA 2OMNA 4Q0XH 4GS7B 4DK5A 3WMPA 5D71L 3OZ9L 4L9IA 4UEMA 4TL5A 1TQWA 2CBPA 1S7VB 3HC0A 3P0VL 4K71B 4P4KA 3PABB 4WVRA 4FKEA 1AMYA 4YHOH 1UGOA 5FC9A 3VFTB 2OCJA 2XPYA 4O02A 3EH1A 1GGBH 5D7HA 2BKNA 2G2NA 1IGTA 1W09A 3Q0HA 3RWIA 3LKSB 5I6NA 1O7VA 2VH5L 35C8L 4AEEA 5EMYA 2QEJA 4OBSA 2AJXL 2BSEA 3L5JA 4W9IC 3U4EB 4NOFA 5D1QC 1KELL 3B2MA 4WUUD 4DP8X 4XXCC 4PD4K 3UBXA 5B8CC 2NT1A 2O30A 3BPNC 2WW8A 1BZEA 4XMKL 3WS6C 4N8VB 1X6LA 1T6BX 3EZ8A 3PXJA 3QEQD 2UWEF 5IB5A 2BNQA 5MEND 4B3VA 4IIJE 2HT2C 5A1LA 3RWHB 1KLGA 5GS0L 1Z5LB 3WFBL 3U46A 4DMVA 4C8XA 4IGUA 3CMOL 3TVMC 1XF2A 5FGBA 1XNRT 3M45A 3PJNA 1F02I 1WAAF 3KLSA 4HKXB 5CBEB 3G5VB 1ADWA 3SOLA 1MFMA 3O9WA 2LVCA 2W65B 3MCKA 4YUEH 5GRJH 3SO5A 1KJMB 4X9BA 2YFOA 3DV6A 3KW8A 3KPNB 4PRHA 1MCFA 3D39B 4NKIH 3VD2A 4HPYH 3HI6H 4YHMH 2CCLA 4PU2A 3ZHDA 3Q9DA 3X1GA 4GKLA 1T7ZA 4MJJA 5DHEA 2F54A 4XODA 2V5RA 43CAA 1DJSA 2HPJA 1S8DA 1Y6KR 4LCIL 2BIQA 2ADJA 1IBGL 1NCWL 3M88A 3QPQC 3K3NA 1VGKA 3JTTB 1ED3A 4LP5A 4WI9A 3F7PC 5DHMC 2HLAB 4N6RB 4NO0B 1UWEL 2NCEA 4QNPF 4N5UA 4TNVA 3RF1A 1Q38A 2DMGA 2NLJA 2WIIB 3FQWB 4PJGF 2DWGA 4G8FA 3VFRB 4AVIA 2VRKA 3CVHH 3O6LL 3FQRB 2UUDH 2YD1A 3QISA 3CFTA 3HNTL 5I8EB 4MXWL 3N40P 1FFRA 2VL4A 3ILPB 1FV1A 2W38A 1F58L 1HYSD 1W9RA 2OCFD 3RY6C 5DQ9B 4ODBD 1K3IA 2FJBA 3M17A 2IG2L 4KUCD 1W6LA 3UDWC 3EYFA 3BCDA 4KDWA 2OZNA 3UJJL 1E27A 1USQA 4JN1H 1MFEL 2VXVH 3QPKA 1AD9A 3QDGD 3VW3L 4KVCL 1AR1C 5AW8B 1PEZA 5T3ZE 4JUSA 4NM4H 3NIFE 1BEYH 4DZBA 4JY5H 4QHNB 3QNYA 5DUPH 4LEXH 4PREA 3TBTA 3O0RL 4MJ6A 3PUSA 1GSMA 3OX8B 1K5NA 4ZI7E 2I9LB 4ZUWA 4F9PC 3CHXA 4O2EA 3NZHL 3D0LA 4HWBA 4JRWA 1G1OA 2BSTB 5FECB 3AAIA 1CXEA 1AJ3A 1S7SB 3UQ7A 1MW0A 3NJMA 3FQNB 2DYSB 5ACMA 3PY9A 3VXQB 2LSKA 1QBBA 1S5HB 2H3NB 4UT6A 4J39A 3CUPB 3STZB 1B6DA 2EKSB 3CK0H 5GISH 3HAEA 4AZUA 3M7FB 4NCDA 5D7JC 3WO4C 2CLZA 4TF4A 4UIKL 2YOAA 4UVAB 1TEYA 2ERJC 2FEEI 3EJQA 4X7FC 3GMMB 3IJ7A 1UD6A 2JE8A 4NUPA 4XXDB 4LRNL 3NIGB 4HS3B 3FZKB 3L9RB 1BCIA 1FNSH 4ZW8A 4CADB 1J5IA 5C8YE 3O8XA 2ICES 3OHMB 1J9QA 5GGQL 4UT7H 2TSBA 4DCQB 3DJBA 1S7RA 3P3TA 4UV8B 3MBEC 4U7IA 3HE7C 5HYEA 3VFVA 2LU3A 1QLEH 4ZPTB 4Y5YB 1RIVH 1ZVSA 3GBLA 4OM1L 1US7B 4OD1H 3U9UA 4PSRA 3VTTA 2WXKA 3REWB 3TO4A 2B5IC 1KJ3H 3BGMB 4XBGB 1OD9A 4CVUA 2DYPB 4J3OC 4LP8A 2UXBT 1ZS2A 2R4SL 4LCWE 3P4LA 1H3GA 4IDNA 1F1DA 2E9WA 1DQQA 1T89C 2O6PA 2OMZB 4NQCA 3V6FA 4AENB 2PXYD 2OP4L 2XBDA 4HKBB 3QUZD 5JTWA 4Y9GA 5TH2A 2V17H 2OMUA 1JRHL 4GG8A 4HMDA 5EO1A 2W9LA 1OTUD 5HEUA 2CRYA 1LO3H 3HUJF 4APXB 4Z7OF 5CP3H 4YFLI 4F8TA 2PPFA 5J5EA 1SF5A 2ZAHA 5CJXC 3ARDA 2AZUA 1MJ7L 4DNDA 3I6KA 5AD0B 2IDQA 1DQIA 5E2TL 4IKJA 1U92A 3EBIA 5I1AA 1JGEA 2X3CA 4NENA 3RAJL 4TKWA 3ZQWA 3MK7C 3CDGA 3HI1A 2X0YA 1AKPA 1UB5B 4OLWH 4ZMXA 1OCZB 3PUCA 3PGCB 3P2BA 4M48L 2X6UA 3O1JA 5FFGA 1FE8H 4L0ZA 1ZVYA 2NQ3A 2YQ3A 2R4RH 2GJZA 3WIFA 3TURA 5BOPA 2CDEB 4QDGA 4DBRA 2UU9T 1F4XH 3II2A 2YA1A 4E41B 4HUUB 5K9OA 2B77A 4KKCD 3DMMB 1BLNB 5FK9B 1OGSA 2WXNA 3MNWB 4NFBA 4NHCH 4IRSD 2WYIA 6FABH 4L29B 5KSBE 4TSBL 2ADGA 4HUWA 2X12A 4N2IA 5JIKA 1GOFA 2FRGP 2FWLB 2YAPA 3PWJB 4S1DD 5EO0A 1NCAL 4YNYA 5F0MB 3WTXA 1NOFA 2CA3A 5JMRA 1RK0A 2FBWA 1PZCA 3ALPA 3H3PH 3LH2H 4W9DC 3MLSL 3LKNA 1H5BC 3BZ4B 4DKFH 2QSQA 1BG1A 1WO2A 1B0IA 1XR8A 2IBBA 4HAGA 4TVSa 2QMJA 4NAJA 2E8YA 5F89B 5AAPA 5LVEA 2ENQA 1IGFH 4XP4H 3TV3H 1JZFA 2Y5QA 1GYVA 3ARFA 3NFSH 4JDZA 5KYYB 4A1RA 1MCKA 1FYTA 4ONFL 5D1QB 3X1FA 3KLDA 2E86A 5IOPB 5B8CB 4GOUA 4RBPH 2QRXA 3AEBA 3MRGB 5I6KA 4WZXA 3EW3B 4KKQA 4BKSC 3L6FA 5B21A 5H2BA 4JFOA 4HD5A 4Z7QE 3SS1A 5EU5B 4Q6YA 3QG7L 4MD5A 2V3DA 2RB8A 3PGFH 3PP3H 1CL7H 2DQGL 3QUKA 3ULUF 2BDEA 1E9OB 2B7DT 4J3SA 3TVMB 1OT4A 2XTJD 2CLYC 3CHRA 4N85A 4QUOA 5A7EA 5TDNA 1W0VB 1MNEA 1WFUA 5ICYA 3GMOA 1TYJA 4EXPX 4X80L 2F9BT 1G6RB 1OANA 4AKGA 2X89D 4WHYH 3MBXH 2X4TA 3D5OF 3ANWB 4FG6C 3WMSA 2FX8L 2AF2A 4W9JC 3IGKA 1N67A 2OZ4A 4MAZA 4MWFB 2NNAB 1XV8A 3R8BB 3ZTJG 5I5MA 1T03L 3D2UB 3EBHA 2GBTA 3WNMA 1TVBB 1OQXA 4PJMA 1G9ML 2PYEA 3DPBA 3OKEA 4F7TB 3KAAA 4U1JA 1SA0E 4BZYA 1C7TA 5BW7C 1IZNB 4ZOLE 1LVEA 4LSQL 5D9SB 1U8MB 1YHPA 3CFBB 3HPJA 3MOAL 4OIIL 5HJDA 1I9IL 1RIHH 4KY1H 4FG0A 3GKWH 5ISZA 5IHUH 1G1YA 2M67A 1PEWA 1FGNH 4Y4FC 4A67A 3G5ZB 1KF6A 4URTB 3RLSA 3LNFA 2HT4C 2X88A 3VNYA 1AYRA 4AVJA 5K59F 1FSKB 5GONE 1DFBH 3G6DH 4JO1H 5HHQB 4N68A 4Z3JA 3UGUA 4ZNCD 3X3GH 2R7EA 4K7PL 2XACC 2A0LD 4U6TA 4O02H 4KY2A 3IU3A 1YC7A 2G60H 4PJCF 3V5KA 3LK3B 1AR1B 4OLVL 5GGTH 1GZQB 1QFWL 1SXSA 3CDCA 2HKHL 3GHPA 4PJAF 2H47C 3F62A 3SEPA 1R5IB 1TQVA 4QO1B 5LXVA 3E6FA 4HPOH 5GGSY 4RDQG 4I3RH 3O41B 5AUMA 1BJ1J 4WTQA 1CDYA 3DWTA 1I3GL 2X1WL 3H3BC 2R1XA 1UCBH 4ALAL 4WI8A 4Y19D 4HBQA 1AS8A 3K6SA 5JDQA 2W2UA 3QORD 1IJ5A 2E27L 3WO4B 3VHLA 3V2AR 3ZE0B 3TPUA 4QRRB 4UDUB 3SY0B 4Y4HC 1MG2C 2WQAA 3K8MA 5AG8A 1RPKA 4L3AA 4W9FC 2ERJB 4LOUC 2IQAA 5KS9E 5J11C 2H2PC 4UQBA 1HIMH 4LCUB 3RJQB 2AJSH 4YXKL 4U3CA 1YN6B 3MRQB 3WHE1 1CI3M 5KXJA 2E7CA 2FUQA 2L0DA 3H9HA 3MGTB 4ES8A 2V9UA 5JIQA 2X40A 2FGZA 3W0WD 4NQSA 2DL9A 3EO9H 4IRJA 5DSCB 1DL7L 4Z9KB 1PVHA 3BJLA 2P47B 3MBEB 3CD4A 3NAAH 5I1CL 4KAQL 4BUGA 1NSNL 4N9OB 2GUYA 3STLA 2E75C 1T1XA 3BAWA 3CQXC 5IR1A 3UAAA 1U30A 2MPAH 3OR6A 1XDTT 1ZA3A 3LTVA 5F8QC 3C5XA 3GXFA 3PDOB 3GSWB 4DW2H 1YMHA 1KTDB 5GS0D 3KPRD 3VWJD 2WZ0A 5DRNA 3MR9A 2XY2A 2RAMA 1MVYA 3SQOL 2Z31B 1JGUH 2N01B 2BG9E 2EINB 3N41F 1NCJA 1OOAA 3V6ZA 4L3EB 5KUKA 4UOZA 3RJOA 4HWIB 4NP4L 3JWDC 3VKGA 4LKXB 2Z0BA 2QGBA 5E8DL 3BRDA 4M6OL 3NZPA 2WXJA 4U05A 5DS8B 1I8LC 4LCWD 5ESAB 4MAYD 2AERT 3QPXH 5HHME 1CXHA 1WBYB 1W0AA 3LKRA 4GUOA 4Z3GA 4M29A 4TQ8A 4HHAB 3FT3B 1L7TH 4TNWF 2DPKA 5BO1H 2XQYG 2GJ6E 2A6JA 4BQCA 4Z0XA 1MCIA 3ZMZB 5E51A 2Y7OA 4N0UB 3IBEA 1NEZB 5DVPA 3DP7A 1CFQA 2AK4A 2YARA 1ASQA 4QRQA 5KBPA 4HWBH 1Z9MA 4KFZC 1FRGH 2HFTA 4HJGA 1E30A 4AM0A 4UILL 5L88L 4HT1L 4OCSL 4GG6E 1OE2A 2YKLL 4DUZT 4QHUA 4P2RA 2CE7A 4Z8XA 2UXNB 1P84K 3O2VL 5FF6A 3BLKA 4UT6H 3JC6C 4JM0A 2X0VA 2Q2EB 5IHZB 1S4IA 3GSXA 4X9IA 4H26B 4ZMYA 5JDJA 2XC8A 3HAEH 3CX7B 4F2ME 3C60A 8CGTA 3NIDB 3BO8B 1H5BB 3HCVA 1FJ1A 3Q2NA 2VCOA 3KGUA 5GSVA 2WXQA 1AVAA 1DBJL 2J71A 2A73A 3MV7A 5CD5C 5E23A 1KB5L 2WNGA 1NINA 1NDGB 2VMJA 4I4WA 4N2GA 3OAWA 2E2AA 3VFNB 2FQEA 3FTSA 4Q56A 2L04A 3RU8L 2X3BA 3QIUD 4NQEB 4UQ9A 3ZT5A 1VZHA 1GIGH 3O3UN 2KWHA 3MBWA 1SFHA 3L5WA 4Z76A 5FUCC 2WTPA 2VXUH 3EHBC 1OAXL 2CQVA 2KMFA 5KYUB 1TSHA 2EH8H 1PU0A 3MRRA 5D1ZD 4L48A 2AQPA 3Q2LA 1E5AA 1G0DA 3GMQA 4UVCB 3MPCA 3WEXA 4RFOH 2QPEB 4MCYB 3CFCL 5FYLL 2CHNA 1UOVA 5HDOA 4M8UA 4WW0A 3UTZB 3LZFH 5CZXD 2Z0UA 3EFOB 4JFPA 4ZFFB 5BRZE 2CLYB 1CFMA 5DVMA 1ZLVK 4IIZA 4KMLB 1MELA 2C5KT 1K4CA 1X5FA 3E80A 4N90E 5DLLA 1CCZA 1F4YH 2P5WE 5E08L 3RKPA 1PX3A 5F7KC 4KFMA 5C92A 2I69A 5LUMA 1NIBA 3V4VL 3SDDA 4PJLA 3AM8A 3GIZL 4KZCA 4X1IE 4NFCA 4PGCA 1NGXA 4XN9A 3QXAA 3SKUD 4WI2A 3MUY1 5IEHB 3JWNE 3MLVL 4NS0A 5KVGE 2UY6B 4PWEA 4ZAKA 4ZS2A 2LFGA 1YNKH 4X1KE 5EBGA 1KFGA 5LJMA 1ZGLB 5GGUA 1U8OA 5ACZA 2N1GA 2BSDA 3TA3D 2E7MA 1P7QD 4KROC 2BCKA 5IIEB 1QRNA 3V0HA 2YKKA 3UZVA 3NN8B 3SE9H 3ZYJA 1A6AB 4WNQB 3ZLIA 4PY7B 4JI7T 3FT1A 4PJIB 3WKQA 3ZYLA 1AIFB 5ECGA 2K4WA 1FZMA 4JDEB 1BBJB 4Y4FB 4WI6A 1N64L 1WA0X 1TVHA 1SLVA 5EUOB 5DK2B 5CMAB 2D0HA 1RUPL 1KTJA 4RMRA 3I50L 1QNZL 2VLKB 3IJEB 2NR6C 4HZ1A 1EO7A 4U1IA 5LG6A 3AEFA 1A7QH 1QPPA 1CGSL 3GMLA 2R15A 3RWJB 1IFRA 4EN3A 1E2WA 3ISWA 1IGJA 2X0LB 2CDGB 2X2HA 4HPHA 4OBRA 1D7FA 1UGKA 1RVFH 4KK5D 2UXVA 3ABLB 3MRIB 4OZHE 3VH8G 4D0DA 2R51A 4BQ8A 4FKHA 5IK3A 2CR3A 2TRYA 1TTFA 1IM9A 4H5SB 3RVTC 3ZQ9A 1ZK9A 4M61B 4Z7WA 4YJ3E 3EJYD 5SX5H 3DXAD 4I1RA 4QRUA 2MCPL 4GBXC 3UZQB 5IMMA 2DRUA 1IJ9A 5C9KA 2M1KA 1EJ8A 2Y6TE 2D7TL 5C08A 1CGXA 3QI9C 3G5XA 4P0DA 4PW9A 4OZIA 4WO4C 3QHTC 5FOBA 2XY1A 3ZPDA 1MSPA 4Y4HB 2J8UF 3WAJA 3BMVA 2UWEB 4ASKA 3IXAB 5BZDA 3CLWA 5IWLC 3HKFA 5EOCJ 2HUEA 1CBVH 1CGVA 3Q13A 3Q6GH 3TF7C 5EN2B 4GSQA 1EAPA 1D5BB 2A6KA 4UAOC 3VXSD 5DD0H 3GSQA 3RZCD 1MY5A 1QG3A 1XDPA 4M7KL 4NKDB 1NM9A 4NJAL 2XZCL 4Y2NA 2LRKA 3I9WA 1UGNA 3MJ6A 1BBDL 4JHVA 4PRDB 5DUMH 2OZ4H 2WLHA 1QBLH 4TQPA 5J8OA 3PHAA 3O6KL 2CRBA 1J8HE 5FO2A 3VTMA 3VU2A 1KNPA 3ESLA 3CU1A 3N1QC 3OQRA 2JQKA 2AQRA 5E6ZA 2VR3A 4RNRA 3MRHB 5HTSA 2AV1A 3FFCA 1FFNA 2XQBL 4KRPC 3MV9A 1UX5A 1TZIB 2EABA 2QVIA 2XNAA 3QHFH 4I0PB 2ICWA 4Z77A 1ZCRA 5K9QG 4FNRA 3P9WB 4RDBA 4PVBA 3OLIA 3TWYA 4MA3B 1ODAA 5F21B 1SBSH 2ICEA 1OCWH 4GXUN 4PJGB 5T3XL 4PW4A 2PCXA 3VCLB 3RL1A 3QEUB 1HCFX 2RPAA 5FB8B 2JF1A 3TLWA 2MNJB 3O6FD 4R4FH 4R26H 2WOYA 4G7VL 2MWCA 4TV3A 4Z7UB 2MAWA 3BPOC 4PFEA 4TPRL 1JZ6A 2FH8A 1SJHA 4PJFF 5HEOA 4K23H 3C6LA 3IPEA 1Y1UA 2K48A 2ID5A 2N1KA 3BKCH 4UBDD 4NI6A 3P40A 3S3PA 4JPQA 1MREH 4KHTH 1KTCA 3WIIL 4R8WL 2QQLL 4XX1E 2W91A 4KZ0A 2QJDA 4ERRA 3APFA 4YDVA 3MXVL 5HHMD 4FNTA 3NEXA 1GGYA 1THCA 2DNXA 4ODHH 2X4RB 1A3QA 5JW4Q 3MTRA 1JK9B 3CLFH 4XCEA 1WD9A 3NVOA 2Y4SA 3SDXF 1YUHB 4ELKB 3GBEA 3SYQA 5IKCB 1KCSL 2P8MA 3HZKB 1U3HD 4TN7B 1XVSA 2R27A 3KL3A 4UQDA 4L8DA 5E95B 3SKOB 4G1EA 2Z93A 2V8SV 3DX9B 3LPGA 2CPTA 4F6RC 1BM3L 1DDHB 4DV2T 3KLAB 2UZIL 4R97C 1FFPB 3D39E 1N70A 4JI0T 2FJGA 1OARL 2VDQH 2X5PA 4RWYL 4K2UL 5I23A 2HMIC 5HYAA 4QLRA 3TZVA 2X9WA 5KDMC 4XH2A 2ZCKH 4ZW6A 3QJVB 2BDNH 5IROD 4JM2F 4DVRH 1X5MA 4HJJH 3S35H 1OHZA 1ROWA 1BQHB 3VR9A 3EHBB 4KMCA 3FQ4A 1YPZA 4JZJA 1P4LB 1VEPA 1DSYA 5FYJH 2MOQA 1HDMA 3QQDA 1CUOA 4XAWL 4Q6IC 1TMQA 4CN4A 4RA3A 3U0PB 4V11A 3MACA 4NQVA 2YMOA 3C09C 2E7BA 4U1MA 5BOZG 3MUJA 4QKTA 1TJMA 5HVHB 1S7WA 1ZGLP 4P2CG 4APQC 5IREA 2W4XA 1BQRA 5HCJA 3QIWA 3CZEA 4OGXH 3DOSB 3F2LA 3HC4H 4L5FL 1WIPA 3ZOAA 3OMAB 1PCXA 4G6KH 5C2BL 5E4AA 4ACPA 2BVUA 2XFXA 5L4JA 1XEUA 1FDLL 5FLUA 1JZ8A 2CLVA 3K80A 3C8KB 3ZHNA 1IC7L 4EUPH 5GGSA 1T2QH 3HUJB 4Z7OB 3ZKXB 2GHWB 3KINB 3L45A 4U3HA 1CDCA 4P4RA 3VXRB 4N90D 3ARBA 3EJUA 3JT2A 1EDYA 2B3RA 1GTFA 1IC0A 4ZZBA 1X7QA 2BVPA 5DC2A 2XZZA 4KROB 1LM8V 5I1IL 2WP3O 3F65A 4FQ1L 3WNOA 3DBXB 1D9KD 4Z78A 5ID1B 4MVBD 4LKCA 1ZHLA 5DXWA 3L3GB 2C1OA 5GRUH 5C07B 5JVDE 3V0WL 4EJ1C 2XXCB 3AB0B 2K3WA 1HSAB 1T5WA 3FUEA 4HGWA 2J6EL 2JWYA 2X7LA 3MRFA 4FQXC 2IBZY 1RZFL 3PFQA 4I2XB 2BOCA 3JV4B 2F8VA 4XPGH 3L3DB 4L1LA 3NIGE 1ASPA 4KH9A 2K8MA 2YGVA 4FULA 4XC1H 4L18A 1I6ZA 1IEBA 1DQJA 4PJ9D 2LW3A 2C1PA 4D3CL 5E0QA 4GRMB 1Z0MA 1U91A 4JUTA 3EHZA 4LLMB 5AVYB 1X5GA 3AACA 3NCJL 1YMMB 2WLLA 1SLXA 2VDKB 3SPHA 2EHOD 2N7BA 1OWWA 3ULUE 5HI5C 2DMBA 3FB7A 3GZKA 2AJ3B 5H4YA 2SODB 4KXDA 3ULVH 1IO4C 3FC8A 2WUCH 1EEYB 3PXLA 4K73A 5A2FA 4LGSB 1E3XA 4A7UA 5C6WH 1I7TB 1NJ9A 1E7PA 2GUOA 2VDRB 3SKJH 4DKAA 3NQIA 2B1AL 5DJXB 4YSAA 4NNYB 4Z8FL 3DTUB 3FT2B 4UUJA 3U2SA 5B7EA 4WO4B 4ERSL 4XNZC 2FSDA 2ARJA 4QAMB 4JHAL 4TUUA 5I8OH 4DVDA 4JGMA 4XP9H 3U6RA 2V7HB 2ZUWA 3CBKB 2K8QA 1AS6A 2Z65C 5I1EH 2Z7UA 2ZZUT 5JW4N 5HHNB 3X1DA 4UAOB 1NC2A 4YDJA 1ZWIB 4B0MB 5I75B 1KG0A 3NDZE 2FBJH 2OR8A 2MOZA 4HUVB 1YEHH 5DFVD 2HRPL 4JFEA 3O4LD 2YIHA 3BSGA 3EJRA 3GSRB 4ZSOE 1BHGA 4U33A 4M62L 4RFEA 1F3JB 4XP1L 5GS1B 3LFMA 3CN0A 3T0VA 1BFSA 3JADA 3N6YA 3UO1H 2Y5TB 4JM4H 1RUQL 4Y2OA 4QYOA 2DOCA 4E41E 1KULA 2OMYB 4LAQL 2OSLB 3KLLA 4I13B 4PRPB 1M05B 4OFKA 1AP2A 1QKZL 4J8QA 3L95A 5F7NC 1SLUA 5FYLD 3SCMD 3QFDA 4XMUA 1JGLL 4KK9C 3MRNA 3GDCA 4HP5A 2H1XA 3N85H 2CRIA 4HHGA 1TG8A 1MQKH 2G2RA 3S34H 3P4PA 3UBXI 1AOHA 3GJEB 4G9FB 4QAWA 4OF6A 3T8VA 3FBQA 4UINL 2WIMA 1BAFH 4GAJH 4PP2B 2XQYA 2XX1A 2YD4A 4MSWB 2K9AA 1FH2A 5FKPB 5J0BA 1XF5B 3DTXB 3BPOB 4KJYA 1KZYA 3OMIB 1MRFL 2JJTC 3ZHLA 1NFKA 3MKGA 5F3BA 1N8OE 3L08A 4P23C 5D1QE 3AE3A 3T6VA 1VFMA 3N9GL 4O4YL 5JO5A 2VM9A 1NOLA 4PJCB 2V5DA 2CIIA 3D9AL 4BFEA 3DJ9A 4FTVD 5BZWB 2HTKC 1QLFB 4PJ6A 1Z1WA 1CR9H 3DBSA 4PJAB 3KS0H 2YXVA 2AMUA 3IFNH 2OCCB 2AE9A 1MFNA 3AG3B 4DTGL 4K3HA 3P7IA 4W6XB 2A38A 5BOJA 2DQCH 1AQ8A 4C56A 4H40A 1F4WH 2MQ0A 3QGVA 4DWHA 5C0CA 2BIIA 4F7EB 5FFOA 3OVUA 4N0YL 1XHHA 1IGCH 4NNPH 3GI9H 2R2BB 5J56B 5DMIL 4YWGL 1HJBC 1OGAB 3WE1A 2D8KA 1KF9B 2WUBL 4R97B 1QLBA 3LH8A 4ENEC 1T1ZB 3C5JA 4GRLD 5AQPB 2DWTA 1PDKB 4HHWA 4ZXBD 3RWFA 4X65T 5KVEE 4FN0A 1WZ1H 1CD8A 2IH9A 2LV4A 1BZ9A 1U5PA 4FYTA 4J7RA 4AG4H 3UU5A 5AWNL 4JDVB 4BYHA 4I87A 1OEZW 5AVTB 3WNPA 3S4SA 3DX3A 2E46A 1P4BL 4IEFB 1ZTXL 4NQDD 1LK2B 1S9VB 2VXTH 4OGYH 5JNYA 4F57L 5ABHA 1U95B 3QO1B 4KITB 1PD0A 4JFFA 3IGUA 4GMSL 4B60A 3FUFA 2WQVA 1UA6H 3P73A 1XGZA 5DZOA 4MJIB 1HEZA 4P46A 4QXWA 2VL0A 3E2HC 2XAHB 3L3OA 4Q6IB 3IGAB 4Z95L 5KW9L 1BLIA 3GPSA 3I75A 1KN4L 2H3RA 5HXSA 1T72A 4M7ZC 4OLZH 4F91B 4N9GA 4HIXH 1X3DA 4NO0D 1ZTMA 1WFOA 3TLTA 1UACL 1F13A 2VAAA 4APQB 2BS9A 4MXQC 4NZ8A 3IJ8A 3VRLE 1AOZA 1E4XH 1A4KB 2E76C 4RGNC 5JXEA 3VE0A 3N41B 3O2WH 3TTSA 1YKEB 5T1JA 5D2LF 1Q0YL 4E42B 4QT5B 4OB5H 5I16B 2A9NL 5DEGA 3BDYH 4C47A 1FG9C 3AE9A 4EF3A 1RZPA 4LAJH 4PGBA 5BRQA 3EKCA 3C4XA 5EU4A 5HDRA 3G3LA 1YEGL 5H8DA 4JB9H 3B2UD 3EO0B 2OJZH 5KTEL 3NT0A 2LLNA 2ZX8A 3A6OA 3ZJ1A 3CFDB 1R0AL 5FGBC 4F8LA 3E8VA 3L8RA 5IUXA 4LLQB 5C70A 3P30L 2WN3A 1OAZH 4MD4A 3ZE0E 4X66T 4CJ1A 2NY5H 1E1HB 2ZE0A 4QRRE 1E2AA 2XWRA 4DGYL 3T1YT 2H3XC 2MHAA 5T3XD 1EHNA 3HG5A 1SN5A 1U8PA 2DQIH 3OKQA 2C7UA 3EDDA 1C8QA 1N6QL 2BRRL 3RYHE 1RUAL 4NQXA 1F3DH 1EZ3A 5KVFL 3KPMB 1QLEB 1Z8UA 4HIHA 5DD3H 1HEJC 2X4PB 2QFPA 5CZRA 4NPYA 1NGYA 2VDNH 1RMFH 4OVUA 2N3JA 2CXDA 2F58L 3OJDA 1S78C 4LCCB 2OI9C 4XNXH 1MWOA 1VGEL 2VKOA 1KN2H 1PG7W 3O9XA 3ZRCC 3DI2B 1G7QB 3HR5A 3KV5A 1A6VL 4KK8D 2XAGB 3VXPB 4ZS6C 1CICA 3MMEB 5IG7B 3UPRB 5C0AB 2Y7SA 2HYMA 2D3NA 2NYKA 2OQJA 4ILBA 1HCZA 2XPGB 1KLFB 3A21A 3B2PA 5E00A 2PR4L 4QRTB 2WWMC 1XF1A 4FI6A 3QBTB 2ZG2A 4R96A 4L3EE 4PI0A 3QWOB 3FUNA 5I2IB 3NRXA 3OAZK 4IGBA 4OYKA 2VZSA 3MACH 4UQIM 1G7HB 3NA9L 4F33B 1MRCL 4GW4B 2IPKA 3P3RA 4PLNC 3QNUA 2R2HA 2DYPD 5CINH 4DF9A 5CKAA 5GZOD 1G84A 3LY6A 5FVKA 5DQVA 3HZYA 4MJHA 5I1HL 2AZAA 1SXBA 4DV0T 4A37A 5FW6A 4NM8H 4QD2E 3SE4A 1UOLA 5EUKB 5L4IA 1GVIA 4RQQA 5C0JA 4LFHG 4O8SA 2I07A 4N0UE 1CO1A 1QFUL 1XAKA 4HFUH 4XNQA 4DP1X 1UXSB 5LYJE 2DYRB 3FCTB 3JV6A 4XMXA 1YYLL 4HK3J 1MUJB 3S8FB 2DIJA 2AK1L 1MAML 4WUUA 3MO1B 4O9HL 5DLML 4L8SB 3RG1C 3FU9A 4AC2A 5D5MF 4ZUUB 3HC2A 1IGYB 1IC5H 2E7DA 2Y1AA 3B5TA 4TQIA 1EFXD 5TF1H 3PTRB 2DHRA 4B5EA 4XVUD 2F5BL 1LWHA 3GHBH 3VU1A 3QEQA 1MHPH 2F74B 3HFMH 5MENA 1U21A 3NIDE 4KMQA 1GS7A 2C7FA 1DJZA 3GB7B 3S3BB 3A6BH 3O8XC 2ZX6A 3QA3A 4XCCL 4AGLA 2W67A 5LNGA 1CTOA 1A25A 4D2NA 2C3XA 2NYYD 2IXQB 3DJTA 5D8JH 3MJ9H 2J7LA 5HSFA 5JXAL 4P23B 3QDHA 3GXMA 5T1KA 5KSVB 4HF5H 4YXLL 4GY4A 2QV2A 4LSSH 4HJTA 3QUML 3G04A 3UTTA 2Z3FA 3FRPA 4CBPA 1LVKA 1HH6B 3CQGB 2OMBA 5I5JA 2C5IT 4M1PA 1IAOA 3D09A 4M1CC 4X6DF 5F5WA 3CE1A 5KJ7E 2CUMA 1TO5A 3K6IA 1A47A 1FGVH 2NTSP 3HHRB 3QXVA 3CVRA 5G4NA 4NIQA 4OIFA 4M43L 4MQ7B 5DFAA 4R5VA 4BBWA 5C9JB 3EYOA 4KJWD 4EZMA 5IW1A 1QO3B 1A4JB 1B0GB 1D3CA 1ZJAA 2AJZB 2XWBB 4H8VA 3ARDC 3ASNB 5JQGE 5JW3H 2OV9A 3PNWB 4UQAA 3LIZA 1MG3C 4K5LA 2AV7A 2C0SA 2UUDK 4KJQD 3L1OH 1CT8B 2J8UB 3DGGB 4MCZA 1FNGA 2HPLA 3D4GA 4JY4B 2EXYC 3QUXC 3WNJA 2BOBB 3D18A 1CJYA 1IUZA 1M7KA 4A6YL 1SBBA 1YDPA 4YIQA 1A22B 4JYAT 3V52L 1UD5A 3QDGA 1ZV5A 1T83A 5D70H 1LLAA 4AYSA 1BQSA 2X9YA 1L0VA 1I8AA 4NN7C 3QUHA 5F93C 5KSUA 1AXSB 3S36H 4FJOA 5JYMA 3WCYA 4NHUA 2ZTBA 2W95A 2GVYA 3E2HB 4HJSA 4LU5L 3QHZL 4PJIE 1MH5A 3CIAA 4JJHA 3HG1A 4GXUM 1A1NB 2YMTA 1WEJL 2AC0A 5EUOE 1IAIM 3S37H 1N32T 5T1DL 1RZIB 4P3CH 4E9LA 4KVPA 5J1TC 4E7ZA 1WICA 4P5MA 3MA9A 3BH9B 3C5ZD 5F97E 3Q1SH 1D7CA 2B59B 1JVOA 5E99L 3UCQA 4NCC2 3VA6A 4B9PA 1LE9B 4K8RL 2KNDA 3VXMB 2WB5A 3MJ7A 4TNWK 5I1GH 3K2UL 4OQTL 1XBRA 2F8XC 5TJWK 5IM7A 4ORGA 3Q5OA 3RB7A 3ESPA 2RQEA 4HDIB 5CJ8A 5SWSD 4WCYH 2NQDA 4H8UA 4LHUG 3ZCIA 5IV2B 1SDDB 1MDTA 3M1OA 2AQ2A 1GC1H 4KHPT 4Y4KA 1K9TA 2CPCA 2JKSA 2BP0A 4PG2A 1B4LA 1AXTH 4PJFB 2XVKA 1KCRH 3FTXA 3OHXA 4FXKA 2R1WA 2I5YH 3MDJA 4KXZH 4WI4A 3LPOA 3JWOL 2X1PA 2V6HA 3K2KA 3KDMB 4M7JH 2KSRA 4BV1A 5CILH 4ZTPL 1YVLA 3K1SA 2DWDA 5CJQL 1NGPH 4ODSL 5JLZA 1BGXL 4KTYA 2UWEE 3IAQA 3IA3A 1ZE3H 3RPUA 3IJYB 4PRHB 4FLSA 4YDNA 3Q48A 5C3JA 2ATAA 2PXYA 4AQOA 3ABKB 4FFVC 3SDXB 3FCSA 1WAAE 3FNKA 3GS7A 3N44F 4I7ZC 3Q3GB 1RURL 1HWWA 2IC6A 1A3ZA 4XAKD 2BH0A 4ATWA 2OI9B 3PWPA 4AEIH 2KDYA 4MB5A 2CAKA 2EVFA 1DQKA 1U8CA 4WZ9A 2CO3A 2FSEA 1F6AA 5DI8A 3KPSB 5C6PB 2YMXH 4N4YB 3SKMA 2R69A 3QJUB 2CK2A 2R0WH 5D7LD 3QRGH 3ZT6A 2EP6A 3FO1B 4G43B 15C8L 3V9EA 2ENPA 4JM2B 4DPCX 3QEGH 4S10A 5JHDD 4Z18A 4UTAL 2D2CC 1JZ3A 1OO2A 4JHWL 1CZ8H 3ABZA 1HNWT 1M71A 1GCFA 2MQGA 4QNPE 1LK3L 4MD0A 2IAMD 2JB6B 3RNQB 3DDGA 5DC4B 2DLRA 4TX5A 4NQTA 4PJGE 4WGWB 5T33H 4LASH 3HA4A 3VXOB 4OV5A 2K7QA 1GW6A 3TX4A 1KNOA 1SZNA 1VCAA 4OV6F 3EAKA 3ZTNH 4BQ9A 3FUKA 2H26A 1SHMA 2VC2L 1BVZA 4TUKL 2Q9QB 3VJ6A 2H7OA 3KGTA 3HMWL 3L1FA 3S6CA 4GYBA 3RRCA 4XVSH 3TBTB 3TCLA 4POUB 3GK8H 5FHBL 5DRWA 2XSAA 2Z31D 1ETB1 2E6QA 4MJ6B 1K5NB 4HK0B 5FO8A 1B4JH 3D0LB 1QD0A 4G7RB 1L5GA 3EDUA 5E9AA 1MJ8L 2JKTM 5I1LB 5IQ9B 4HLZH 1LO2L 2XQ9A 4E5XB 2A83B 3GF8A 2FCBA 3BC9A 3R7QA 3ZR5A 4DFIA 2NY3C 2P5PA 4HJIA 5IESH 5TDPA 4FC3E 1G7PB 2NTXA 5F7AA 1EHLH 5TPWL 5I5RA 1HG5A 4J6RH 3VSUA 3ILQD 2GSIA 5AL0A 2VOTA 2ISDA 3AE5A 3HAEB 2D31A 3QCTH 1FL6A 4JFXA 3BVWA 4YHNB 5L3CB 4FXTA 1J1OH 3SGEI 3D69B 4RBPK 5FHAH 2NY2D 2P8PB 3WFCH 3S88H 4DGVH 4G11A 3CN4A 3WFEH 5DCCA 4G6AD 1X5KA 3CC5A 4J2CA 5KZCD 4NPPA 1UJTA 4WLCA 4LBAA 2G0UA 5IQLA 3B57A 2E47A 1JHLH 2V6YA 1AGBB 1E4KA 7PCYA 3PP3K 4IRJC 4CU6A 2XV6B 3PAYA 4PV9A 1S7RB 4GMTH 4LF9T 4HFEA 5KEZA 2XBTA 3TIEA 4YVUA 2CO1A 3TKLB 1ZHNA 5HYSG 4L1HA 4GH7B 3AA1B 5AYTA 3PV6A 1DO6A 4XT1C 1HL4A 4MRBA 1NAMA 1AZNA 2EQDA 4P3WA 1DVFD 4WHCA 3E6HB 2M26A 4K7PY 2DLGA 4HD9A 4PCSA 5AVRB 4F7CA 4XPBL 4KKAD 1QPXA 5AOKA 1SOQA 3VB8A 2COVD 5D6DC 5HI4D 1ZEAH 4U1LB 3BW9A 4C83B 1T2JA 2AQQA 2WD0A 3EYUL 3LN4A 4P9HL 5E6IC 3IDNB 3OXRA 4HWFA 1A3RL 2WSPA 4RAUB 2AXGA 1EMTL 3SYOA 4H2CA 3HNSL 2J21A 2P24B 3BP5A 4G7QB 4XVOA 3VMPA 1P69B 1IFGA 3I6KB 4PS7A 4B3EA 5I1AB 2DJUA 4NFDA 4EOWH 4NENB 4Z0BH 3RTQA 1WCRA 3CDGB 3HI1B 4YJZL 1A6PA 1YEFL 4D9LL 1JPST 1BF2A 2X10A 3HUJE 2XJ7A 3BZFA 2Y1ZA 4Z7OE 3QUXB 1WHOA 4EO5A 2IWFA 2GJZB 3VXRE 3WIFB 1IAIH 5BXFA 3SBQA 4GSDL 5B39B 3GUTB 3FXDB 4KI0F 5CJOL 2DWSA 3FTZA 4AGQA 3MNDA 5E7FA 1XGUB 1EWHA 3E7JA 4NN7B 1W0WB 3CZSA 3M86A 2H2SD 2MQ3A 4U7SA 4GI9A 1CFSA 1PSKL 4WO0A 1KGCE 4GW5A 2R0KL 1HHIA 4MDIA 1MCDA 5C07E 3N2KE 1FO0B 1BP3B 3H2QA 4JGUA 1EZVX 2DV6A 2I25N 1DN0A 2KLQA 1N4XL 2YPLD 3C60C 4NUJA 4TLKA 5CSZB 3D51A 3LKNB 5I8KH 2ITCB 2VZOA 1TQCB 4I2XE 3UEZA 2IO5A 4IHBA 1E9QA 1HSBA 2FO4A 3HC3H 3PUQA 4N8CH 1QR1A 3ZDZF 2QELA 3GS0A 3QORA 5HGDA 4YDKH 5J3HC 4MQTB 4PRAA 3PPSA 3N0AA 5FR3A 1BIHA 5ABZA 3NJNA 3ULVC 2EVHA 1BJMA 4JFQB 3AXIA 3C8HA 4GXFA 2NSXA 5FWQA 1YMME 2KLTA 3WDJA 5H35A 3CXDH 2BM3A 1A7NL 5L6YH 4LPXA 4E0RA 3O4XE 3ARQA 4ZMWA 3ARPA 4WKXA 2OMWA 3W0WA 1J5OH 1KJ2A 3GWHA 1Q9OA 2M8XA 4XBPA 3PAVA 5KVMC 4X4KA 1A6ZB 3T0BA 3IVKB 5MHSD 4DP7X 3QUKB 1AD0B 3E3QC 4KNSA 4O5LH 3L5XH 2UXFA 5TE4L 5BV7B 2DQFA 1MFAL 3OKLA 5E70A 5JPMB 4O2FA 5FO7A 5TDNB 4ZYKB 3NRYA 4MXVF 2OL3A 4YT0A 4UV7L 5MEQB 1U2HA 2IH1A 4QXCB 4PK4A 4DV1T 2X4TB 2YU1A 3F58L 4R7NA 3KPRA 3ES6A 4TLSA 5GGRB 4BK5C 3SDDC 4TNVK 4ZI3D 4N1HB 1G7MA 4JAMB 1EJOL 4LLUA 5DUBB 1HN1A 4CI3B 1RK1A 2VUOA 3EOBA 3GXDA 4EI6A 1X5JA 2H0FA 4R6UA 3WXVH 2IDSA 4EI0A 3RWCB 3FQTB 1A6TA 2ICWI 2MPKA 4U1JB 1I4FA 2VNCA 4HSQA 4JE4B 3US9A 4OCLC 2YD3A 3ZZ1A 3PGDB 1VOMA 4LCWA 3FONA 5CGBA 2DQHL 1TFPA 2HVBA 4LQ1A 1E4WH 5IJBC 4A55A 1E4XI 3JYBA 4EBQH 3OBVE 3P9LA 2V7MA 3A4EA 4GAGL 4PRPE 5J13C 3FMGH 3C4WA 3K7UA 3CVDA 3ATFA 4PLJD 4JRFA 3VQ2C 1UTDA 1PZDA 1EGJH 1XGPA 4TQEL 2JQMA 3MLZL 4XN7A 1G1KA 1U4EA 2HZHA 3AXLA 3S3SA 2RFXA 4P5KA 2GITB 5D6CB 1HNYA 2LU4A 5TDOA 3VDBA 4G9FE 4C58B 4EN3C 5LAPA 3TJHC 4FXLA 1FLRH 4AYBA 4I0PD 3MA9H 5K59E 2VIRB 1QWNA 3L1EA 1IC4L 3CV5A 2W0FB 2PKDA 4MBRA 3ELQA 2RMNA 1QSFB 5EIIG 1FN4A 4XX1G 4W9CC 1TDQA 4G59C 5AUMB 1RFDH 2XTSA 1G0YR 5KSBA 3VI3F 2FECI 4PJCE 5D2LB 1NPNA 4MX7A 1VERA 3PDDA 4JG1L 2YA0A 2DKUA 4QXTB 5MEPA 5ITFA 3QIUA 2IV8A 4PJAE 3I9GH 4U74A 3VRBA 1A2YA 1NCUA 1DJGA 2DI7A 2WXFA 1CLYH 4NX0A 2HB0A 3TPUB 1SQMA 3WKPA 1G4RA 1UKSA 4LSTH 4D7PA 9CGTA 4KK6C 3A67L 2ZOWA 5SWZB 2EC8A 2Z4QB 5L2KE 4H1LH 5TGBA 2UVEA 4G3YH 3VAEA 2VDQB 3LHPH 3ECWA 3LX9A 3S2AA 5C0GB 5IFHH 4IMLB 2L9QA 2NY7L 3RI5F 4AC4A 5ETWA 3H9HB 4FNSA 4F8QA 2C26A 1OGAE 4J3TA 4NWTL 3V4PA 3PUWF 3KPQA 3ZTCC 1E3ZA 1ZHCA 1IIKA 5LWYH 1R3IL 4HUMB 4AQEB 1HTYA 1PKOA 4YE0A 2DBLL 1XQ4A 2GTZB 5BZZA 2X4QA 5G5DA 1OSYA 3K2IA 1KEGH 2GK2A 1F2XK 3RPBA 3STLB 4JHUA 1T1XB 5B7FA 4UTCA 4XB7A 2JIWA 2W94A 5IR1B 1SHSA 5IF0B 5J6HA 1D5XA 1ZA3B 3OJVC 4KZDH 1HHKA 5J1GA 1YMHB 4DN3H 3FCUB 2PYFA 5CKGA 4BSVA 4MJIE 3KR3L 5DRNB 4CA4A 2R69H 3AT0A 1SUJA 3PL6B 2BERA 2AQSA 2LAAA 12E8L 3D6GA 3RWDA 1OWAA 2JCCF 2HH0H 2OR9L 4D8OA 4W6YB 2H32A 2ICEC 4Z3HA 5E6IB 4JMXA 3T77B 5K1NA 2BNUB 1OK0A 1S9WA 4OW6A 4WY7H 4IOFC 1DN2A 4EUPB 3VFGL 5I6XC 1WLXA 1AH1A 5E6YA 5EOQH 2E7LC 1WD8A 1C7SA 1XAUA 1X4XA 3LKRB 3OG4B 1BXUA 4ODUA 3IBOA 3C6LC 4Y5XB 2CHDA 4LDOB 2QQNL 2PP9A 3EH5B 3UULA 5JRCB 1ES0A 4FLHA 4R90L 4DZ8B 3MCLL 4XMVA 2XZQL 4PLOB 5I26A 4MTMA 3DUSA 1NLDL 1G7LA 4JQIL 4G63A 2QKSA 2HKAA 2FATH 1EJFA 3TH2T 2DD8L 2FEDD 4LB8A 5ICXA 1TVDA 1DBKL 3EYQC 4DQOL 5IUSA 1I8IA 4JGNA 5FAAA 4GQ9L 2NY5C 3UIZA 2CK0H 2DLEA 5JPNB 1RH8A 1I3RB 3R0MA 3L13A 3ROLB 1W8EA 3BZEA 3ZEFB 1KPRA 2A6IA 3E0GA 3VG0L 3DXAA 3QZMA 3KGRA 2E8IA 3LXBA 3VMNA 1J8KA 4HCRH 4NT6B 5DJ2B 5LCYA 3HCVB 4ZMTA 4KO7A 3UABA 5F2FA 2QDVA 5HP5A 2A73B 1GZHA 5D5MB 3L3KB 4N20A 2WQRA 2GB2A 3D0VA 5B4MD 1UJ3A 4I4WB 5TE7H 2YR3A 3TZVC 3W5NA 4HEAA 1R3LA 3B37A 3NH7L 1TYEB 2XJLA 3BQUD 4QGTA 3KYKL 3DOIA 3SIKA 1OB1B 43C9A 1E8YA 2PPDA 3NACH 1NAKL 5DR5L 2I60H 5LN8A 2J25A 2OMVA 3FAWA 4GP4B 1ADQA 1YECH 2V33A 4HXAH 4ISTA 4YHLH 2B4CH 1RK7A 2YD9A 4YBHA 1S9YB 5F9OH 3VGGA 5BUPA 1UM5L 2Q8BL 2E6PA 5L2JA 4KXBA 4WKZA 3RZCA 5J2UE 4DR3T 4J23A 4JZJC 4NAQA 1Z2KA 1FL5A 3MRRB 4TSAH 2B76A 5CWSA 1RJZB 1TUPA 4QHKJ 1CFNA 3GMQB 2MRYA 1OV8A 1B88A 5C0AE 2EDWA 3WEXB 3T6XA 1MWAB 4AVHA 2PCFA 4PGEA 4KTEH 3O45B 1QI4A 5KS9A 4ONHB 3KWUA 1OOWA 4NZDA 4L3CA 1F11B 3F12A 2EVJA 3LQAL 1HQRA 3IMTA 5DYOB 3ZE2F 1U42A 4X6DB 2WM0A 3AREB 2VZ1A 4WJ5A 3T0ED 3BEVA 4PEEA 2FT7A 3QIWC 1PAZA 3CPUA 2XIDA 4LFHD 4AL8L 3OXSB 2WGNB 4U7YA 1H3VA 1KCVH 1N19A 1W72A 3CXFA 4WEBH 5HD8C 3M3ZB 4UZSA 4GEJA 4FZ8L 5EOCH 1P5UA 5LGUB 1H3TA 3TASA 3EOTH 1JNNH 4WW1B 4D94A 3ARBC 3QO0B 2YBRA 5HVGB 5B3JF 1C12B 1OAQH 3QR0A 1BXAA 4XGZB 4LF5T 1CGTA 1U8HA 2IWKA 2CBJA 4MJ5A 4XNDA 4Q9QH 5HHVL 1MI5B 1BREA 3EO1A 1WZAA 3WDIA 2BG9A 4PY8I 3SPGA 3EJZC 2PN5A 4FADA 5FKAB 3UUMA 3BX7C 5LQBH 1FZMB 3RZWA 1ZANL 3FO9A 2WKOA 4X5XA 3W5MA 1U93A 3CVCA 4ZFOA 1L3WA 3Q2CA 3L3JB 4LCVA 1ACCA 3P1VA 5HAXA 3MFGB 3VXUD 1FVEB 5DURD 2GJ6A 2JKIS 3CCHB 3IF1A 4NBYB 4QHMA 4YSQA 2AEWA 2WB7A 2FO1A 4NO5B 3B6SA 3WFHA 3IRCA 1BZQK 5D71H 1LDPH 3RDTD 2YAHA 3N55A 4D0DB 5FXZA 1MFBH 1R3HB 2EXWD 3MJ8B 3DA0A 5IK3B 1IARB 3G6AB 4K3EL 4H44C 3LPWA 4L4TD 4GK0E 3KLHC 3K0YA 2WOBA 2HN1A 2IH3B 3TBWA 1UKQA 3DSNA 3SOTA 3ZYMA 4JPSA 5F6IC 4CNIA 4PB9L 2ILLA 1WFNA 2ZUXA 2YGPA 2IAND 3HPLA 3AVEA 3WS3B 1N5AA 4P09A 4N2EA 3PU8A 2PABA 2E59A 5IB1B 4EQ3A 35C8H 3G5XB 2AJXH 1KJ2H 2VLLA 4F2MA 3A23A 2B8OT 3AEEA 1II4E 1WFTA 2O93L 5FOBB 3I02A 1KELH 3OKMB 4AKPA 5CSGA 4UXNB 5TF0A 1IGIH 5HYJD 2BMKA 3S35X 1EH9A 3BAXA 1LTXA 2JIXA 2XVGA 4IS6B 3H9ZA 2WCPA 2B1EA 1D5IL 4KUCF 4XMKH 5KSAD 4P2YA 5CP7A 1VADA 2OL3H 1MCOL 1FFQA 2KLSA 2XV2A 1O6SA 3GSQB 4MNQD 3DDFA 2PWHA 3BHBA 4XRCB 5GQBA 1UA3A 5GS0H 4N24A 3ECBA 3FN0H 3KPPA 1RL1A 2J8UE 1S46A 2VJ8A 3D3VB 4JCWA 4ZUVB 3CMOH 3UH8A 1VKXA 4IRZA 4FQCH 3CX8B 2A6DA 2EO7A 4UQ3A 2L7UA 5L2KD 2FK9A 1RUKL 4ZPVB 3AUWB 4C54A 1OD7A 5AOMA 4C4KT 3KYOB 3MXZA 4P5TD 4ZD3L 3VFPA 4MZ2A 1NIEA 3DKHA 3N44B 2EZ0D 1GYUA 5BRZA 2GAZA 1DJWA 2EUXA 3BWAA 2IFGA 2XHEB 2ICWB 4Z77B 5AQIB 3CVIL 3H53A 2WLNA 1SOXA 5ICZB 5L4FA 5AKRA 1Z5YD 1YD8G 3T1FB 4R0LA 2HFEB 1A5FH 4XPFH 1E6OL 2KDGA 3LMJH 3DJZA 4HLEA 2B1HL 1A21A 4ZMLA 1IBGH 1MIEL 4ZZFA 1N33T 1NPUA 3HRZB 1TETL 3KM2A 3SQBA 5J6GB 1J0IA 1UWEH 5BUAA 1IQWH 3KWVA 1J11A 2WWKO 5I6XB 2YN6A 3W9DA 2K9UA 2XXMB 1HFAA 1PX4A 2QADB 2TSAA 3NRFA 4G1MA 1VRBA 2Y07L 3VXME 3IJSA 2LOEA 2X0UA 4Z5RA 3O6LH 4DT2A 1GC1C 3D50A 4OD2B 4RGOL 4R7DB 1XCTB 1M6OB 3PWNA 5KOVC 1F58H 1RZ8B 5T1MB 4A39A 2HAZA 2IG2H 3VYOA 2QZ5A 1U2YA 1I1FB 2DI4A 1OAJA 2N0KA 2PWEA 2Y3NA 4YDVB 4N2HA 2NUTA 3UJJH 1PZ5B 4LP4A 1MFEH 3KPLA 2EYSA 4OLXH 4GIWA 4PJFE 3WI9A 3H55A 1SEQH 4BKTC 3VW3H 2HG5A 5C97A 4AE0A 2EHOA 4E9XA 1ZE3C 4NC1C 4XCEB 3FRUA 1QUNB 3MGAA 3O0RH 5HXEA 5JZ7C 5KYWA 2XHNA 2FHBA 3L7FB 3JT0A 3G7TA 4PFOA 5SX4I 1ZT1A 3SYCA 5FUOL 2J88L 1XCXA 4G1EB 1N12A 1RHFA 3NEOA 2O61A 4PRHE 1E5YA 3DX6A 4OZHA 4G9DA 5MERB 2D2OA 3NEEA 2C9AA 1AR2A 3C2AL 3INUL 4L1SA 3P9MA 4GINA 3Q8BA 1RJLB 2YDQA 3QWRA 4IJ3C 5JH7E 3PJAA 5DQDH 3SDXE 4X7CC 1AI1L 2WBJB 2R56H 2YRZA 2CHXA 3V4PH 1M2VA 1QFWM 5C1MB 1EX0A 4ESKA 3ARGA 4IU3A 5JIIA 4HH9A 1GGCL 3C98B 4K55A 1R5VB 3AWGA 1A64A 1P53A 3G08A 3OGCA 4M7LT 2Y06L 5EU7C 5K33A 3KPSE 4NERA 1WCBB 2C3VB 3O3BA 4U1GB 5EF0A 4P46C 3O4LA 4V33A 4ZI2C 3L3OC 1SM3H 1NBVH 4CVZA 1HILA 3BGAA 5JOFA 4PS4L 1Y01A 1G94A 3BUDA 4KZEH 1HCYA 2F2HA 3NGBC 4OKVA 3FU3A 2G75B 2RBLA 3RWGA 3KVBA 1IT9L 1IAII 2Z6FA 1JXDA 5HHOB 4DMWA 4ONGL 4XPAL 3LVTA 5DZLA 2H32H 4JFDD 1FNLA 1JCKA 3DSFL 2Y6XA 1XGQB 2XQ7A 1IEAA 1UH3A 5JXEC 5DRXA 1L9TA 5C0AD 2XFXB 2D0FA 4C55A 2R4SH 1UXWA 1J8HA 3O0LA 5GGSB 1GYAA 2VZVA 3IBPA 3RVXD 1UWGL 1YN7A 5CEZE 1B9ZA 3RGBA 4P4RB 2OP4H 3HKZA 5FGSA 1F86A 1NEZG 2MOVA 3ARBB 1P4UA 3NSYA 1JRHH 4UIGA 3OF6A 4JCMA 5FXVA 3VDAA 5DFTA 3W3BA 1VA9A 4MS8D 4CC4A 4RRPG 2Y6SC 1XXFC 4DFHA 4Y1TA 1S7VA 2R2CA 3PABA 3VFTA 4F8NA 3TJEH 2XFGB 3I6LE 5BVPL 2X7LB 2KI6A 4M48H 2BZBA 2VJ0A 3PE9A 4K94H 3IPFA 3APDA 3LKSA 2F7QA 1HFUA 4I0KA 1QFPA 1ZHBA 2D7QA 2D4DA 3U4EA 4ATTA 4U6VL 2X6VA 4BZ2L 3CVBA 2ZG1A 3MUZ1 4X2UA 2BC4B 3HE6B 1UYWL 4AWJC 4TSBH 4K9EL 1UATA 4QWWD 4QTIL 5ACLA 4XOCA 4H20H 1DYZA 4GJTB 1KWKA 4N8VA 1ZSHA 2X4UB 1PD6A 2XWZA 4WHTA 3ZDZB 1UB6B 3TBYB 1CICC 2W07B 3RWHA 2X9HA 5A2BA 2M6BA 1Z5LA 5F6IB 2YKSA 2XIIA 2BO0A 5DD6B 5E94B 3S96B 2GUOB 1OAYL 4B9JA 1WQVT 2VKWA 5CBEA 4UUJB 3Q44A 1G5AA 1MXGA 1NA8A 4X5LA 2MCAA 2W65A 2OX5B 5DZAA 2EYTA 3O4OC 2DQ6A 4PRIB 2VB6A 4LL9A 3KPNA 4PHXA 3BAIA 3HKBE 4Y8DC 5F88B 2CG9X 5BQ7B 1YEWA 3D39A 2C8NA 4FXGC 5ETUB 5BS0D 2YJQA 1GPOL 4ANWA 1TCMA 2AFNA 4QR7A 2V7LA 4M6NL 3VFSA 3V4UL 5DDHB 4KOBA 4AQZA 2X3AA 1IBYA 4L23A 2RA1A 4PCKA 1CXFA 2DQGH 2P80A 2WLZA 4LZKA 2HLAA 4NO0A 2FHFA 4L5GA 4QJ3B 3WEMA 4KNQA 2VVSA 2WVTA 3FQWA 3CDZB 4FNPA 4LVEA 3UQ4A 3UIYA 4YSTA 3D85D 4OU3A 2YUZA 2P9BA 3ARWA 4HWEL 3VFRA 1PMYA 4I3SL 3FQRA 1DJIA 2IFFL 2X4NA 1YEKL 4JANB 3SE8L 3B9VA 1G7JB 4H8PA 5DGQA 2FX8H 2V37A 3EDEA 5I8EA 2BHUA 4O2CB 1A7BA 3ILPA 3HB3D 1JS4A 4BIKA 3RLFF 3GNML 4OTXL 3ZL1A 2FLMA 2HFGL 5DQ9A 4Q9CA 1Q94B 2XT1B 3F85A 4JO2H 3F7RA 4KPHL 2ROYA 4PWJA 3OKDB 1HINL 4J8RA 1LEIB 2K6WA 3BGFC 4QOKB 1AYOA 1UZ8B 3E38A 3I2CL 1R75A 3GBML 4QHNA 1X6NA 2X2YA 3CFEA 1I7RB 3MOAH 4OIIH 4AZ8B 2CDFA 3OX8A 2I9LA 1FORH 2YN5A 3GLZA 2BSTA 5FECA 2ZCHL 3P3YA 3VQLA 3FQNA 1F8TL 1V05A 4AGPA 5JO5B 3VXQA 5JMOC 1S5HA 2H3NA 2CIIB 4AH2B 2V2TA 3CUPA 4TQHA 3STZA 4K7PH 4BDVA 2EKSA 2PPCA 4DR7T 1TQBB 2EDKA 1IBLT 1TTRA 3IRZA 2AJVL 5I15H 3L9YA 3KPTA 3TT1L 3O6MH 2PWGA 1RZ7H 3RHWF 2CA4A 2YPVA 3GMMA 2VDML 2IGTA 2XKSA 4G80B 4C56B 1QFWH 4J3WA 4XBEH 1DANT 4I8DA 4HS3A 2HKHH 4WNJA 4ZOEA 3VI3B 5C0CB 3SZKC 3L9RA 1N59A 4CADA 1HOCB 2CCQA 1C5BL 1C1EL 2F61A 4DCQA 3AE6A 4YBQD 3CFNA 2QPDB 4F1ZA 3H3AA 2VDPB 3HHMA 1XTMA 4ALAH 1EXHA 3F5WA 4HMEA 4IJ3B 4ZPTA 3X12B 1TJGL 3NFNB 1BZ9B 5D1XB 5EULV 4L4VD 4BSWA 3QQNA 1RZGB 4FQHB 1SDAB 4RISH 3FQUB 1HQ4B 4RMTA 1RP9A 4U1HB 2RD0A 3REWA 3BGMA 4XBGA 3S4SB 1GCYA 2DYPA 1FMWA 4UAHA 4LSVL 4LMQE 4JPWL 3O3EB 2Z64C 4YEEA 1CURA 4JBWF 2OMZA 2VMCA 4GP5B 3SGJA 4AENA 4OI7A 3LS5H 1I94T 1HEZB 1SPDA 5F3HB 4HJEA 3KXFD 4M4RB 1X7TA 1H3WM 1ZLDA 3L3OB 4PAZA 4BH7A 3B4NA 5IY5B 3EBAA 1DL7H 2WMPA 3DVGB 3I75B 1IBFA 5C0BD 5ILTL 1YNLL 1UKTA 3NGBB 2NW7A 1CE6B 2ZG3A 5DVLA 1NSNH 2NX5D 5DEFA 3WLBA 5AD0A 3BWSA 3WUWA 5A2KH 2VLJD 3ESNA 1P6WA 3X3FL 2LTQC 5JUEL 3VE0B 2JCCB 2ORBL 4ZSOA 1UB5A 1QBML 3N04A 3E8UL 3JWNH 8FABB 4YQXH 2J1KA 4X6BA 1J18A 3I0QA 2CDEA 4QRPD 2K45A 2WZ6A 3QC6X 1ZJBA 2GTWB 4HUUA 4E41A 2R29L 1NBQA 1BLNA 3DMMA 5AVZB 4MMZB 1QSFE 3MNWA 4Y4KC 5F7DA 4PG2C 3PJLA 4L29A 1TQSA 4IKLA 3OHXC 1AZZC 4FXKC 4P59L 4PK5A 5D2LE 4CW1B 3OM3B 4ZMVA 1DQDL 3HRPA 4KQ4H 3IMWA 4JRXD 3GZPA 3PWJA 3U79A 2Q9QD 3VX1A 2DLFL 1WAPA 3KYMA 3WTVA 4FP8H 1PLCA 5B38B 1UOWA 4Q7DA 2J57A 5CEZD 5M94B 4MD4B 1LMIA 1NPJA 3BZ4A 1DVSA 1L7IH 5GGVH 2EVGA 3Q05A 1E0OB 3Q7JA 2P44B 2Y2YA 2BWQA 1VHPA 4WGKA 3DO7A 5SWZE 3F05A 5CCHE 5F89A 4JKKA 3HN8A 1XWMA 1Q1JL 2YK1L 4HWCA 2PXYC 5DJAB 1J10A 5AZ2L 1FIOA 4UILH 4JPIB 5L88H 5F9DC 3QUZC 4QJ4B 3WAKA 2JLPA 2B3IA 2YKLH 3I6GB 1OTUC 4JLRA 5EO9B 5IOPA 1MEXL 3LDQB 3DGDA 5B8CA 3OJDB 3MRGA 4X6EB 1A7RL 5I74C 2Y48B 3WS6A 4Q9RL 4KI5C 4IBSA 3P11H 2C9QA 1T1WA 2E0PA 4BUQA 5IUCA 4OCWH 4KQ3H 5AW4B 4YC2C 4Z7AA 4J28A 2X70B 3ZKMD 4A2FA 4WFGD 5CIPH 4ZI8A 1R3KB 1E9OA 3MNMA 1KB5H 2OQJB 3BOVA 3QDJB 4RSVA 3U9PL 3WNLA 2Z35B 3BYTA 1LYQA 1W0VA 2FEEL 4EIWA 5FYKD 1KC5L 2VTFA 1G6RA 1JP5A 3Q1EA 4KKCC 3RU8H 1UUNA 3ANWA 2Q76B 4XXWC 1H3UA 1XO8A 1SFDA 5EDSA 3RVWD 1X9RA 2WTRB 3OMNB 5CCKL 4FXGB 1T8BA 3AY2A 2PCPA 2R2HB 4MWFA 2NNAA 4S1DC 3QW9A 4K0KT 4QKXB 3GLAA 3S36X 4S0HA 4HX1A 3LK2B 3QIBD 3HG3A 1BD2B 1CLZH 3WGUB 5FYLH 3ZE2B 5JW4R 2HTLC 4K3JL 2CGRH 3B5MA 4A2DA 1NWOA 5LXTE 2XWCA 3TNNA 3US1A 3RQUA 1D2OA 5D9SA 3C50A 4LSUL 2VR8A 3S37X 5LCVA 2APSA 2NXZD 5E08H 3JV6B 5FY0A 1H3PH 3HA0A 3LEYL 5FWRA 3VM7A 1WTLA 5EORH 3L4VA 2WYZA 1TPXB 2IPTH 3EG9B 4OUOA 2GSGB 4IE0A 5I19H 4N3TA 1QSED 4GYSA 3UTQB 4YMPA 3W2DL 5HHQA 3FL7A 2XV3A 3QCVL 3WV0A 1AQMA 5HDQL 2J47A 3L8QA 1L0YA 2BVYA 4X20E 2PR9A 1MOEA 1UZ6F 2H6PB 2CR6A 1J48A 5K69A 3LZLA 1TZAA 1PPIA 3QK0A 2XVBA 2XM1A 2XTJC 1GZQA 5D5ME 1CC3A 3HBZA 4OF8A 5L4HA 2B4CC 3UFGA 3DETD 4Q14A 3M46A 1R5IA 2K24A 1Q4NX 4NZUL 4QO1A 3PAUA 4ZS3A 4OCXH 2GC7C 3O41A 2JH2A 1N64H 3U0WL 4ZOCA 1WWCA 5IMKA 4XMLH 1RUPH 1AMXA 1Z9NA 1QNZH 3MRPA 3T6ZA 5E1AB 3HNVH 4QF1B 1IAOB 4XC3L 4NZJA 4PWFA 2L7JA 1ML0A 5DJ0A 2X68A 5FCSH 4UDUA 4Y89A 1KB9J 2EC9U 4WUKL 4LNVA 1JFQL