4G2AA

Crystal structure of a putative nutrient binding protein (lpg2210) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.33 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
321
structure length
321
Chain Sequence
NDTAVGGEGSLPIPVSQPHIKMVSELIRISGKNLNEPQMNGSWHYNCNFTFKNTLNKEVTISMAFPFPINDGNSEIALPAGQQTNVGQALVYDFLVTVNDKQVSAQRGNIAPDQNKGLYYEDAYFWKTTFPPLATVNIHHDYSTGATYDVMGYHWVRYVLKTGALWQDSSIGHTRLEVIPNTPTRLCSEIDQKADYLNPTPSGMSISGSRADRKYIWDLRHFQPQADLSLCLFTGISYVRYKVIYPWLNSDDALSKLARLSNKELRFLRNTIYAQYGRQFQSPDLQEYFSKKWWYVPNPDYSDRMLNEEDKKLLSMINQAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (lpg2210) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 2.33 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 77
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13308 YARHG YARHG domain
A PF14415 DUF4424 Domain of unknown function (DUF4424)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1690 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4g2aA02
2.60.40.3680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g2aA01
4G2AA
chains in the Genus database with same CATH superfamily
5HBBA 3U1PA 3LDBC 4H40A 4I18C 4FA6A 3CN1A 3BRFA 3WAJA 1HSBB 3HNVL 4P59L 3Q5TA 3SBWA 2D2SA 3UG3A 5KTEL 4PJCE 2BSRA 2IAMD 5ABDE 2JTYA 3TO4C 5IROC 2A38A 5IFJA 3GMIA 1B88A 3BDYL 4F9PA 1M6OA 4B9JA 4R97B 5CHNA 4KI0F 2JB6B 3IJ8A 4IGUA 1MFEH 1YEDA 2EECA 4N0FA 4ADJA 4E5XG 5KS9A 3GHBH 3AS3A 4LCYA 4X99A 3U0WH 4P4KC 5HEJA 1IQDA 3VR8A 1FO0L 5CZVH 4PP1C 4AX3A 1BBDH 1UGNA 5GSRA 3ZE1B 3GGWB 3PIQB 4RGNB 3FT3B 3QO0B 4XO5A 5IMLA 1HCVA 3IJ9A 5DK0A 3BZEB 3ELQA 4Y4FA 4HN9A 5EU6D 1PG7W 3BKJH 4OM1H 4FZ8L 2V9TA 5JTGA 5AVYB 5DJZB 2WNGA 1FPTL 1W8EA 3S3SA 1HDMA 1AP2B 4HCGA 4HHAA 4TUYE 1B4JL 4TZ4C 4LSPL 4TQEL 2A9UA 1SPDA 2NX5E 5FW6A 4GP8B 2RH0A 2DQFA 4LQFL 3TCLB 1IGFH 3ZDYE 1SZNA 4XZ4A 1OARH 2J4WL 3CZNA 4WBOA 4AVIA 1P9MC 1BAWA 1KV7A 1XF3B 2DBLL 1UA3A 1KZQA 1QI3A 1FYHB 1CCZA 3F2EA 5HHME 4PBVC 4U05A 3WFHA 1TSRA 3LBXB 3UAJD 1WSST 5G2NA 1MQKL 1X5MA 4N6RB 4CXYA 1PLGH 3VG9C 1L3WA 3WMSA 1CC3A 1QRNE 1ROCA 4MGXA 5DJAB 3V0DA 3KD4A 1UM4H 4ZOLE 2O5YL 2X7LA 4WW2A 1OT1A 2NY5C 1D1CA 3CFBB 5I1IH 3UDWA 4U1JB 4QO1B 3MUGB 4N8UA 3KPSD 3QPKA 1AD9A 5JOFA 3RE0A 4B9YA 2DQEL 3K8KA 1QW8A 3LKOA 3UTSA 1QZ1A 4NO3A 3MVSA 2WSKA 1O9WA 2EE3A 1P1ZA 1ETA1 2F54B 4M02A 4IE6A 2R7EA 3O4LE 4XGZB 1F6AB 5IB5A 1BWWA 5MEQB 3D0TA 4NXMT 2VDNH 1GS8A 2VSCA 4GIOA 1HC1A 1XGYL 2G5UA 3IGFA 5AUMA 1NAKH 1MNEA 4J12A 2J6WA 3LQZB 1ORQA 1E9PB 4FTVD 4W6WB 2IFFL 3HA0A 1F8TL 2FO4A 3ARPA 1Z6JT 4IMLB 4P5KA 5E6ID 4UQEA 4AEIH 1WWAX 2BVYA 2KZ7B 1K2DA 5FB8B 1BJ1H 2WBJA 2JJTC 1JSYA 4PK4A 4Y5YA 1M7DA 2YD9A 5DYFA 3CUPB 4WHTB 5LNGA 2ES0A 1F18A 4FFWC 3QDMA 2WOYA 3ZMTB 3CFEB 4L23A 1C5DA 4FJZA 1WYJA 1JNNL 1J7VR 1RURL 2Q8BH 3VXQA 1FFPA 5L8LB 1OSPH 3PL6B 3EO0B 3GPEA 5F6HI 3JXAA 5IB1B 2BP0B 4D3CL 2XZEA 5HYFA 1XDPA 1KT2B 1MKFA 1OAKH 3IWVA 4EVNA 4P5TA 1PDKB 4N90E 2X09A 4HAGA 3X3GH 4EZJA 3RYCE 2L8KA 1WRDA 1OQOA 1T1WA 1RMFL 1AMYA 4E36A 5IUCA 5E5MA 1I94T 3BP4A 5A6IA 4HFDA 3A24A 4RDQF 1FZOA 2W63A 3BSZL 1OGAB 3MLXH 2DRUA 3D69A 1HNWT 3H42H 2ZX6A 4XZUA 3KYNB 1NGXA 3H2PA 2CEAA 4ZXBA 4DGIL 5E08L 3MOBH 3EO9H 3NZ8B 5DD0L 4EEBA 3RWFB 1CYXA 1EZSA 4ZS7H 4AQ1A 4P2RD 1ACYL 4G8IB 5BPPA 4LB8A 4HT1L 3VACA 1SBSL 3T0DA 3QUMH 1CZ8H 1HL4A 1VGKB 2CA3A 3QR0A 4IHJE 1Z8UA 3VD4A 2EEFA 1I8AA 3KW8A 1BMWA 1JWUA 3QFJE 4ZUSB 4E9VA 1HNXT 2JH2A 5MEQA 3TVMA 3VFOB 1YEKH 3TC9A 5F70A 5L0QC 4KPHL 3P4PA 3ULUH 1UCBL 4NNPL 2YARA 1X9LA 1CUNA 4COFA 5KMGP 2WP3O 4KO6A 1A3LL 4LLUB 5EO9B 1FZJA 2CO7A 3VFWB 1FZMB 4MNQA 3O9WD 4W70A 2DQJL 2A0LC 1TR7A 3KWTA 4CXWA 2KDYA 3HZKB 5AQNB 2X4NA 2X7LB 3I6LD 3FT9A 1BECA 1NAKL 1WR6A 1XF4A 5LAXB 1WA0X 3U30B 4F2FA 4QHLA 4OQTL 1VKXA 3EYVA 1JZGA 5CEZD 2VC2L 1Z5LB 5L88L 3IPFA 3CQGB 5C0BA 4NYLA 3IDIA 1DN0B 3VQ1C 1S5IL 1CGWA 2AJYL 3FCUB 1RAMA 1UYWL 3FSWA 3GDCA 1A4BA 3KBUA 3P4NA 4ZOCA 5DO8A 5C08E 5MERB 1N67A 4B3EA 5I0WA 4KH2A 5EFIA 1C16B 4YE4L 1ITBB 3NEOA 2DQGL 1E5YA 2JJVA 1WBYA 3MROB 4D0DA 4JCMA 1MEXL 4FLQA 4UV7L 1F02I 2TSAA 3PABA 3FB8A 4U33A 4P06A 4V11A 2YUZA 5B3JE 1G1OA 2D9QB 2HFGL 1T0MB 3MRKB 4G6AC 2CLRA 5FMNA 1HHJB 3Q01A 5CS7A 4LLYB 5FK9A 2A9BA 4FD0A 3INUL 4N9OB 4MASA 2FIKA 2CXFA 1EXGA 2UYLA 3IDXL 1HQRA 1QBLH 1CLVA 2HVKB 4EI0A 5DJZA 4HUXB 3O9XA 5BUAA 4I0PC 1ZT4A 3T8OA 1X7TA 3UYPA 3UBXB 2NR6C 2QFRA 4FQPA 2QGCA 1EFXA 4C4UA 1TVHA 2F8IA 3EZ8A 4UTBA 3TPKA 3V0HA 4EDXA 4Q6IC 4QRAA 2W60B 2KDGA 1J10A 1ILUA 2UXFA 3HPJA 3LJCA 3QUYA 5IHUL 1J5IA 1MFCH 3KPRB 3E1ZA 3OZ9L 5LA6E 1NCAH 1E2VA 3SKOA 4AGOA 4DQOH 5A6LA 2VLKE 3AS0A 5CU5A 3BZFA 1HSAA 4XP4L 4ZS2A 3T77B 4U7MA 3AXJB 3ZTCC 1JYVA 4AUJA 1E5ZA 4EUPG 2AMGA 2XQ8A 5FXZA 4KRPD 1OEDE 4KK6D 2XKNA 3QQ9C 3RL2B 1EHNA 1FNEB 2P8PA 4DP9X 1E6OL 2ADYA 1JHTA 1KJ3H 3LPGA 1DQKA 2BH0A 5IW1A 3LB6C 4QKTA 5GS0H 2AS5M 2QFPA 3IE9A 4M5ZL 1E90A 2V3DA 2VLJE 1KCKA 2YBRB 3D39D 4OLYH 2H1XA 4EZ4A 5E8OA 3VH8A 4HWHA 2G3XA 3A6CL 4QAWA 3CXHJ 5F7DB 4N3UA 4KBMB 4NI6A 4IOFD 1LVFA 1AGDA 3QR2A 4LAQL 4V1DE 3NVOA 2ZKHL 3BZ4A 4MLSA 1E0OB 3G5VA 2CXDA 1J8HD 2OR7A 3KPMA 4AXWA 4XODA 2WY3B 3B3BA 1FJ1A 1NLDH 5I18L 1CL7H 5EULV 2X4PB 3T65B 3A6BH 5FGCE 1MLCA 1TZAA 2IALA 2YN3A 4N22A 2WQUA 2FBRA 1MXGA 5KANG 3U48A 3CX7B 2QSTA 4XPTL 1W72L 5HYQB 2GCYB 4MCYB 4UAOB 3H0TA 2VERA 4OLZL 3NIFB 5GRUL 2BNUA 2DW5A 2F5BL 3SDXA 4KI5C 9PCYA 2ICWA 5CIPH 2OJZL 4E7ZA 3QZWG 3U30C 2YUVA 3WHXB 1T0NA 4QLRA 1AYOA 1ACYH 1DVFC 5GSVA 3NACH 2WVUA 4KVPA 1QX1A 5FFOA 4UQIM 3QXWA 2NZ1A 2W07A 3NTCH 2EC8A 1NWMX 5C0GA 2H3NB 4M93B 3VRLE 1FA4A 4X5RA 3F5WA 2EDBA 1EZLA 1ZSHA 2K8MA 4DGWC 5GS2D 2HKHH 1DYZA 3LZLA 4FQQA 3BWSA 2HKHL 4NJ9H 4WSKA 2EVFA 3EJUA 3X11B 5J8OA 3FBKA 4PV8A 2H2PC 2X28A 3BEVA 4EI5A 5LNDA 5HGAA 3MNZA 2WCAA 3X2QB 1BZ7B 1G6RA 1R1CA 1ZIBA 3ETSA 5AAWC 2D7TL 5TE6L 5IR1A 6FABL 4WU7A 3FJTA 1BR4A 5H2BB 1MLBA 1F5WA 4J5VA 2RTTA 2WVSA 4KHZF 2NUTB 2CH8A 4ASKA 4CL7A 2PTTA 3GSWB 5LXGL 3MJ9H 1AS6A 1OEZW 5JDSA 3RQ3A 1G94A 4QRTB 3W0WB 1GW6A 1CGSL 1GYWA 4G42A 4OX9T 4YNYA 3LD8C 1WTLA 3HUJF 4JPWL 4HS6A 1FRGH 5KYNA 3IE4A 2LSYA 4JRYB 3II3A 2FJDA 3GBEA 4TS6A 4F9LA 4DKDC 2EIZB 1DR9A 5JQHC 1KPUA 1JYWA 5B8CC 2VRAA 2QPUA 2XXCB 3SE3C 2GITB 5LHHB 4AQAA 4JKPH 3VGHA 2X0HA 4KNSA 2DS4A 1AGFA 5HI5D 4BQ9A 3U6RA 2H6PA 1OKEA 4G6JH 5TDOB 2XPGB 5F3HB 5IY5B 3MLSL 5FKYA 1I75A 1QSED 1TYEB 1FL5A 5AZ2H 1EO5A 1A7QH 3G6DL 3SRZA 3ARUA 4EAEA 1U30A 2ENPA 5EH1A 5LXTE 5AQJB 2XKUA 2IGTA 2GSIB 2VDKB 4YPGB 1A7NL 3GSOB 4R7VA 2VMEA 2P5PA 4KKPA 2JMRA 3QYNA 4UVCB 3WLBA 1JERA 2XWZA 2XAJB 4X4YA 3RVVD 2FD6H 2HLAA 4GMSH 1DFXA 4OD1H 4HUWA 4X80L 4RISH 2RALA 3RY5A 1E5CA 4IMKC 2X1PA 1M7IA 4MB1A 3R8BB 1BJ1J 5DQJA 1WFUA 4C56A 4WEMB 2AQQA 2WLYA 4NDMB 1K4DB 3OZKA 4FXGB 4X9GA 3TNNB 3P30H 1TLMA 4FQXB 4YHOL 4L8SC 3PWPA 1EVUA 3D2UD 2V7MA 1XZWA 4JI3T 1IM9A 4PJHE 2Q8AH 3KDSE 3FXDB 2YRZA 4YTMA 3DUSA 1ECZA 4FQJH 3SKJL 5D2NA 3TFKD 1F6FB 3L9BA 4OZHE 5I66B 4UR9A 1IL1B 1BFVL 2DLFL 1GZPA 2IWKA 2P5WD 3QZPA 1KB3A 1KIUA 1ZT1B 4ODVL 4P3CL 3WS6A 2B59A 3JV0A 4GAYA 2ZM6T 2WLMA 1ANUA 4QIRA 3FSZA 5CSGA 2OYKA 1AZVA 1U8NB 4PK6A 1KXTB 3QJOA 5MP6H 4I0PA 3NH7H 3KLKA 4OFDA 2VUKA 3LKPA 1O5DT 5C6TH 2NYYC 1JZJA 3DPDA 4OJYA 5CKAA 3BQUA 4ELDA 2H41A 3QEQA 5CNHA 4BJMA 4HQQH 4GBXC 1AIZA 4BZ2H 2LVCA 3QNYB 2MNJB 3QUZD 2XSAA 1XIWC 4RZCB 1Q72H 1YQ2A 1HNZT 4F7KA 4V1Av 3QG6B 3SKUD 4ELKB 3CDZB 2VXSL 3FN9A 3IRZA 3RFZB 1QBAA 4K3JH 3UEZA 5JLZB 3MJ8A 5MHSE 1DSFL 1NOLA 1K72A 3BYTA 1IILE 1F4YH 4ICXA 5TK2A 5IB4B 1WA2X 4JPKL 1VDGA 5EUOF 5FYMA 4YE0A 4XWGH 5MENB 1EDHA 3DVNB 2YPLB 3BT2H 2DBJA 4C47A 4DO6A 1CXFA 4U7SA 1BJMA 4I4WB 1B6UA 4OGYH 5K1JA 4IRSB 1EEYB 4DF9A 2WGXA 3LXCA 4BRJA 2XXMB 2Z91B 4LDEB 4WW1B 2XZZA 2UXXB 3EDVA 2OSLB 2AEQL 3IDUA 1GOGA 2LKHA 2Y3AA 2FO1A 4IU2A 1HHGA 4O4IE 4KZCA 3KM2A 4QRUA 5ICYA 4YXDA 1NEZG 1NANI 5I6MA 2VAAB 3FC8A 2E4TA 4G5ZL 1FFNB 1GYCA 2D03H 4GP4B 2FT7A 3MRDB 3DYOA 3LMJL 1IEAA 1QEWA 2CK2A 1OB1B 3RAJL 5KYYB 2Z3FA 5IQ7H 4FFYA 3DVGA 4GKZB 4U1IB 5FUCE 1J8KA 2YWZA 4Q9RH 3KPPA 2FJFB 4FXGC 2JSFA 2X2IA 3RPUA 2NQCA 1A3RH 3KPNA 1BVKB 4UTBH 4AZUA 4N20A 1WC7A 2NQ3A 1S9YA 4QY8A 4PI2A 1ITCA 3NQKA 1CURA 3Q1SH 2J5WA 1BX2B 1OHZA 3O3EB 5KBDA 1DQMH 4U31A 4BWUA 1UWXK 3EH4B 1G4RA 2CJUL 1YUKB 4QF1B 5AZEH 3VD1A 5FECA 3DX6B 1N8OE 3MLRH 4ZSOA 1P7BA 2WXOA 5I5RA 1TJMA 3MXVH 2BWIA 4DESA 2F6AA 1XV8A 4YIQB 2BJMH 3HI6H 3I2CL 3T3MB 3JWOC 1F3JB 2UZYA 2VRQA 5J6HA 4G8EA 1QVOB 4ZI7E 5E6IB 2XASB 4XP1H 1NMCB 5ETUB 3GMRA 4NZUL 4L8DA 3MV7D 1I3RA 2FX9L 4L3EE 4PJ8A 2DD8L 5KBLA 4MWFA 4FQCL 1TETL 2H8PB 4C4KT 1P7QA 1XT5A 4O2AE 5FYKL 4FEIA 4PRDB 3E2HB 4DHLA 2ZCLH 3IJ7A 2DTML 5SX5H 3T0VA 1WAAE 3L2NA 2E7BA 2AMUA 3A22A 4OGAC 2A77H 3TA3C 1Z1WA 3FFCA 1OB0A 2Z4QA 3FZFB 1U8CB 4Z7WA 4NQDB 5E4AA 4ZZFA 1NOAA 1J5HA 2QQKL 5C0CA 3NZQA 2F53B 1FL6B 3L3IA 3BH9B 3DI3B 3ABMB 1LO2L 5JIHA 1KEML 1E4XI 3L3HA 2BFVL 4KVNH 1DO5A 3L6FB 3PGCA 5BMVE 5A3IC 2JRKA 2VWEC 4UAHA 3N9MA 1MCKA 1C08A 1Q9OB 3S3DB 4AEEA 1T8BA 4BZ1H 3Q9QA 2XWJB 3DK0A 3DRTB 3EIFA 4IU3B 4JFPA 1ET8A 4JFEB 3C5XA 2PN5A 3FO1B 3BPOC 4LP5A 3RVTD 4PV9B 4TOYL 3RPBA 2DQUH 4F7TB 3I6KA 4G82A 1A65A 4MYPA 3TU6A 2G0UA 1ONQA 4H25A 1KLUB 4WJKB 2V3EA 1ZHCA 1TU2B 3K2IA 3ARFC 1NA8A 1NMAH 2OTPA 1J1OH 4LF8T 5J12B 3SDDB 1ED3A 1JNLL 1S9WA 4U6XB 1IFGA 3ILQC 5BOZG 5CP3H 5FDWA 1J0YA 3V5KA 2G2PA 4N2EA 3B7YA 2OK0L 5FKAB 1BEXA 2VQ1A 3WS3A 4ISVA 4BKSC 3GPSA 3NRXA 2V5TA 3CZJA 2HJKB 5EU6B 3SD2A 5BV7L 4AZ8A 2XSKA 3AUWB 4ZW6A 3RJQB 4QLWA 4L3AA 4JFWA 4PJAA 2AABL 3ARGC 1CDIA 1NCJA 4X6EB 5IHZB 1M7UA 3H3PH 4TNGA 4B95C 4LSPH 4TQEH 1JN6B 3AM8C 5BNXD 2VLJA 1CFVL 1JUFB 1WCQA 3HIZA 4WEBH 1IAOB 4O00A 2H32H 5T5NF 3ROLB 4HC1H 1Y6NR 4LE8A 4DO0A 3P11L 4J23A 2YZ8A 4Q2ZB 5JOPE 1QZNA 4J4PC 3RPIA 4NKOB 4D0BA 3GI8L 3HTLX 3QAQA 1JNHB 3GMOA 1V7NH 1AGCB 1BZ8A 1F2QA 2AP2A 1M05A 3HRZA 4L5FL 4DW2H 4KQ0A 3PWPE 1VZIA 1RJLA 2H32B 2XTSA 2QDWA 1N10A 1RUQL 4YWGL 2GW5A 4W9HC 5FYLL 6CGTA 2FX9H 3IXAB 2FJGB 3OGCB 3SOTA 1Q1JH 5LQBH 3MRCA 2QV4A 4K4KA 3SPVA 3VFPA 1IGIL 2FL5B 5DHVB 4S1QH 3NCYS 1THCA 2E46A 3KPQB 3L5IA 5FA4B 3U0TB 4IJTA 4OZIF 4QHOA 2FQEA 2LLLA 4WUUE 1DQIA 1UEYA 3RRQA 4D9RE 2WXIA 5F89A 4F7CA 3GBNH 3HOGA 2L4OA 3MLZL 4LKXA 1D1BA 3T6ZA 2QHLA 2LFEA 3IPEA 5DD3H 3V0EA 1PLCA 4QWWC 5DZLA 3DX8B 3HI1A 3Q6FB 1E8ZA 2K24A 3KV5A 4IGBC 4IOIA 4JFQB 1F58L 5DRZB 1DVYA 3BE1H 5ESQB 4PFPA 1DQVA 3BH4A 3JWNG 4L8SA 2W94A 25C8H 4E9XA 2ENJA 1BD2A 5B38G 1GYVA 1VFBA 4JM0A 3GSRB 1GTFA 2VSKB 2BIPA 4BJNA 4BFFA 4O02H 2AHIA 4UV4L 2KT6A 4HZAA 4NN5C 4DVRL 1J5OL 4NQXA 3RRCA 5GS1A 1QR1A 3QW9A 5ESAB 3E0GA 1IAPA 4X6DE 3WJJA 1KCWA 1B4RA 3BDXA 5HHOD 1BXAA 1N6VA 5INCA 2Y25A 1E5BA 5LJNA 1BQLL 1NDTA 1R5WA 2XZQH 4XO8A 3TH4T 5LWYH 3O8XD 4PJXA 2PKDA 4PR5A 1ZJBA 1EBAA 5LBQB 2OMXB 4HJTA 2XN1A 5CMAA 3R4RA 1TZHB 4PJ5A 2B4CC 2BLFA 1GGCH 1E5AA 3RX7A 4I50E 4F3FB 5EF2A 1GCYA 3PV7A 3LH2L 1KBKA 4ISVB 1MUJA 3WFDL 3WD5H 1TQBB 1DDHB 2BVEA 3HMWL 3NQIA 3W3BA 4J3XA 4YDMA 4N26A 2QHRL 3CLEL 3VWKA 1WT5C 4MMXA 1UCBH 4GG6A 5I6KA 1M1SA 1RHHB 3QFJD 4DAGL 5I16B 2B1OA 5BJTA 4ZFOL 1SDAB 1ZS2A 1E4WL 4LMKA 3ZMEA 5F3BB 3CNKA 3S8FB 3FHAA 3ULVL 2G5BB 3MRIB 3C6SA 3GMMB 3VD5A 2BZDA 2FATL 3VGGA 3Q9PA 5DEZA 4PV9A 2ISDA 3RWCA 4ZAKA 4LAJH 2Y6XA 4KNTA 3FO1A 1USZA 4HLZG 4J3OH 2IPTH 3BW9B 3JUZA 4M62L 2WOBA 3RL1B 1JV5B 2VLRE 2H6OA 3H1ZA 4PK5A 4NO0A 4P9HH 4TNWA 3K71A 2OMTB 5I1CH 5DA4A 2WJ5A 4U1SB 3ZMSB 2WN2A 5D1QA 2R9HD 1R75A 4DZ8B 4DEPB 3O1IA 3E3QE 1AE6L 3PWJA 1BQ5A 5F72S 5F71A 4XCYB 5T1KB 1P9MA 3T0BA 1DJGA 4EKJA 3KHQA 2ADIB 4LHJB 2AKRB 3HI5H 4HV8B 5D7SL 4K7PL 3HNTH 1NUNB 1RZJC 1W0VA 3GHPA 4ADZA 5T5NG 2B2XL 4Y5XA 1GTNA 1B0WA 5D4HA 3REVB 4KDTA 1BW8A 3AE9A 3APCA 4N1HB 3KPLA 5AQOB 3KV4A 2VO5A 3T1FB 4P46C 3H2QA 2AK4D 1MWAB 4AKGA 3QQDB 5FOBA 5E8PB 4Z7NB 3VGEA 4PJ8B 3IJHB 4TUUA 3L1FA 2BCMA 5F0JB 4DR6T 4WK2B 3V0WH 3AY4C 1IBHA 3VMOA 1ZV5A 3TV8A 5H37H 1SEQH 3ZYLA 3A4FA 3C6LD 3K72A 4G1EB 4P4KB 3EHBC 1ZLSH 3UBFA 3QQ9D 3EGDA 1TZIB 2JQ9A 3ULUL 5I19L 2CIIB 4LVOB 3V6FA 3HI2A 3L5WB 4YSSA 3CC5B 4AIOA 1U8LB 1E3XA 1FO0A 5TDNB 1S5IH 1ZLWH 3ZCIA 1A1MA 1FNHA 2IG2L 5D7IA 1DBKH 3TT1L 4BBWA 1QO3A 1KLFB 2VR6A 2V8SV 1OP9A 2WC7A 3D87B 4KAQL 4OQTH 4U7KA 4QNPF 5I0XA 1EHLH 3KWWB 1EK3A 3FXEB 1RZ7H 4P0DA 4R90L 3N9PA 3O4LD 1YEIL 3NFNA 4KKLC 4IT4A 2I27N 2BG9E 4PRIE 3T09A 1NCWH 1KZYA 3NIDF 3IVKB 2F74A 1K8DA 3TN0B 2BWQA 2DJ4A 3GMQB 2CLYC 1AQDA 1H15A 1BREA 4LF3A 4XNUH 2IWGA 3TLVA 3JV6B 2YGNA 4GAAA 1O7DC 3L2LA 4WSGA 4DZBB 3F6LA 3CQXC 4MCZB 2BNQA 3N85L 2DMBA 3PE0A 4HEPA 4G3YL 3D6GA 1ADQL 4EMZA 4C91A 2WZPA 4XXCC 1MFVA 4IRJB 3W1ZA 2DHRA 3TLTA 4O2FA 3MA7B 3HC4L 2CG9X 3SGEI 1FNSL 2ZCLL 4AKIA 2KERA 4OCYH 3WY4A 4P2OA 2O6FA 5D6CB 1QSDA 4QXCB 3FCTB 3M7OA 4AG4H 4G72B 3CC5A 3MV8B 4M48L 4S2SB 1VRBA 4FFVC 3IF1B 2PYFA 3LEVH 1YQ3A 3ZKND 2VDPB 1UWEL 3EJRA 3I3EA 4I77H 4QRRA 2ADGB 4IRZH 3IU4L 4CC0A 3OHXB 3AS1A 3FOLA 3MJ8B 1FORH 3RZCD 1JPSH 4HPYH 2CWYA 4BGLA 3AT8A 3I9PA 4MJJA 2RGSA 2L3BA 1OWAA 4RX4D 4ZTPL 1JGEB 4I2XA 4AGNA 1CI3M 3RNKB 1JK8A 3PS6A 5B1JA 3R8QA 3UTKA 3DXAD 3JV4B 1D2PA 5CBAB 2WBWB 5JR9A 4Y5XB 4UDTA 1D5MA 5BRQA 4ILCA 1HL9A 2QYWA 1YYCA 2Q0ZX 5E1AA 3D0LB 4EDWL 5I73B 3TZVA 5DSCB 4NQCB 3O3DB 1AJ7H 1XGZA 3FCSB 2K45A 2FJSA 1SBBA 2VZ1A 3HRZC 1UT1A 3O4OB 4QYAA 2MCPH 4IBLT 2NW8A 3KPRE 3S36X 1Y18A 1T21B 1I8MA 1UFGA 1JD7A 4IKNA 4P23A 1GQEA 1YYLH 4JV5T 5LB1A 2B4CH 1BR0A 1GL4B 3HKCE 2WXKA 1FFOA 5DYOB 1AFVL 3RTQC 4OJDH 4CI3B 3VM7A 5CF3A 3Q5WA 2X9WA 1J8HB 2H9GA 4HIXH 4P04A 3NP3A 4LVNC 4YHKL 2X3BA 4JEUB 1L0YA 3F84A 4L4VE 1T89C 4X7DC 1H0DA 4LRNL 1W0YT 2MRYA 2XETA 3VG9B 1Z66A 4WV1C 5EU4B 1V05A 2UX6A 3E6FA 3AQYA 3QIWC 3QJRB 5TPWL 1TQVA 1RJYA 2VKXA 3S3JA 3OKNA 1IC0A 2VMDA 1D5ZA 4DERA 1HTYA 4GKSB 4H0HB 4J1UA 1RHHA 1NDMB 1GC1H 3PHQB 2ZOUA 3BN9D 2MAWA 4MMXB 1BVLB 4HFBA 3VXRE 2WNKA 1WFIA 3I3DA 4J3OC 4ZMZA 3F3HA 5E0QA 4J3VA 3AREC 4JKPL 5DQ9B 3OF6D 2OI9C 4WHCA 1IX2A 2ORBL 5CIPA 1NCBH 1V55B 4JRXE 5EPMA 5TQ0L 4M8QA 4X80H 4CN6A 4UNUA 1HXYA 1O0VA 4P5MA 2I7SA 2B5IB 2HJLA 3UMTA 1GZHC 5JHMA 4Z7OB 4JJ5B 5IIEA 3DRQA 4UTAL 5BR8T 4Y4HA 3ZY7A 4OBRA 5C09A 3DVIA 1XZ0A 4AVKA 4C83A 5IHUH 2VR4A 1WJ3A 3IMVA 3L08A 2LV4A 1A66A 1ET5A 4GI6A 4ODXB 3HMXA 4FNTA 3BIKA 2UWEB 4AISA 3HNSH 3RH3A 4D2NA 2YMTA 3L4VA 4OIFA 2X5PA 2B8OT 1U42A 3DARA 4OFYD 4S1RL 4TL5A 3DV6B 3G3LA 2L04A 3WN5A 2Z31A 3LV3A 1DN2A 3HFMH 1OE1A 1CFNA 3GC3A 4JFOB 1GSMA 5KBNC 3UJTH 1MCNA 1P1VA 4W9LC 4IL4A 3N40P 2WXGA 3IN2A 1RURH 2Q8BL 2J20A 3K91A 4OQTA 4V2BA 4ZX5A 5IQMA 1CDHA 1BYNA 2R2HB 1BZ7A 5AG9A 5IG7B 3PDYA 3AU0A 4EI5B 3KGSA 1E5UI 1T2QL 2WLLB 1FYTE 2K9FB 3K6SA 4W9FC 4XVOA 3KPQA 3KG5A 1Y07A 3PUUA 5FYKH 3Q1EA 5CJQL 4Q89A 3CDGB 5DZAA 2X41A 4WWPA 3BMVA 4IM8A 3SO3C 2XVLA 1V10A 5AVZB 5CZRA 1I1AA 5ITBL 2WDVA 2OL3H 3HLKA 4UU9B 4D9LL 4YBLC 1T0NB 1J1XH 4ILDA 5KVEH 1JXDA 4HKZA 5A40E 3CXDH 3FRPA 4NM8L 4CI1B 5AZ2L 4U7YA 3IEEA 2CO6A 1JNHA 3GMOB 5AFAA 3S9DB 4D0BB 5JRCB 4UVAB 1CJYA 3CSGA 3MBXL 1S9VA 1PLBA 4XVUD 4W68A 4BWTA 5HYQA 1EPFA 4BSJA 1T7SA 4BFJA 3L3PA 4LESA 3S88L 4WW0A 3O6LL 1NCHA 3EHZA 5C0AD 3V0GA 3UPRB 2ZUQB 3HNVH 3GUTB 2PCPA 4IIQA 4PJHB 2OTUA 3CMOH 5JDFA 4YDVA 5DR5H 5ENWA 3F7VB 5DJ2A 2V1DB 1UM5H 3E2HC 5DJCB 2XG5B 2HP4A 1SOQA 4QPEA 4AXWB 3AEAA 2AGJH 5CO1A 1AIFA 1HILB 2AERT 3G5VB 3RX9A 1IKNA 4UTBL 3N44B 1YN6B 4TSAL 2Y7NA 2K6ZA 4RBPH 4R4NC 3V4VL 4YQXH 1MY5A 3KYOB 2OMNA 5T1JA 1MIYA 4LF4T 3HG1E 1G1KA 4HK3N 4HXBL 4DEPC 1JMZA 2WO3B 3VH8B 4A2DA 3RAJH 5BZDA 3K4ZA 3EI0A 2DKSA 2YBRA 4U0QB 4A7GA 4XMWA 4X7TB 5EIQA 1GAFH 3D4CA 2FEDD 3V6OA 2XPKA 1A4CA 4AMWA 5ADOH 4N2OA 1FUNA 4LBAA 5F7LB 4ZNEA 4HBCL 3RL2A 4FNPA 5L6YH 2H88A 35C8L 4FMVA 1A6TB 3HW7A 1RK7A 2BWDA 1YCSA 2UUBT 2ODUA 2ATPA 1DJZA 2WLIA 4MA1B 4BKTC 1E4KA 2ADFH 3KV6A 3GXUB 3JWDH 3ETBJ 4RSVA 5E9NA 3CVIL 2H0FA 4AEHH 4U0RC 4S1RH 2BDNH 3GA8A 3HPJB 4Q56A 5JW4Q 2UY7B 5DS8A 3RUGA 1W15A 3NZHL 3CMLA 2ZOOA 5C08B 3CE1A 5LCVH 3UPAA 4EDXB 3G04B 3QJFB 1FL6A 3L3IB 1KCSL 4W81A 1LP9E 3IWUA 2R2BA 2D2OA 3EFDH 4RIRA 2Y69B 4Z7WB 3SWHA 1MZYA 3PHQA 4K3GA 5GS3A 2RMNA 3KYKL 3NPSC 2MOZA 4PJIA 3QUMB 1WBZB 1AO7E 5K9OA 5ALBH 2AV7B 4TNWK 2NY1B 1T2QH 3AACA 4TVSa 2LABA 3NFSL 1XSJA 3JTBA 4RMRA 3BLBA 3R4DA 4ZFZA 3Q7JA 4W9CC 3RWHB 4MLIA 5MENE 1UFUA 1BP3B 4JLRB 3E8UH 5KOMC 3QCVH 4N0YH 4E9SA 1LP9B 2ORBH 1C7TA 2WWMD 4PRPA 1VCTA 1I7ZA 2EE9A 3NIFF 4G8EB 1HN1A 4PGEB 3IJSB 1N0XH 5GHWL 5K9QI 4I5BA 3VSUA 3LRGA 1BZEA 2QSCL 2XAHB 3HCVB 2H4EA 4NBYB 1P69B 5LGTB 3IKCA 5GZOA 4I18A 4CADB 4QF1A 1EV2E 4AQ8A 3SPJA 3ZR5A 3KGRA 4M5ZH 4NYLB 4QUOA 1UTDA 2NZIA 2FNBA 4Y1TA 1G6RL 4IRJC 3R06B 4X9YA 4PRNB 1HZKA 4L4JA 2F5AL 4KY1H 5D55A 1CFQA 4PJXE 3VDCA 2IXQB 1SLUA 2F53D 2XTJE 3OJMB 4XRCA 5KX5E 4FQ2L 4OF0A 3VFMA 3LTVA 4K3HA 5E94B 4MQXD 4D7PA 4M6MH 4YDKH 4YHLL 5KJ7E 3NOIA 5F6HJ 4FX5A 3SDCA 3ELAT 5I6LA 2Z1KA 1EXUA 1MELA 3PQYA 3T0AA 1A25A 1KJ2A 1U2YA 3L45A 3FU9A 2QGEA 4XMXA 2V8MA 3FUKA 2BP8A 2UZPA 4MS8D 5E1IA 5HYJE 1UACH 5TFSH 1AGBA 2DM2A 3CFTA 5HDBE 4HU2A 1X4XA 3E9TA 3VXNA 3WDJA 2PP7A 1SN0A 2DEWX 4G8GA 4IRJA 4KHXL 2CR3A 3QQ3B 5SX4I 1UKSA 1RZFL 4F8PA 2X05A 3TKLB 1LVEA 3T2OA 2XJ7A 5JDGA 4M3JA 2PYED 4HWUA 1XFPA 4RMUA 4Z7AA 3VXOA 4AEHL 1IC5H 4IK6A 4PHZA 1RK0A 2OSWA 2GUOB 2IH3A 1BIIB 3BEWB 3NUKA 4RISL 4WUUA 5FUZH 1CR9L 1XMOT 1I85A 1T5WB 4R96A 3MLYH 2WXLA 3PU7A 1F97A 5LBSH 3LN4B 4QCIB 5ERWB 1JVOA 3UAAA 5CZKA 3KWXA 1CZ8L 3ZO9A 3QEUB 4IKLA 4Z95L 1NFDE 4LSDA 2AEOA 1ETB1 3L95B 3FN3A 3BP5A 3B13A 2Q3ZA 3VXMD 2HPJA 3M1OA 1UZ6E 1OTUC 2WUBL 2HLFC 3MJWA 4JDZB 1OOAA 3M86A 5I1GL 2HRHA 3L5XL 3V4UL 1MJ8L 2C4FT 3SE6A 3UC0L 5JNYA 3JYBA 1X9RA 4UV4H 4DVRH 5GGSB 1HNFA 1DL7H 1KIUB 4XP5H 5DURD 3VSVA 4HKBB 2BSTB 2NYKA 5BQDA 1FFPB 3BQVA 5BO1H 3WTXA 4PAGA 5CGMA 4AKQA 1AKJA 5F3JA 2X0LB 1KPVB 3ZDYF 1UB6B 5ID1B 3BE1L 4HJGB 4RGNE 4XNMB 4WEBL 5IFAH 1MCWW 5F7BA 2VM9A 1UG9A 4OYJA 3CFKB 5DK2A 4JG1H 4J28A 3EO1A 1RUPH 1W6WA 3V5DB 4GKKT 2WVVB 4XXCA 1UH4A 3BSHA 5I71B 1BQHA 3P4RA 2YPLD 1NBCA 2HMIC 2DMGA 1JNRA 1I9IL 1EZ3A 3APMA 3H4FA 4JFDA 8PAZA 4IRSC 3KYMA 2E4FA 3P0GB 3TT1H 1C1EL 2ERJC 4N0RA 4BFOA 2AKRA 2YEZB 4HV8A 2R7EB 5IB5B 1Q1JL 4ZMYA 4YPGA 1C9SA 2AJSL 4L3CB 5T1KA 3AREB 5CILL 2WJ7A 4NO3B 3GBMH 2JCCB 4DMWA 4N0UA 2XN9B 5H6RB 4DW2L 2A5UA 5HDQH 1PX4A 2EH8L 1IC4L 2OMTA 3PAUA 4IJ3C 3DBXA 1GPOL 5AQHB 2BVOA 2YMXL 4WFHD 1HTJF 1DUYA 5ECJE 3RL1A 4JANB 4YHIA 5DEGB 3VI3A 1XSKA 3WFHB 1SXBA 3VXSB 3U3IA 3GS0A 3SJVA 3W39B 3HN5A 4UB0L 3ARFA 1OV8A 3NCJL 4RDQG 2WWVA 1HYSD 2CLZA 2DWYA 2PPFA 3ZKQD 1U8QA 1P6AB 3QIBC 2EO1A 4JHWL 4KK8D 2XFGB 5CJQH 4HG4K 4TUKH 4F8NA 4HJJL 5LBSL 1XMQT 2APBA 3T1HT 3NCMA 2ADJA 2HX9A 4FQ2H 4HK3J 1FIOA 32C2B 4LFHG 4M7KH 1ZDSA 3EYOB 5E7BA 4HTEA 3VD3A 5C9JB 2DI9A 2YSSA 3VVWA 4NZDA 3CH1A 1TEFA 5EUOA 1HQ4A 5CGBA 4DOHE 3T0XA 3EOYG 1KN4H 1T7WA 2B0SL 2XZCL 2VLRD 1XQ4A 3UMNA 5IVZA 3S6CA 3GWJA 1MI5A 2ICEA 3VCLA 1A6WH 2X9HA 2EABA 2E9XB 1XGQA 1T5XB 3OPCA 4QHUB 3MLWL 4FYRA 3TIDA 1CF8H 4L9LA 1HJBC 3CDCA 4FI8A 1IQWL 4EKXA 3PIQA 3GGWA 4NOFA 5DK3A 5I8CA 2ZM2A 1QSEB 3DV4A 3W37A 4KNUA 4F57L 3ZKRA 3QRBA 4L4TD 3BD5A 2AQ2A 2H3NA 3WI9A 4F93B 1MJUH 1OSYA 2W07B 1MW0A 3GXDA 3D0AA 3FZUC 3FULA 3VDAA 1N33T 4JL2A 1Q9WA 1VFBB 1H9VA 1ZWIB 2DJMA 4P2CG 4ALAL 1UA7A 1SY6H 3SYQA 3UBGA 3TLRA 2CNYA 1YEKL 2BNUB 4DV5T 3VXSE 5DQDH 3DGGA 4JFQA 5ESQA 3TEWA 4G6ML 2A74C 2OXHA 2X4TA 4RESB 5I74B 5HXEA 1IV8A 5DD6B 2NNFA 4RCAA 3RYIE 3KWUA 2C5DC 3RWDB 4AJ0A 2DYPD 1RLWA 3SKNB 5I1KL 3T65A 4Z9KB 2I0MA 2YKLH 3MUY1 4PP1D 3U0TA 4CKQA 4RGMC 2VYRE 2CLYB 4LCCA 4JKWA 2XQYG 1CF1A 3MRHA 4GAGH 1IGML 3GSUA 4HGWA 5LGHL 5BMFL 4GKNB 4BFIA 2BXZA 4EN3C 3RURA 1DL7L 4XP5L 2DQEH 5INDA 4LPYA 4M4RA 2CZNA 4RFOH 3O4OC 4Y4KC 4V1DB 3DXAE 5DUPL 5ADPL 5AQKB 4G8FB 3I0QA 1CBVH 2ATKB 3LQAC 4K0OA 5GZNC 2CXGA 4ZBJA 4TLKA 5A2BA 2FO8A 1NAMH 2EDTA 3QYMA 3SE8H 3RWDA 4JHAH 2V2XB 3QEGL 4JQIL 3AITA 4RQQA 3QDHA 4OB5L 3RZCC 2E6PA 4RMQA 5AG8A 5FLVA 4DKAA 1DJSA 1GS6X 3T77A 1FHNA 4KITB 4XX1E 3B56A 4HEAA 5DHMC 5HEUA 5KOVC 3C5ZA 1H5BB 3GEWB 2E9WA 4K8RL 1SEBA 3UUXB 4Q9CA 4CJ0A 4O5LL 1QR4A 3QUYB 3WLWD 4OCYL 1MNDA 4PWIA 1V3KA 1LVKA 3GHBL 2VXVL 1R0AL 4PJ8C 1AQ8A 2X4QA 2DQIH 5CEZH 1WZMA 4WO4D 4MD0B 1VA9A 2H47C 3APDA 1I3UA 2DV6A 1P5UC 1QPXA 1OEDB 3UQ7A 4L2YA 3DYPA 1FL3B 4X64T 3HMWH 1NGPL 3ZL2A 1ZT4B 4RFEA 4Z77A 5GJTH 4L3EB 3VRJA 1LM8V 1U3HD 2ROYA 3IDYB 3T3PF 3AS2A 4EPSA 2V5SA 3D48R 1XF1A 4BZ2A 3ANWB 1HHJA 1G8XA 2B08A 4HLEA 2VABA 1G9MC 3V5HA 4M3KB 3IA3A 3ARXA 1U8PB 5DUBA 2PCXA 3GO1L 1CGUA 4PD4K 1ADQH 5I1JH 3L6FA 4ABUA 2ZXEB 2CDEB 4MA7H 4MRCA 4PRID 3T6WA 4R83A 4XXDB 1AXSB 1YNLH 5TD4A 3V95A 1IBKT 3VXME 4NO2A 1D0ZA 5EFIB 3NG5A 5C0CB 3QI9B 1WCBA 3L09A 2FLBT 4PRAB 5D7JD 3S5ZA 1AZCA 4LL1A 5ISZB 1LNUB 3GRWA 2PCYA 5DUMH 4PTUB 5ICXA 1R4XA 3KPRD 4UF7C 1HKFA 4Y16C 3BX7C 3DX0A 4GQZA 5BVJA 1KCRL 5DMIH 1UEMA 5DVMA 2VN6A 1I7RB 4FDWA 1HZHH 5IBUB 5BV7H 4MXQC 2CDGA 1CD1A 5BS0B 2OCCB 3VFWA 5F96H 4MQSB 2UWEE 2I9TB 2BKOA 2X67A 4S1SH 3TOPA 5D1ZA 2YK1H 3OGOE 4LOVA 3F7YB 3NESA 1BMGA 2IANB 1DE4A 3LY6A 4NFBA 4RLDA 2XQAA 4ALAH 2K7QA 4UQBA 3FB7B 1WV7T 4P5TC 4XBMA 5HYSB 1H3TA 1SXZA 1JI1A 2E9XC 3DX4A 2JKNA 1N4XL 2ZNXA 2QQNL 4Z7OF 3GINA 3MJXA 5I19H 4BH8B 1ML0A 4ZI2D 3VKHA 1RJZA 1MJJA 2OV0A 1QABA 2P26A 2VC2B 4FOMA 3O3BB 5A2JH 2CGRH 4JG0H 4J3BA 3QDJD 1CIDA 1CUOA 5F1NA 1J11A 1I8LC 4L1SA 4ZW8A 3UL4A 3VXTA 3ESPA 3R7QA 4FG6C 3O2DH 3HBQA 4GLRI 4H1LA 4DP0X 5KXJA 4MX7B 2H2PD 2NNRA 3I85A 3QIBB 3FPYA 5CM1A 4KC3B 2YRPA 4QOKB 3WKPA 4BUHA 4KFZC 1NEZB 1IAIH 3HB3C 1UQSA 1TZGL 3N55A 4QRQB 3F57A 3S2CA 4MKTA 3S37L 3FQYA 5LO7A 1IE5A 1A0QH 4U6YB 4KZ0A 5DHXB 2M83A 1Z9PA 2WTRB 1LYQA 2ZG2A 2LAAA 5FVKA 2NY3D 3DX9A 5C0FB 2Q76A 4ZI3D 2A99A 2HFFB 2K4AA 1RZQA 1T1WB 1JHLL 3WTYA 3T08A 4QRQA 1I1FB 2BRRL 2I5YH 1UOWA 5FM5M 1PZ2A 5ERWA 1S7VB 5DLLA 3ZE0F 4YGAB 1IM3B 4BQ6A 3BAEH 4RMSA 3EO0A 1TF4A 3DVNA 1IGYB 2AQ3A 3GS4A 3WJMB 4MQTB 5FL0A 4ELMF 1JL8A 1YPZB 4K5OA 2BVMA 4JI6T 4NIQA 2C9QA 1KXQE 1FYTA 3LSOA 4YJ3E 2YD8A 5F1NB 5IYZE 3GD1C 5DZNA 2K5BB 1G0XA 4CMHB 1FF5A 3OYXA 1Q0XH 3MLVL 4XC3L 2CMRH 3I6LE 3BESR 3M88A 4IMLA 4FP8L 5B7EA 5IM7A 1Q38A 5KTEH 1P0SE 3TTSA 2BMKA 3DX9B 1BOYA 5DI8B 4P2RB 5C0FA 2ICWJ 1LO5A 3UU8A 3KAAA 4FFZA 4R0LC 4GAJH 5CGTA 3SGJC 1A1NA 1YMME 3TWCL 4ZG1A 2XAQB 3DO7A 5EK3A 4XMVA 5KSBF 2ED7A 3T0EA 4K0UA 3PTRB 2F54A 5FY1A 5GGVL 5LWYL 2LOPA 3VJ6A 2VXVH 4NO5B 3O1HA 1EBPA 5A2CA 3X12A 5FW8A 2CDGB 5BS0A 3NN8A 1XH1A 2FHBA 4MJID 4JDTH 2BW5A 3DIDA 4L2LA 2FDBP 3FFOA 3WEOA 5DLMH 4ZS3A 3IDGB 2UXVA 2ZP8A 3D50A 1PD6A 3R06A 3EH2A 1YLBB 5ACZA 5IWAT 2XQ9A 3ECUA 3H9HA 3U83A 3ZN0B 2G2NA 5AAMC 1IAKA 4PRAA 3VG0H 1IZKA 3VGFA 4FF9A 1YEEH 1PFCA 1OLLA 4I18B 4F9PC 5DJ8A 1LGVA 1C12B 1SQMA 5JHAA 3Q5YA 4HFUL 5EMYA 4MSWA 1JXKA 1Z9MA 1HL8A 1AXSA 4I5BB 4X98A 3FH5A 3UCQA 1XXFC 3HE6D 3VX0A 2F7RA 4BDVA 1D5BA 4EZLA 3PRZA 5L3EB 1NC2A 5FYKU 1N9PA 2VW7A 3HRPA 3EXLA 3LEYH 3AECA 1OXZA 4GSRA 5TDOA 2ODIA 2HX8A 4Y4KA 1HDMB 4LEOB 1ZTXE 5IROD 3W5MA 4KJPC 4ILUA 3I9GL 2BERA 4JFTA 1ZV4X 4I0UA 1ADQA 3EUDA 5SWZA 3ZL4L 1KB5H 2WYIA 2GK0A 1U6AH 1JYNA 1AE6H 5LCYA 3VNZA 1BR2A 3ILPA 4PGCB 4PAZA 3D34A 5D70H 3N1MC 4R6UA 2PP8A 4P9HC 3ABVA 4WYVA 5L9DL 4EAHA 1T20A 2DWSA 4KX7A 1KB5B 5I75B 2F58H 5BZWA 5KEZA 4PJIE 3B57A 2ZJSL 1KYUA 4XXDA 2BKNA 4F5CA 4HF5L 5FYKD 4EOWL 4X7EC 2O30A 5EUOE 3NGBB 1J05A 5DUBB 4FQHB 3H8NA 5IFJB 1K4CB 1KLGB 1FC2D 5HP5A 2A73B 2ZZUT 4Y2DC 5E70A 3LAFA 4L4TE 4NRZB 2MIZA 2ZICA 2R69L 1AANA 1KTCA 1USQA 3TO2B 3IRCA 4JO1H 1OTTD 2E8YA 3L4ZA 4Y4HC 3W11C 5IMMB 1KJ3L 4HWCA 2VN7A 2A9ML 5KYWB 1P5VB 2ATKA 1MVUB 5FLUA 1GYUA 1PZSA 1QOKA 1U3ZA 5CEYB 4AKPA 4L9IA 4MD0A 2DNXA 4ILBA 4ELMB 3RVWC 5B3NA 3B7UX 4QTIH 4LSRH 4ONFH 3WJLA 3MRNB 1N64H 4A1RA 1PKQE 1IFHH 1NM9A 4KKBC 2MFNA 1X7QB 1AIFB 3GSNL 1UA6L 4TL4A 3ETTA 5AENA 3HHMA 2E8ZA 4JZNA 4IW4C 2OTUB 3CCHA 1PNCA 4TX5A 1SYSB 3E0ZA 5GRWA 2NY0D 2JCWA 3LPPA 4KMLB 1TTBA 4LGSB 3TA3A 1RIVH 3MCKB 3SZ6A 3DC0A 4PWEA 4AQFA 3LXBA 1U8HB 3EJYC 1S3KH 2J55A 4Z7QF 3EG9B 3CK6A 3D2UB 3H85A 2P7TA 2YQ3A 4WSJA 5B1KA 3VXRD 1FJ1B 3UZEA 1JWMA 5JYMA 1E3ZA 3GSXA 4J3OG 1QRKA 4Z3HA 4Z7IA 1NANH 4FZEL 2DTSA 2OA9A 3MLTA 4D8PB 1KWKA 1T6WA 2XVKA 2E3VA 2LSJA 4YPJA 4PJGA 5HI3D 4ZW7A 4FNSA 5CJ5A 3VWJA 4BFIB 1ZGLM 2JKIS 1IB5A 1CVSC 5AW4B 3L9EA 4ELMA 1AXIB 3N42F 4JHWH 4LCWB 1ZHKA 4HUUB 4MA1C 4H8VA 2QADB 5CB4E 5JXEC 5MEPA 2CPTA 2WLLA 4K5PA 4YHMH 1BQKA 2YAMA 2BY2A 3IRPX 4U1KA 5E1HB 2VKHA 3V4PH 4MZIA 1FNEA 4NWUL 4PY8J 4RSYA 1TYJA 4CGTA 3WNMA 3FW6A 5JORB 5DMJB 4IIZA 3UU6A 2KH2B 5BQ7B 4F15B 5C3LD 3UZEC 1X6LA 4AK2A 2YSSB 1IBZA 1WWBX 4KI5F 1T98A 1TO5A 4FHJA 3OWEA 4YAQA 1A6PA 4YC2B 2ZKHH 1RIUL 2KNDA 3SKOB 5ADOL 5LP6E 4JM2A 3IFOA 4JFHE 4J8RA 4YHKH 4OFZA 4Z7WF 2P42B 3IT8D 3N1QC 5DLML 5D96B 4ZQTA 1QBBA 4FLHA 4NM4H 1YO4A 2CLZB 2NX5A 4JY6B 4OK0A 3Q05A 1EGJA 4YHYC 3QUKA 4FLSA 2X10A 3ESOA 4PW9A 3VXSA 4DWHA 3O0RH 3ARBA 4TVUA 1LEIA 4DR4T 4XPTH 2DIBA 2QVAA 1JZEA 2YO3A 4LLQA 2GK0B 2NOYA 4ADGA 1IC7H 5AQLB 5SWZB 3VI4E 4AIZA 5E99H 1ZANL 1NEUA 4QR7A 5KSVA 1HQ4B 2BVOB 2L7QA 4M1CC 4MD4A 1BXXA 1QSFA 3L4YA 1D9KA 2Y6TE 3LHPH 2NRDA 3U4KA 3ULVD 1OF2A 4PRHD 1MVYA 2EP6A 3E80A 4K73A 3UUMA 1QKZL 2YXWA 1LMKA 3DDFA 1EQWA 2XRAL 3FQ1A 3I02B 4OLVH 4PVLA 2AXGA 1CFSA 2AV1B 5JW3H 3W15B 3T1WA 1J0IA 3GNML 4B3VA 2YR3A 2Z8RA 3S34L 2EDJA 2WIIB 1C16A 3MN8A 4K94C 5GZOC 5LGHH 1MFDL 5C07D 2VERN 1D5ZB 4CQIA 1QFUL 5GRXG 1BYPA 1DEDA 4MXVE 4Z7UF 2DBLH 2XBTA 3EFOB 3NDZE 1IAKB 1CLOL 3AEBA 3KYAA 4PPTA 1KBBA 1H0DB 5ACZB 2YUWA 2WVVA 3FRPG 3S5YA 4YLCA 1XGPA 4WU5A 5GGRA 3ZTNH 43CAA 1WAPA 4M7KL 1FFOB 3H7BB 4QDGA 1Z9OA 4PYHA 5AQFB 4YR6B 1BVNP 2MQGA 1T21A 2JCCA 4L37A 5GS1C 4OI7A 4LLUA 3HKZA 3ZMVB 1OVZA 4AM0B 3FCSA 3VJ6B 3WY1A 2YAPA 4KY1L 4ODHL 4R7DB 3D85A 4G1MA 1PEZA 3T0EB 3UABA 3I75A 3KVAA 3GXMA 3QDJE 5FF6A 3DO7B 5C08D 4FQCH 2CBMA 1KFYA 4JM4H 4BCXA 1BM3H 3SEPA 3QSKB 1MMDA 1JWUB 4LHQB 3WSQH 5C2TA 4KKQA 4XPAL 3WSQL 4HJ1A 4OLYL 1JZ7A 4A7QA 4Z78A 4HCIA 5M94B 3I2CH 1JGEA 3LEXB 5I30H 4M7JH 5DO2C 3QIUD 3RY4A 2K9UA 3LSOB 1HXMA 2WMPB 3BPCB 1AKJB 1T3FA 2ADGA 4TVPL 1NBYA 1X5AA 3R19A 4ZXBB 4X6BB 3SY6A 3RPKA 3TEUA 2Y1ZA 5SV4A 1IM3A 1RZKH 1JFQH 2VDKH 3GM0A 2NW3A 2BSEA 2B1HL 4NAQA 4PI0A 2PO6D 1RZIB 4GRLA 3LS4H 1D7BA 4O2FB 3RWJB 2R23A 4H9SE 3C12A 3ECWA 1RSFA 5C0RL 5IESL 2I32A 3QORB 8FABA 2CXLA 1LEGB 2GIYA 2EHOC 1MH5A 3V4VH 2BNQB 4F7MB 3KL5A 1Z9NA 1AXTL 1E2ZA 3MUJA 4FKEA 2J6EH 4W9GC 4FXKA 3QWRA 4WWKD 3UBXI 4LF3B 1GGUA 1XNRT 1ZVNA 4AYEC 5I2IA 2XZCH 2R0LH 3TBTA 1I3VA 3VFNA 4E41E 4Y9BA 3V4VB 1A5FH 3LB6D 4H1LB 3OAYH 1KYOK 5FKPB 2AEWA 3CVDA 5PAZA 2OBGA 4FS0A 2IXQA 4Z0XA 1MNUL 1UM6H 1KDJA 4JFZH 4A2HA 4HAKA 2Y1YA 5F6IC 1CXKA 2ESVD 3T4YA 1JPFA 3BN3B 2OMYA 1CE1H 2FO4B 4POZD 2IC6A 1A4AA 3OJ2C 4UQDA 2IJ0C 2EEDA 2EXWC 3T8VA 3U78A 3ZTNL 5L2JB 1UC6A 1JDCA 3M1BB 3AY4A 4N90D 1D6EB 4W9ZA 2FX7H 1S78D 1AG6A 1L9QA 3IKCB 3SBWC 1G9NH 2ARJB 4TWDA 2XX1A 1S8DA 2WXRA 3LKNA 4WI0B 5T1MB 2VXQA 3B2UD 1CFBA 3B2MA 3NABL 4JFHD 5G55A 2IV9A 3FBZA 1EJ8A 3EFDL 2VB5A 4O58H 2Z6EA 4DUYT 2V9RA 3PQYB 4GO6B 4GRMA 1NBZA 4JQVA 3MSPA 3R84B 3T4AB 2UWEF 4JHZA 1KJ2L 2DQTH 1KGJA 2APVA 5LG4A 1X5LA 1H3VA 1ASPA 4FTVE 5C09E 5JOPD 4DKTA 3KZ8A 3SOBL 4A55A 4IOSA 3IDJB 3NZSA 4PS4H 4HIPA 1IT9L 1O6SB 5ICXB 1OQXA 1DQQB 1QSZA 4JO4L 3L4TA 3UTSD 3ASOB 5JOEA 1JDDA 4YDIL 2RD0A 4XC1L 2GTWB 2AJVL 1N0LA 3QI9A 5E56A 5AFUL 3KXFD 3B5GA 4E9TA 5EDSA 4UXNB 4BE6A 3BVNB 3NSYA 4G80A 2BHZA 5CFAA 3D39E 4PGBB 3JBG7 4DP8X 3U7YL 4AM0Q 3V0JA 2E9JA 4F7EB 4Q9RL 1EMTH 1RZ7L 1LK3L 1ZP0A 2N2NA 4EN3B 5I1DA 1TJXA 4DN4L 4NO0B 4Y16D 1U8PA 3P69A 2WWKT 4J4PD 4DETA 3L8QA 4KUCF 3WIHA 2IWFA 5DDHB 4HHAB 1AP2A 1MHPH 3KPSE 4ACPA 3PUAA 3LS4L 3BWAA 4L3FA 1JZ8A 1MWAH 4ZI8A 3G06A 4DR1T 1A6TA 5B3JF 2WHVA 2V6YA 4DK3A 1OPGL 4P1NA 1YNTB 3G5XA 4L3EA 3VRJB 2OX5B 4ZRGA 2ZF9A 3OZ9H 2WLNA 5LG3A 1L5GB 4YSUA 1WE5A 5AB0A 3QRLA 4N2NA 2XZAL 5BZDB 1MAJA 4RIRB 1G9ML 4P5TD 5HDOA 1BM7A 4HWIB 2PCFB 4YFDB 5DRNA 5DMIL 4GK5E 4R2GD 3VFTA 2VM3A 4G7VH 4KXCA 3RG1C 1SMAA 1SOSA 5HXSA 2X42A 5JQGE 2AAVA 3CSFA 3U0PB 1MCBA 4F3FA 4N85A 4DQOL 2J7LA 2XV2A 3D25A 3JTSA 3RLSA 3PNWB 5J2UE 5ENWB 4EO5A 4ODTH 2BW4A 4IIQB 3KBFA 1CT8B 1HX1B 4FFVD 4TNEA 4I2XE 2YPVL 3GEFA 2ZP9A 3CSPA 4KUCD 3PUQA 3K80A 3TZVC 1I1YB 4ZDHB 2B76A 4CC4A 3HZMB 4MA7L 3HE7B 2EKJA 5F7FA 3TESA 2PJQA 4RGNC 4KGJA 1Y6KR 1EO8H 4XVJH 1RP9A 1RUAL 3QDGE 3PJAJ 1DBJH 3PUWF 1P7KA 3DIFB 4X4XA 3CIRA 1PKQA 4KHXH 3CX2A 3HS0C 4M4RB 5EEYA 3NZPA 1YECL 5DC0A 2JIXA 2Y3NA 3ALPA 5GRVL 2IIUA 2V7NB 4C90A 4G6FD 2BVPB 1J87A 2ALWA 3OD3A 4JRLA 3K8PC 3KYOA 4N0CC 4BFBD 3FS9A 2HTKD 4ANWA 4K5NA 4HFUH 3LKRA 1KG0A 5IK3B 3RWIB 4F58L 4IOIB 2G0LA 5DRZA 3N1GC 3ZHDA 4ZNEE 3FZKB 5KWYC 2NY2C 3MRHB 3QJSB 2DF3A 3A67H 4OTXH 4PY7A 1KENH 4ZD3L 3TJEH 1OE3A 2CWOA 3C50A 1OTSD 3V2AR 2IH9A 1VFAB 3OXRB 3CVCA 3V9FA 4OV5A 4LKXB 4BFNA 3F83A 3NJMA 4DIXA 3LRKA 4PJ9B 2NLJB 5EO1B 1R3IL 3FTGB 3HUJB 1OAXL 3GIZL 1UYWH 3RIUC 4MNQD 4PY7B 1FZKB 1XF2A 2IOMA 3MRCB 3DGGB 3JYCA 3WELA 2LW3A 3QB7C 4L8CA 5IEHA 3CLWA 5EBMB 5FS5A 4HKZB 2LU3A 3DV6A 3WN5B 5FC9A 3BKCH 3VRLF 5I23A 2E7DA 2BVPA 4QX7B 2FRGP 2QSQA 3RIFK 5LVEA 4HOXA 1MRFL 4JQIH 4F1ZA 1D1AA 5DVKA 4GRLC 5AOJA 1P7KB 4RRPA 5AQVB 1XAUA 5T33H 2SEBB 4W4OC 1G7MA 1UCUA 2MMXA 3UOAB 1I1YA 1JCKA 4ZDHA 1JUFA 3ROLA 2IQAA 5GGTA 3TIDB 5IFAL 2CBOA 2AJSH 4PM1A 3VA6A 4KROD 1NKRA 4PTTB 3LK3B 1AH1A 1MCFA 2GT9A 2OMZB 5K93A 3D25B 3VDBA 2GY5A 2PETA 1PEWA 3CH1B 1FORL 1T04B 4NCDA 3T0EC 2HLEB 5KSAA 4H63V 2XJLA 1WHOA 3L7FA 4XBEH 2ADJB 2ZP0T 3IPBA 2DAVA 2BM3A 2YKLL 1WPCA 5DRNB 4JPIB 5IMOA 5MHSD 1YW0A 2EZ0C 1BQHG 2DD8H 2Y7LA 1M4KA 2IFGA 3B37A 5GGRY 1BV8A 2E0PA 4DVBB 4F2EA 2A83A 2YEVC 4KQ3L 3ZYJA 4ODXA 3SE4C 5M95B 1AVAA 4Z8XA 3MC0A 1FAIH 2JI3A 3S8GB 2OX5A 3ATEA 3C6LC 4C83B 2R0ZH 4PS7A 2XBDA 4Z23A 2H3KA 1J0KA 4M93C 2WKGA 1HU8A 1NLDL 2WB1A 5DUPH 3LQAH 4ZFOB 4E2OA 5ADPH 4JANA 3L3OC 5E03A 1JVKA 3ZE0E 4JG5A 2HJLB 1O9VA 2Q20A 5FVLA 2C4FU 5TDPB 1YEGH 1C08B 1Q9OA 4JM2C 4Y1AE 3TURA 1FSKC 3SYPA 4ELME 3AQDA 2OJ1A 2FWOB 4P23B 1KK7A 4ZUTB 2A6IB 1J8HE 4XPGL 3SPCA 1WYCA 1VEOA 3K0YA 5DJ6A 3CX6B 5L47A 1TJGH 3T3PB 1BIHA 2DLIA 3U9PH 2X1QA 4MB4A 5IT2L 2KZ1B 1L7TL 1DSFH 1H6TA 2ZNWA 2OQJA 3BVNA 3FU5A 3HR5A 5T5FA 1GVIA 5C9KA 1HS7A 4NUGL 2YD4A 4M61A 3RY6A 2ROXA 2YKKA 3ETVA 3HNTL 4GKSA 4XVSH 5AQMB 3SQBB 4LEXH 3OB0K 2YAHA 4QRRE 1YKEB 4GG8B 5CXPA 1R3IH 3CX8B 5JR9B 5JVDE 1ORSB 2K78A 4GMTH 4X8XA 1JGDB 5LB7B 4JQIA 4HCRH 4HH9B 3SQOH 2B14A 1B0GB 1O7SA 2UX7A 4S10A 5I24A 3F7KA 3L1EA 1MCIA 4RAVB 4GRWF 4UBDC 4KTEL 4XAKE 1I8LA 3OAUH 4G7VL 1C7SA 4HSCX 3FTZA 3S88H 4HJGA 1AY1L 3NFPB 4GRMB 2YXFA 4WI4A 3VD7A 5CLWA 1IKFH 2APFA 1U4EA 4AIEA 1X5IA 4PJ7A 1MY7A 2ZYIA 3MV11 1P4IH 3ZUNC 1O75A 1EHKB 4NPYB 4WI0A 5T1MA 3F62A 2EUXA 1TQCB 4GUPA 2FB4H 1D6EA 5TK4A 3RWGB 1QWNA 2P46B 1KNOB 1VHPA 4FJYA 5EOQL 2VNCA 2KT9A 1G7IB 4G7RB 2CLVB 2D8KA 3BP5B 2EDYA 4R4ND 1EHLL 2EUVA 1HOCB 1IC1A 1JOIA 1TTCA 1VCAA 4ZXLA 1RVFL 2C3HA 2PR4L 3CSYA 3RKGA 3JV4A 4TRPL 5DWPA 5FCUH 4JB9H 3WFCL 5AW6B 3OKQA 4ANUA 4BZ2L 2HPOA 4YK4B 4XB3A 5F9JB 4GUQA 1YUHA 1IBDA 2B4CL 3NEEA 2YA2A 1ZS8B 4JS7A 1U91B 2X6VA 1BLIA 3E3QC 2WY2A 4LLMB 3QI9C 4DMVA 5J9PA 3MA9A 2YD2A 4I1PA 2XOTA 1ZANH 2Q9QA 2XTJB 1DSYA 1OB1A 5A1LA 4EI5D 3IVKA 1QAWA 3WJLC 5C6PB 1SHWA 5EBLA 2X1OA 3VFUA 4BQCA 1J86A 4Y89A 5JO5B 2NW2A 3NFNB 1MH5B 3GK8L 4C4KO 1CDBA 4YSYA 2WXNA 2VAJA 5J1GA 3KWWA 3T6QC 2JTDA 2CALA 2X9YA 3HKBE 4UT9L 3O2VL 4G8GB 3RWJA 1OP5H 4H20L 1EEYA 2IOIA 4W9DC 2GYSA 2OMVA 4CA4A 1OD7A 5I26A 4RMBA 4M00A 4H9OC 3ARGD 1SN2A 2NW3B 5I1LA 2Y7MA 2GG1A 3PXLA 4MCZA 5EOTB 5HDQL 1D5RA 2BP8B 2P43B 4ZQKB 3VFUB 5ALBL 3EGDB 4IRZL 3RGLA 1RULH 3BUIA 4P49A 4HFHA 4G1EA 4P4KA 5JW4M 1NEPA 2Q9QB 5JPMA 3B9EA 1DQML 4KKAD 2F74B 2Y4SA 4DGYL 4OZIA 3CVHH 1ZS8A 1QUNB 5JMOC 1R3LA 4NQVB 4Z7UA 2NZ9C 1A4JB 3Q2VA 9CGTA 2HTLD 2VTFA 1DLHB 5L8KB 4K5LA 1PSKH 3L13A 3SDDC 5H37A 4XN1A 5HJBA 1T89A 1URIA 1N3NA 4EXPX 1IAIM 1YA5A 3QULA 1G7IA 2CO4A 3MKKA 4JDTL 4AV0A 1NCNA 1NGYB 1SFHA 1U58A 4Y1SA 3MDJA 1KXTA 5H4YA 3D85B 4G1MB 4I1NB 5FCSH 1JMXA 4CSZA 5DJ0A 3NVQA 2VDPH 4JY5L 3JUYA 4JO2L 2N7AA 3RIAK 3O6KH 1D6VH 2M8XA 5I8KL 3JWOL 4M43L 4XMZA 2XIDA 5JDLA 3F12A 3NIFE 2VJ0A 2DWEB 5C0ND 5DXWA 2WANA 3WJJC 1I7ZB 4IHBA 3QH3A 1CK0H 4Q74A 4M3HA 4XOAA 3WD5L 1K4DA 1EAJA 4GI9A 1JGVH 4RAVA 1HKLL 1YNTF 4CKVX 3EUUA 3LKSA 1KBGH 4OY9A 5E8PA 2JELL 4FULA 3RWHA 3MBXH 2EYRA 4M8VA 4AYGA 4HIJA 4X5TA 1PG7X 1TKWB 2MH4A 4P3DA 1QPPA 4HUWB 4OM0H 3V8CA 3UU5A 1GGYA 3ZPOA 3TBYB 2PWHA 3I3BA 5HPOA 3ARBC 2J1ZA 3O6ML 4PJIB 5AB1A 2P5WA 1HHIA 5J0BA 4TQHA 3UROR 5EZYE 1A3QA 2H89A 3AU1A 4I3SH 2R2BB 2ZPKH 3PXJA 1JPTL 2AXFB 2NUPA 3ES6A 5I1HH 2OJEA 1XB8A 3RNQA 1FL5B 1XEUA 1S4IA 2A6IA 1O5PA 1J5CA 5F3HA 4JFED 1KN2H 5H4ZA 3VD2A 2DH2A 2EKSA 1BBJB 2VDOH 1DZ0A 4IEFB 2QTEA 5DHEA 4OSUL 4GSQA 4E0RB 3TYGL 2W66A 5FHAL 3BW9A 2VE6B 4JRXB 1KPUB 1PBYA 4M8RA 3SKMA 3EKCA 1WFJA 1OARL 2J4WH 1W2KT 4R4BB 3RZCB 2BIHA 3C6SB 2XA3A 3UACA 3UO1L 3K5SA 4FFZL 3VU7H 5JPNA 3KJ6L 1OCCB 2QADC 1Q90A 3D3VA 4X7TA 4WHYG 4DKFL 2PPDA 4Q9QH 2XQYA 3ZLIA 4DR3T 2V0AA 1U36A 4OT1H 1Y6MR 2LSGA 5C0IB 3CFNA 1XEDA 1YJDH 3F7QA 3M8OH 2EDWA 2P47B 2VQ4A 4JPIA 4DGYH 1S7TB 3NCWA 1DDHA 3QBTB 5I1IL 1T04A 2HLFD 3EOTL 4XTRD 2G60L 1MLBB 4A98A 1MFAL 4G9FD 1OCZB 5DO2D 1YEFH 3OBAA 2IDFA 1H3UA 4YDVB 4KKRA 4FG2A 1P84J 1PVHA 1FVCB 2MQ0A 4AV4A 5I1AA 4F7CB 3TF7C 1DVUA 3D05A 4OD2B 1R5WB 1YDPA 4MRBA 4FQ1H 3B83A 1OW0C 2BK8A 3L3OA 3VFPB 3S34H 4YFSA 2N1KA 3P02A 2AE9A 1UHVA 3QUXA 5ESAA 3T2NH 1X9BA 1NUDA 4L1LA 3QXVA 4PJEB 4U2YA 2W00A 4WK0B 5EIIB 4K2UL 3RHWF 1XCTA 4UT6H 2N56A 1BD2B 4PJAE 1BGXL 3TGXA 3WHXA 5JW4N 4HUVB 3TEYA 1O3XA 2OYPA 5HJGA 4U1HB 3SYOA 2V7HA 2Y72A 2AK4E 5CUSH 3RPIB 4GW5B 3CQPA 2Z7YA 3LZQA 4R2GB 3DDGA 3CK0H 4WWKC 3K6SB 1LJMA 2DTMH 4OAWA 3ARZA 5K1VA 1A3RL 4FGMA 4H63H 4QNPE 3SCMC 4PFOA 1VSCA 3NJGA 3KXFE 2FCBA 4KOCA 3N9QA 5IP4A 5K39B 4KV5F 4R5VA 4A6YL 3H9YA 2YEQA 4HC1A 1UXSA 5BW7C 2HJKA 2WUCH 1CFNB 4JFOA 1JXFA 1DJYA 3LKRB 2JKWA 2V4LA 2AK4B 3B7RL 5FKAA 4JZOB 5LBGA 4K3DH 1RJLB 3IJYA 2EXWD 1J5DA 4YBHA 5E1GA 2PP9A 3JWOH 3NK3A 4WIQA 1GMIA 1AGCA 2W1NA 3HRZB 4K8RD 1WFDA 5CEYA 3N3EA 2DM3A 1A9VA 1L0QA 5B38A 1P5VA 5MEND 3IU3B 5DMGD 2R69A 5TF0A 2MPAH 5JPNB 4GG6E 4NCC2 3JWNH 3HBGA 5AVUB 3M17A 3O9WC 4JRFA 2ARWA 4OZFG 5DZ9A 3TBSA 3IFNH 1AJ7L 3QQ4A 5GGVY 1CT8A 4Q9QL 3L48A 4JPKH 3OLEA 5IIEB 4H0LC 4JFPB 2LTQC 4LVOC 4OFKA 2NT1A 4PS3A 5CR8A 1D9KC 3S3BB 3CQCB 1BBDL 3Q2NA 2F18A 2E5VA 4Y19E 3H37A 3L3HB 3SO3B 4FMKA 1RZGB 3L9YA 4DGVL 2PCFA 4MMZC 3FO0L 2AXFA 2J12B 3Q2LA 3GSNA 3SDDA 2OLTA 1G43A 1XCWA 3FFCB 3I9AA 3LZFL 4UINL 4TV8E 3PHOB 4Y1AD 4ZODA 4HHGA 4KGLA 1YNTA 2JB5L 4A2FA 4F7TA 4G6AD 1U8OA 3H7LA 2ZOWA 1W8NA 2FH8A 1MCHA 4MWFB 3PWUA 3IEAA 2NSQA 5BMFH 4Y4KB 5DDHA 2XWBB 4NXNT 5IBLD 1X9UA 4OGQC 1ZTXH 5DYOA 4K0KT 2PG8A 3M1CA 4EN3A 4DP1X 5I1DB 4BDVB 5F7AA 1KCUH 4OBSA 2B39A 1I8MB 3E1F1 1C5BL 2PTVA 1E67A 1JS4A 3WOVA 5KAQG 4HLZH 2K9AA 4M03A 1UH3A 4ZT1A 3QZMA 4AK1A 1CGTA 5DJ0B 4LP4A 1D5IH 4DPAX 4E42B 4Y19D 2UU9T 1FN4A 2I60L 1E9QB 2PLTA 4I3RH 4LPUA 3K6OA 1TEYA 5SX5K 3C64A 1B90A 1QPKA 3H9HB 3U2JA 1O6SA 1RSYA 4K9EC 2EDNA 5CBAA 2AXWA 3RTQD 3EBHA 5CD3B 1XF4B 1JK8B 1WC7B 2P8LA 3KJ4C 1OAYH 4I2XB 4JFXA 1TUPA 1A4JA 2X9XA 1NGZA 3QORD 1ZLWK 4NC1E 2HB0A 1TQBC 1UA6H 3QB5K 3LXUX 3FB5B 4WLCA 2G30A 5C7XL 3FOLB 5JPMB 5TE4H 3RB5A 3X12B 1S2EA 1TPXB 1RZ8B 1DBBL 1JFHA 4KZDH 1QSVA 5JHDB 4MFHA 3MMEA 1INEL 5CJOL 1IAMA 4TQIA 4Y4FC 3FNKA 4JYAT 5D6CA 3GN5A 4IU2B 3EYSH 3PJSB 4PB0L 3F31A 4FFYH 3L4XA 2BZ7A 2OSLA 3ZLQC 1RCYA 1TIUA 1FEWA 3JZ7A 3GTNA 3WLWC 4L5GA 1CD9B 4M9PA 5DZVA 1FMWA 5ALCL 3SDAC 3ULVF 5LMUT 2G9HB 1MRDH 3PG2A 3DOSB 4IGBA 1F86A 5AQ0A 3T5WA 4LVEA 4Z0XB 3PUXF 2NY2D 4F91B 4G8IA 3QA3B 4GW1A 4MD5A 4D0CB 4OLXH 5AYUH 2IBZX 2NSXA 5JHBA 3GMQA 4ETYA 1HJCA 1IGYA 1PX3A 2HT2C 2W81C 5J9PB 4V33A 1LO2H 4EIBA 4FXKB 3HC0A 4YSPA 2A3TA 5BV7C 5FO2A 4XMLL 2VRKA 3U46A 2KQNA 4P59H 2BVUA 1CG9B 2OV9A 2HFFA 4EIZC 4NKMB 3PDDA 2HVJB 2DM4A 4Y8DC 1JPSL 2JLLA 2K6WA 4U1NB 3JAFA 3RU8L 1T03H 1HNGA 5J1AB 3UERA 1ZV2A 4LQ1A 4UT7H 1UUSA 1VLXA 2LLYA 3D18B 3UJJL 5EF3A 4NZ8A 4BHUA 4B6ZA 4X6CB 3RGHA 3CVHA 4B9CA 4D9QD 4AITA 1QYGL 3MBEA 3BPCA 3KBPA 2HPLA 1DQTA 2ZKMX 4EZKA 2NCEA 4X5WB 5C07B 1XDOA 3RFZA 4I9WD 2G4EA 1HFAA 4WENB 1M7DB 3BDYH 3ZTDC 2V2WA 2HRLA 3QHFH 1WZ1H 5IB2A 5DQJB 2NXZB 3QNZA 4LSVH 5FB8A 3QNYA 3BXNB 3AT0A 3CFCH 5IMKB 3BQUB 3V0VA 3LQZA 1MCQA 3DMMA 4IDZA 3TCTA 3RQWA 1A4KA 4JZJB 5FF6B 4JAMB 1UD2A 4I0PB 2QTVA 2ZE0A 5L7XH 1ZA3A 4TULH 2IANA 3QISA 1EH9A 3R0MA 4R7DA 3ZRCC 3RIFF 1R0AH 1P7HL 5G4OA 3GTTA 1DBAL 3DOHA 2I9TA 2EDKA 2R4RH 3OKKB 4O2EB 1RIHL 2O6PA 2PWGA 5DJ6B 2IIJA 5JOFB 4I43B 1Z0MA 2YZ1A 4XWOC 2JNZA 4MBQA 2J1XA 3CFDA 1KYDA 1NCDH 3GIZH 2IDTA 2D7NA 2KS0A 4F15C 2IADB 3MR9B 5KJRL 5EEWA 3BH8A 3ZRSA 4X6DB 3P4LA 2IBZY 3SPGA 1LNUA 2W0FB 4ZD3H 3KFWX 1F90L 1MJ8H 1JJUA 1DVXA 3C2SA 1IAIL 4PJ9C 3LFMA 4KXZI 2N3JA 3GKWL 5CCKH 4PJFB 3S37H 5B4MD 2R0ZL 1DEEA 2DQHL 2Y2TA 2CO1A 4OW6A 5F88B 3W56A 1LWJA 3DX2A 1O6VA 3P8CD 2X2UA 2VLRB 1HEZA 5BRPA 4ZZCA 4TMPA 3X14A 2HN2A 4LCWD 5JTWA 5ITBH 1RIVL 3V5HB 5JHLL 2VL8A 3NABH 2Y07L 2VQFT 1XCXA 2UVEA 4HALA 4YL9A 1OWWA 1W0WB 4N8VG 4IDQA 3ENEA 2XQYK 2EINB 3BPNB 4BFRA 1BAGA 4XPHL 2DQCL 4LFBT 3OL2A 4DV4T 5AVTB 3ZTJH 3CFMA 4UNVA 3BZEA 2B77A 2UZXB 3KBTA 2F53E 2PNDA 2XTJD 1IRAY 4NLAA 5DD5H 4CVXB 1K3ZA 2HRGA 1EO7A 4YHLH 5IW3A 2A72A 3NIGB 1G6RH 2AFNA 3ET9F 3AE7A 2VXQL 2WXFA 4LCUB 1FDLL 2DEXX 3QARA 1QLRB 1FBIL 3ECBA 4NN7B 4PQXA 4QRTA 3W0WA 2UZIL 5JA9A 3WXWH 2ZSWB 4P2QA 3KLDA 1ZXKA 2IH1A 3OAZH 1UACL 4S1DC 5TFSL 3UULA 3QT2A 2ICWB 5C8JA 4LP8A 5HYJA 4HGKC 4GYRA 4X8JB 5AVQB 2XQ6A 2EO9A 3MFFB 5L88H 2NP9A 4J2XA 2GCYA 5D4JA 1IKFL 1AC0A 5LHDA 4YSAA 4Z5RA 3KGTA 2H2SC 2Q2LA 1KJMA 2DQJH 1DP0A 4AY0A 1VEPA 2VISB 3RIFA 4BEIA 2H7OA 4DUZT 4A67A 3O2DA 1ZKEA 3WYRA 1J9CT 3P50A 3FRUB 2CRBA 1ZSDB 4N5EC 2DQUL 3QUZB 2YOAA 1JV2B 4PMFA 3VWJB 1KNZA 2J5LC 3ILDA 2UUDH 4L29A 4RAUB 3FUIA 4GMTL 1J0ZA 4JKLA 1DTUA 5T1DH 4P9MH 5A2KH 5E4EB 4UAOC 3EDUA 4U1MB 1TJGL 5IT2H 2XPYA 5L4JA 1Q94A 2E9BA 4Q2ZA 1KGCD 1P5UA 2P8MA 4QXUL 4PJNA 3CPUA 4HWZA 2C7FA 3NIGE 2P8PB 4E5XA 1QI5A 3DTOA 2F8OA 4AKOA 1KWGA 1VGEH 5DD6A 1LDPH 5GGTH 3GKWH 4Y9GA 4KKAC 4IL9A 1SYSA 5ACLA 4XOBA 1HSAB 3RA7L 4OF5A 5LMNT 2VDQL 2F1AA 2J47A 1QFWH 3GNMH 5CR1A 2YPVH 1OGAD 4LK4A 3AA7B 3P4QA 3U0PA 2O4EA 4DR7T 2P5EA 3HEIB 3V4UH 2IMMA 2A6KB 3WI3A 2RR3A 1G9NL 3RI5K 4TV9E 3KJ4B 3QVAA 3C60A 3L7EB 4MJHA 5F7DA 4ZYKB 1RU9L 2MCPL 1HG5A 4HXBH 3CHQA 4L1DA 5E8OB 1II4E 5SWSA 4OFQA 4Z3IA 3UBXA 3IFLH 2NPLX 1FJGT 4DK5A 4Y2LA 2DI8A 3WIHH 4UYPA 5AOLA 1XGTB 4LLVB 2XKNB 1RUPL 3L9RA 2ZXQA 3OF6A 2XM2A 1J9SA 1J1PH 4Y88A 4NRZA 3VFRA 5EUOB 3KR3L 4HIHB 4EV6A 3AXJA 3ZMUB 4N2HA 4ZPVA 2XM1A 1MAML 3DRTA 1K4CA 3J27A 5DD1H 5TPWH 3IAQA 5C9JA 1DHKA 2W0PA 3K81A 2EH8H 1RK1A 5A2AA 2VR3A 1OTUD 2RQ8A 4Y4HD 3W11D 4D0DB 1WBYB 4NKDA 4NWTH 2WCGA 2VDPL 1YXRA 1SYVA 4JY5H 1U8QB 4GUCA 4JPVH 4OJFL 1NDGA 4JRYD 4PGBA 5M7QA 5GRYA 1EXHA 5I8KH 1GZHA 2P1YA 3P4NB 2GTWA 4NZRL 3FFDA 2C3VA 1KB9J 3Q9DA 3UYPB 3X1DA 4DVDA 1W72H 2YPKB 2YGQA 4ZMTA 1BYOA 1RMFH 2X4RB 3KPSB 2XHNA 4GFXA 4FRWA 4Z7NF 1DQLL 1Z5LA 2DMHA 4DTGH 4PRDA 5I71C 3QB5A 1PMYA 2D3NA 4IKIA 3AB0B 5DUJA 3NJFA 2Z31D 3QFDB 1IVTA 2OYMA 1F4HA 4LEOA 5FGCB 1CIUA 1MFCL 3ZL1A 2Y5QA 1RXLA 5HWYA 3MCLL 3TBVA 1KTRL 4LLAA 5T3ZL 1NBZB 1QTSA 3AXLA 3GFUA 4KK5D 3EO9L 1TT6A 4LOUD 2DH3A 4A2LA 3WY2A 3WXVL 2LTQB 4JI5T 1RULL 3D7PA 1QMUA 4FQLL 3S35H 2Z0BA 1UXWB 1NC4B 4EGWA 2ZX5A 4ICWA 4KRLB 4XPHH 5FYJD 3KJ6H 4PP2A 1A14H 3H3MA 1OGTA 1WDAA 2CCLA 5IEKA 5MP6L 3MLWH 2F1BA 4XCFL 1U8MA 3MZGB 4JFDB 2B16A 5SWSE 4JE4B 1AD0A 5GGTL 1BQHB 2YWYA 2R1XA 5FWQA 1HNYA 1BFVH 3FYEB 3LD8B 4HETA 4M1GH 2Z64C 3GZKA 3BAKA 3HG1A 3CGTA 2Y1AA 4HUKB 1RUML 2WXMA 4DPRA 1MG2C 4APQC 2RA1A 4UANA 2P52A 4B27A 2G60H 4GB9A 2WP9A 1TZOA 5JXED 1SY6L 3NH7L 4DV6T 5EC2B 3B7TA 1MNUH 3W2DL 5GS0D 1JZFA 1Z0NA 3K2KA 3LRSA 2CM0A 3TBTB 3VFNB 3W2DH 1TQTA 4ZTOL 5JZ7C 2XQ7A 4NQSA 3BFQG 1J1OL 5KZCB 3MRDA 1YJDL 4WKZB 4JB9L 3V79C 5JNYB 1KIRB 3QIBD 4KK8C 3TVMB 3VFOA 4UIMA 1A1NB 1MQKH 1OM3L 1T7YA 2CBTA 2YD7A 4A7SA 3EF7A 1L7TH 2VC2H 2Z91A 1NBQA 3K2UL 1BA9A 5FL1A 2RIKA 3D5OF 3BVXA 2JJTA 1E27B 1YZZA 2WQYA 4R5XA 5IUXA 3WFBH 3D3VE 1CDYA 3AG3B 1CD0A 4YHZH 3THML 4K7PH 4EQ3A 3CZLA 3MLSH 1HZHL 3GSVB 3EJZD 4LIQL 4IDPA 1ID2A 3A8YC 2KLRA 4URKA 4X6BA 3GSNH 4TF4A 2QEJA 3LIZH 4HGAA 1T3FB 5IB4A 5IJDC 1NJ9A 3ZCJA 1I1AC 4RGOL 4ORGA 1E7PA 5DRWA 4HSQA 4WNJA 1JXJA 1RK0B 3ARSA 4U4IA 5F8RC 3CDZA 5JHDD 4WHTA 1XMEB 4HEPG 1S7VA 2QDVA 3P2TA 5K5YA 3BUTA 3OJAA 3LEXA 4JKKA 3OXSA 1TMQA 3IGUA 3QQ3A 3S5LG 3P77B 1O9ZA 3QEQB 2DWKA 4DTGL 2ZM8A 2WINA 3H9SD 3IFLL 4QJ4B 2D0UA 1W6LA 5ITFA 4MHHI 5LGKA 3UJIH 3SOLA 3AVSA 1F45A 2ZWYA 4NKIH 4UIMB 2WU2A 1WUZA 3JC6D 3RTQB 2GIXA 2DI7A 1ID5I 3BWUF 2CBIA 1TQCC 2H26B 4BKLA 4QKXB 1ZGLA 1B2WH 2X1XR 2BJML 3HI6L 4PLJD 3SDCB 1MFBH 4NSKB 4XAXB 3ILEA 4MX7A 5D2NC 4S0TD 3GHEH 3TIEB 4E9YA 4YEFA 2WZ0A 3DPBB 4ODHH 3VFMB 4B97A 3L3KB 4FQLH 2LT3A 2WIMA 2A6DA 2UY6B 4XNXL 2KWHA 2JMKA 1LILA 2CJUH 4JO2H 5DGQA 3MREB 3MOAH 3HG1B 4NT6A 3PJLA 1SJXA 4HJ0D 1U33A 3FAXA 3HS8A 1MPAH 2VXUL 4BAYB 1M3JA 5LAPA 4U4BA 4LMQE 4PRPD 3HE7C 2X0UA 2NWBA 3V55A 4C8XA 3EFOA 4RH4A 2WCPA 2OCJA 3VSTA 1XIWA 3FB7A 1FAIL 4WDIA 4Y2DD 5HYSA 2MCMA 4M8UA 5E95B 3F00A 1TETH 3HCVA 2FJHA 2HN7A 4R3SA 3D0VA 2J2ZA 2WIIA 3T0EE 4A68A 3TCLA 2C3GA 3U0WL 5C0DA 4O2BE 2IEPA 5FA3A 4EIWA 1FLRH 1FE8L 4OZ4B 1LP9A 1XDTT 1NFDF 2C1PB 3MUGA 4CMMB 1OF2B 1VJSA 1N5AA 3CIAA 2HAZA 1AGFB 2HXAA 3NJHA 2ZWNA 4HWFA 1EJOH 1MRCL 1QEXA 2VLKD 4HUCA 2BS2A 5KSVB 3QIUC 4XP6H 5AQGB 4B3TT 2BP3A 4MZ3A 4QJ5B 4FJOA 2R9HC 3B9KA 3ME0A 3O9WB 4LLQB 2NY5H 1DBMH 3QDGA 4LNRB 4PJEE 3SDCD 5KANI 1LO0L 5DHYB