4G2AA

Crystal structure of a putative nutrient binding protein (lpg2210) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.33 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
321
structure length
321
Chain Sequence
b'NDTAVGGEGSLPIPVSQPHIKMVSELIRISGKNLNEPQMNGSWHYNCNFTFKNTLNKEVTISMAFPFPINDGNSEIALPAGQQTNVGQALVYDFLVTVNDKQVSAQRGNIAPDQNKGLYYEDAYFWKTTFPPLATVNIHHDYSTGATYDVMGYHWVRYVLKTGALWQDSSIGHTRLEVIPNTPTRLCSEIDQKADYLNPTPSGMSISGSRADRKYIWDLRHFQPQADLSLCLFTGISYVRYKVIYPWLNSDDALSKLARLSNKELRFLRNTIYAQYGRQFQSPDLQEYFSKKWWYVPNPDYSDRMLNEEDKKLLSMINQAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (lpg2210) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 2.33 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Structural genomics, unknown function
total genus 77
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13308 YARHG YARHG domain
A PF14415 DUF4424 Domain of unknown function (DUF4424)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1690 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4g2aA02
2.60.40.3680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g2aA01
4G2AA
chains in the Genus database with same CATH superfamily
1QMUA 1YHPA 3AROA 3STLA 2QDVA 1L9PA 3QNFA 1F00I 4ZNEE 5GRWA 1F90L 1U91B 4QOKD 3QB5A 1S2EA 5DI8B 4ENEC 4L3FA 4MVBC 5DZNA 1CDIA 2ZKYA 4UT6L 2HT4D 3FRUA 4MD5B 2UY7B 3IDNB 1KGJA 4CVWA 3FT1A 3M88A 3ES6A 4F7CB 3T0XA 3BN9C 2VDPB 3BZ5A 3CIAA 2AQRA 1GGIL 5AOMA 4GQ9L 2YSTA 3L3IB 3OB8A 1N59B 3I75B 3N9MA 5ID1B 4KROB 5GS1B 4YDZA 5CGTA 4P04A 4GXUM 3QYNA 3FHEA 4WI3A 1UURA 2R1WB 2EH8L 3KXFD 4M4RB 4KNSA 4NNPL 3TLVA 4JGUA 5K9QI 2A1WL 3GMNB 3WXVH 3HG1D 5FV1L 1KGUA 2E7DA 4CN6A 2F58L 4PJGA 1DVSA 1ED3A 1TG8A 2EC9U 3ZRSA 4I77H 1ADQL 4A6YH 1CVRA 2BY3A 2YD8A 3T77B 3TIEB 4LU5H 4M4PA 3HAEG 4AVIA 1HINL 2BC4B 4LHJB 3OJMB 2XQ7A 4M6MH 5EO0A 1FIGH 1A7PL 2D2OA 5IOPA 3AVRA 5C09D 2CRBA 5IJDC 1AR1D 4KPHL 1UH4A 4UQAA 3L95A 4JO3L 1S7SB 2LU3A 2PO6A 1SLWA 3RUGA 1ACCA 3RZCB 3LEYH 1MQ8A 5H35B 5HXRA 5L3EB 2XOTA 3D4GA 3B3BA 3SDAA 3UZVB 4XVSL 4YR6B 5CLYA 2DF3A 3X3GH 2CDFB 4NYLA 1MCEA 4PW9A 1ZHLA 2X4NB 4ZAKB 5I75B 3FF8A 2IBBA 2UXVA 4HA1A 3S97C 1WC7A 4X9YA 3Q5YA 3D85A 2VZUA 5LQBL 2QRXA 1LMKA 2JKWA 4AQFA 2KNDA 1EUTA 1V8HA 3FN3A 2DWEB 2X2HA 2C3HA 3MV7A 5E6IC 1MG2C 3CZGA 3FMGH 1AQHA 3H0TA 3BAXA 1CICD 3VWKB 1KTCA 1X5GA 5C0DA 3IMBA 2J12B 4KI5D 3KWUA 4M9OA 4FQ2H 4AEHH 1ZHKA 3MLTB 1AD0B 2VLJE 3Q2NA 3A4EA 5J13B 3EGXB 2XTJB 2E9XA 5BS0A 4OQTH 1XCQA 2WAUA 3CU7A 4KRNA 2L3LA 2BOCB 5C0DB 1EMTH 1OTSD 3ESOA 1RZGB 3BI9X 4M6NL 4NKIL 3OAWA 2OTPA 4LASH 3LQMA 2YPLA 3SQBA 1CD1A 1AVAA 4FCHA 3ZDXF 2CUMA 4X83A 2CHZA 4G7YL 3U4KA 2WCPA 3AA7B 3QRGH 3GXFA 1SHSA 1WT5A 2J57A 3QHZH 5D6CB 3V0WL 1KDIA 1DR9A 4JEUB 4HS6A 4F1ZA 1B3JA 4PJGF 4NJAL 4XI5C 4HS3A 5JDSA 1D0ZA 4JFSA 3JV5A 3O2WL 2WVSA 5CJQL 5EO9A 4FABL 1AQMA 1E90A 4J7RA 3IAPA 1L5GA 5H37A 3TJPA 4IRJB 1X5LA 3U46B 5I1KH 5I8CA 3ZQ9A 4KKLC 1IAOA 5LB1A 3T9WA 1KGCE 3OV6A 3S8GB 1K3ZA 1FYTD 4E9VA 2IALB 4WWNA 2VTFA 1E4WH 2NDFA 3ARYA 2FB4L 4TNWK 2HP4A 3FTVA 4TRPH 1U8HB 2GITA 4WNQB 3KV4A 4JY4B 5D1QB 2B9BA 4KXZI 1KPUA 5FC9A 5TFSH 1BEYL 2ZG2A 3RUGF 1U3JA 3SBWC 1UKQA 3SKOB 3M86A 3ZYMA 2HVJB 4LLMA 4GY4A 4KXDA 4DP7X 4CVZB 5IROA 5EK3A 2NCMA 2GY5A 3GC3A 4HCRH 4YC2B 2EHOD 5GJTH 5EDXA 3P2TA 4F7EB 4UILH 1S7XA 2ICCA 3VRLE 2D9DA 4QYAA 4KUCF 1YY9C 5DQDL 1RZKC 2BCKA 4L29B 2A77L 1KTKE 3CMGA 1U8QB 2BSED 1EXUA 1ZTXE 3ATEA 5FB8A 2FO1A 2JMHA 5B1CA 5TE7L 2VDKL 1NDGB 1NINA 1AQDB 2DQIH 2H32A 3D12B 4WV1C 3RDTB 1UKTA 2FT7A 1TCMA 4PI2A 4FULA 1VDGA 1DVYA 3LPOA 2YFNA 3Q5TA 2FTAA 2AJ3B 4NCC1 2CO7B 5JOPD 2QGSA 5EULV 1RIVL 3E8UL 5LUMA 2BVOB 2O6CA 3GIVB 4P4RB 5D55A 1XCTB 2UVEA 2O6FA 2YKLH 1TZGL 4MFRA 4K3HA 1UWFA 4YGVB 3INUH 1EAPA 3LNGA 2B1EA 5HGBB 4O02H 1ZWIB 3IKCB 1M7UA 2VSKB 4JPWL 2O6PA 2V3FA 3KE0A 4U3CA 4C47A 4EUPB 1WTGT 2VM4A 2DI9A 1NBZB 3M17B 3CVCA 5B8CC 1HNGA 2P46B 4Y2DB 2HWZH 4CC4C 3UG4A 5F1NB 3ESUF 2RCSH 1BPVA 4WKZB 2X3AA 3ZT7A 2Y7SA 1FO0H 2B1AL 4X62T 4ZBJA 2B77A 4JN1H 4PS4H 5FUCE 5L4FA 3DHUA 4F2FA 2BIIA 5EH1A 3WUWB 3KV6A 4HC1L 1NCDH 3IVKB 3D30A 3GMMA 4DOHB 1NBYA 1NGYB 4UZGA 3T3PB 3MRNB 2ZG1A 1DBKH 4P4KB 3S5LG 2WBJC 4AH2B 1DANT 2R1YB 3O6MH 4NSKB 3O6KH 4WK2B 3FO9A 3NN8A 3WJJC 4QY8A 1R3IH 4R84A 4CADA 4CI1B 2EE9A 1DFBH 3EJSA 3ZE2B 4NUGL 1GH7A 5E6ID 1RK0A 3RY6C 3ZMEA 5DLLA 4ALAL 2MTAA 2DQCL 4NWUL 4P9ML 3WY1A 5AQNB 5KZCB 1HWHB 4XPTH 3RG1C 3NP4A 3PWPB 1OF2A 3QW9A 2R2HB 4KTDH 3H3MA 3ANWA 3ETBJ 4YDJA 1PX8A 3FAWA 1CZ8L 4DNLA 2JTDA 4DN4L 2PNDA 1OCWH 2P49B 1U4QA 2WQUA 1M71B 3F00A 3DRTB 1S78D 2WSPA 1GIGL 2J56A 2BP0B 2CBPA 3RQWA 3IGAB 4FQ1H 3RKDC 4DEUA 4ECNA 5FFLA 3QEUB 4LAQL 4EIZC 4JY5H 1MMGA 2ZMAA 1G4MA 1QD0A 4G9FD 3M3ZB 2E59A 3Q5DA 4IMLB 1PAMA 3A67L 1F45A 3QWRD 5DLML 3TO4B 3SOLA 2BVYA 5LGJB 1JPTH 1N34T 3B9KB 4FHJA 2I7OA 3O45A 1XGTA 4JEGB 4PJ9C 3OKMA 5CXPA 3PABB 4L3ED 5ICZA 5HYSG 4ZUUA 3FUJA 1WBXA 3GMOA 4FLRA 2QHRH 4MXVF 2VL5A 3U83A 5ETWA 2WGNB 1SXBA 3BEVB 4IE7A 1DBAL 4KKLD 3U7YL 3L3DA 5AVTB 2CKBL 4XCCH 4JI6T 2WNXA 2QA7A 2QQKL 3EO9H 1URZA 3EYQC 1L0VA 1N9PA 1ZY9A 4OD1H 2WKLA 5GGTH 1HSBB 3QXDB 3S8WA 1F58L 5CHNB 4ZW8A 1IBHA 1QR1A 2HUEA 5FYKU 3FONA 3HN8A 5DK0A 2AMUA 3UROR 4L5GA 2VCOA 1J05B 2EVFA 3PHQA 1BZ7B 5KW9H 4A55A 3H3BC 1S7VB 1LP9A 1IMHC 3SGDI 4BSJA 4HIHA 3LD8C 4Y4FC 1KIRA 3IGFA 3K8KA 5IV2A 4HWEL 1H15B 3WY4A 1J1OL 4PRPD 2ADYA 1LVFA 5MHSE 3GSVB 3ABMB 2VH5L 3PPSA 1OB0A 1WCBB 1IGTB 5DD3L 3UTZA 2Y6XA 2J55A 1KBBA 5IVOA 3V4PL 4YDVA 3EAMA 4GIPD 3HC0A 4M62L 4OM1H 3RU8L 4PJIA 1S3KH 1JZ5A 3GJFK 3DX9B 4LCWB 5HDQH 5DRWB 3MNVB 4XBFB 1XVSA 3ZOAA 5E6ZA 5C7XH 4NBXB 1MMDA 4G6MH 5CFAA 2O30A 3ROOB 3WFEH 3DVIA 5DJDB 1DBBL 4EZ4A 4M6AA 5AW9B 3RAJL 5IR1A 3QYMA 1U8PB 2PPFA 2ZWNA 3L3OB 2GTWB 3FCUB 4JKNA 4QXWA 3NT0A 4NQXA 1KC5H 1BHGA 2K8MA 4Y0GA 3SDXA 1BWWA 3LDQB 1UB6B 3KPSA 3OKYA 4GFXA 1DQJB 3QJUB 1BX2B 1KPRB 3BPOC 3KYNB 2VDMB 3CPLB 2C1PB 5L2KD 1YC8A 4ZODA 2IWFA 3W1ZA 5JYLA 3QCTL 4BFEA 3DJSA 4ES8A 3GXPA 4XMPL 4IBLT 2YUZA 4FX5A 1FZJB 4XNXH 1VENA 5HP5A 3AU1A 2GEEA 4WHTB 1FF5A 4OCYL 3WY2A 1QR4A 5E2JA 4W81A 3SKJH 4B6XA 3MPCA 4JPVL 2EH7H 5KVFL 3T0EC 5T3XE 1DP0A 5KSAC 5T3ZE 4M3KB 5EU3A 3GBLA 4FFZA 3DX2A 3UU6A 2LSGA 3JVGA 3FQRB 5F7EH 2Q2EB 5CZRA 1LVEA 3E6FA 3VXSA 1GZQB 2GEQA 2XRAL 3DHJA 4HH8A 4M03A 5JPMA 3VXRE 4OFKA 3C98B 2V9UA 1D5MB 3MI6A 2HH0L 4Z0BH 5D1XD 3GO1L 5I23A 1QKZH 4NO5A 3BVUA 1V3MA 3L17A 3W56A 1SUMB 1VOMA 2R69H 2RQ8A 2VR3A 2K4AA 1I8IA 1UG9A 4X8JA 1P4BH 3WFBL 4FI7A 1IC7L 1I9RL 3TA3C 4KDTC 4XPHL 5BV7H 1LP9F 1A25A 4E41A 1RUML 4N22A 4L1LA 3RKDD 3IGUA 2PPAA 5KBMA 4Y16A 4P5KA 5KSBA 3Q43A 1GJIA 4Z1PA 3LRKA 4G6FD 2BLFA 1PZCA 4K3JL 3II2A 4XP4L 1MDTA 3V6ZA 2HZHA 3LNDA 4P9HH 4R97B 2EXYC 4PJIF 3IJYA 2IC2A 5C9KA 4QOKA 3PDGA 4PJ9D 3ES6B 3L2MA 1ZGLP 4CMMA 2D7MA 5FYLE 1Y6MR 1J48A 3AREC 2VC2H 1MIEH 3ZL4L 4D3CL 4PW8A 4KKRA 1TXKA 3AG2B 3OLEA 4PGZA 2XBDA 3BUYA 5E1IA 2P1YA 1OD9A 3AUWB 4QT5A 5EZIL 1ET5A 4K07A 1HQRA 3SDXF 4MTMA 3QUGA 1OCRB 2P24B 4FXGA 1X7TA 1Q72H 3G08A 4IBUA 3GWHA 3FTXA 4PJGB 3K3NA 1BBJA 1ED3B 1DE4A 1SF3A 1FLRH 5FS5A 3NJXA 4TPRL 3FC8A 4ZSOA 5F9DC 2CD0A 3X1GA 4X5RA 5CEZH 3KLDA 1CK0H 1MCFA 4P2AA 5HVHC 1SEQL 4Y4FD 5EO0B 1A7QH 1CXIA 4NBZB 4HIPA 4ZI7E 1XDOA 3O4LD 1QSDA 3PQYD 4TVUA 2IDQA 5FECA 2PO6B 4KVCH 3RUGB 1DBML 1BXAA 1X5AA 4N68A 5C09A 3S98A 1EAOA 1J88A 1AO7D 1RZKL 2Z93A 1TJGL 4IKKA 2NQCA 1VPOL 3SDAB 4XO3A 3US9A 4ZEYA 3AA1B 1OE2A 3RKGA 2XN1A 3S35L 4WU5A 1JI1A 4NYLB 2WXGA 5C1MB 5AAMC 1WLHA 1ZHLB 1D5IH 3BFOA 3VFWA 1WC7B 5IB5A 3D85B 1KFGA 5C0GB 4NIQA 2HFFA 3TTYA 2VJXA 4YDNA 4O51B 1ZANH 1M7XA 3QUYC 4UQIM 3INOA 5D93C 4P1NA 1DCLA 2DZEA 2B76A 2NUPA 2RTTA 1XSKA 3H0TB 4YHMH 3SY0A 2CK0H 3TNMA 4A2HA 3EJQA 4ODSH 1N0XL 5F1IB 1WCQA 1PW3A 2MOQA 3ARDC 1E4HA 3HNVL 4HJGB 4UIGA 4M00A 3ZN6A 5I19L 2QBWA 2ZM8A 2BSBA 3NJJA 3ZZLA 1ZHKB 3K6DA 1CICA 2ZXGA 2E9XB 4QCIA 5BS0B 1QBBA 1XCQB 4LLAA 3VI4E 5J5EA 4UTCA 3LMJH 3QA3A 4XVJH 4JFDE 5ADPL 1M53A 2AK1L 3QJXA 4ZTOL 1SBSL 4KQ4H 3TPKA 1S9VA 1KB9K 3WIHH 3D0AA 2PPEA 4AQZA 1H6TA 3T0ED 1F1AA 2YPLB 5I82A 3ULUL 2XWRA 3AG1B 5DJ6A 5MEQA 3GN5A 1CD1B 2BIPA 4UM9D 5FGRA 1EJOH 3DARA 4WUUE 3SO3C 1JDDA 5JMRA 2EQDA 1F02I 2F8VA 3MRKA 4IRSC 2IQ9H 3NIGE 1YC7A 4OCXH 1G7MA 4HS6B 3UYRH 2YOEA 1QEWA 4DGUA 3GF8A 3ALPA 1SYVA 2VO5A 4HS3B 5JDSB 3ILEA 3DUHA 2BHYA 1CUNA 5EO9B 4G8AC 2XQYA 3SOTA 5I8KL 1L5GB 2VXTL 3KPRE 1IAOB 1OM9A 3BVDB 3P11L 2BSTA 3DHMA 3TA3D 3VRAA 1USZA 1XNQT 1X4XA 4Z7UE 3UCQA 3M8OH 4UIMA 1CD8A 3TM6A 3OXRA 4NZTH 3E2HC 2ZG3A 4TUOB 2GITB 2OP4L 5IJVA 2IANA 5ANME 1FYTA 1JP5A 1KPUB 4GUQA 3MK7C 1VRSA 2ID5A 4F7TA 3DYMA 5JTWA 4A7UA 4LLMB 2C26A 1SJHA 3GSUA 1LQSR 3DO3A 3KR3H 1SMAA 3V4VL 2X6MA 4TSAH 1BQKA 5FKYA 2GYSA 5L6YH 4RFNB 3DXAD 1UYWH 1CGWA 4AC2A 1S7XB 5GZNC 1W09A 2O61A 1IFHH 5IW1B 4JJ5A 1BAFL 2BCKB 3MJ9L 1VFUA 1IIIA 2EHOA 3DOHA 1EXUB 2ITCB 4W68A 4X6DE 5H2BA 2MCG1 4N0UE 3ASWA 3RWJA 3V4PA 5KVGH 5L8LB 5FB8B 4NZUL 4ZRGA 5BUAA 2CRYA 1QLEL 2H7WA 3WNOA 2H32B 4JB9H 2BSEA 4MYWB 4YDLC 1RUPL 4GBXC 4Y5YA 5AQJB 3IYLW 4GKNA 4JFYA 1V3KA 1N6VA 1ZPLA 2N1GA 2PCFA 1WYBA 9CGTA 2LOPA 3O1JA 5JQ6H 4GG8B 4AW4A 1FPTL 2UXNB 4DKAA 1RZFL 1FG2A 3EJUA 4DV1T 1JOIA 1EAPB 4R96A 1P4IL 2X6UA 3HG3A 2AC0A 2HRHA 5EIIA 6TAAA 3O8XC 4JFOA 4WI9A 1OSYA 1QSZA 2G3MA 2QVTA 3IFPA 1RK7A 3V0GA 2ZLYA 5IFAH 3PUQA 1KWKA 1JNNL 4OJEH 3K5SA 3MLXL 3BRDA 1PIFA 5KX5E 3QP3A 4EXKA 4Q74A 1GAFL 3BK9A 2F54E 3BUDA 4WO4C 1LDPH 4Q4IA 1ZA6A 4N0RA 2Q5BA 1A4AA 2MPAL 3PWJA 1D0XA 1QBLH 2CM5A 4KTGA 2V2WA 1PS3A 3GSNA 4X7CC 4YS4A 3CAFA 4S1RH 4F57L 2R9HC 3KBUA 2NCEA 4QXGH 5ACLA 4ONFL 4D9RE 1Z9MA 2F5BL 5KVDL 4ENZA 3GMMB 1NBYB 2C4XA 4KHTH 4BA9A 3NEXA 2NXYC 4WI0A 3V5KA 1HEZA 1BR2A 1KTLA 3NN8B 3RHWK 2VW7A 1M42A 1CFVH 4BFKA 4BK4A 4NXSA 4CADB 2XHEB 2YSSA 4APQC 1RK0B 3LDBC 3BAWA 3K71B 4OF5A 3D9AH 1PLBA 3S5ZA 3OMAB 2NXZD 5LGUB 3PRZA 3CFKA 3PGFH 4W9EC 3P54A 3V5SA 2B15A 3KPMA 1KBGL 4DGYL 1OF2B 5I1JL 1DVXA 3C2SA 5E6IA 2Q8AH 3P8CD 3ANWB 3JYCA 4LP5A 4GAFB 1BZEA 4TKWA 4YDJB 3QUMH 2P44B 3NUKA 2XACC 5K1VA 2YJQA 3M1OA 3RX5A 1HOEA 2YHGA 2KXPB 3ZHDA 3O3DA 4XP5H 2QVMA 5HXHA 2Z35A 3H3AA 4DKFH 2L8AA 4JO4L 3PP4H 1KGCD 1RMFL 4R3SA 4WTWA 5E0OA 2PWHA 2WC7A 2J2ZA 2VWEE 4K5MA 4QAWA 5F96H 3C08L 3W2DH 3WUZA 3HS0C 3MACH 1HNFA 4NZJA 2QJDA 2P3YA 3LBXA 5D1ZD 2J73A 1KENH 5HJGA 5IEKA 5JW4R 4PRBA 3X1FA 1FZMA 1IAIH 1E43A 2H1PH 4G9FA 3SYPA 3O45B 1JXFA 2X9XA 4PJCA 4ZYKB 1XGTB 1XGRA 3OKMB 3UGEA 3QWRA 4PJEE 3L48A 2R7EA 5ICZB 2VWAA 1KB5A 3O2VL 4ZUUB 5BVJA 1CWVA 1WBXB 3GMOB 4X7SL 2TRYA 2VL5B 4HJ0D 4Z7AA 2HJKA 3T08A 4K71B 3MJWA 5IEHA 4L3EA 1RIHL 1M3JA 1ZVHA 1EHLL 4R2GD 2L04A 3FYIB 2VDQB 3I6SA 3NFPA 3L3DB 2ZXBA 1W72A 1SBBA 3DRQB 1FIEA 4EGWA 1F86A 3A5XA 3K4AA 4PLOB 3UT5E 1BCIA 1IFGA 3VFSA 3EOBA 1GRWA 3VGFA 5FCUL 4ANWA 4NJ9L 1T0NA 1QR1B 5C0AD 3RGBA 2TAAA 5IF0A 3FONB 1IM3A 1AZNA 4Y19A 3T8XA 5DK0B 3V4LA 3KYOA 1PSKH 3PWNA 3TT1L 2CMRL 5AVWB 5BO1H 3IK2A 3QQXA 5HGHA 3F7KA 1LP9B 1MCWM 4PK6A 1E9OA 1MJ8H 3HNTH 4HIHB 3SBWA 4G42A 4UMGA 3V0VA 5IV2B 1H3PL 1MN4A 3MLZH 2AEWA 3B37A 3LQAH 3K6OA 3LH2H 1ZK9A 1B3IA 5A3ID 3K46A 3UTZB 3O3AA 1CTNA 3CN4A 4YDVB 3HC0B 4PJIB 4OM0L 3FTYA 2ZXQA 1GY1A 1CMOA 3PE0A 3QEQE 2ZWSA 4OGQC 2OBGA 5LBMA 3D09A 5C0FA 4H40A 1FNSL 1B4JL 3ZTJG 2QFRA 3JC6C 1FLTX 4WEUD 3P02A 3U1QA 2D73A 5IR1B 3O3EA 5IQ7H 4TNFA 4G70B 3I2CL 4A68A 2EVGA 3DV4A 3CFDA 4NQXB 5DVKA 4PBDA 1E7UA 5BZZA 1A3QA 1NIEA 1DQTA 3SDXB 1HKFA 2N7BA 3KPSB 4GRMA 4QMEA 3AECA 4YOKA 4AIOA 4RWYL 1MWOA 2L9QA 5E0FA 1ORQA 1GOFA 2ALWA 2X2IA 3O9XA 2JKJA 2DLGA 4G2AA 2ED8A 5B8CA 2XPKA 2Z0BA 3PE9A 3EHBC 4PJCF 2ESVA 1L7TH 3AU1B 4MDIA 4OCLC 5DQ9A 5L2KA 1EHAA 5EOQL 2OK0H 2Y36H 4U0RB 2V5CA 4FQLL 5CEYA 2YEVB 3JTTA 4CXYA 4MZ2A 4RNRA 1M1SA 2G75A 4NCDA 5EU3B 4K2UH 1YECH 3NJNA 3M1BA 3TYFA 1INDL 4JW3A 2DPKA 5LBSL 3CU1A 4Q6KA 1XXDC 2W9DH 4U74A 3E6FB 3VXSB 1YQ3A 4FZ8L 4AE0A 3RPIA 1NLDH 5JPMB 1ACXA 2C9VA 2VZ3A 3EJPA 4J27A 1WD9A 4YK4C 3WJJA 2HLFD 2QMJA 5D72H 1UCBL 3K4DA 4JFZH 1MLBA 4ZS7H 1TEGA 3GB7A 5HI5D 5JH7E 4NO5B 3RWHB 1VEPA 2HFEA 4U7IA 4ZXLA 4M7JH 1FMVA 5B1KA 5GZOD 3CXHJ 5D1XA 1FI8C 1I8IB 4X8JB 2YN6A 4FNRA 4HPYH 1U58A 3OPZL 5E03A 1WFUA 1KWGA 4E41B 1GL4B 3O6FD 4HYTB 4UT9H 2WQYA 1Q4NX 2F19L 4TVPE 3B3IA 4Y16B 4XN9A 1FN4A 4JHZA 3NWIA 4JUYA 4P5KB 4C90A 5SWQA 5K5YA 1D6VH 5KSBB 2CLYC 5AVVB 4X8GA 1IGCL 3Q6FA 4PJHA 4BFJA 4DAGH 2J25A 3VQLA 3V4VA 5DVNA 2VQFT 3VXUD 1GGCL 1R5IA 3MRFA 2DTSA 4N0CD 4QOKB 4CMMB 2F7QA 4NBYB 3WNPA 1NMCB 3ZZSA 4EXPX 3H9SE 1KOAA 3KW7A 5EV7A 2G3NA 4QUOA 1EHXA 3RWHA 5I1EL 1BMGA 4LIQE 1QO3A 2Q10A 4DR2T 3VU1A 4MB1A 4PJ9A 4J2XA 2BY0A 4LSRH 2ZT9C 1SUJA 3JZYA 3BUYB 5DEJA 3VX1A 4POYA 5MHSD 1KJ2A 4DP6X 15C8L 4RFEA 4J12A 1HQRB 2JMKA 5I0DA 4FXGB 4CSSA 4EUPG 3D39A 2Y7QA 3G08B 1LHZA 5KVFE 5I6KA 2IH8A 3K3QC 3PLYA 3VSQA 1DJWA 4FGMA 3IS1X 3CBKB 3FUEA 1BBJB 2VLME 3DC0A 1DE4B 3CTTA 3JWNG 1OK0A 4KRPC 2H2SD 4POZC 1BQLL 5JDGA 2MCPL 2G0LA 3WUWG 3EJYD 1CDYA 2IPKB 2VXSH 4E5XG 2W67A 2XWEA 3WLWC 1ETB1 3RKOA 1NH6A 5HDRA 3WKMH 2CPUA 3CHQA 3U9UA 3KJ6L 4U1MB 3GK8H 4Y4FA 4B9ZA 1T66C 3G04A 3QORB 4I85A 3B9EA 3ZZ1A 4XNZC 1TTBA 5C09B 1TF4A 4YHOH 1E6OH 1AR1B 4O4LE 2Z93B 3O4LA 4Y1AE 1DJIA 3PQYA 4XZUA 4S11A 4OR1A 1KN4H 1OSPL 4X4ME 3CZKA 5FWQA 4R8WL 2CA4A 2VDOH 2J62A 3CNKA 4WU5B 4B9GA 1AO7A 1QFWM 3NFSL 4JZNA 2VW6A 3KM2A 3CFCH 2FX7L 4FNPA 3CZNA 3EJJX 5T3XD 3VFWB 1QUUA 1Q9KA 2FHFA 5IB5B 4OCWH 5T3ZD 2HFFB 2CEAA 2X4OA 4LRIC 3MLRL 4LO9A 4OLXH 3EYFA 1ZEAL 3R4RA 4Z7WE 5AW8B 3P9MB 3SY0B 3Q1SH 4LSDA 3TNMB 3BISA 4IGBC 1MXGA 5BZDA 3GD1C 3ETBF 4YHJA 4HEAA 3F31A 4MJIB 3AAAB 3VSTA 2X0VA 4EQ2A 1ZLVH 5BJTA 1FA4A 4PJHF 1CXEA 1CICB 2DD8L 1GGUA 1H3XA 4QCIB 3RVVD 2HLEB 3AEDA 3VFNA 4PTTA 3QA3B 3DYOA 2NY0D 2PW2A 3WCYA 1UWGL 1S9VB 2BBJA 1Z3GH 4QPEA 5FFOA 1J8HE 2E9WA 2JMRA 3ZHFA 43CAA 4OFPA 5MEQB 5DJ6B 2NY5C 3GN5B 1NPUA 2FH8A 4WNKA 1BREA 1BQ5A 3NJFA 2VQUA 5AW2B 3VGBA 3MA7A 5JIQA 1GZPA 4YSAA 1MFCH 4X7FC 1WD8A 1JXGA 5D7JC 3MRKB 3S3BB 3T0EA 2APVA 1G7MB 4UM9A 1QEWB 2E7BA 4ZMYA 3CFNA 3ESLA 3PXLA 2FO8A 3C2AH 2Z34A 5EEVA 3SYAA 2XWCA 4HN9A 2D5UA 1FBIH 3D4YA 2HYMA 4TYUA 4Z18A 1E6JH 3WXVL 2BSTB 1KXHA 1UHVA 3OF6D 2KKQA 4HE8A 4OLUH 3Q05A 1KB9J 4PJDE 3V0AC 5G4OA 4UIMB 4PWFA 3IHRA 1EGJA 3OXRB 4I77L 3KDPB 4DT2A 4RDBA 2JXMA 5IJVB 3TA3A 1SFHA 3HI2A 2EABA 2IANB 2OV0A 1FYTB 1G0XA 4KDTA 4XO4A 2CE6A 1J87A 4F7TB 2GJZB 2YLKA 3BIBX 3GSUB 3QO1A 4M6ML 3VD2A 1FIGL 1EVUA 1ECYA 3HZMA 4K7PY 5FY0A 3AEGA 3KLAA 4PBVC 2O61B 2YGNA 3FQTA 4LLQA 1HDMA 3QI9D 4DPBX 2EHOB 2VKDA 2DQTH 5H2BB 3BWSA 2P80D 3GQFA 1BW8A 3RWJB 3V4PB 3LEYL 4AV4A 3SJVD 3DXAA 4BINA 2ZCKL 1QSVA 2IXQA 5IUXA 3LEVH 3M46A 1J7VR 4UINH 5IWAT 4HWIB 3ULVE 2PUQT 4DR3T 3NTCH 4RAVA 4Y5YB 4H8WC 4QRPE 4GKNB 3X3GL 4JFYB 1E42A 5F7UA 2PCFB 4FLOA 2YEZA 3ULUE 4OGAD 3T2NH 3A6OA 3VRBA 4NQVA 1WLXA 1KY7A 1PJ9A 2YQ3A 4PRIA 5ITFA 5LCYA 4HEPA 1FG2B 2YRBA 1I1RA 3FMGL 1XF5A 2Y1VA 4R96B 3F2EA 3T8VA 3S2AA 5CLWA 3L81A 3DMMC 1T04A 3IN2A 5FKAA 2LKHA 5BV7C 2NQ3A 1X5HA 5KAQF 3C50A 2F74A 2G30A 4FQ2L 3IFPB 1RAMA 1JZEA 3KWTA 4OQTL 5DR5L 4DEPC 5J7CC 1OSZA 5J06A 4NZDA 5BOZG 2ZPKH 1ZA6B 3PWJB 2MIZA 3Q3GA 1RZJH 4K3DL 2JIWA 3CX6B 5F6IC 3CCHA 4MNGB 2V2WB 1SEBA 3GSNB 4P9HC 2AEOA 1L7IH 4LASL 5IREA 3LB6D 2Y9RT 4JFDD 2MQGA 3CC1A 3R1GH 5EZPA 1WSST 1BVLA 1QSEE 3DO4A 3QRGL 4WI0B 1HEZB 3LSVA 3B43A 1I85C 4WO0A 4YH6A 3QHZL 5FGBA 3ZTDC 1KTLB 1MKFA 4NKOA 4MQXD 4WAFA 3N44F 1S94A 3QXAA 2HMIC 2YSSB 4WUUD 2J4GA 2A2FX 2VIRA 1JCVA 3GXTA 3F84A 1BZ9A 2D0UA 3CFKB 4XP9H 2X4QB 3KPMB 3RB7A 3TBWA 3O4XE 4YLCA 3G7TA 5I1KL 5E6IB 5LNGA 2VM3A 2YIHA 3APNA 4WTZG 4GXFA 4J3OD 3B7YA 3O3DB 2Z35B 5LN4A 5M7QA 4HWDA 3KPRD 1Y1UA 4TRPL 4R3SB 3EHZA 3NK3A 3UULA 2J2ZB 7TAAA 1ZLVK 1CG9A 5TFSL 1WFMA 4L4TD 1M7IA 3M7FB 2BWDA 4MZ3A 3LBXB 1I8AA 2V8LA 3NEOA 2I26N 4NC1E 3TIDA 4HCRL 4PRBB 1FZMB 1T22A 5GJTL 3W57A 2FSDA 2V7NA 5HEJA 4G9FB 3KYMA 1WYCA 4PJCB 4ZOLE 4LHUG 1XGRB 2QGCA 3CX5K 5HD8D 1FFPA 1SHZC 1MCWW 1XX9C 3NRFA 1KB5B 3D69A 4GP8B 5BVJB 1HR0T 1IAKA 1SLUA 1RUKL 5I8EA 3P4PA 4IRSA 5IEHB 3D50A 3CSPA 4QTFA 4JKPH 4L3EB 2HTLC 4OK0A 3SIKA 2DQIL 4ZOBA 2VDRB 3NFPB 3QFJE 3N2OA 1W72B 2N1TE 3DIDA 4MA7H 4P2RE 1HX8A 1HJCA 1BYNA 5A2FA 4BCYA 1V55B 2YKLL 1JGIA 3EOBB 3FTGA 1U8CB 1T0NB 5C2TA 3INUL 2GK9A 4W9JC 4XCEA 1KGIA 5EC2A 2D9CA 5IF0B 1CLOH 4LDOB 2Q2LA 4O02L 1IM3B 2E86A 4Y19B 4N24A 3T8XB 2XWZA 5LXGH 1OP9A 3KYOB 4BKSC 1IJ6A 4LVOC 2ZKWA 3DGDA 3RIUC 5DMJB 3VMOA 2GHWB 5C0AA 3KYAA 3WEBA 5HGHB 2HWZL 5J57B 5JTGA 4GRWF 2EE2A 1A7OH 1MCLA 3F83A 4G42B 2RCSL 3V0VB 4H8HA 5BRZE 3Q8AA 3Q8FA 2W0LA 4EOWL 1ZDSA 1FO0L 4Y5VA 4U1JA 4JN1L 4AMXA 2EIDA 2OPCA 3Q2CA 1AHMA 2WW8A 1RJLA 2GJ6D 2F54D 4OY9A 1TTCA 1JGVH 4AKLA 4NXKA 1FGNH 5E1AA 3T0BA 1OP4A 3JWOH 3RBSA 3AE5A 1DBKL 4LESA 2ADFH 5C0FB 1R3IL 5K9OA 1DFBL 5AW6B 3O3EB 4UF0A 4N6RA 3RI5K 4IOFC 4XPBH 3IDMA 1QW9A 3DV4B 3CFDB 4I3SH 5F0JB 3UTPD 3DMMD 4XPTL 4CGTA 4F92B 4GRMB 3POHA 3ZDYF 3FPXA 3KH3A 3K3OA 4PVLA 4KTDL 1ORQB 3QIUC 1JYWA 1NCJA 1E40A 4NI3A 4DPAX 4IDJH 3AY4A 1OCWL 2WZPD 3QR0A 2XA8H 5AQSB 4R26H 4U6YA 5B8CB 2UY6A 5MENE 2Y72A 4RISH 4I13B 4FQ1L 4GKZB 2ESVB 1ZT1A 4HBCH 4MDIB 5DQ9B 4G43A 3QZNA 1AIZA 4RMTA 5KS9E 3S0PA 4JY5L 5L2KB 3O9WC 5CEYB 1JD7A 4HAFA 4QRBA 4RNRB 2OMNA 2G75B 2RBLA 3JTSA 5KBPA 4K73A 4OGYH 1JPTL 1NCCH 3M1BB 4JDZA 4RBPH 3TYFB 5H37G 4JI0T 5FGCE 3NMEA 4XNBA 2OR8A 4OJFH 4I0PD 3AE4A 3CX8B 3RPIB 3ZX1A 1YNKH 4IE0A 1A65A 2EKSA 3T0VA 2WBJB 3EYVA 2QHRL 5E5RB 3TBTA 4Y9CA 3GZPA 4G6KH 1MLBB 5IB1A 2VQ4A 1M57B 3GB7B 5IQNA 1FJGT 1AJ3A 2WVVA 5CSGA 5JHLH 3IETA 4S1SL 2GI0A 4XCCL 2HFEB 3IPFA 1FHGA 3Q06A 3UUMA 3FUMA 2YXFA 5D1XB 2DKSA 1U58B 4OD1L 3W39A 4AI7A 5GGTL 5DD0H 1EUUA 3IT8D 2X6AA 4CJ0A 4FERA 2G9KA 2PP9A 5EK2A 1NBQA 5GZOA 3B3IB 3LRMA 4G8EA 5HEUA 1FN4B 5SWQB 2IOIA 3QO0A 4LCIH 3HZKA 4HGMA 2RR3A 5SWZD 2J1DG 3O6FA 3Q6FB 1UOKA 2IH3A 4GO8A 4U2YA 2EE0A 2YXMA 3KVQA 3T2LA 3VMNA 1HEHC 5KW9L 1Z9NA 3V4VB 1R5IB 3HL6A 3MRFB 3HR6A 5LDSA 2ENJA 4QX7B 2NY5L 1MI5E 3L16A 3DNKA 2D7QA 4FQJH 1U4EA 5LAPA 3VXUA 4BQ8A 1QUNA 3TWYA 5JO5A 1QO3B 3O3UN 4HK0A 3VX0A 4PJ9B 4IBTA 4U1GC 2LU5A 3CXFA 4XMXA 1BXXA 4OM1L 1U4FA 2NSMA 4AC4A 3RWGA 1S3KL 5ABDE 3HKZA 3BQIA 1KJ2B 4RFEB 1XV8A 5HDQL 2DM2A 5C7XL 4IIZA 1NDTA 1AIFA 1O9WA 3D39B 3F58H 4H4NA 3CQGB 3NJHA 1IGMH 1A02N 2ED9A 3PNRB 3QEQD 3K7UA 4JI3T 2IMMA 4QRTA 3II1A 1J9RA 1KC5L 3IMWA 4ZUSA 3CN3A 4XWOC 3O4OC 3WHXA 5C6WH 2X09A 1F13A 4ZOEA 5CN1A 4MJHA 4QRSB 1SXNA 2QFPA 1YMME 5AW5B 1JXJA 1HZLA 1E9QA 5AQUB 2L7JA 3CK0H 2VSDA 3V6FA 5L4MA 5CP3A 1Z5LA 3MREA 3LD8B 1IBMT 4XNXL 4Y4FB 3G04B 2PXYD 7CGTA 4M5TA 3U2SA 1A0QH 5E2WH 3SKJL 3AITA 3ARGD 3DUSA 2BXZA 2HB0A 2EH7L 2ZP0T 3O4LB 2VR4A 3RPBA 2AQPA 4XZUB 1Z3RA 1DUYA 2Q0ZX 5F7AA 4AQ8C 2V5YA 3L7FA 4OZ4A 2BZCA 5F7EL 1AH1A 3VD9A 1AO7B 4R7LA 1A8JH 4JZNB 3QUXD 3LS5H 2J6EA 1WP6A 1Q9KB 2OJEA 2VUYA 4H8WL 3OPUA 3P30H 3QFGA 2ZXAA 1H3VA 2X4OB 2VMFA 3ROLA 3K2MC 3V9CA 5JZ7C 2NW3A 2LTQB 2XJLA 4B95C 1JGLH 4Z0BL 4QF1B 5KBLA 1O0VA 1JI2A 1QKZL 3C8HA 3EYFB 1OQOA 2VUKA 4LGSB 4CILA 1BJ8A 1VGEH 3C12A 4TWDA 5BZDB 1QI4A 4ZO7A 4WFGD 4JQIH 2R69L 4H9RC 1P4BL 1QACA 2K70A 3KLLA 5BV7L 3BPOB 1TFHA 1EHKB 3VFNB 1WR6A 2AE9A 4PTTB 5E5UB 3RYIE 2M2DA 2IBGA 1U9KA 2PW2B 5AOKA 2BOBA 1ZKEA 3WYRA 4JQVC 43CAB 1TCRA 2XX1A 2DQJH 1KCSH 2Y2TA 3DTUB 3I50L 5HJ3A 3WS6C 3MUGA 4P9HL 4JDVA 4WFFE 3QPQD 1WIUA 4TL4A 2VL8A 3WMQA 2K4WA 3MA7B 4AQYT 3CHOA 1GZPB 4PP2B 2JJSA 1SLXA 3LQAC 3TVMD 2BVTA 1T03H 2ACXA 1OLZA 2RA1A 3T0EB 1W0YT 3GJFA 4ADGA 4U1KA 5KSAB 2VC2L 5DD5H 4ZFFA 4ZUTA 1CDUA 5EZLB 3K6IA 5AKSA 3OQ3B 4M93C 3H9SD 5L7XH 1G9HA 1C08A 3IE4A 5CBAA 1T8BA 4G8IA 4Z3FA 1FRGH 2WMPB 3CPZA 1Q72L 3N44B 1CYXA 4RGOH 5K39A 2WLIA 2Y06H 3QUKB 4JM2D 1FLRL 2JQHA 4MB5A 2JXMB 4TLTA 4W6XB 3VNYA 3O2DL 4QHNA 3TA3B 2D3VA 3L4ZA 4LT7A 3OF6A 3VA2C 5CEZL 2H3NA 1U21A 1R19A 1CK0L 3I9PA 4M9PA 2ZX5A 1JNLH 1JRHH 1FH5L 2QSQA 3QO1B 5AW3B 2WZHA 3QZOA 4NUUA 3U0WH 3HZMB 5MI0C 5JIHA 1A7QL 1IKFH 2ZKHH 3KLAB 1GZHC 3EOYG 3FQTB 4K3EH 4LLQB 1HDMB 1PG7L 3QAQA 2EUXA 4YPGA 4E9XA 2EE3A 3DXAB 1J8RA 2IXQB 2W0FA 1SVCP 2J8HA 5BQ7A 2O26U 1JMZA 1GW6A 3UPRA 4RAVB 3SJVA 5I9QC 3OM3B 2EDXA 3ALWA 4Y1AD 4PJ8D 1D5IL 2WZAA 4M5ZH 1FJ1A 4NQVB 2BJML 2UZXA 4OZIA 1U2CA 4PRIB 5ITFB 1MEXH 3X2QB 5L4IA 1P9MC 2Z7UA 4LDEB 4XWOD 5B3JE 3WEMA 3LZOA 2CK0L 1HESA 2YN3A 3DVNB 1REIA 2X53A 4O2BE 4ODSL 1T04B 3J2PA 2LRKA 5FKAB 3FULA 1H19A 1OY3B 2AI0H 2F74B 5PAZA 4KHXH 5C3LD 5FV2A 4JI1T 2QZ5A 2VKHA 5DTFA 4ZX5A 3MUJA 1OSZB 3LMJL 3GZOA 1TNNA 2XN9D 4FYTA 4MQTB 1HHGA 3UJTH 3ECBA 3Q3GB 4KQ4L 1HF8A 3RVTC 3CCHB 3WIHL 1SEBB 5FKPA 2YARA 4HSAC 3CLFH 2OX5A 4RMWA 5CF3A 2Z4QA 3UCRA 1KXTA 2JQMA 3I02A 4K15A 3EDEA 5HTSA 1DBJL 1E4XH 4GRWB 5E9DD 1UVQA 2OMWA 3US0A 1BD2D 1EJOL 5J1SC 4MQ7A 3VI4A 1J8HD 4Z7NE 1BVLB 1KBPA 4FKHA 4KXAA 1Q0XH 1NSNH 3JT2A 1WFIA 2IQ9L 4KJWD 4NKOB 3UYRL 2EXWD 4MNQD 2OL3A 4ZMQA 3STBA 1IEAA 1II4E 4HFIA 3QXAB 4R7VA 4XB7A 1NGWA 3FS9A 5C0CD 2E6QA 1D5BA 1OEZW 5IMKB 2VIRB 1Z7JA 4U4IA 5A43C 3ELQA 3F62A 1BZ9B 3E08A 3R6NA 2XPZA 4PLKC 4YL9A 4LRIA 4DP4X 4N6QA 4UXNB 1DO6A 3TBWB 5D93B 3HZVA 2Q8BL 5G2NA 1NAML 1A3LH 4I1RA 3ARDB 1OGAE 3M8OL 4IGBA 4ZX6A 1WWWX 2J3SA 1GS6X 3P1VA 5GGTA 4NZTL 2OA5A 1A22B 1N64H 3SGKC 3HE6C 1CJYA 3ZJ1A 4TLSA 3S8FB 1S7QB 5GRZA 3ZDYB 1CG9B 4BK8A 1XF4A 1CFSA 3BAIA 5FHAL 3X1NA 1M7IB 5C8YE 3NA4A 3ISYA 2AXJA 3KR3L 3Q2WA 3TIDB 2HX7A 3ZO0A 5JW3H 5IMLA 4TSAL 1C1EH 1FFTB 1T22B 1GMEA 4WK0B 2FGZA 2V7NB 2W81C 4IIQC 4L4TA 2LHRA 2E8IA 1VRBA 3KYMB 5L6YL 3X1DA 1IFHL 1FFPB 2H0JA 2NW7A 1SJXA 5A2LH 5ANMA 4J3VA 5KVGL 1KULA 2MKWA 1IAKB 4F5CE 3ZKMC 5FM4A 3VYNA 4OZIF 4IRSB 1MIWA 4N2OA 3G5VB 5IJKC 2E7CA 2HAZA 5TQ0L 4JB9L 1G7JA 2I85A 3HBQA 2ZM2A 1BAWA 5K9QG 1CL7H 4LOEA 3RTQD 1UZGA 3RWIA 3T8OA 3GUTA 3U79A 1B2YA 3ULVD 1AI1L 3BQUC 5JQ6L 2MRYA 4QRPD 4QO1B 3SDDD 1XQ4A 2XAGB 4QXHB 4XCEB 1EEZA 4GXUN 5CKAA 4AY0A 5EC2B 1S5HA 2E6PA 5BO0D 4BKLA 4BGDA 3FZUC 3E2HB 5DHVA 2EDKA 5GRUL 1QHOA 5IFAL 1B0RA 5C0AB 3B7TA 3MGAA 3GMLA 1T1WB 2EIBA 4JFFE 4Q9QH 1DQDH 1FIOA 3LAFA 4Y5VB 4ZUWB 1LDPL 3F7RA 3VI4F 3QZWA 3ZQXA 1BR4A 4U1JB 1QBLL 4TUYE 1ZT4B 1HYRC 4S1RL 1CUOA 1RJLB 3FUHA 1AKJD 5JVDE 3IDJA 2DM3A 4QXGL 5T1MA 1HE8A 3JV0A 3X13A 4LPXA 5E1AB 1S9KC 1GPOH 2AJVH 3HMXH 4KHTL 2CE7A 4FFVD 2Z7ZA 3I3EA 5E4EC 2DKMA 2GJ6A 2OW7A 2F54A 1D6EA 3TU6A 3VCLA 4PJXE 4JI2T 4X5WA 5K9OB 1LMIA 1NC2A 4UIKH 1CFVL 2HLAA 3TLTA 4I9WD 2V5SA 1HWWA 4UF0B 3MV9D 4N6RB 4EUPH 1QSED 3BKJH 3IDMB 1A64A 1AXTL 4CNIB 3D9AL 4H2AA 4BQBA 4RQQA 2V0AA 4WGVB 3BESR 1SY6A 1HZKA 3PGFL 3JWNH 2XQ6A 5CGMA 1BZQK 2Q8AL 4UM8A 4PIRF 1CFBA 1A1OA 4PCSA 2R69A 3QUML 5IGXH 1XXFC 3DMMA 3QZLA 5TQ2H 5IIEA 3S4SA 4XP5L 3TV3H 4IDPA 5EO1A 2M1KA 4DKFL 4TSBH 3PP4L 4XX1E 4U6YB 1ZHBA 2UY6B 4ONOA 4X0NA 2ROXA 5AVSB 3HKFA 4EVNB 5F96L 1ZT1B 4RRPM 2VB6A 3W2DL 3MACL 4X1YE 4G43B 3DLQR 5SX4H 4WO4B 1E67A 1KENL 1UATA 1ZLDA 3L4VA 2AJSL 3II3A 3MRBA 5EMYA 3KH4A 4HLEA 1A21A 2M67A 2OZNA 5BPPA 3JTSB 3EABA 5C6TH 4MLKA 2VRQA 2AMGA 2Z8RA 2XQYG 4JDZB 3ESNA 4P06A 2WB5A 1U95A 4DTGH 4PLNC 2W65A 5D7SH 5I1DA 1JZGA 2IDSA 3FT9A 3GLZA 3L54A 5IWLA 2NXYB 3F04A 1IGYA 1I9IH 3EYVB 4Z95H 3TBTB 2X9YA 25C8L 3RQ3A 5IB1B 2AW2A 2C5JA 2ZD0A 1VFOA 1P6WA 2JV6A 2OSYA 4I0PA 4I4WA 2WVVB 1OOWA 4V2BA 3LDBB 4NHCH 1XAUA 3IETB 1GGBH 1MNDA 3PXHA 3QFDA 4KXBA 4PVNA 4IDOA 5IZ7A 2YC1A 3AB0C 4U6XA 2F8IA 3ZE0B 4BZ1A 4XBPB 3DWTA 3W39B 3OLIA 5L2JA 2C9RA 3EDFA 5F6HJ 1URIA 2GY7B 4G8EB 3VH8A 3O2DA 3QO0B 4I43B 2IAMC 3AZUA 3P9WB 1OL0A 1XR8A 4P5SA 1SHMA 4B9FA 1PSKL 5JIIA 1NJ9B 3EDVA 1MRDH 2VZTA 4PMFA 2IH3B 5LGNB 5DWUH 5BO1L 3MRGA 5HXCA 2VRKA 3HNTL 3HS0B 1KLUA 3MJ6A 2WLHA 4BCZA 1LE9A 1RZJC 2H0EA 3OX8A 4KQ3H 4YSCA 5C0NC 2VN3A 4J2CA 3MLZL 4PG9B 3JTBA 5SWZA 1JZ3A 1JHKL 4GYSA 1D7DA 3Q5XA 5HHQB 3AAZA 3LQAL 3VXUB 5JO5B 5C8JA 3LH2L 5BRZD 4HK0B 5HDLA 4AEEA 3L3GB 3RHWA 4U1LA 1QI3A 3RWGB 3ZLIA 2BS4A 5LAXB 1XCWA 3M07A 5IUCA 1HJBC 4UOJA 1AIFB 3ZT6A 2Z7WA 1MCHA 3KLQA 1DTUA 1FNFA 2BKPA 3BP6A 5IQ7L 3QIWD 2BNQE 1MJJA 3GLEA 4QRTB 5E2UH 2JH2A 2ZCHH 2B5IC 3WHXB 4Z7OE 4H88H 1K5NA 3K80A 1XIWC 5DD6A 3SPVA 2B8OT 4LF6T 4YXKH 2UXFA 1KCBA 3L3HB 1E9QB 3D48R 2I32A 1UOVA 4PHXA 4R4ND 3V6FB 4I2XA 1Z5LB 3MREB 3OZLA 4LCUA 4XP1H 3CDGA 2Z91A 1Q90A 4HWZA 4A7SA 3W0WE 3U2SB 2OK0L 2V7IA 4NHUA 1RZ8A 4IOSD 1R17A 2X40A 3DUSB 4O00A 4BK5C 5MEND 4PK5A 1MJUL 5J12C 3FN9A 2PXYA 1SFDA 1VZHA 1DUYB 1LGVA 4K2UL 2YGQA 1ZLUH 2WMNA 5F3BA 5K9JL 2XKUA 1IL1A 3L7FB 4OZ4B 1NOLA 5E8NA 3S3DB 2W9DL 3WENA 4OCNC 4TQPA 3V55A 2WKGA 5I6XC 5JR9A 2J21A 1NLDL 4G7VH 2WYIA 3N42F 4UOQA 3UTQA 4XNQB 5LWYH 1MNNA 2V2TB 1TTRA 3ROLB 4JI5T 4MB3A 2WOYA 2NW3B 5D72L 4ZS7L 4JFZL 4EQ3A 2O5YH 1UJ3A 3H9HA 5E00A 1ZV4X 1ECZA 2CK2A 2VDMH 4DV0T 4XWGH 5LMUT 3QUXA 5IOKA 3L4YA 4FTVE 4KH9A 4AV0A 1TO5A 5HEHA 1ID5I 5B1JC 4M7JL 4X4YA 4XAWH 3ARXA 7FABH 1U3ZA 2WWKO 5A2JH 4HPYL 1GJUA 1NAMA 2DLTA 1RFDL 5HY9A 5ETUA 4IHOA 4BCXA 3QIUA 1CIUA 1TETH 3Q5EA 5IHYA 4JRYD 4UT9L 4UEMA 1XB6A 1E3ZA 2X68A 2Q20A 1D6VL 2BOBB 2PCXA 3T1FA 4BJLA 4KJQC 1DN2A 1LO5A 4MBRA 1TMQA 4GMSL 1A4JA 3QQ9C 4KK6D 3T3MF 2EDOA 1TCRB 4ILCA 2NP9A 3EHBB 4KZDH 3PY9A 4DAGL 3MUGB 2JVUA 4JDVB 3RHWF 4DQAA 3HA0A 4BEIA 4LF7T 1V05A 5CAYB 3BJ91 4ASKA 1P0SE 4JS7A 5F2FA 5HHVH 1M3IA 3GJFB 4EI0A 4U1KB 3GI8H 3MJGX 4OF8A 2NOXA 4ZFFB 4ZUTB 2OV9A 3RIAK 3L45A 2G3XA 3BMVA 1MFVA 4MRBA 3V6OC 5CFHA 3NA9H 3ILQD 1AGFA 4LSRL 1RP8A 2ZX8A 3RIFK 4GO6B 2BWQA 5FVKA 4HUCA 2HVBA 4NM8H 5GHWH 4NPPA 1C08B 4YK4B 5CBAB 4G8IB 4LOVA 2GI7A 4Z5RA 1NUGA 3K74B 3H9SA 4F7PA 5K39B 3SD5A 2WLIB 4PJFE 4F8TA 3N1GC 2FK9A 3KPNA 5F6HI 5HXSA 5EZOH 1U93B 4Y2OA 5FO9A 4CQIA 3EKCA 3SY6A 2H3NB 2WSKA 4JM2A 4MXWL 2OJZH 1NIFA 2ODUA 3DHPA 4KH2A 4OZGE 4LLDA 3PUSA 2VXSL 3KL5A 1IBDA 5C0ND 2CLYB 1PX4A 3X14A 3WKML 3FBKA 1E2ZA 4OCRH 2NDGA 2FD6H 1QPPA 1YMMD 3GK8L 1WFOA 4I18C 4YHNA 4AQ1A 1PYWA 3FK3A 3ZDZE 4FKEA 4YHOL 2NSXA 4O5LL 4OUUA 4FG4A 3X17A 3CQFA 2W0FB 3IPEA 1S7RA 2VISA 5BQ7B 1KN4L 3DSNA 2EICA 2AANA 3S37X 3UPRB 2VDOL 5DJQC 4CN4A 3SJVB 2AJZA 4CBZA 4OFYD 3KLKA 3CFCL 4DO6A 4OCWL 2XZZA 3NJKA 2UZXB 4OZIB 2Q3XA 1S9WA 2WO4A 4KOBA 5CJOH 3LK2B 2Y5QA 4WWKC 4S1QH 4Y1AA 3FBLA 4PJ8A 1ZOYA 3Q1SL 1M6OA 3PFQA 4NUQA 3A8YC 1FORH 4KRPB 4MCZB 5FYJH 5J11B 2V5RA 1I31A 4IU3A 3UUNA 5DTFB 4L1TA 5DFVC 3CMOL 1JXDA 2YOCA 2NPLX 2NR6D 2ZYHA 1HHGB 3NPZB 3RTLA 5DJXA 3RWDA 1Z3GL 4QNPE 5FKPB 5LJNA 5I1LA 5ABAA 2C9QA 2OX5B 2VL4A 4NQSA 2Z4QB 4YMPA 1VGKA 1DDHA 1KXTB 3I02B 1I53A 2XN9A 2J1ZA 3MV11 4XNZB 3LXAA 1UVQB 3LTVA 3PV6A 5E6RB 2ZNWA 1JERA 5HI3C 4XE5B 3T0AA 4MQ7B 1MFCL 3AE9A 4LXFA 2V8SV 1SN5A 1KNPA 1WAAA 3GNMH 4GRLC 5AAWC 4NP4H 2ICEC 2EEFA 2F15A 4LMJA 2OL3B 3P0YH 1BD2A 5E9DA 1IEAB 3SOBH 4AQ8A 3W38A 1NGWB 2DOCA 1J8HA 3MLPA 1ZLUK 4DZ8A 4FC3E 4JPKH 2ZX7A 1XD1A 2MWCA 1BVNP 4MNQA 1FBIL 3ZPDA 1V3JA 4WNSA 2FDBP 4QRQA 5C0CA 1E6JL 4AYEC 3HZVB 4JRLA 3U0TA 1YY8A 3UTTE 4JM2F 1KN2H 2F18A 2WQWA 3EJZC 4HUKB 3IN0A 4HGWA 4IGBB 4FRWA 4MAZA 4OLUL 3ARFD 4AITA 2FL5A 1PEZA 4IBVA 3O6LH 2IUBA 1M9WA 3V95A 4YSRA 5EA0H 3OKOA 4JFHE 4KJQD 4OLVH 4R7DA 4RRPG 4B3ST 4LRNH 1CFSB 3QQ9D 4HIEA 1G1OA 4EB6E 4NQCD 3TBSA 5FP3A 5FM5M 5DZ9A 1QEXA 2BVMA 3DX1A 5IMLB 2X2UA 2N1KA 4DK6A 4JQVA 4AEIH 1T7XA 5CD3B 1K9TA 2Y3NA 4Z6AT 3FFCE 2P47B 4L4TB 4PJDA 3SGEI 3TWCH 4AYSA 3ETTA 2DQUH 2G2PA 1I1YA 1OT4A 5HYEA 1NQBA 1GSKA 3ECWA 2VXVH 4HFUH 4KK5C 4X80L 5DHMC 2FECI 5ANMB 3FO0H 3IAGC 4M1GH 3RJQB 8CGTA 5D7JB 1D0YA 3ETVA 2YAQA 3NH7H 3P3UA 5KXJA 3KWXA 3HFML 4UINL 5CZXC 4GI6A 3HW7A 3OZ9L 1G7JB 4IE6A 3C5ZC 1EDQA 2LW3A 4LEOA 3MRDA 2MAWA 1F0LA 3RWIB 3T2NL 3BJLA 4PJ7E 1JYNA 3GUTB 3VGDA 4L4VE 4ODHH 3N0PB 1G84A 2GT9B 1DVFC 2FBRA 3RTQA 1EEZB 1JPGA 2FEDD 3U4AA 3U9WA 2CHWA 1S5HB 3WI3A 1RVFH 5ESAA 1LE5A 4NERA 4UBDC 5DHVB 1BQHA 4QRPA 4RGNC 1IO4C 3BXNA 5DHXB 1ZOXA 4N8UA 3QB5K 1B0RB 1X9LA 3IU3A 4LAJH 5D4IA 2DM7A 2BO0A 3GTVA 3VFPA 3WKQA 2DQHH 1SJEA 4PTUA 3L5HA 3GMLB 5HGDA 1MZZA 2ZPKL 5CBEA 3N41F 3QZWB 2BDNL 4JHWH 1RZJL 1LEKA 1WAAF 4ERSH 2H32H 1KUMA 3CZFA 4JE0A 1L7IL 2BW4A 2QDWA 5JRCA 3IDJB 3MFFA 5D70H 5IVXA 1TPXC 4PJAE 4NPYA 2RHEA 5J0ZA 4TXVB 3R1GL 3X13B 3BPLB 4KV5F 1AS7A 4MA1B 4OTXH 4MGXA 1AKJA 5DMIH 2GJ6B 2WP3T 5CS7A 2F54B 1D6EB 1EHNA 2JTYA 1MG3C 1S3RA 3DYPA 4X5WB 1NC2B 1YEIH 2BP8A 4PGEA 2HLAB 2B59A 2DI7A 2OMYA 4OIIH 1P5VA 5AQ0A 2XFXA 4GKJT 3AE7A 3BO8A 4RQQB 3PAYA 1OGPA 2PMZA 2HKHH 4XP9L 5JW4M 1P9MA 3OWEA 4XH2A 3MV9A 4OD3H 4UM8B 1QSEA 2R29H 2ZOUA 1A1OB 5KAQG 4KTEL 2BS71 3B2DC 4D9QE 3DMMB 4K23H 1NCWH 5IIEB 5DFVD 3S4SB 5CSBA 3ONLC 4GMTL 4Q4EA 1QHPA 4UT9A 4PJDF 3WLBA 5M94B 1N0LA 3BLPX 1G7PA 1MIMH 3CG8A 4DEPB 2F7PA 4UZSA 2ZWKA 2YKKA 1YEEH 3B2UC 1O6TA 4JBWF 5L4HA 4OF3A 3LPPA 4TTDD 3MRBB 5HI3D 5F6IB 4P3WA 4KROC 1IQWH 3OPCA 4QHOA 4X6CA 3KLSA 3LV3A 1ETZA 2XX0A 3UACA 1U95B 1J86A 1IBKT 2W65B 5A2AA 2KLSA 4C91A 2NY6D 3K8LA 3X11A 4ADZA 1F6LL 4AGPA 5I1DB 3ARUA 1AHWC 2GSIA 3D05A 4Q14A 4UAHA 4UTAA 4LP4A 5CILH 1IGYB 2XQ9A 3MX0B 3PAZA 1FG9C 5GS2D 5GGQH 1HVXA 4LNRB 1N68A 2OA9A 1JG9A 4JKPL 4OBSA 4I0PB 4I4WB 4UNTA 5AVXB 1MFDL 3ET9F 1B7TA 3FZKB 3QFDB 3ULVF 2YC1B 4U6XB 5EC1A 4FQIH 3P9LA 4MA7L 3VXME 3N42B 3MUZ1 4M3JA 5GSVA 2C7UA 2VDLH 3IDYC 5L2JB 1U8IA 2QVKA 2OULB 2VE6A 4UOZA 3U78A 1NBCA 2DS4A 4YSPA 3VH8B 3C4XA 1DDTA 4WGWB 1BG1A 5LXGL 5FMNA 3P73B 1WPCA 1XR8B 2D0FA 3F2LA 3F7VA 2VKWA 2WTPA 3SGKA 3HE6A 5IVXF 2IH1B 2LM2A 3MRGB 3GBNL 2WK2A 1LE9B 1KLUB 2A6IA 4MBQA 4TNEA 1MCBA 4UUJA 1A7OL 3OX8B 3TEYA 1H0DA 4OUOA 4QR7A 4OFVA 4L5FH 5SWZB 3GXNA 2B39A 3KINB 3BWUF 4FD0A 3TH3T 1RY7B 3AAZB 4APXA 4X7EC 5C8JB 2VDQH 3T3MB 2EH8H 4JFFD 1TENA 3LCYA 4U1LB 5CZXD 4HEPG 1JGVL 1X5YA 2OAAA 1F5WA 5BRZA 1AZZC 4G3YH 1M6UA 2ADFL 2FECL 2OZ4A 2CR0A 3ARBC 3FU5A 4L37A 5IJKA 1G9MC 1NKRA 1J10A 1LWRA 3BP6B 3PURA 5B21A 4XPBL 4PR5A 1MJJB 5E8EA 4I3SL 4ABVA 3BOVA 1HNZT 5F7BA 2ZQKA 3G5XB 1MCRA 4RGND 4O4YL 1AS8A 1K5NB 4BIKA 1UWYA 3TEUA 5DD6B 5E8OB 2BNUA 3SPVB 5EZJA 1YQVH 3GI9H 3K72A 4IDJL 2ALAA 2HG5B 2JRKA 4LF3A 4UV7H 5F7KC 4LVOB 4X6CF 2H47C 4I2XB 4LCUB 4RISL 1NOFA 1N6QL 3CDGB 3QWQB 2Z91B 4M7LH 4HWZB 4B96A 4HBCL 5LG1A 4A97A 3FCGA 2YPKB 5D7LE 4NHUB 1RZ8B 2E8YA 5CGYD 4M29A 3C60D 2R1XA 1N8OE 3BH8B 3WBDA 2AEQH 3C75A 4OGYL 2PXYB 1XT5A 4NQDA 1NCCL 1EZLA 5LQBH 2VB5A 4IOSA 1IL1B 5E8NB 4IRJC 3P3RA 5JXED 4GYRA 1XBDA 5JR9B 2MQ3A 4OJFL 1DJHA 3UTQB 3MC0A 1YNKL 1QLFA 1JGUL 1XGYH 3HBZA 1E5YA 2GHZA 3BW9A 2BFVL 4G6KL 1UJ3B 3H9HB 4HW6A 5E00B 5F7LB 4C4KO 4F8OA 5JHLL 4Z7QE 4HX1A 5ABEA 1K3IA 4Z3IA 4X4YB 4AK2A 1VFMA 1SXZA 1NAMB 3OMZA 1C9SA 4M6NH 5ETUB 4YC2C 4AIZA 3QIUB 5HSFA 3K81A 4H0IA 3TBYA 2WJ5A 3T1FB 1CFTA 3CWGA 4FFZH 3TOPA 1LO5B 3UJJH 3HI6H 5HYIA 4JRYA 3P3YA 2I5YH 1WHPA 3IWVA 4RMBA 3WNKA 1FNLA 5JIMA 2PF6A 3LNFA 3O9WB 4J8RA 4QAMB 2P9BA 2ZSWA 4BXVA 1MUJA 2IJ0C 3ZL1A 4NOFA 3M65A 4FQJL 4BHUI 3CSTA 3O2WH 2HT3D 1US7B 2WXHA 4I0KA 2D7NA 2JKNA 3LPGA 4ICXA 5CJQH 3K6SB 3UO1H 2UZPA 1AGFB 4N2MA 4DKEH 2AV1A 2YGVA 2YD0A 3H9ZA 4FEIA 3RI5A 3SWHA 1IJ9A 4WDIA 4N1HB 1F6AB 3L3PA 3HRZA 4Z5RB 3P4OA 4QH1A 1PKOA 4MS8C 3PAVA 3H9SB 4F7PB 3UUBA 5JMOC 2R0ZL 1IGML 2D7OA 2FQEA 4Y2DC 1JFQH 4DP9X 1XFPA 3FHQA 3KPNB 4WJG3 3L1GA 3ZCJA 4Y2OB 2J43A 5FO9B 5F70A 4ZFOL 5CUSH 2QPDB 4AL8H 2WXMA 1ZLSH 4W9LC 3OKKA 1TZIA 2VL0A 1GKEA 4NQEA 4JM2B 4P48A 3TLUA 3UFEA 4B6ZA 4WW2C 4LLDB 5I66A 5JHBA 2H3KA 2WZ5A 5E6UB 4LP8A 2IDFA 1INQA 4HFCA 3CFJA 3X14B 2ITEA 4DP2X 4FLHA 4L8BA 4BWUA 1I94T 3KVDD 1THCA 2WLZA 4YHNB 4AQ1B 4B3TT 1PYWB 1CYWA 1A0QL 2RMNA 2I9TA 3FL7A 1R1CA 3FF7A 5I24A 2DKUA 4NUJA 2A9UA 1IILE 1YMMA 3TGXA 1S7RB 2VISB 3ARRA 3DSNB 2PTVA 4QRFA 1JPFA 2DMCA 4U1GB 2WTOA 3W0WD 5MP6L 3GRBA 5DHEA 4YVUA 4ZFZA 4JR9H 4FFYH 4AUUA 2AJZB 2XAHB 3C9NA 2IPUG 2W2UA 3VFUA 2WWOA 1K5WA 4CRPA 3P30L 3APMA 1EBAA 1S9WB 2DV6A 1L9SA 1XF1A 3G6DH 4FQHA 1A66A 1JZ4A 4L1DA 4PJ8B 2FEJA 4OZFA 2Y07H 1M6OB 1GC1H 1D3CA 1VGEL 5KG9A 4ACPA 5HHOD 5CD5C 4JQIL 1OEDA 1U8KA 3PF2A 2B1AH 3O4OB 2YUVA 4U05A 1SQMA 4P46D 4IU3B 4Z91A 3TO4C 2ZUUA 4XVUD 3REVA 4OYJA 3B9KC 2PR9A 5CMAA 5DJXB 1LYQA 3RWDB 3S3PA 3PJAJ 2CCLA 3ARWA 5I1LB 3BRFA 3QXVA 4NQSB 4FNTA 4HETA 1VGKB 4JMNA 1DDHB 3HE7C 2DQJL 1KCSL 2XN9B 3B7SA 1EDHA 3C6EA 4BDVA 1HT6A 4KX7A 1M2VB 5EFIA 4BK5A 3RI5F 3N41B 3SE4C 1T03L 3ZMZB 2XJ7A 1RZ7H 4ALAH 3LRSB 4P9MH 5E9DB 2COQA 1BD2B 2P43B 1W6LA 1YNLL 4Z3GA 1HYSD 2P8MA 4CAGA 4PFPA 3CX2A 4KKBD 4K0KT 4DZ8B 4ODBD 2H8PA 1B90A 4MNQB 4Z9KB 4N2EA 4DGIH 3N9QA 4QRQB 5C0CB 3SCMD 1FRGL 3U0TB 1YY8B 2J1XA 2BRRH 3EZJB 4RGOL 4DP1X 4HGWB 2Y06L 5G4MA 5B1JA 2FL5B 2WXKA 5GGVH 1MCSA 2CWRA 3OKOB 1X5IA 5DLMH 4HMDA 4HIEB 1AZVA 2WGXA 3ARFA 3VACA 3ESPA 4FXKA 3TBSB 5F89A 3CLWA 3VNZA 4GIOA 4UQ2A 3DBSA 5AYUH 2V9TA 3DGGA 1M7DA 5FYKL 3KPQB 4PJDB 1IKFL 2ZKHL 3BE1H 4NQCA 1I1YB 1UXWA 1PCSA 1F3DH 4K3EL 3ZKSD 1NCTA 3QDMD 5LGHH 3T4AC 4YVNA 2EYRA 2JQQA 4XTRC 5IMMA 1T4KA 3ZHNA 2XN2A 3L3OC 1J12A 4QXTB 4FN0A 4YXDA 2KH2B 3AQZA 4YXHL 1MFEH 4QH4A 5TK4A 3U4EB 4NO2A 3GXUB 3V6OA 5TAOA 3D18A 3K0YA 4JHUA 4MS8D 3SKMB 1IKNA 4M93B 5CCJA 4OJCA 1AG0A 4LEOB 5FVLA 3MRDB 4ONGL 4K9EH 4M5ZL 2VSMB 5DFAA 5AWNH 1MEXL 4L9LC 4MXQD 4OKDA 3RJOA 3FB8A 3AY2A 3RTQB 3S9DB 1JPGB 2VZSA 3MDJA 4LLYA 1WZ1H 4WBNE 2NNAB 1X9QA 5ESAB 4WI7A 1LE5B 4KXZH 3G6AA 2H7OA 1BQHB 4K3GA 2KS0A 2AI0L 4QRPB 3BXNB 5E56A 5SX4I 4KHXL 1Z0NA 2EADA 3IU3B 3VFPB 3VU2A 4EIBA 4FQQB 5K59E 2C4FT 1SJEB 4PTUB 5AYTA 4DHLA 1QA9A 1YEWA 3FQ1A 4HDIA 3L7EA 1GHFH 5HGDB 4YBLC 5CBEB 3NIDF 4ZT1A 4M62H 1LEKB 2F08A 3CZFB 3PWVA 2EO9A 4GT7A 4ELME 3CLFL 3BD4A 5JRCB 2A99A 3IF1B 3MFFB 1OP3K 4I48A 5IVXB 1G5AA 3T4YB 1CBVH 5JDJA 2EVHA 1UM5H 1ZP0A 3OTTA 4I18A 1E4XL 2A6DA 1Z32X 3S37H 1MSPA 3LXBA 1HTYA 1AKJB 4N1CA 2I69A 4PJBE 3EOAA 3QIBD 3Q6GH 1Q0XL 1NSNL 4MJ4A 4GG6A 4GW5B 1LNUB 2BP8B 4PGEB 1L0PA 2JCWA 3RA7L 2BVLA 2B59B 3NGBC 4XP6H 1R8IA 1P5VB 3F8UB 1G9ML 2BX5A 2XFXB 1LJMA 3BO8B 1G94A 3SPIA 3ZKXC 4X8XA 4ODTH 3BSZA 5KDMC 3CLEH 3QCTH 5LGTB 2JJVA 2V7JA 4V11A 3MV9B 3ARVA 4XH2B 3E9TA 5CU5A 3RVXC 4XMPH 1BV8A 2CPTA 5F9OH 4EYYR 1A3LL 3L1OH 1MJ7H 2AXDS 4F27A 3GSNH 2NY3D 5FLUA 4KMCA 1D5RA 1B4LA 1N64L 4LMKA 1BZ8A 4J1UA 2HKFL 4KKCC 3WLBB 1BP3B 3QWOA 1N0LB 4YTNA 3UTTD 4XN1A 4IE5A 1G7PB 2NW2A 3CBRA 3ENEA 3HE7D 3AE2A 3TFKC 4BZYA 4UOW1 1B4RA 2VVSA 1D5ZA 4PRHE 5JHDE 4PHZA 3ZJ2A 2WDVA 4JFHD 1C1EL 3DA0A 4X6CB 3LV3B 1XCXA 2O5NA 3LY6A 4NM4H 5AW7B 3OBAA 4LK4A 3EH2A 3X11B 1ZPUA 2HH0H 3P4SA 3MZTA 4HPOH 1I7ZA 1IBLT 2BIQA 3WO3B 3MR9A 3DGCR 2EAEA 2Q7YB 2QT6A 5J1AA 4Q9CA 1XGPB 5AAWA 3U6RA 5CA0E 3KJ4C 1JYXA 3NIFE 3FNKA 3WFBH 3ZE1F 3FCSA 2VK9A 5L3GB 1I9RH 2RACA 2VR7A 4WVRA 1LO0H 4GUPA 1CL7L 4N0FB 1PBYA 1RUMH 4UV9B 5EC1B 4YJ2E 5GSVB 4AOFA 2LT3A 2C7UB 3EFOB 1Y07A 2D03H 1VZGA 5JQIB 1MIYA 1U8IB 4N3UA 2EDEA 4E36A 2VE6B 4K3JH 2YA1A 1EERB 1PVHA 1A6TA 5KSUA 1KGXA 5I5IA 2VLRD 4ZFOA 4LOUC 1PF3A 2Z1KA 4K5NA 2PO6C 4A2EA 3QEGH 3F7VB 1CD0A 3HE6B 1M62A 3W5NA 2HRPH 1GS7A 1ZA3A 4CVXA 5A16B 4EI5C 4UYPA 2A6IB 1KB5H 4UUJB 1IZKA 4WU7A 3SDAC 1H0DB 4PWIA 3ZYJA 5AQKB 4Q9QL 1DQDL 4HEMA 5AVUB 4NFCA 3F3HA 4G7RB 4MD4A 5AKRA 3VMPA 1J5CA 1HHHA 2DLRA 2K9UA 4IIQB 5E0QA 5EZIH 4APXB 4GG6F 2VDRH 5B38B 4EF3A 5JPNC 1W72H 4MLSA 4NQQA 4TLKA 4UQBA 5K9KA 1QBMH 2AJVL 2W8CA 2A3DA 2A38A 2A4CA 2XQYK 5BRZB 4JFFA 1RZIA 2C9XA 4Z7NF 4HWNA 3HLKA 3FZMB 1FL5B 2B3RA 3RL1A 4WFEE 3BKMH 35C8L 2E9XC 3BKJL 4PR5B 2Y22A 5E8EB 4HD9A 4U1HA 5TF1L 5T1KA 5FR3A 1Z9LA 1QUPA 5FUZH 3TZVC 3BQUB 3U2IA 4YEFA 2JQ9A 3PUZF 1OE3A 1VESA 2NW9A 5K33A 4ZMAT 1HKLH 4PB0H 1UUNA 5KOMC 5JDFA 1WBYA 2O93L 2P5WA 4Q8BA 5I8OL 5IGXL 5EZJB 3MAWA 3K72B 3FOMA 5F9JA 3HTLX 4NZRH 5TQ2L 3T6XA 4ABWA 4LF3B 3TV3L 3MKKA 5AZUA 2VLKD 4G8FA 1DBMH 3A24A 3SGDH 1VCTA 2CSPA 1QQDA 1R47A 1TJGH 3KL3A 4D9QD 4DV3T 1VPOH 1PTZA 1TITA 4KC3B 4MCMA 1R6VA 3D08A 1T83C 3OKEA 3V5DA 1A6AA 5C08D 3AVSA 2SEBA 1IM9D 4FA7B 2R1XB 4KZ0A 4AKQA 1YEJH 1YW0A 3B4NA 3IXAA 5HDBE 4NQDB 1E8ZA 4DTGL 1XDPA 2AF2A 5D7SL 2D2CC 2XYCA 5D2LA 3C60A 2WSDA 2WLNA 1SZNA 1ET8A 4PYHA 3UP1A 1IGJA 1QLFB 5E4EB 1J5DA 1I9IL 1N0XH 4Z95L 3HNVH 3BW9B 1QZNA 1RPKA 5JW5A 5F44A 2IG2H 5JXEA 3F7LA 1G0YR 1YD8G 5EU7E 1MAML 4N26A 3U6XS 4BE6A 2N7AA 1GGBL 2BK8A 5GGUA 5E23A 3T0WA 3V4UL 4JUSA 3L5JA 1CIDA 3MRLA 3RLSA 3MV8D 3AQXA 2JLLA 1HCVA 2CLZA 4ZMOA 3EF7A 4AIZB 4ZI3C 4P0DA 3K2UH 5CR1A 3TBYB 4B3RT 4D94A 5DU7A 1BFTA 3I3DA 3VXMD 1IVTA 4F7KA 4CJ1A 2E0PA 1CFTB 1QRNE 1OCZB 3SDCD 3QBTB 2OMXA 4UQ3A 5JLZA 1MRDL 1CR9H 2YMOA 4JRYB 1HC1A 2A3TA 2KERA 5LCVH 2P7TA 5IVZB 4J8RB 3D4ZA 4KQ3L 4A7QA 1TQUA 2C9PA 2FEEI 2CHDA 2IGLA 2ZSWB 1G7IA 1HZHL 1MUJB 5HJBA 5TH2A 4LPYA 3W9EB 3L4CA 4LOFA 1IBZA 5IQLA 3QRBA 1CTMA 4AM0A 1E8YA 4MHCA 1U8LB 2CHOA 4N2CA 3OSVA 4GSDH 2AV1B 3BMWA 4A39A 3PU8A 4R5XA 4QHKI 3QDGB 3KCWA 4WDIB 4JQXC 3J9X1 2XSAA 1MW2A 4DVDA 2X88A 1AGDB 3HRZB 3AGVA 1K2DA 3P4OB 3PJSA 2OP4H 2NW8A 4PLJD 2YRPA 3HMWH 4GW1A 1ZGLA 3D3VE 4Z3JA 3AB0B 5I1AA 3Q2VA 3NRYA 5E2UL 3RYCE 2ZCHL 3V4VH 1EV2E 4QWWD 3QZWG 1LWHA 2ATKA 4TZ4C 3OKKB 4H88L 3ZMNA 1TZIB 3TS8A 4PJNA 4NQEB 4EI5D 2FZ3A 3OG4B 2QADD 1WEJH 3EFFA 3CZJA 4YXKL 1AMXA 5I66B 5HWXA 1BAFH 5E2VH 4IM8A 3MCYA 1INQB 3CFJB 2JJWA 2V2TA 4X1KE 2QPEB 1IAIM 4XP1L 3SN6N 2Y6TE 3QOFA 4BH8A 4AQGA 4LPWA 2MOVA 2NT1A 5D2LF 1W0BA 1KJ2H 2JQZA 1QTPA 2PP8A 1IGIH 2I9TB 4BFBD 2WP9A 3KGTA 4NUJB 2BHZA 1YMMB 4U4BA 3CZUB 2WXNA 3T6ZA 1JPFB 1J5ET 2EDJA 1SA0E 4ZFZB 1LTXA 1EPFA 5D7IE 2DTMH 2APSA 4OQ1A 3C9NB 1LL1A 3F6IA 5D2LE 3QUJA 2XLLA 4G7VL 5D2NC 1P4IH 5LWYL 1NGPH 1OARH 3ARBA 3W0WA 5CGBA 1DU2A 3BP5B 2O5YL 4OFIA 3S4SG 3T2PA 4FQHB 4DV4T 4QD2E 4XZ4A 2FBOJ 3TZVD 2GK0A 4XWGL 4OZFB 4A56A 2NY4D 3VR8A 2ADJA 3OB0H 4PP1D 3IRZA 3MRJB 4QRAA 5HI4C 1GAFH 4P57A 2FYVA 3VYPA 1OEDB 4YFEA 1U8KB 7FABL 3FQWA 4LHQB 1NANI 5SV3A 2MPAH 1C16A 4AJYV 3UBFA 2ES0A 1TETL 5DURB 5HHOA 3REVB 5C3TA 1EWHA 1CS6A 2F5BH 4NN7C 5FDWB 2Y8DA 4P46A 3ALXA 1LM8V 1J0ZA 4IJTA 1NEUA 2V7KA 1B0IA 4KZDL 1I8KA 3QDJE 3VD1A 3BZDA 4XX5A 4UQEA 1LQBC 4K71C 4BDVB 3ONJA 5EFIB 2BSSA 2WLYA 5CU9A 3NIDB 5J12B 5HHVL 3GIZH 3GI8L 1JVLA 2Q6WA 2Z64C 3CQPA 1T7WA 1XEDA 1G7LA 3MLVH 2BZDA 4LMQI 1KBGH 3QH3A 1WITA 3NA9L 5I1JH 2DMHA 1KTRL 2P8MB 5I6XB 3GTNA 1K6QH 4XMZA 2XPGA 3GKZA 2BRQA 2H8PB 1LEIA 3HB3C 4M02A 4NM8L 5GHWL 2ZM6T 2H3RA 3VH8G 4DR5T 4GQZA 4H44C 4K7FA 1M56B 2YMXL 5EN2A 4NO0D 1R24A 1RCYA 4CBPA 1WAEA 3J7Yq 4ZI3D 2XVBA 3C08H 4GQRA 3VI3E 4N25A 3NCXA 4Z7VE 4KGLA 4OKVA 5EZOL 4KBPA 4TUKL 2PG8A 1JHTA 2CXLA 3ARTA 3HHMA 4PG2A 3H7BA 2CJTA 3ARFB 4LLWA 4ZQTA 1RLWA 3IE9A 2OJZL 5F89B 4CC1A 3FZLB 4EXTA 5GS3A 4UQ2B 1E8WA 3DGGB 5J3HD 4PJFA 4W70A 4I55E 2I25N 4OCRL 4PEEA 5TD4A 4NQCB 3QJOA 2FD6L 5GRVK 1UXWB 3B34A 3L9RA 4YNYA 2EYRB 1AYRA 4ILUA 1XD0A 5IBLD 1T4KB 2B4CH 1AY1H 2X4TA 1NCOA 4RWHA 2FEEL 5GONE 4HJSA 3MV01 4EE2A 3QDMA 2V37A 3ABZA 2BNRD 4NO2B 1R3JA 3D18B 1JK8A 3N9NA 4XAKE 4LEXH 1EGJH 4X7DC 3GA8A 2QLYA 1VA9A 3ATDA 1S8DA 2JKIS 2DYPD 4PSPA 4L2YA 3QQ4A 5EUOE 5CJOL 4I1PA 1J0IA 4WY7L 5EZYE 3FB8B 4HWBL 4S1QL 3ZE1B 1AZBA 1T6BX 2P9RA 3B2XA 4LLYB 1R0AH 4KZEL 4XN2A 1MAJA 3L1FA 4YFDB 2EACA 2N59A 3G6AB 1FORL 2EDBA 5DEGB 5FYJL 1KCKA 3GM0A 2CRZA 3MCKA 3OD3A 5CLTA 4YBHA 1CGTA 3WEAA 1X5XA 1MNEA 2A6JA 2QQLH 2VR6A 2X42A 4L48A 4TL5A 4H5SA 3L7EB 4HDIB 4WW2A 2AS5M 3REWA 1XMQT 5MEOA 4IDLA 1VACA 3MLYL 2R8SH 2Q3ZA 4BWTA 1HHIA 3PWVB 1XBRA 3BP4A 5F7HA 5JPMC 2J20A 4I48B 1A8ZA 4K8RD 3QS3A 1QATA 3ONXA 4I18B 4LBAA 3SS1A 3RIAA 2A6DB 3OAUL 4YZWA 1B4JH 5ISZB 4WJ5A 4LARL 3X1EA 4KK8C 4ISSA 1NFKA 2ZXCA 2CWOA 5I30H 3RIFA 3KVAA 1ZS8A 1BR0A 3EOAB 4FQXC 3GNML 4MS6A 3U4BL 6FABH 5ES4B 4NP4L 5DF0A 4GG6B 3P0YL 2YLHA 2XQBH 3HR0A 3TKLB 3HR5A 3HVDA 3MN8A 4HIQA 5F7NC 3SOBL 2DI8A 4ANJA 3L13A 4PU2A 3PGCA 1Q1JH 1JHLH 1H3TA 4AT6B 3VHLA 5HI4D 3GJEA 2XXMB 3JWDH 4WWKB 4Z7NB 4JKMA 1KN2L 3RNKA 1HSAA 4GLRH 3ZYIA 5IM7A 4AL8C 3O6LL 2KPNA 4MASA 1Z0PA 2WNGA 3OB0K 4PJFF 5EF0A 4FQLH 2A0LD 5EA0L 3QWOB 3JQOB 1JCKA 5C92A 1YAZA 4OLVL 2NW2B 4LRNL 1CC3A 4YDKH 1C5BH 1INDH 1ADWA 2HT4C 2Y7OA 5JIKA 1D5ZB 2XU9A 1XMOT 3PNWA 3UTTA 2GKIA 1ROCA 4AEIL 4C83A 4A1RA 3TWCL 3FTSA 3HE7A 2DQUL 5HCJA 1KY6A 3PJAA 2PCPA 2QQNH 1R9FA 2RQEA 2ZOKA 1OCCB 1I7ZB 2VXVL 4HFUL 1NFIA 3MR9B 3FO0L 3BSGA 3SE4A 4M61A 3T1HT 5J1AB 2E74C 2XYBA 5K1JA 5DVMA 3LK42 2XKSA 5KYXA 4GRLB 4X9GA 3U6RB 2NLJB 5EEXA 4OW6A 5CINL 2NY6B 3TN0D 2C5IT 5LB7B 5B4MD 4EEBA 3FCSB 1EEUA 1HOCA 1LDSA 4GUPB 1ZTMA 5AQTB 4JVWA 3CPUA 3FW6A 4W93A 3AE3A 3ESVF 1TNMA 3E3QE 4U3XA 1GC1C 2JCCA 1A9EB 3MLWH 5I16A 2XSKA 2ZZUT 4WW2F 1A6TB 1GA2A 2CBQA 4ZFOB 1W0VA 1RVFL 2B9AA 5DJCB 4IBSA 2MQ0A 2XVGA 4MDJA 2P42B 5TDNA 3ZL2A 3TNNA 1T7YA 1ZA3B 4ZI2D 4CVXB 4OFZA 4W4OA 3TO2A 1P7BA 1ML0A 2A5UA 4DJMA 2DQHL 2VLRA 4PJ7A 4S1DD 4WU7B 2XTJE 3RIAF 1JJUA 4NWTH 1S6NA 3FQ2A 5AUMA 3CKDA 1RH8A 2YO3A 2UX6A 1GCFA 2YMTA 3RIFF 3MTRA 3FH5A 4JHWL 4MD4B 1DQLH 4ERSL 1Z9PA 1HHHB 4OT1H 5H4YA 15C8H 1MQKL 3M6DA 4EN3D 3U25A 4QNPF 2AJYH 2CJSA 3WIFA 3TJEH 5I5RA 2H6UA 3T4AA 4K5LA 4XMUA 5K9KB 2DIBA 2B08A 1XHHA 4EYUA 4OTXL 5DMIL 1ZTXH 4NQTA 1KLGA 3SZKC 4XXWC 1KEGH 1MW0A 5DZOA 2F53D 2W9EH 5DXWA 4KKZA 3WI9A 4XC3H 1CICC 4OIIL 1CQKA 2MCPH 1D9KD 1JNJA 4H25A 4L8CA 3VQ2C 4U1HB 1UD8A 4KI5C 5T1KB 3POCA 2HKHL 3IA3A 1MWAA 4L9LA 1DCEA 3ASNB 3QC6X 4OD3L 4MDRA 2AQ3A 2R29L 1SLVA 4XBGA 1JGDB 1WBYB 2P5WB 1W80A 3DTXA 3KJ6H 4K23L 5GGVY 3QUZD 1NCWL 4IKJA 5F9JB 5IHLB 3GSWA 2HH7A 1OTSC 4L0PB 1YN7A 5IBUG 4RGNB 4G8FB 1A2YA 4AZ8A 5KSVA 4O58H 4WUKL 2UWEA 1QQDB 1LO2H 2DDQL 5A1AA 5D1QE 1F3JA 1MIML 2K9AA 1F3DJ 4N86A 2VLKA 3V5DB 1A6AB 4DV7T 3OAZH 1TU2B 2SEBB 4GT0A 3SODB 1IQWL 3IMSA 5LXTE 4NPKA 2BG9C 3IXAB 1TPXB 3PYCA 3EGSA 2J8UB 2VZOA 4XOAA 1MOEA 4C56D 1JNRA 2V33A 5AYQA 4ZZBA 5C08A 5D2LB 5AQMB 1IM9A 1XL4A 1EZ3A 3C60B 4P2OD 4PRHD 4XO5A 5EU6A 5JHDD 5CILL 5C07D 1IGJB 1KSRA 1CCZA 3MNWA 4A2MA 2IV8A 1NAKL 2BMKA 5JW5B 2JCCF 2KSRA 1T6WA 3VB9A 4MX7A 4WW0A 3D06A 4K9EC 5AOLA 4BSVA 2ICWJ 5GGUB 3FSZA 1UZ6E 3GRWL 1LVKA 3MRLB 3FXDB 4FQIL 4QJ3B 2C3GA 2ZICA 3MCLH 1UWGH