4G2AA

Crystal structure of a putative nutrient binding protein (lpg2210) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.33 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
321
structure length
321
Chain Sequence
NDTAVGGEGSLPIPVSQPHIKMVSELIRISGKNLNEPQMNGSWHYNCNFTFKNTLNKEVTISMAFPFPINDGNSEIALPAGQQTNVGQALVYDFLVTVNDKQVSAQRGNIAPDQNKGLYYEDAYFWKTTFPPLATVNIHHDYSTGATYDVMGYHWVRYVLKTGALWQDSSIGHTRLEVIPNTPTRLCSEIDQKADYLNPTPSGMSISGSRADRKYIWDLRHFQPQADLSLCLFTGISYVRYKVIYPWLNSDDALSKLARLSNKELRFLRNTIYAQYGRQFQSPDLQEYFSKKWWYVPNPDYSDRMLNEEDKKLLSMINQAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (lpg2210) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1 at 2.33 A resolution
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Structural genomics, unknown function
total genus 77
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13308 YARHG YARHG domain
A PF14415 DUF4424 Domain of unknown function (DUF4424)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1690 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4g2aA02
2.60.40.3680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g2aA01
4G2AA
chains in the Genus database with same CATH superfamily
3J8F7 3WS3A 1FN4B 1DQTA 4HD9A 2ZNWA 1XSJA 3B3BA 5EMYA 4NZFA 1BSIA 4FXGB 5L2KB 1XL4A 2OL3L 2AJ3A 3TBVB 3ZYIA 1YYMH 4XCNA 3H6JA 4WNSA 4OF0A 2AK1H 4DPCX 4KTEL 5DC9B 3SPJA 5B38B 3KLKA 1LQBC 1FE8H 2QQLH 3QJOA 5F0MB 2XPGB 2N7SA 1CL7L 2PMZA 1XF4B 4RBPK 4GP5B 3RUGF 2XUEA 4HISA 2DD8H 4IBWA 1GIGH 3OD3A 4C4BA 4HC1H 5TE6L 1E6OL 3PWPB 3IU4H 3HC4L 3JVGA 4UT7H 2D0HA 3VSTA 4C83B 3I0QA 3F2LA 2CRYA 3RU8H 2WGNB 3UBFA 3OC8A 3O3AB 2XVKA 4EIWA 1MFCH 4LGPB 5T1KA 5EB9A 2EYTB 2EDKA 3DI3B 3ENEA 4J4PC 3FL7A 3WLWC 4D0DA 3GMRA 3IRPX 4A2DA 1URZA 1JPST 2O4EA 3MXVL 3T77A 3VRAA 1OALA 3DBXB 5LAXA 3QDGB 4QMEA 1F4HA 4EDXB 2FSEB 1ZSDB 2LGNA 1B2WH 2YGQA 3BEVB 4M61A 4ENED 3HZYB 1JVKA 4GKSA 3MX0A 1DVSA 5LN8A 3VRLF 3IDMB 1QNIA 3FHEA 1HX0A 5EOQH 5EU3A 4AV0A 2E5VA 4E7ZA 4N8VG 1OM3H 3JVGC 3OR6A 3FT2A 4RVBA 4HKJB 2V2TA 1MUJA 4KRPB 3WFHB 1NM9A 1BD2B 2JI1A 4OFPA 3MRPB 4PK6A 3O3DB 1SMOA 4HGAA 3X1FA 1QBAA 2VZOA 1RIHH 5IB3A 1NSNH 1VZIA 3QHFH 3T3MB 3NUKA 3SWHA 1HTJF 1TO5A 4GYBA 5LCVH 4IRJA 3WIFB 3ARDB 3D69B 4HLEA 1U8KB 1FF5A 1S3KL 4KXZI 3D2TA 3W1ZA 3JTBA 4TX5A 4Y1TA 3UIZA 1A1OB 1YEEH 3W2DL 1N2RB 1BVNT 5BW7C 3EO0A 2OX5B 2JCCB 2A77L 4NUMA 3SQRA 4PW4A 2FO1A 1NOAA 2OMYA 1ZV5A 1S7QB 5EK3A 4XP9H 2J25A 4RFEB 3O2WH 3QNXB 3ZZQA 1T0MA 1OE2A 1TU2A 2AGJL 3BWAA 1OEDE 1OPOA 5E6IB 5ESVB 4JG1H 3KBUA 1YO4A 2C4XA 3O6KL 3VXQA 1UFGA 4G9DB 3WN5B 2VN3A 1NBVH 4R5XA 3K6SB 3IJEA 3PWVA 4AYFA 3M1OA 3BZFA 1HJBC 4HXBL 5FYLE 4H44C 4IRJC 1AIZA 1XCTA 3X1NA 3L3PA 5SWQA 1OAZL 4J4PD 4JRYD 4UEMA 3K8KA 3NIGE 2YQ2A 5D2NB 3S5LA 3WLWD 5HYJE 1J1OH 2LFEA 3C8HA 3FRUA 3FTZA 5IR1B 2BY2A 2J1DG 4QRSB 3A7MA 3UC2A 1VJSA 4BKLB 1IZJA 1DQQA 3JWOC 4IBSA 1ROWA 1CLYL 3BAIA 3BFQG 1PYWA 4Y5XB 3V6OA 4P4KB 3CN3A 3LV3A 1BXVA 3QG7H 1OT1A 1H7CA 1S9WA 3P4MA 4JFEA 4NN7B 3F57A 2DLRA 1Z5HA 3PHOB 1VCBC 3L7FB 3IDYB 3WFDH 3GTVA 5A7EA 2VERN 1ZVYA 4HT1L 5EBLA 5KSBA 1UOLA 4GAGH 5CZKA 4DGIL 3WV0A 2QTEA 3C75A 3JTSA 4XO3A 1FMWA 1EO8L 1JG9A 5EOCH 3U9UA 1K6QH 3SKNA 1JYVA 1T1ZA 4KHPT 4BDVB 5C2BH 4Z7UB 2O5YH 5ETUB 1JZ6A 4XNDA 5HXEA 4CW1A 1FJ1B 1F4YH 3LPFA 3L81A 4N26A 5I8CA 4Y7OC 5ICXA 4QJ3B 4XVTH 2E8IA 3N40P 3GF8A 2Q6WB 2FGZA 4LMQI 3QO1B 3H9HB 3V6OC 3CQCB 4CADA 1JPGB 1P4BH 1YMHB 3K71B 4WGWB 1L6ZA 1HCFX 3BH4A 2AK4D 2OP4L 4H8WC 3CC1A 5IW3A 1QLEH 4LVEA 3L3OA 5DQ9A 3V0IA 1FLTX 2I9LB 4LSQH 2F7QA 1MJ7H 2VDPB 4Z23A 2A9CA 4TUJA 2IMMA 4G70B 3TZVC 4ZTOL 5HTSA 1FNGA 5CILL 2PTVA 2CLVA 1PDKB 2CDFA 4PB0H 2E7DA 2W91A 4KMLB 3WKPA 2VOTA 3L1OL 4AQEA 5FVKA 1O9VA 3R0MA 2BHFA 3DXAE 2NY3B 3R1GH 3GZQA 3IFOA 5F44A 2VUKA 2BS71 1TTAA 5K9OB 1QYGH 4JY4A 1EJ8A 2K70A 1U3HA 1LP9A 3DOHA 1MEXL 2JSFA 5AYUH 1TQUA 3HE6C 3CFQA 2A83B 4PSRA 4QRRA 3BDYH 1G94A 2XIDA 4XT1C 5KANG 2VL5B 3DX8B 1QFUH 4KTYA 4N0UA 4JDZA 1XB3A 3B8SA 4M6OH 4PJ5A 5IQLA 4EBQH 1YXRA 3L5XH 1HKLL 2VDPH 3QUGA 2G3XA 3RGLA 3L08A 3P9MB 2FJFA 5E5MA 3ZEFB 5K9KB 3TH3T 5H37A 3T2NL 4I0UA 1IT9L 5DMKB 2ZLYA 4Y4FC 2HUHA 2Q3XA 2QEJA 5D2LF 2WKLA 3W57A 4BJMA 4M6NH 2X4QB 3DIFB 4MCMA 5HHOA 2R7EB 3UO1H 3MV11 4S10A 5C0FB 4WHYG 3V5DA 2GIYA 1U3HC 5DHMC 1JSYA 3EH3B 3H9SB 2GJ6E 2WSPA 3KV4A 2Z7ZA 3FUHA 5D96C 3FF7A 2F7IA 1MQ8A 1FFPB 3MRQA 3G08B 4UDTA 4UV9B 3ZTEA 2H1XA 4YFDB 1QA9B 2XWXA 1XBRA 3GUTB 3EYUH 2XQYA 5FKYA 2FX7L 1CBVH 5AW5B 3WTYA 1T66C 1ZVSB 5ID0B 5EF2A 3QOFA 1ZT1A 4MZ2A 5CIPA 4U6YB 4P4RB 2V17L 3TZVD 5GS0D 1ZJBA 2JVUA 3FQRB 4HU2A 3CSGA 2V5CA 4PG2C 3ZQXA 4HIIA 1JHTB 2ZUQB 2WBJA 1EHLL 1Q9KA 2VL8A 3H3PL 3GI8H 3DGGA 4M62L 3KPSD 3AGVA 2I32A 1NGWB 5L7XH 4GKLA 5L8LB 3BYTA 4KTDH 4BZ2A 2UZYA 1KENH 3UABA 1F4XH 3KL0A 1LD9B 3TIDA 1CFMA 1HZHH 2O5ZL 4PJHA 3SPHA 1AD9B 4DVBA 1SBBA 2YIHA 4PJ7E 1KC5L 5C2UB 3NA4A 1KLUB 2CGZA 5LNGA 2X9ZA 1NBZB 3NSJA 3OKMA 4NKIH 3UULA 1F1GA 3FYEB 5HDLA 5SWZD 3ZMVB 4DH2A 1E7PA 3HE6D 2ED6A 2NNXA 1LEIB 2K6WA 4JO4L 1AG6A 3KR3L 4J1UB 4BZ2L 3NABH 1R3LB 5EG6C 2D0TA 1U4QA 2BKPA 3HVNA 4D8PB 3T2PA 3S37H 2QQNL 2K6YA 5J1AB 5F8PA 5EN2B 1SVZA 1EAQA 4N68A 4NLHA 3Q8BA 3S2AA 4BFIB 5BMFH 5LAPA 3WTVA 2W88A 2M6BA 4MNGE 2ZUSA 3WBDA 3ZHNA 2WBJC 1P7HL 1QD0A 5HYAA 2DLEA 5F6HJ 3EJYC 4RQQB 2W92A 1KY7A 4Y4FD 3SZ6A 2Z7WA 3NVQA 2XU9A 5IB5A 5JORB 3BZ4A 3QZNA 5ECJE 2FSDA 5HXRA 5GGUA 1OAUH 4WWID 3DTOA 2VLRD 5CA0E 2WJ5A 4PU2A 1JK8B 1U3HD 5CXPA 3AA6B 2H2PD 3CQFA 1HDMB 4YEFA 1WFMA 4IDLA 4JO2H 4ODUA 3EOTL 5I74C 2R1YB 3UU4A 3UACA 1CFNB 4PSPA 2TAAA 2K4AA 3QNYB 4R90H 4G5ZL 2QADB 1IM3A 5T1LD 1NDMB 3FT9A 1JPSH 2ZSVB 2J8UA 4U7YA 3QZPA 5LB7B 2ZCLL 4K15A 2XSBA 1SOKA 5C07A 1AHKA 1WBZA 3LKOB 5CGBA 3F31A 1EAPA 1U0QA 1A47A 4OGXH 4IE0A 4LLUA 3WELA 4ZW3A 2VSMB 2J72A 2HJFB 4DAGL 2BPBA 1MHEB 2DS4A 2Q2LA 5SWSE 3W3BA 1TQWA 5JW4R 2IJ0C 3RIUA 3LKSA 4NGHH 3U1QA 3Q2VA 4RFNB 3JAEA 4TUUA 2YU1A 4RMUA 1RZIB 5LDSA 3PUGA 1LILA 3GZOA 1KPUA 1OGAD 4ZTEA 4GKNB 4P9MH 5TE4H 4KZDL 4DV5T 2E27L 3KXFB 3IDNA 2VRKA 3O3UN 3U0WL 4EXKA 3I6SA 4U1MB 1AO7E 2H3RA 4HPOL 4M7LL 4WKZA 5MEPB 3BRFA 3QP3A 4DR3T 1S94A 4OV5A 3B7UX 2NSXA 1JGLH 4JUYA 2WP3O 4NKDB 4MHHI 2HG0A 5CUSL 4DMWA 1UXSB 3CFEA 2F58L 3Q6GH 1XD0A 4G7YL 3OKQA 4MX7B 2G2RB 2DQCH 4H88L 1NFIB 3FTYA 1MRDH 5E4EB 5C0AD 2VW6A 5HDRA 4LAJH 3WJMA 3ZL4H 5I6LA 5E94A 3CQQA 4OLZL 4RESB 4Q6YA 1R0AH 4NP9A 1FDLH 1KTLB 3CZGA 4XPGL 3RA7H 1S9XA 1CD1B 2WBJD 4FTVD 2MIZA 2EE2A 1GZQA 1EHKB 2CRBA 3EJYD 4JPWH 3BX7C 4M5ZH 2F08A 1CCZA 3OXSA 1TPXB 4GKZB 3Q6FA 5E4IA 3RQWA 3MLRH 2Q1EA 3QK0A 3LIUA 5KSAB 1IAIM 2X0WA 5HEGA 1AOHA 3SE8L 5DQDL 2VDOH 3O4LA 5F7FA 3T09A 3MGOB 3AXIA 2VN6A 3TYFB 3RIAF 4B9PA 5D71H 1FVDA 3ZT7A 2BVUA 3CDFA 1T5WA 3P4OB 1FGNL 4F2EA 1N33T 1IIKA 1RUAL 2OMXA 4X5XA 1MHHB 3VD0A 1J5HA 1BPLB 3NA9H 1VA9A 4RISL 3APMA 4TSCH 1AOZA 3FCGA 3EJZC 4LCIL 3OAYH 3DO7B 3FSOA 3TM6A 3KCWA 2HCZX 1ND0A 1Q90A 1AY1H 3MRLB 1FNHA 3SB3A 5BS0D 5LOVE 2V6XA 5EO9B 5IFJB 5KW9L 1ULVA 1OTUD 2R23B 4NENB 4NKOA 2D03L 3ZDWA 5EU6B 4EI6A 2D3JA 4LCCA 3CFCH 5IY5B 1S7VB 4EZJA 3SYPA 4FKHA 4DGYL 4NNYB 3TF7C 4OJYA 3U4AA 4LLQA 1JK9B 3DHJA 1NCDL 4PJIF 1JF6A 4DMVA 3G5VB 1DQML 2OJEA 2JQZA 5BO0D 3SOBL 3B9KD 3MNWB 1TSRA 4N9GA 5CJQH 1QBMH 1SVBA 4UB0H 1K85A 2FQGA 3BPNB 1AACA 3VHLA 2B76A 5DFAA 4PJ6A 2A6JB 1WBYB 3QH3B 2DYRB 2V9QA 4FA6A 4AUJA 1IBKT 4J12A 3QAZC 4M7ZB 5AD0B 5C09B 3TCLB 4QHLA 1EGJA 3DECA 5D7KE 3UG5A 4A7UA 5JXEC 3WO4C 1BR0A 2X4SA 4ZI7E 3VI3F 3D5OF 4W9ZA 3G9VA 3CFDB 1R9FA 2W9EL 1PSKH 3IRZA 4MQXC 4HKBA 4IEFA 2A9NH 1UZ6E 4KVCH 3ZE1B 1A4JB 1UH3A 4M5YL 3THML 4EE2A 3QIWA 2GBAA 4QKNA 2L8AA 4CI1B 3KBHE 4LCCC 4ILDA 1BZ7B 3V52H 1KBGL 3P4LA 4H4NA 5CO1A 4QNPE 1KJ2B 1EGJL 4QT5B 1KTBA 3QNUA 3RGHA 2AAVA 4OI9A 5DFTA 4ZI8A 5HI5C 1Z0MA 3MV7E 2PO6C 1IJNA 2LV4A 4JE0A 2BDNL 2D3NA 1SF5A 5E7BA 3NZUA 1XMEB 4X4ME 4NZ8A 4JM2F 5HJDA 5DD1H 2JLPA 2PXYB 3FQ1A 3TPUB 4MDRA 2EH8L 3WU1A 1KNPA 1BBJA 3ECBB 2XG4A 3CVDA 3HC0B 2HTLC 4OIIL 2QHRL 2FJSA 3W81A 2BZDA 2CBMA 3EJZD 2YEVB 2AI0H 4ZS2A 1WFUA 2XQ0A 4OZGF 3QIWC 3MV01 4JO1L 4WFGE 1YHPA 2YD6A 2E76C 2BCKA 2BRRH 3MKKA 3WE1A 5LGHL 3KDMB 3NJJA 4R7DA 1AR1C 1I7UB 1OB0A 1MI5E 2EO1A 4OCLC 3NCYP 4JRXE 1BVNP 3HG1A 1CDJA 1CFTA 1I1AC 3P77A 5IW6A 1KJ2H 2WVVB 1Z9SA 2ZXGA 5CKAA 4AXWB 4Y7MA 4G6AC 2V7HA 2MCAA 3P0YH 1TTUA 4OZHE 2HUEA 4KV5E 3ABKB 3RP1A 3VI4E 1SUMB 1AXTL 2ZF9A 2P5EA 2C9AA 2Y25A 3KPLA 4JM2D 1D2PA 5JIQA 1FFOA 4XBGA 2CDGB 4W9IC 3HJEA 3SHSA 3RYFE 5T1MB 5DLMH 1AYOA 1KF9B 3GTTA 5E2JA 2CHXA 2B59A 1KCUH 3PJSB 4JKPH 3AE1A 3F12A 4JHVA 4P2OA 5I1IH 3Q05A 1E28B 2LTQC 3V4PA 1N34T 5JXED 2OSWA 4PJFE 3M7OA 3J7HA 4ONFH 1NZRA 4H1LG 2OL3B 4MQXD 3NRFA 1NM4A 1BZ8A 2OR9H 4G8IA 1AD0B 4JHWH 1F58L 1UCTA 3FRPA 5FKAA 1MRFH 3AS1A 2VZ3A 3C6LA 3CMOH 4FULA 1TVDA 4RIRB 3UP1A 4XMKH 1SLVA 2ZKWA 4AOFA 4YO0B 3V4PL 3WS3B 2VO5A 3MC0A 4TV3A 5HI5D 5L9DL 3D07A 4EQ3A 2AJ3B 2PO6D 4LHUA 5FFOA 3EDJA 1JF5A 2XIIA 3EI0A 2KLTA 2PYFA 3DSFH 4NO0D 4XCNB 5IVXF 1KFGA 1OT2A 4I55E 1VERA 1H15A 1H6EA 1A14H 4MFRA 5C0BA 4W4NA 2Z9TA 4YLBA 1GYWA 1FSKB 2VISA 3OKOA 5FYJD 3ZN1B 1BEYH 2I5YL 4PRAA 4RFOL 3UP6A 2HTLD 2GHWB 3G5ZA 5EUOA 4A2FA 3PWJA 2C3VB 3MLZL 3SYAA 5CJXA 3U9PL 2OJZL 2C5KT 4HW6A 4KJWC 5CEZD 3PWLB 3AA1B 3Q5WA 2EDYA 2VXQA 1L3WA 1I3GH 3WKML 3C6LC 2OL3H 3QIWD 4OHFA 2ZPKL 5T1KB 4JBSA 3K6NA 4DOHE 2X4TB 4AT6A 2EILB 1AR1D 2UUAT 3OKYA 3C87A 4KTEH 3RIFF 3TYGL 3T77B 4EI5A 5MENE 3W0WA 2OULB 1I1AD 5LAXB 3GYRA 1CL7H 1KYAA 5A2IH 3D0VA 2FHFA 1PKQB 5D5MA 3WDJA 5IV2A 4PK5A 1RI8A 2C8NA 2VXQL 3PP3H 5I5IA 1CUOA 4GKSB 3DK0A 4TQPA 5TE6H 1E6OH 1KB5A 3MX0B 3HC4H 3SO3C 2PABA 5F3FA 4R7LA 4DIXA 5DVOA 4RMRA 5JDLA 4QF1A 2BG9E 3SKOB 1SHWA 2YUWA 1V54B 5DFVC 3M86A 5EU3B 1T6VN 5FYKE 4DT2A 2VLME 3D2UD 1D9KA 1GL4B 3ZDZE 4EF3A 3WG7B 5AQNB 3R7QA 4AQOA 1IGTB 3LD8C 3EOBA 3OR6B 4JHUA 3IS0X 2V2TB 1F6AB 1MUJB 1QLFA 3NTCL 1OP9A 2F0CA 4FA7B 2I9TA 1KB5L 1CT8A 1P84K 2EIBA 4ANVA 3LSOA 4GYRA 4KKNA 2XXCB 1JV5A 3VFRA 5IB3B 1SJMA 1MCHA 3NSYA 4K7FA 3GIZL 4EI5C 1N5AA 1PZ5A 4XI5C 3HG1D 5D4QA 4IRJB 3GT6A 1AZUA 4I4WA 4K7PL 1Y07A 3KYOA 3C09B 4QRBA 4UILH 5BZZA 1MCWW 4MNQE 2O5NA 1BAFH 2G3ZA 2O6FA 2VUOA 3AG4B 2WCAA 2XY2A 3OGOE 3SBPA 3UPRA 1M7IB 1R3KA 1XGTA 2AQ2A 3EO0B 1LO4L 4PJAA 3U30C 4QRPE 4Z7VA 5JIMA 5TQ2L 3SE4C 3WDIA 3FOMA 2WMOA 1E3ZA 2XACC 1G73A 3PE9A 1D9KC 3VU7H 5HEOA 1K72A 1T0MB 2G9HA 5DEGB 9PCYA 2QELA 5DJ8A 1NA8A 1TU2B 3FDWA 3BWAB 3QJQB 2DQTL 2OW6A 5AW7B 1TMQA 1S46A 3BAXA 1CR9H 3GXFA 3VXQB 1S3KH 1OB1A 1KEMH 4I77L 4ACPA 3KDSE 3NIFF 3PWVB 1MIML 2WW8A 4J23A 2A77H 3B2DC 5CFAA 1OLZA 3C6LD 4QUOA 5JUEL 1HEZA 1XCTB 3OWEA 5SWQB 1KYOK 3HE7C 2F19H 3HG0A 2GK2A 3S5LB 2H0FA 1RZ7H 4M8VA 3FRUB 5FCSH 1TQVA 2ADGB 1ZVHA 3RHWF 5IYZE 1DQQB 4LHUD 1TZHA 5HGAA 4IRSA 2P7TB 1JWSA 3O6KH 1PZCA 5CJBA 1WR0A 2ES0A 2ZX5A 3JV4A 3DX6A 1IAKA 3P4MB 4H0LC 4JFEB 4LNRA 3T0VA 3VXMD 3A5XA 2Q7NA 2EC9U 4YLCA 1AFVL 4HXBH 1U8HA 3AG1B 3HI5H 3TN0A 4EMZA 1I8MA 5JZ7D 1EXHA 4JI0T 3NSDA 2DOCA 5DFVD 2A9AA 1L5GA 3PDGA 1JTPA 3ATEA 4UANA 1OAZH 5EBLB 3RTQA 3VXUD 4PJ9A 3V4VH 3ZYLA 5AVUB 1MCIA 3JTSB 1DVYA 4DV0T 3A5VA 3U9UB 4LT7A 4TQEL 2A9DA 1T1ZB 4PRDA 4JNXA 4DP4X 1CLYH 1J8HD 1ETJA 3CHXA 4DKDC 1NCBL 3F84A 3HLKA 4CW1B 1RIVL 2X89A 4XI5D 3W0WD 1T1XA 4C58B 1DBMH 2WTOA 3VXSD 3PGDA 4HT1H 3MRCA 3FH5A 4OSUL 1SN0A 1KYUA 1S7SA 4IRSC 4Y8AA 2X05A 4DGIH 4RRPM 5HYIA 4G6JL 1S7UA 4CADB 5GZOD 4PS8A 3QHZL 1EO8H 3UAEA 3TN0C 4X4KA 1VCTA 3L3OB 4OFDA 2FJGB 5CZXC 3O1IA 3ARXA 4X5QA 2L8KA 3SDAA 4PJ9C 1U2YA 3QJVB 2X38A 2YC1B 4R4FH 2V8LA 3P3RA 4PJXE 2O6DA 4TUJB 1C8PA 3EUUA 3ZT6A 2LR4A 1H0DA 1FNGB 3FAXA 2WUCL 2A3DA 1SM3L 2MYSA 1UKTA 4FFTA 2CLVB 1FFTB 1ZIAA 1X9RA 1AKPA 3WLBA 3NG5A 2OK0H 2X88A 4KDTA 4PYGA 5EV7A 4U1NA 1KXTA 4Y4FB 3MBEA 2NSQA 2OP4H 2AITA 3HE7D 3FFDA 2ZD0A 3ZKNC 3IFOB 3UL4A 3MACH 3SDDA 4MB4A 1RPKA 3MBWA 1KIPA 3CPUA 4JY4B 5ESAA 3C50A 3FCBA 2QKSA 5C7ZA 1U3HB 1B2YA 1O75A 2ZKMX 1LP9B 5AW1B 4ZTOH 2PWGA 5IF0A 2OLDA 1V3KA 2YUXA 3I50H 2WQ8A 1WHOA 4QRRB 5CILH 1MNNA 4AK1A 2J21A 5D96B 4NNPL 2ENPA 3PUXF 2FUTA 3SDAC 1RSYA 3W37A 1QWNA 5HEUA 2ADFH 2BP0A 3L1OH 3SJVD 1Q9OA 3F6IA 3EZ8A 4JDZB 3EBAA 4MXQC 4N0UB 3A47A 2FRGP 4PJ5B 4KBPA 2BVYA 4LSSL 2OMZA 2PPAA 2Y7OA 3LEXA 2PETA 4GNKB 2FJFB 5E5MB 3WKYA 4F20A 2CXDA 1R19A 2IWFA 2C9QA 2A0LC 2XNAB 3WUWG 4YSZA 1HF8A 4AQFC 2OBGA 1A4KA 1MEXH 1JRHL 3EJQA 4YHKL 3MBEC 5K69A 3KLSA 1JHKL 2LOSA 4Q9RL 3R8BB 3FU9A 4R7VA 4GAJL 3MVSA 1IFGA 1YEIL 5T3ZH 1GR7A 3B5TA 3SDDC 5HHOB 1DVFA 2LAGB 3VX0A 1OGAB 3V5DB 5BQ7A 4C54A 1HKLH 3EJTA 3BH8A 4X6DE 4Y8DC 4ZXBA 1B7TA 3DVGA 3QJUB 4P3CL 5GJSL 4LF6T 3MRQB 4NOBA 5DS2A 4Y16D 5EIVA 3T2NH 1S3RA 2D2SA 2AEIT 2P43B 1IT9H 5AQTB 1P0SE 3S3JA 4TS6A 4CDHA 5AW3B 5CZXD 3DYMA 3RZWA 5ISZA 3BUIA 1JV2A 2Y7NA 1CE1L 4JHAL 5ECGA 2Y24A 1ZT1B 3KYNA 5CIPB 3EXJA 4ZW5A 4MDJA 5KAQF 1YMMA 4EKJA 1UZGA 2CA5A 4ANJA 5H37H 3OLEA 1EUUA 4U7SA 2WBJB 1Q9KB 3OJ2C 5EBWA 4U7MA 3DGGB 1A7QL 1VEPA 4ONHA 3LNGA 8PAZA 1DVFC 2X68A 5HY9A 4Y19A 2UZYB 4DCQB 3TIDB 2FX7H 4WEEA 3ZKND 4ADZA 2I60L 2H5UA 2VE6B 4PJHB 1EWHA 5GGTH 3VWKC 4K9EC 2XY8B 1ONQA 2CNZA 2NZ1A 3OKMB 4FC3E 4OIAA 4FXKA 1H8SA 2V17H 2IQ9L 2AMGA 3A22A 5I74B 3EUHA 1ZAGA 4RMSA 5JQIB 2H1LM 4DZ8A 3H3PH 3INOA 2P49B 4O00A 4JMNA 4M62H 2ZG3A 1YNLL 1W8NA 3AB0B 4JFHE 2AC0A 2FBWA 4H8VA 1D7DA 5HVFB 4M7JL 3ILQC 1AANA 3KWTA 4X98A 5CIPH 4NNXA 2O5ZH 2IWEA 4RAUA 3S4UA 4HFHA 4KXAA 3TEXA 1KC5H 4U1JA 1UK5A 2A0LD 4GI9A 3BAWA 1FLRL 1A2YA 3ANWA 1A3LH 3EHZA 1KGCE 4PVMA 5IB5B 3MBED 3GWJA 5CN3A 3BZ4B 4FERA 3O3BA 4JO4H 3KR3H 2N2NA 4MNHA 4U7KA 1N10A 4HIEA 3TLWA 1F1DA 5GGUB 2Q87A 3SDDD 2TSBA 1A6ZA 1T98A 2QQNH 4FXKC 4JPVL 4WEUD 3CWZB 1EJOH 1Y6NR 4GXUN 2VDQB 3RWEA 3K0YA 5G5DA 1G1OA 1MMDA 1IM3B 4JQVC 3UBXI 3IRCA 5I15H 2BDEA 3HRZA 3AY2A 4P06A 2XOTA 5C07B 1RZ8A 1WBZB 4M4RA 3LRGA 5GGRY 3TCXA 3PFQA 2YU2A 3VGBA 3RLFF 3LKSB 2D8KA 2DMHA 3NRYA 3J7Yq 4QXGL 4G5ZH 3QWOA 3BWSA 3I9GL 3IGFA 3KE0A 3TTSA 3UPAA 1KPUB 1NC4A 5IZ7A 2ZCLH 3QR1A 4U0RB 2EDBA 4YSPA 3IDNB 3SKUD 2UZXA 1JZGA 3VWKD 1HZLA 4F7TA 4WKZB 1IBGL 2NTFA 4XVOA 2VQET 4U1SA 4PJIB 4Q14A 4OV5B 2X4PA 1U8LA 4LL1A 2WLMA 4DAGH 4DEUA 1U58A 5DRNB 1N0LB 5H4YA 4NO3A 3CFEB 3VQ2C 2WLYA 3FUJA 2E47A 4K3DL 3SGDI 5ISZD 1XVSA 2JQKA 2B4CH 3FT0A 3QYCA 3QZLA 4CBPA 2A73A 2WCSA 2PPCA 5HDBE 3WJMB 1L6XA 1DJYA 1PLGH 5E94B 3W9DA 3DKHA 1JIBA 1FUNA 1YMMD 3ILQD 3PHQA 2E27H 3U0PA 2GT9A 3O1HA 3ULUE 4WV1A 1DYZA 1SLXA 1X5GA 3S34L 1S7TA 4B53A 5I71C 3EGSA 4JYAT 3OXSB 1BM3L 4HBCL 3EYFA 3Q6FB 3B56A 4Y19D 4QR7A 4XTRC 5CUSH 2F58H 4X1KE 3IFLH 4NM8L 2UWEF 4H88H 4XOCA 3RY4A 1CGWA 3TH2T 1NKGA 1OTSC 3RBSA 2D7OA 3UTZA 4YMPA 4XPGH 5LDUA 1S9KC 2GJ6A 3E0ZA 3VD4A 2ZAHA 3OBVE 1T5WB 2AJYL 5EOCJ 3QEQE 2OMXB 4X5XB 4ILBA 3CH1A 2FBJL 2B77A 4XMZA 4YXHL 3QAZB 4F57L 2GEQA 3HJ0A 2G4EA 2FT6A 4WV1C 4YJ3E 4JI7T 4F58L 2KLSA 3WO4B 4G63A 1WK0A 4HCRH 3SE8H 5DQDH 2UXVA 5B3NA 1HWHB 5AW0B 2D7PA 3CBRA 2H4EA 4F8QA 4NKOB 4EI6B 1FFNB 4LCCB 3PUAA 1NC2D 2DLTA 5CSZA 1C12A 1E9OA 1I8LA 3TO4D 4F7PA 1A4BA 3APNA 4P2CG 2W00A 2JMKA 1RUAH 4X83A 4YSOA 4LLQB 3VG0L 4RISH 4JFOA 4UF7C 2E59A 2WB1A 3HKZA 4ZEYA 3GBML 3DMMA 4DK3A 2VLKD 4NO0B 5T5NG 4N9GB 4U49A 1KEGH 3ARWA 3QDJD 2HHHT 1QKZL 1R6VA 1IAPA 3VR8A 1QFPA 1WH0A 1MNUL 2MOZA 3HN3A 3T0EE 5FW7A 5E8PA 2A9BA 1BIHA 3B2UC 3BZEA 3FQNA 3MLSL 1TEYA 2X4SB 5PAZA 3TBBA 1E30A 1FA4A 4DGYH 2HX9A 5IHBA 4HKBB 2WN3A 4GRLA 4FDWA 4IEFB 4MNGA 1NCDH 1E4WL 3QT2A 5D4IA 5F3HA 3BAYA 3QIWB 2ATAA 4P23A 4XO4A 4I3RH 1DQMH 4WI0A 1I8LC 3SOBH 3TH4T 1XF3A 5F88A 4Z7OB 1KCWA 3PWNB 2FWOA 4J8RA 4RX4D 5E95B 1HE7A 3ZW3A 4X6EA 2N9DA 4D0CA 5IQ7L 3DMMC 5KTEL 5MEOA 1KXQE 1OTSD 2W9EH 3RWGB 1BZDA 1FL6A 5I6KA 4YDZA 3KJ6L 1TTRA 3IE9A 4C56E 4MYWB 3D08A 2W0LA 4AYSA 4DIDB 5B21A 4OM1L 1U8QA 4JM0A 2KXPB 2VASA 3BISA 2HPLA 4A2MA 1KBGH 2XG4B 4ZUTA 1EGJH 4Y5VC 2IPKB 4GRLC 2LHAA 2LTQB 2PCPA 4GQPH 3UTSA 3ZDYF 3RNQA 1MLBA 3SD5A 1M7XA 4TVSa 4P23C 2BSED 3VU2A 4L1TA 4RGMC 1AGDA 2BCKB 3L1EA 5AQMB 3CLFL 2NUPA 2GW5A 4P46C 4R7DB 5I0YA 3HG1B 1Z32X 2VJ0A 1EDHA 4X8GA 1CFTB 3VH8B 5IW6B 2EH8H 3QC9A 1Z9SB 5EUKA 4QXCB 3KCPA 4FFVD 2V7HB 4JHBA 5GS3A 5L3FB 1JYXA 2KQNA 1E4JA 4NC2B 1YEFL 5HYQB 3F8UB 5I5RA 3VQ1C 4OIIH 3RKOA 2P5EB 2QHRH 1S7WA 1H8NA 3ZHDA 4ZFFA 3QPXL 5IFHL 1J7VR 2F61A 2KINB 4OLWL 4YSUA 3AWEA 2E46A 1FFOB 1MH5A 1X9UA 2IGTA 4JO1H 4XBGB 4X9GA 5TDPA 4BWWA 5K9QG 5CR8A 5LGHH 1TT6A 4K73A 5DU7A 3F12B 1PNCA 1D0YA 3NK3A 3CQXC 3HKBE 3V4PB 4LMKA 3B2UD 2OAAA 1OQOA 1AZBA 1DSWA 4L9LC 3V0EA 5LVEA 3EF7A 3QULB 3ZN6A 4V1DD 4ETYA 3D0LA 2WXLA 3CBJB 4G8IB 4OUUA 4DP0X 3BLKA 4NOFA 4MRBA 4R97B 2WZ0A 3C6LB 3JV5A 1H5BA 1L0QA 4WFHE 4PJCE 3IDJA 4NFBA 4L8CA 2HN2A 3N04A 1DBJH 1TYJA 1F13A 5L7XL 2ZICA 3BQUA 2I24N 4GSDL 1HHKA 1Q72L 3B2MA 4LHUB 5FS5A 3RB7A 4ETQA 2BP3A 1J05A 3WEMA 2PYFB 1X5JA 4H63V 3SO3B 5I28A 1H15B 4NQCE 2VQFT 1CF8L 5C0BB 1ZK5A 4HHGA 1IKOP 1F58H 4WUUE 1E2WA 1OE3A 4MMXA 4EUPG 3NSCA 1IGCL 3OKOB 5L4JA 2PWFA 3O8XD 5IVOA 4W9GC 1PAMA 3K3QA 4PRAB 3G5ZB 1WD9A 5EUOB 4EO5A 3V4PH 3PWJB 3LD8B 2AHIA 4Z7QE 3E7JA 1K8IA 4WSGA 5LG4A 3RVVC 5L9DH 3Q5YA 3T1YT 4P23D 1H5BC 2AXWA 4NPYA 3BZDA 2YAOA 2BO0A 4AT6B 4P46D 2D3VA 1NEZA 1X5XA 4ALAH 4EI5B 1XR9A 2IOMA 3W0WB 1AGBB 4AC2A 5CS7A 3D0VB 1QUPA 3VXSB 4ENZA 1AZZC 5D5MB 4XHJD 2I5YH 2VABB 3BHBA 4RFOH 2X7LB 2BNUB 2IANE 1KB5B 3MLZH 3WYRA 4X4XB 3U9PH 2OJZH 4H9SE 2Z6FA 3U30B 4U6VL 5EEVA 1YNTF 1S7XA 3I02A 3GLEA 4MMXC 4IDNA 3WKMH 1WYCA 1DZ0A 2HVKA 5CGYD 4EJ1C 1D9KB 4EIBA 3K3QC 4WLCA 3TYGH 3EOBB 5FGCE 4XCFL 1IC4L 5HHME 5ADXL 1QLFB 4O4JE 3QWNA 4OK0A 4HGWA 3S3BB 1CT8B 5I8EA 2ADJA 5INDA 5IB4B 4LPVA 1DQVA 1ZHLA 4M48L 5FP3A 1JV5B 2VXQH 3MNZA 3VFRB 5EU7E 2ZWZA 4K7FB 1N5AB 1PZ5B 1DQDL 3JUZA 4TM9A 5F3BA 4JUSA 1NCTA 5E5UB 3RL2A 3KM1A 3KYOB 4BK4A 2CKBA 4Z7WF 5CD5C 3HE7B 4ZS6C 1WFNA 1LK3L 5DF0A 2P52A 2NY0C 1D1AA 3UBHA 1R3KB 3UPRB 1XGTB 3N41B 3FCTA 5D7IF 4PJAB 2YD8A 3R4DA 5E0OA 4M93B 4Z7VB 3NTCH 1I1YA 4HIJA 1L0VA 3FOMB 5GJTH 3ZKSD 4I5BA 4WI8A 4BSVA 3S5LG 3FFCE 1MCQA 2DQMA 3S4SG 2G9HB 2CKBL 2PYEE 4D0BB 1AJ3A 1QHPA 4JPQA 2RHEA 2KDGA 5EDXA 3GIZH 3SJVB 2H6PA 4LGSB 1L9MA 3RG1C 2B1AH 4K7PH 4Z76A 2ZE0A 3MRHA 4JCMA 5F1IA 1A65A 2IBZX 2VSDA 1OB1B 3AEAA 3LN9A 2W07A 1WA1X 2X6CA 4NX0A 4O5LL 5KBKA 1JZ4A 2ITFA 1UACH 3W5NA 4XE0A 1BMZA 4LSRL 4NZUL 4AKGA 1HL8A 1GY2A 1LO4H 3P2DA 5LJYH 3RVVD 3RX8A 2ZOTA 5TQ2H 2NSMA 1HEZB 3BSHA 4TNWA 1IQWH 1HU8A 1X5KA 2ARWA 1I8UA 1WAEA 2IOOA 5I30L 5CINL 1WTLA 1MI5A 2COQA 5B4MD 3QDME 2DQTH 3NSXA 5FXWA 5DWUL 1TZHB 5HGAB 1FNLA 4QRFA 1LYQA 4IRSB 2I69A 1JWSB 3AXJA 4YHLL 3NJNA 4I77H 4XNYL 3VI4A 1EZVY 3JV4B 3DX6B 1IAKB 4LNRB 1A6PA 1OAKL 2HFTA 3MV8D 2NTYA 1MIMH 2A6KA 1I8MB 2X1PA 1U8HB 3V4LA 3TN0B 1GJIA 3X1EA 5JUEH 2AVGA 1L5GB 4GIWA 1D1BA 3PFUA 5DHDA 3PAYA 4GI8A 3RTQB 3NCMA 4PJ9B 2KT9A 2DW5A 2IV9A 4OCYH 4GUPB 4O4YL 5C9KA 4WBNE 2F6AA 2ZX6A 4P9HC 4DP6X 1BA9A 3P7IA 4PJFA 1PZ2A 4L2YA 1OD9A 4PRDB 5HGHA 1JPTL 4KO9A 4OQTA 2XN9D 3S35L 5LBQB 3RPUA 4ZI2C 2KKQA 2CO3A 3GPEA 4JY5H 3RWHA 3TVMC 5EDSA 4DZBA 5I76A 1F3DH 1T1XB 1X7SA 4ZMYA 5CLTA 5CD5D 1WPCA 4ZS6D 5M94B 2UZIH 4NFCA 3PGDB 3MRCB 3EYVB 1T5KA 1S7SB 5E0QA 4ABUA 5K59E 4WHCA 4KITB 1D5RA 5LBVA 2ZXBA 3NBXX 2CHOA 1KYFA 1S7UB 2QDVA 1FNFA 4G1MA 4IHBA 4AV4A 1F2XK 4OQTL 4ZMQA 4UM9D 1E67A 3TURA 3DSNA 3DARA 1TMCB 3FH8A 3SDAB 1NCBH 2D9DA 2M8XA 4CDGC 3HZMA 3IEAA 2VKXA 1H0DB 1RMFL 1DZBA 4GUQA 5MERA 1KPVB 5ADOL 3LRMA 1T1WB 4OSUH 1E43A 4LVOC 3WLBB 4HSAC 3GMMA 1BVOA 5D7SL 5KXJA 1KXTB 4K9JA 3QHZH 1XDTT 4MLKA 1VFBA 4RGOL 2BNQD 1I82A 2P46B 4ZTPL 3MBEB 1M05B 5AW4B 1XWMA 4BM7A 1E3XA 5JA8B 3SDDB 3EAKA 5MENA 1CDBA 4OZIE 2X6UA 5H37G 3MBWB 1KIPB 2HN1A 3OB8A 3BWUF 5ESAB 4DPAX 3KMDA 4BA9A 2WUCH 3C51A 1SM3H 3LH2L 2J57A 2JJTA 3T2QA 5EEZA 2KUTA 4JG0L 1FNAA 2CCLA 4JPIB 2BP0B 1VZHA 1YW0A 4B6XA 1Q9OB 4J3WA 1A9EA 2BG9A 2ZKHL 3I3EA 3SGEI 2OMZB 3LEXB 1KB9J 3QFDB 3VM7A 2KHAA 4PWIA 2A5UA 1EXUA 3DUUA 3HS0C 1UATA 3NPZB 3S36L 4KH2A 1A4KB 2XQYG 2DH2A 2KI6A 1OCRB 1MAJA 4KHTL 4ZI2D 1OSEA 1ADWA 2X9WA 5FYKL 3TVMD 2BH0A 4YJZL 1AZRA 1DVFB 4ZUSA 5HWYA 3FO2A 1S6NA 2BY3A 3B9EA 4YLHA 2RP4A 5BQ7B 1VGKA 5AVQB 1FG2A 3UUBA 2XV0A 3BH8B 4NQQA 2E5LT 4B3VA 1AKJD 4LSSH 3VWKB 4U2ZA 2B0SL 2IFGA 3DVGB 5TF1H 1S4IA 3DTXA 4E9WA 1ANUA 2IIJA 5B1JA 4QRPA 1S35A 3RQUA 1NGZA 2BG9C 1JRHH 4DSYA 1CLOL 5JLZA 2P8LA 5ISZB 2P26A 4Q9RH 1Y6MR 3T6XA 4XCCL 1JV2B 4GAJH 3GBDA 3KYNB 4O2AE 4PGEA 1G6RH 2WU2A 5C8YE 3CXDL 3EDKA 3L2NA 4HEME 4MDJB 2WYZA 5BRZD 1YMMB 2J1WA 5HHNA 5EZOL 3ZLIA 3GSQB 3AECA 3CN2A 4W9KC 4ODHL 5EBWB 5KSBF 1L0PA 4P3CH 4YDKL 5GJSH 4ONHB 5HY9B 2G2NA 3V8CA 1QFOA 4Y19B 3WNNA 3H9YA 3OTOT 4JJ5A 2H2SC 1KEYA 4IE5A 3WD5L 3WFBL 3VCLB 1I8AA 1I7RA 5E00A 2WP3T 1JGDA 1N8ZA 2K5BB 4JHAH 2YK0A 1CE1H 3KINB 1ONQB 2PTUA 1N6QH 4UF0A 1QFWI 1T1YB 2CHWA 4FXKB 4ZFOA 4UTAA 2O6PA 4L05A 3MRRA 3IJ9A 4G8GE 5DQJA 2XTJC 1QQDA 4JFXA 3DP7A 1XMOT 3UCQA 1UD6A 4AG4L 4DZ8B 4ASKA 5CU9A 4XO5A 2WXIA 4TRPL 3K2UL 3NAAL 3RI5A 1KIQA 3SCMA 1E65A 2A74A 2TRYA 4AIXA 4PWGA 4PJGA 2ZYSA 4P2RD 4NNXB 2NY2C 3LHPL 3D51A 3OVUB 1OP4A 4ZFOL 4UTAL 2UXTA 2R4RL 1NANH 4U1JB 1ET5A 2A9UA 2CRZA 4ODTL 4UOJA 3GSNH 1A2YB 3ANWB 1OM9A 2HRGA 3ZOAA 1BEXA 4AQAA 4E68A 1MIVA 2IQ9H 4DNLA 3O3BB 5IMOB 4MNHB 3J07A 1M9SA 1C7TA 4Z77A 1LO5B 2R2EA 1A6ZB 1QLRA 3GEFA 2FD6L 3P50A 4M7JH 4OD3H 1VACA 3RWEB 1E4KA 5IQMA 5G5DB 4CJ1A 3HB3D 4XO9A 1NCIA 3CD4A 4F1SA 3P11L 4C55A 3NP4A 4EPSA 4DUZT 3MYJA 4RZCA 1FLRH 2AJXL 1FIGL 3MV9D 3WEOA 1G0DA 1RZ8B 1KTRL 2A2FX 3BZ5A 4M4RB 2LW3A 1EFQA 2D7TL 2F5AL 4KRMB 5CJ8A 3R06B 3X13A 1AR2A 2UXBT 2V5TA 3MCG1 3NZ8A 1CXEA 4JPVH 3EBHA 4WO4A 1L0YA 4HHAA 4F5CE 4JI8T 1PX3A 1OPGL 1E5ZA 4Q9BA 3QWOB 4S0HA 5DTFA 5JIKA 5I71B 3L09A 4KGLA 1YN6A 2C7FA 1XH1A 1CVRA 4Y1SA 3WHXA 1NC4B 2EYRA 4MJ4A 2H2SD 4MBQA 1YQ2A 2D0GA 1WT5C 1GZPB 4JI1T 2AJSH 2UZXB 1DEEA 1E4KC 1R24A 2Z0UA 4HUWA 4ORGA 4Y2LA 4F7TB 1N36T 1F97A 2NTFB 2OW7A 4FNRA 1JXFA 2VO8A 2QYWA 1B3IA 1U8LB 1GS6X 5DK2A 2EVFA 4KKCC 3FHQA 2ATPA 3L3HB 1WUNT 5I6OA 1QFWL 5FUOL 2XTJD 4OGAC 5DHVA 3SKMA 4GQRA 2ADIA 4QXGH 2A73B 2Y5QA 2K9AA 3I9GH 1LNUA 4ZOEA 3W9DB 1K4DA 4F15C 4CC0A 3K3NA 3PHQB 4M3JA 2GT9B 2J1XA 2NY2D 3U0PB 4GP4B 4DP2X 4GW4A 4WV1B 1N6UA 3QUXA 4LRNL 1IBGH 1S7TB 4MA1B 5GRVK 3KYMA 3EGSB 3M3ZB 3US1A 3BLPX 5L47A 3EYFB 3BVWA 4E9TA 5EF3A 3E22E 2MSPA 5IFAL 4HH9A 5DUBA 4XVSL 3KGTA 2YD4A 3RYHE 2WAQA 2X28A 3GB7A 5SX4I 1HNXT 1OK8A 4I4TE 4QO1A 3CX5J 25C8L 5B1CA 2BBHA 5CNHA 5BVPL 5I9QC 5TJWK 1NUDA 3N2KE 2J5LC 1T6BX 1HCYA 3AE5A 4R4BA 3UTZB 4KI1A 2J71A 4X6DA 5DR5H 3UTTE 1Z5LA 2GJ6B 5I1DA 1BZEA 1GZHA 2EHOA 4XN7A 1OQXA 2QPSA 1IO4C 3BKCH 4NKMA 4PM1A 4HBCH 1DSFL 4MHHG 4LLDA 3CH1B 1ACZA 2JJSC 1E2AA 3E38A 1EEYB 4LLMA 4NM8H 3QUXC 1JFQL 4R9HA 2NUTA 3SDXE 5J57B 4IJ3C 1R5VA 3EJSA 4Z0XB 5T3XD 1A8ZA 3FO0L 5TAOA 5JR9C 3GMQA 1D5ZA 5CSZB 3KHQA 1C5CL 1E9OB 2AJYH 4F7PB 4GKKT 5D1XD 3RJOA 3TC9A 1CGXA 5FWQA 5LG3A 1I6ZA 3UROR 3C98B 2YRPA 1WAAE 4XMTA 3OPUA 4JFOB 2K9UA 2GJRA 2OZNA 3QZWA 1QZNA 3RWCA 2VR5A 1GZHC 4F57H 4LB8A 5I16A 2XAQB 4PRIA 3DMMB 4F58H 5F2FA 2CPCA 2AXJA 2WQUA 4Q0XL 2LFGA 1TCRB 1WUZA 3K1SA 4L4VA 1IBDA 3DVNA 3EJUA 2ZOOA 2ZUUA 2HKHH 1ZVNA 4OGAD 2B20A 2MOQA 2EC8A 1WE5A 1PFCA 4OR1A 5E8PB 1MFUA 4POZC 4J3TA 3BZEB 1NCWL 3FQNB 2NNRA 5FGRA 5L6YL 3EABA 4U31A 3FT4A 4CMHC 1E2ZA 3KAAA 5CBEA 5SX5K 3VG0H 4GRLB 1RJZA 2J8UF 1WWWX 4MNGB 5F3HB 4P23B 4WI0B 4RGMB 5D6DC 3WSQL 3GBMH 5MHSE 1QRND 1XF3B 5F88B 5DT1L 2ETWA 4U1HA 1QKZH 4J8RB 1VKXA 3E8UH 1S5HB 1MNUH 2K7PA 2BOCA 4X6EB 1IBHA 2L9QA 4D0CB 3JWNE 3IDIA 4NQSA 1OCZB 4JFSA 5MEOB 3BAEL 2MMXA 5GGVH 3QJTB 3LZNA 4YSAA 1IFHH 3I6KA 1FL6B 2KL6A 2AJVL 4NN6C 3VH8G 4Z7NE 1INEH 1EPFA 4L23A 1E4WH 1UH2A 4OF5A 5IMKA 3N9GL 4LDCA 5GRJL 1U8QB 3TBWA 2ZOLA 2QVAA 5T5FA 3ZQ9A 1EUTA 4ZUTB 4UUJA 5FY7A 2HYMA 2Y36L 2OFQA 4JLRA 1XHHA 3UTSB 2PCPB 3P4RA 3GFUA 4O9HL 3RNQB 1MLBB 5SV3A 4U33A 3JBG7 4LCWD 2P5WE 1HFUA 5FO8A 5I8KL 2XX0A 1NPJA 4KWUA 5ABFA 1AGDB 5SV4A 5IQ7H 5KTEH 1ESOA 4PWEA 1ZHBA 1ZA6A 3L54A 2NUPB 4JFPA 1T3FA 3RWDA 4Q97A 1BMGA 5T5FL 3FXIC 3KJ6H 5EUKB 1LEGA 1WJ3A 3KCPB 5GS1A 5AZ2H 3DDFA 5FHAL 2Y7SA 4MALA 5AZEL 2F18A 4RDQF 2KZ7B 4HD5A 3IFPA 4E9LA 2ODUA 1E8XA 1X4XA 2GVYA 4ZFFB 2HX8A 4AC4A 4NZDA 2O5XH 5TDPB 3X1DA 3IPEA 2XXFA 3CLFH 2VR9A 2XSAA 5DA4A 5KDMC 2GAZA 4JEGB 4LHUG 4QXVA 1A4AA 4POZD 5KYYA 4AQ1A 5JW4Q 5FM4A 3B34A 3NZQA 1HOCA 1X5AA 3AVSA 4K8RH 4JZOB 3AUVA 4HF5L 1NFDF 3M17A 1YEFH 3D0LB 3LZQA 4OUUB 3A23A 4MHCA 4JKNA 5IFHH 1H5BB 4WU7A 4OLWH 3OAZH 4GXVL 5HDOA 3QA3A 5GS1C 4L8CB 3HVDA 5DRZA 4GXUM 4AKQA 3POCA 5AWNL 3BQUB 3LEVL 3CIQA 4Q4EA 1PPIA 4KMTL 1PEWA 2W0FA 4DETA 3GUFA 4ETQB 4L9IA 2WCPA 4UZGA 2MBGA 3VYPA 4L4VD 1YQVH 1GJUA 1NCCH 4YHNA 4QY8A 4GFTB 4MMXB 1DJZA 2CJUL 2B39A 3QARA 5IBUB 3E1F1 3V2AR 1JPFB 4AQ1C 4ABVA 1NIAA 3Q1EA 3CK0L 5L2KE 1K8IB 1UWGL 4PFPA 4GSDH 3HI1A 2ZUTA 1FL5A 3PPEA 1R3JB 4IOIA 4NPYB 4PPTA 4FEMA 1J5ET 5BRQA 1PD6A 3QUYA 4XX1G 3C5ZD 4X0NA 2X2HA 4B9KC 5BZWB 1CF8H 1XR9B 3HBGA 3N2OA 3MRFA 4ANUA 4NJAL 1MY5A 4NQUA 4ZMLA 3ZKRA 4JMXA 3CHRA 1IGCH 4F2FA 3VSVA 1AQKL 4F3FA 3H53A 3BHBB 2NY0B 4QKTA 3PWPE 5IBLC 4AYMC 5AQFB 3MLTA 1N32T 1U42A 2ZKYA 3FW6A 2P24A 4GBXD 3U79A 4UM9B 3I02B 5J7CC 4ZHQE 4AQ8A 4LGRB 5F93C 2GQHA 1WWBX 4AMKL 2HVKB 3C9NA 1DFBL 4DFHA 1NMAH 3IDXH 2HZHA 3VB8A 5FL0A 1VCSA 2NYYC 4AYDC 4XVJL 5C3TA 4HG4J 3QDGE 2YJLA 4HGWB 4BH8A 3T0EA 3FTUA 5I8EB 2ADJB 2V5YA 4JL1A 1ZHLB 5K1JA 2EIEA 1SJEB 2HT3C 3CFMA 3DTUB 3PUQA 3QUYC 3V10A 1WICA 3D12B 2FWSA 4HS3B 5F3BB 3RL2B 4AWJC 5IW1A 2C3WA 2CKBB 4YHMH 3NJXA 3K6OA 3UGXA 4BV1A 1Q0XH 1BR1A 1NGXA 3MU3A 5KYXA 2NXZC 4QXWA 2DTML 2YJQA 5E2TL 3FCTB 2GJZB 4XCFH 2ZX9A 1IC4H 1P2CA 4LHJB 2XASB 1BD2E 1I1YB 4HIJB 4FLHA 4BSVB 4I5BB 4K3GA 4AQ8C 3NCWA 2VDNL 4M48H 3U82B 4CI2B 2VKJA 2HJLA 1U2CA 2YRLA 3T3ME 1IAII 3BT2L 4FKEA 4C56A 1DQDH 2H6PB 3WNIA 5EC2A 4HWIB 1I75A 3WI3A 3BP4A 4Z76B 5C0NC 3MRHB 5F1IB 4JZNA 5AFUL 4G5AA 4KOBA 1LK3H 2W07B 3UADA 1YEWA 3ARGC 3CHQA 2H3KA 3AAIA 3DX4A 2Q7YB 1CIUA 1OGPA 1SUHA 3P30H 4FF9A 1RJLA 2HT4C 3FHNA 3N6YA 4K0OA 3NQIA 1NMCC 5KS9A 3DPDA 3TVMB 4P5MA 2CKBH 1MI5B 3AEBA 4JFQA 2EZ0C 2B8OT 3H3KA 3QCTL 4KKLC 2E2AA 1G5AA 2VXUL 4QHMB 1MHCA 2XZCL 4JE4B 1MKFA 4MA3A 4MRCA 4H9RC 4NIKB 4O5LH 4X6BA 5IBLD 1S8DA 3VI4B 1ZA3A 3NT0A 1R8IA 4NUPA 4LSRH 5CD3A 5KJ7E 2A6KB 2VN4A 1PZSA 3MGTB 2KT6A 3KJ4C 1MIEL 5J6GA 1UD2A 1NPNA 4ZFZB 4PCSA 2KNDA 2PW1B 4YE0A 4AKIA 2M26A 4FQCL 2YGOA 5I30H 5CINH 2NYYD 1OAXL 3L2LA 5BRZB 3S37X 3BD4A 2LVCA 1CFSB 4PJFB 5DWUH 1SEQH 2SODB 5HGHB 2HT3D 4LVOB 2ALAA 2NNCA 4JFVA 5JDHA 1RFDL 3RWHB 4YHYC 4DZBB 4JFDD 5EBGA 1OAKH 3AMKA 3VGFA 4NXSA 5F8RC 4TZ4C 3K80A 2FUQA 2ACXA 5KAQG 1IL1A 2NXZD 2PTTA 3HBPA 3IGAA 1FC1A 2CJSA 2IDUA 4G1MB 4O4YH 1UTDA 4POUB 3PREA 4OD2A 2NR6A 2ZUYA 4FYSA 4IDJL 5AKSA 5EORL 3WIIL 3DSNB 1ZTXL 3LOWA 5GS2D 3VGAC 1JPTH 4K5NA 4NYLB 1O9WA 1MCRA 3N2GE 2Y06L 5DMGC 2IAMD 2NMSA 4M5TA 4PGZA 3L4UA 5MERB 5C0ND 5J89A 2XVGA 4BK5C 2GUOA 2DAVA 2QLYA 2I7OA 3OYXA 4GUCA 4CBZA 3HS0B 4ZUUA 2AP2A 3ARGD 4QGYA 4OQTH 1VFBB 4P0DA 4GY4A 4XB8A 3AQZA 1JERA 4PJEE 2APFA 4OFZA 2HT4D 2WWOA 3TNMA 3X3FL 1JNRA 4DOHB 1Y64B 2AFNA 4N2AA 3GHPA 3Q5OA 1CG9A 5MENB 1XDOA 2BX5A 3GIVB 2DIBA 2DYSB 2EZ0D 4JK0D 4QH1A 4Q9QL 3EXLA 2D3LA 4KKLD 2BERA 2OYLA 3WI9A 1RMFH 2DQDH 1FYTD 2NTXA 1R5WA 3FF8A 2IANA 4N28A 4KX9A 3UAJA 4KAQL 5CEXA 5D7SH 2ACZA 4U74A 3VTTA 4RGOH 4BFBD 1A9EB 1B6DA 2BG9B 4TTDD 2VCOA 3KPRA 3MV9B 4WFFE 4ZTPH 5JDNA 2ZMAA 2YAPA 4F1ZA 2GCYA 5JXAL 5K1VA 5LHDA 3FZUC 1FPTL 3K4ZA 3DUUB 1B3JA 5D9SB 5E9DE 1D5IL 2JCWA 3KBEA 3CFBA 2WBKA 1I7ZA 5KVGL 1ACYL 3LH2H 5EHFA 5J3HC 3O9WD 1F5WA 1RUKL 4JG0H 3CFJA 3RNKB 1LWHA 4TXVB 4AM0Q 5D1QA 2XN0A 4ZUSB 3FO2B 5FM8A 1SXSA 4FJOA 1J5IA 2V8MA 4MJHA 5HGDB 1FG2B 3FN9A 2ZKHH 4TPRL 1P7QA 5J6HA 2J2ZA 5CCJA 4LOFA 4QRPB 2IC2A 2A6IA 1MAKA 1MG2C 3PV6A 2W62A 1NGZB 4FG0A 1VENA 2J43A 1XIWD 2JI2A 2XTJB 1IKNC 2C5DC 2E4FA 3FFCA 4HJTA 5E1GA 5TDNA 5JLZB 5FXVA 4KHTH 4X6CF 2H1PL 3C8KA 2XZQH 5FYKH 4JFWA 4PGEB 2P5PA 3PJAJ 3MROA 3G6AA 3EDFA 3Q2MA 1Z9OA 2NY1C 2J8HA 5HHNB 2NY2B 4QHKI 4YOKA 1NMBL 4N8VA 2B0SH 5C6WH 2AKRA 2YPLA 5D1QC 1MCEA 1X7QA 4JJ5B 4N22A 3C5SB 3ZYOA 3B8YA 1CLOH 1RZGA 5E00B 1QBLL 4A6YA 1JGDB 1N8ZB 3I6LE 4XCCH 4H40A 4M6ML 3ZK0A 1AGCA 2X5PA 4L8SC 2WYHA 3CXDH 3BI9X 4HA1A 4ZFOB 2N56A 3O4XE 4E9XA 5CF3A 5DQJB 4NHCL 2Z35A 1OF0A 5EZOH 4JFXB 1QQDB 4HXAL 4JS7A 5IT2H 1EHNA 2I25N 3CSTA 2CM5A 3V7AG 4YDKH 3NBNA 2A74B 4A6YL 2YZ8A 4JAMA 1PX4A 2GUYA 4PJGB 2F54D 3T6ZA 4G71B 1G9MC 3QQ4A 3WD5H 3WFBH 3SFEA 4XOBA 3LMJL 4CXXA 3HA4A 3FZUD 2VL4A 4LDOB 3GXDA 2K3WA 4U0QB 3VXPB 4AQAB 3S8WA 3CSFA 2WKOA 2YSTA 3JC6C 2B16A 2VMFA 3CHPA 4FEIA 4K71C 5J3HD 2I59A 4P3WA 1NWOA 1RJYA 4AG4H 1CGVA 4ZW8A 5ITBH 4Z77B 2PP9A 3ULSA 4TRPH 3K2UH 3NAAH 1QLRB 5HAXA 2IO5A 3GMNA 5JMRA 3VSUA 5F8QC 2XIBA 4DJMA 1VACB 3OKNA 4HCIA 3LHPH 1NCGA 4KJQC 5EFIB 4WW1A 4BJNA 3GN5A 2R4RH 3O9XA 1RIUL 4JI6T 1YC7A 4ODTH 4RZCB 3U2JA 1KGUA 3KPRD 3ARBA 2E7MA 5D72L 4PLNC 1ZLSL 3IE4A 5DQVA 1BVZA 2LSGA 4UQ3A 4ZK8A 4U3HA 3T8VA 4OZ4A 4F15B 4HUNB 2CUAA 3NZ8B 2FD6H 2YKLH 2NY1D 3H3BC 5I6NA 5LHIB 4N2OA 4AKOA 3VQMA 4HHAB 1LJMA 2XWRA 3ZHKA 2BOLA 5DTFB 2LLYA 2DI8A 1HT6A 5D1QD 3P11H 3H37A 1MFEL 1QRNB 4JREC 1PCSA 5DUML 3T0WA 3WHXB 4DUVA 2CHZA 2EYRB 2AJXH 1FIGH 4D7BA 3QFJA 4FJYA 2UXDT 2R15A 5CU5A 4MAYA 1W15A 4NAJA 4HUWB 1R24B 2QVTA 4ORGB 1QATA 2CHDA 2VKOA 2AQNA 1IAMA 2NXYD 1LE9A 1WG3A 3OX8A 4OZIA 5I9QB 3RDTA 3BGAA 1UKSA 2JKRM 2KZWA 3GNML 3VGGA 3MJ7A 5LB1A 2BVMA 2PKDA 4WK0B 1HXYA 1A8JH 2ATPB 1MCSA 4FFWD 4JDTH 5FKPA 3ARBC 5DHVB 4MB1A 3SKMB 3TXAA 2ADIB 3MLXL 4TVPD 1OPGH 3CU1A 4JCLA 1UHVA 3US0A 1LNUB 1JXKA 1K4DB 3UBXG 4APXA 3V6BR 5C08A 43CAA 4IM8A 3KXFE 3GRWA 4HCGA 4MZ3A 1ZXQA 2EDLA 4KK8C 4YGAB 4GW4B 2OZ4A 4LCWB 3QUXB 4AH2A 3QIBA 4HZAA 4ES8A 1GYAA 4IJ3B 3WNKA 1CHUA 1WFOA 1FCCA 1NCAH 2EVGA 1EHXA 5DUBB 2DLGA 3JC6D 1EEUA 1QFWH 3FSVA 3GB7B 3PQYA 3L1GA 4MAYC 5JR9B 4R0LA 5FUOH 1VFOA 1T04A 2ISDA 3GRWL 5DJAA 3JWDL 3L5HA 3RDTC 1FC2D 2NW7A 2OZ4L 3VR9A 1G4MA 4R4BB 5KBLA 5GRUL 4JM4L 4X6DB 1JWUA 1Z5LB 2X3AA 2OA9A 3L13A 4YAQA 1ZOYA 2JB6A 3K8MA 5I1DB 1TENA 2EHOB 3S0PA 1H6UA 4HULB 3VWJA 3TLUA 3NIGF 4LRNH 4NKMB 3IU3A 2YBGA 1JD7A 5DHVH 4UNTA 4HFWA 2GB2A 4IYKA 3BYYA 3FU6A 3RKDC 3WTSA 5IFAH 1M71B 2VC2L 2YZ1A 5IREA 1TTFA 5C0RL 4LLMB 3NRPA 3OG6B 3FTVA 5JIPA 25C8H 2CXLA 1HG2A 2DLHA 4QTFA 4YTNA 1F3DJ 5BVPH 4PV8A 2NUTB 3GLZA 3P9LA 4HUCA 4ODVL 4CMHB 3HNVL 1R5VB 4NDMA 4JFZH 1PNDA 1ODAA 3IXAA 3KS0J 5CLZA 2APBA 5DYFA 1H9DA 4V2BA 1QPPA 3GMQB 3IVKA 3LH9A 1D5ZB 5IHUL 3D39E 3IF1B 1DSFH 1J5DA 5AAMA 4KHXL 3SQBA 3RWCB 1J9CT 5FYLD 5I16B 4KK9C 4PRIB 3VWJC 3OSKA 3SY0A 1IQDA 1BPVA 1JFQH 3GJFB 4G7VL 1W72A 1DHKA 1LDPL 3DVNB 4G8GA 4L4VB 5FDYA 4YHZL 2A99A 4NN6B 3LDBB 3ARBD 3VXRE 5AQRB 3LN4A 5EU6E 5I0VA 2IAKA 4PRPD 2BS3A 1ZKAA 1KF6A 3ABVA 1M3IA 1C5CH 3SQOL 3KV5A 3FT4B 3WTWA 1BZOA 2XSKA 3Q0HA 4HUXA 3HIZA 5CBEB 3M7FB 4YPJA 1SUJA 3QISA 3FTSA 1RJZB 4KK8D 4NRYA 2O26U 1KZYA 3FXEB 1W72L 1TF4A 1SDDA 4HPHA 2RB8A 3AG3B 4FFZA 4PGDA 2X3CA 2F1EA 2Y23A 3QUHA 2LT3A 3H54A 4P59L 3QFJD 1DEDA 4YNYA 1G1YA 5JDJA 3LKPA 1VKXB 4NEHB 3JYBA 3FULA 2BOCB 3I1AA 4N4YB 5C09E 3SE9L 1MLCA 2KPNA 3IDIB 5J1GA 3RDTD 5L6YH 4UZUA 4WI7A 4ZZFA 4BA8A 1J10A 3I6KB 4FFZL 2X1WL 2OTPA 3GMPA 1JD9A 3ZE1E 4RRPA 4X9IA 2BOBA 1LWJA 5IMKB 4GSUA 4K07A 4PW8A 3TBWB 2ZOLB 3ECQA 1QEXA 4GQZA 3WSQH 5EU4A 5C08D 3VFUA 4UUJB 5DT1H 3OLIA 1NUGA 3CN1A 1XB6A 4RAHA 1PVHA 1URIA 5FO8B 4JI5T 5ABFB 4I9XA 4Y5YA 3CX8B 1I8KA 3ZL1A 1ZHBB 1ZA6B 5JHDD 1N59A 3BGMA 2OXGA 1T3FB 4JFPB 4KY2A 3RWDB 3GXUB 1BG9A 2EXTA 2AJVH 3PQYD 4IIQA 4ICWA 4MMZC 2IDSA 2GITA 3S6CA 2QVFB 4I9WE 1LEGB 3N9GH 3RUGE 2MWCA 4OTXL 5GS1B 2LE8A 4BD4A 3K1DA 3JVFC 2YAEA 3D0AA 5HHVL 2IUBA 3AU1A 4AQZA 2Y36H 5JOEA 1PEZA 1U30A 4FZEL 5DMIL 4O9HH 5I8KH 4WJ5A 4ZZKA 4YVUA 2WNWA 1L9QA 1NOFA 4YIQA 2L0DA 2GAZB 2D5UA 2GK9A 3DURA 1NENA 5T5FH 4HFUL 5KYYB 4AQ1B 2AEPL 4HFDA 4NQXB 5ICYA 2Y2WA 3N42B 3O6ML 1QLBA 4Y5YC 5FHAH 1JZJA 1XZ0A 4OB5L 3M17B 5AZEH 3MN8A 4QXUH 2YK1L 5J5EA 1C5DA 4XNBA 5ADPL 4MQSB 3Q3GA 4W9DC 5J8OA 5CR1A 4LPXA 4LZKA 1ACCA 4J3XA 4IIQC 5A2BA 3VRLE 3G06A 3BD5A 4NM4L 3T2LA 3OHXA 5L4FA 4KQ0A 2YHGA 3QA3B 1W0WA 3ULVC 5DRZB 4PAGA 1A6AA 4OJAA 2L7JA 4NXMT 2GY5A 5DWPA 2QTVA 4NUQA 2W0FB 3GO1L 5F96L 3FN0L 1HINL 2XWBA 1ML0A 1XDPA 4QCIB 5I0XA 2YD7A 4WO0A 1OAYL 3TIEA 1ZGLA 4HF5H 3FB6B 4AV5A 2HFFA 4YHNB 2DIAA 3J27A 4QY8B 4ADGA 4K3JH 5FXZA 4UZSA 4GXVH 1OL0A 2OTUA 4PJ7F 3NWIA 1R46A 2NYKA 4KJYA 5AYQA 2MQ0A 3SGKA 4LP8A 5AWNH 3LEVH 3ISRA 3HI1B 3MUJA 2ZJSH 1FL5B 4KMTH 1TIUA 2EH7L 2V2WB 3E9UA 1RK1A 4IOIB 2K3HA 2OLTA 3SDXA 2WQAA 1UOVA 4NZTL 3QUYB 3TJHC 2B1HH 3PDDA 4ELMA 3W9EA 4A1RA 1KNRA 1XF5A 3MRFB 3E80A 5HPMA 3ULVF 4JG9A 4JQXA 1FVCA 1IZNB 1ECZA 4N2DA 5AOJA 2P80A 4F3FB 2NXZB 1YQ4A 2X53A 1FRGL 3O81A 3QB7C 4G11A 3G6JF 3CK0H 4E9YA 1USQA 1I3VA 1B4LA 2Y6SC 4GQQA 5ALBL 3UH8A 2RR3A 3MLTB 3PRZA 3T0XA 1UWGH 2P24B 4ESKA 2BS2A 3PL6A 5I6MA 5IBTL 3BMWA 3C9NB 3ZIMA 2LSKA 3QB5K 1B0IA 2FATL 3O3EB 4LQFL 3WIHA 3OJAA 3EUDA 1BR4A 3L9BA 3SGKC 4BH8B 1Z9PA 1TQCC 5E99H 4NJAH 5IUCA 1RLWA 3K74B 4IGBC 1PKQE 4DP9X 4KPHL 3A6CL 3WY4A 4P0BA 3BP6A 2NOXA 4YK4B 4UNUA 3HPLA 3ARGB 1WRDA 1YY9C 1CLZL 5I82A 2AK4E 5IW1B 4JQXC 3WIHL 4PGCA 2JXMA 2ZWSA 3OZKA 3PTRB 1OOAA 4BFGA 4AMKH 3ULVD 1NMCB 1NGXB 2YN5A 1DFBH 3OAYK 3D8MA 3P1VA 5FM5O 5KYXB 1IBYA 1KT2A 3P3SA 4L8BB 3RAJL 1KIRB 1B9ZA 4PIBA 1P2CB 4XVJH 4YGVA 4EIGB 4Z78B 3UZEA 3TP4A 5MI0C 4R7NA 2GTQA 1FYTB 2X1QA 1HEJC 5E6RB 1MW1A 4JJOA 2HJLB 3QCUL 1GC1L 4WW2A 5EZJA 1MCOL 1BREA 3L6FA 3RLSA 2JTDA 3GLDA 4C56B 3KJ4B 5C92A 4JX0A 2FTAA 2OMUA 4LBAA 5F1NB 3AABA 3NK4A 4JZNB 2X87A 1TZGL 1FNEA 1SYSA 3G5XA 5CLYA 2BZCA 2DTMH 4R26L 5IROC 3ZRCC 3VA6A 2DIEA 1T2QL 5AAWA 2YKSA 1FP5A 2X2UA 7PAZA 3QI9A 1RJLB 2VDNH 4YX2L 1QSED 3ZO9A 3MRMA 2P3YA 5KS9B 4YHYB 4P5MB 4JGMA 3Q2CA 4DPBX 4JFQB 4BZ1A 3BT2H 5D8JL 4IU3A 5K93A 1J8KA 3UZEC 3O11B 4U3XA 1MHCB 1C1EL 3S7GA 5JIIA 4MA3B 5BZDB 4GJTB 4X6BB 3V9EA 1VFUA 2BNRA 1S8DB 2Y6SD 1EAOA 5CD3B 1G8XA 5CSBA 3BH9A 3QORA 3ROLB 4ZYKB 3L5JA 2VERA 5J6GB 1DLHA 4BZ1L 1MWAB 3VGAB 3N2JA 3HOGA 3N9MA 3OBAA 2D31A 1WISA 3TEUA 1AO7D 3U36B 2JELH 4Z3IA 5DK0A 3BMVA 3UYOD 1ID2A 2YO3A 3D4ZA 4IGBD 2VXUH 3EH5B 4OD1L 4MJIA 2DM7A 3LSVA 1OCCB 4PBXA 4JFEE 4R4ND 4A55A 1RH8A 1YY9D 2DWGA 3MHZA 4ZUVA 2ATKA 4YQXL 4GT0A 3CLEL 4WW0A 1A6UH 2FK9A 3MPCA 4O4HE 3T1FB 2P80D 4LEXH 1IL1B 3ABGA 1P4LA 4FQCH 1OAXH 3PUSA 4OD2B 2ICWI 2JH2A 3QORC 3K6FA 4RMVA 2EVHA 2NW3A 1ASQA 3S3CB 4PUBL 1WWAX 1CDGA 1JZFA 1RFDH 4KROC 1M57B 4POYA 2DL1A 3FHAA 1JBJA 4KZCA 5D7JD 3U0TA 5JZ7C 4EAHA 3LIZA 4OZFA 3B2XA 2JB5L 4FQIL 2GUOB 4Z7QB 2VN7A 3OTTA 1OSPL 4ZUUB 5IROD 1OARL 2BS4A 3AREA 5SWZE 4BWTA 4IDJH 4IKIA 4HYTB 5EORH 3N1GC 3WIIH 2J55A 2BIPA 2VZTA 1O5DT 2Y7MA 4NXNT 5DMYA 2VKDA 1ZTXH 1J0KA 2QZ5A 3CPZA 3TNMB 4H1LA 2P45B 1CG9B 2JI3A 3CVHA 3LIZL 2Y06H 2PR4L 2XPGA 1XF4A 3KG5A 4FD0A 2FX9L 4EIZC 2E86A 1J9SA 1AS6A 1XEUA 1R5WB 3PWPA 2IANB 4O2EB 4ZQKA 4C83A 4JVWA 4EVNB 5CEXB 3EZJB 4Q52A 3BK9A 4QNPF 4XPBL 3PU3A 2W63A 3D3VA 1KELL 3CVHL 1GTNA 4D9QD 2E9GA 3KPRB 3W38A 4TUYE 3X3FH 2GCYB 1RUQL 2VLRE 1WIOA 3EOYG 1DLFL 1JGVL 3ESNA 4GP8B 2K3TA 4GRWB 4J28A 4U6HA 5ABZA 2BS9A 1T7YA 1GY1A 2Z7YA 4NPJA 2ZM6T 2FSEA 2NY1B 3CAFA 3HCVA 3CFBB 1GYUA 1I7ZB 2DQJL 2Q76B 4OYJA 4KZ0A 5L4HA 3IDUA 4FL4C 5H94A 4KAQH 2DMBA 5D1QB 4E7SA 2YDRA 2VB5A 4XBFB 1CICA 4N0UE 2ICWA 4KRNA 2NX5A 4AEEA 2IAAC 1P7QB 3GSXA 3FTGA 5J6HB 1Z3RA 4A56A 5HBBA 4HIXL 2BNRD 4ZW7A 5JXAH 2ENJA 4L8SB 1NEUA 3S3PA 1FPTH 2Q8BL 2A6IB 2CXFA 2W5PA 1FQ9C 3O3DA 1D5IH 1JZ3A 4LMQE 1ACYH 3FFCB 5TDNB 3GC3A 4G6FD 3C8KB 4WGVB 1RUKH 4KROD 5HHOE 2E56A 4BCZA 1NBYA 4OZHF 4XCEB 1OGAE 3D69A 3G6AB 3TV3L 1ZHKA 2FNWA 2XQ4A 4HWEL 1WZAA 4PS7A 2X3BA 1LO3L 3ETBJ 4TPRH 3QZBA 4DW2H 2C9VA 4MJ2A 4N8VB 2OX5A 2AKRB 2JKTM 2YPLB 1UFUA 5LQBL 1BMWA 1P7KB 2DWEA 2SEBA 1CICC 1ZPLA 1SDAB 1X7QB 4UNIA 2EDHA 4K71B 3FBQA 1A7OL 1RZGB 2J88H 3QNXA 2O6CA 3F00A 4A6YB 2E9XA 2H1PH 1X5ZA 3NCCB 1AGCB 5E1AA 3SIKA 3ZRSA 2YD3A 2PG8A 4ZO6A 1G9NL 4N2CA 2DJMA 4P5SA 2Z35B 4PK4A 3K46A 4WZXA 1NMBH 4XZUA 1NWMX 4JAMB 1C16A 2CA3A 3QQ4B 1JPEA 4QOKD 4PJHE 1MNEA 3EH4B 1P84J 1QBLH 3ZMNA 3CPLA 3FZHB 4BSJA 2QDWA 4M6MH 2V37A 1G9NC 3GTNA 3OF6A 4M1GH 4PBVC 2H7VC 2DMKA 4WWKC 2EE9A 3VTAA 4NHCH 4L3EA 2VDKB 4HXAH 4PBWD 1B9KA 2VMJA 1PJWA 4WBOA 2E9XC 1R17A 5CHNA 4GO6B 4JREB 5C3JA 3ULSB 2G2PA 2PPFA 4XAWL 4CILA 1A64A 4AUUA 4CN1A 1M7UA 5LCYA 4PHZA 3HR5B 3OKNB 4HWDA 1A7PL 1IGYB 4KC3B 4WW1B 3GN5B 3HS8A 1NLBL 3N0AA 4Y2DC 5CSGA 4NUUA 3G7TA 1EH9A 3DC0A 1A7NL 3D3VD 4JR9L 1YDPA 4ZT1A 1XGQA 4LOEA 2WO3B 3ARBB 4UBDC 2VYRE 2FX8L 3AEDA 4EXPX 4B0MB 1UWFA 1FJ1A 4UQ3B 1NCNA 2WZIA 1ZANL 2YD1A 2ZNXA 5F7KC 4H8UA 2BJML 4L0PB 5F7EL 3H9HA 4PJDF 5DYOA 1E8YA 2YEQA 4OFVA 3TPKA 2X70B 2V9TA 5JHBA 1KYOJ 2MNJB 1YA5A 2HX7A 2WZAA 1RIUH 1CFQA 3ZDZF 4BCXA 1CICD 4CKQA 4AJVA 1SXNA 4PJEA 3QIUA 3QFJB 2NX5D 5C07E 4MAYB 3FU3A 2I9LA 5D72H 1WEJL 2CPUA 2WY2A 2IXQA 1ZLSH 1LE9B 4OZIB 3OX8B 3AZUA 4FQXA 4M1DL 4MVBD 3RDTB 5KUKA 4HHWA 3OMIB 3MTRA 4HZ1A 1LK2B 4FNTA 2JKLA 1W6WA 5FKPB 1IGFH 4TSAL 4RMBA 3PPSA 2LU7A 4KU1A 3VYNA 1DVXA 3LZLA 3Q2WA 2W4XA 4APXB 5JA9A 4H25A 1MFEH 2OI9C 5DUMH 5C08B 1F3JB 2HSIA 3GKZA 3NCJH 3NGBC 43CAB 5ENWA 2ZCZA 4DTGL 2GBVA 5B39B 2MTQA 4ZRGA 3TU6A 2FEDD 3EBGA 4D9RD 4PJIE 4AH2B 5J9PA 5IUSA 2VR7A 2IF7A 3GGWA 5IP4A 1OEZW 3OAUH 5E9DA 2NY4C 2WIIA 1NJ9A 2BZBA 5ACMA 4WWKD 3NFNB 3PQYB 5A6MA 2QGEA 2HKFH 3MLUL 3UQ4A 1T04B 1HCIA 5DJAB 4FQXC 4NKQB 1OP3H 2VC2B 4WI3A 3LNFA 2F53D 5FYKU 5T1DL 4L5GA 1BQSA 3S9DB 3SGJC 4H9PC 4P5KA 3P9MA 3ZE0F 1JWUB 4NO5A 4IKKA 4K0KT 4YAQB 3VI3E 2JB6B 2WVTA 5I24A 3QQNA 2XXGA 3RRQA 3VWJB 4Y2DD 3IU3B 3CBKB 1R3IH 2ZYHA 2QSTA 5C0IA 2UX6A 4MNQD 4ZMNA 1U8IA 3IJ8A 1O6VA 4UBDD 4K23L 4X9FA 4JPSA 2XI9A 5CLWA 3DIFA 3GPSA 4RDQG 2CBQA 1NDGB 5C0FA 4LCYA 3GRWH 3JWDH 4PV8B 5DZLA 3P9LB 1KOAA 5F9OL 1HC1A 3OF6D 4NDMB 2OZ4H 3A4AA 1D7FA 3G3LA 3IXAB 5GRUH 1A66A 3ARVA 5KBNC 1XWVA 3MTXA 3D34A 4L3ED 3FUFA 1A5FL 4Y9BA 3NIDF 3IVKB 1JTTA 5K5YA 3QXVA 3ARZA 2V7NB 3WUWA 5HJGA 1QA9A 3VD7A 3GUTA 3AE8A 2QKIC 3S5YA 5DJXA 2OMVA 3TWCL 2VC2H 1R3HA 1DBKL 1HCZA 1ZVSA 3SQBB 1CZ8L 5ID0A 3RFRA 5C97A 1BFSA 5JNYA 2JIXD 4P4RA 2BCMA 1IQDB 3SY0B 4ODVH 4OZGE 3L16A 2CLRA 4BKTC 4G8GB 3CZLA 3ZDXF 2V6YA 3LN4B 1U8OA 4MASA 5IESL 2XWEA 1DP0A 1SQ2N 4ZNEA 3X12A 1KACB 4E5XG 3IAPA 2DQFA 4MKTA 4HUXB 4FGMA 5HD8C 3F2EA 2YGPA 3T4YB 1FMVA 3FU0A 2W0PA 3P0VL 3KVQA 2EIDA 3BVTA 3FT3A 3L95A 4KHXH 1WRFA 4NRYB 4UYQA 1SDDB 4XBMA 5ALCL 3LPOA 3II3A 2YINA 1NBZA 2Z8WC 4PGDB 3CHOA 1T7SA 1FHNA 2ZWKA 5EBMA 4E9SA 4D94A 2NY4D 4G7VH 5E2UL 5AOKA 5IB2A 1TUPA 4M3HA 4PJXF 2RQ8A 1LDPH 4J1UA 5M7QA 4YHZH 2MQCA 4DKTA 4PFEA 5FYJE 1INDH 2OMTA 4FQXD 1MLCB 4NZRL 1I1CA 5AVRB 3RVWD 5J1AA 4BFIA 3EFFA 4RZKA 1PIFA 5HYSA 5CEZE 3GMPB 5GHWL 4WHYH 2XFXA 5E03A 2BOBB 1IC5L 1W72H 5F7AA 2DQ6A 2MNWA 1ED3B 5FLUA 2DKMA 4DGVH 2UX7A 4AIOA 3G9AB 5EU4B 5GGSA 3G04B 1TSHA 4Z7OE 1BHGA 3VFUB 3O6FD 3RJDA 1GGCH 2C1OB 2CR3A 2R0KL 4H9OC 1GW0A 4EKXA 2GIXA 1E40A 1PKOA 2P44B 2PF6A 2QV4A 1L4IA 4FG2A 4K7PX 4LLAA 4AZ8A 2X10A 3F58L 4Y5YB 1I8KB 3I74A 2XQYK 2FH8A 3VMOA 1N59B 2OXGB 3WNPA 1AGFA 4FFZH 5LUMA 2VK9A 1H3XA 1QASA 4IIQB 2GITB 3AEFA 3GI9L 4W70A 4N2FA 3V6ZA 4YSEA 3ZMRA 5L0QC 2CUMA 3B7YA 1HXMA 2DYPD 4Q8BA 2YQ3A 1JNNL 2UXFA 3AU1B 5AOMA 2Q20A 3G6JB 4LFHD 1MHEA 1QABA 4TMPA 4WJ5B 2BC4B 2D2OA 4YIQB 5A16A 4N8UA 3HG1E 3N3EA 3DURB 1MREL 4I89A 3E6HA 3ARUA 4IKNA 1UCUA 1ZP0A 4GK0E 1JXDA 1LL1A 4Q7DA 4N2HA 5ICYB 1XMQT 4OTXH 4LKXA 4YN3A 5HD8D 4IBVA 1RL1A 2GG1A 4IIZA 3QPQD 4ODBD 1OSYA 3UTPD 2WDVA 1C5DB 2FYYA 5JHLA 3Q3GB 5E8OB 5MEPA 4CN4A 1SN2A 3AM8C 4FZEH 1UWEL 5DMIH 1WO2A 3OHXB 4M3KB 2NY6C 1W0WB 1YPZF 2DJSA 5LGKA 4G3YL 2BHYA 5K1NA 4OCRL 5K33A 4IE6A 3QDHA 4NWUH 5JOPD 3BC9A 1WC7A 2XWBB 4HFUH 3RVUD 5JHLL 1E4XL 1OF2A 2AEPH 3CZFA 4FLSA 4PMEA 4MJJA 4HG4K 2VRAA 3AAAB 1UXLA 1V7ML 3TIEB 5M95B 4OB5H 3F62A 1AHWA 2YK1H 2DRUA 2HFFB 3HR6A 5ADPH 1JOIA 4M5SA 4QAMB 1J12A 1U92A 3U2IA 1J1PL 1XBDA 4TNFA 4NM4H 2ICEC 2OTUB 5AALA 4KJYB 4BYHA 3QNZA 5KSAA 3ZT5A 1TJHL 1TQCB 3FFOA 3K6IA 4YUEL 1BAWA 4IGBB 3WTXA 5A2AA 2Y4SA 3GO1H 2WINA 3F5WA 3FN0H 1HINH 1RK1B 5F96H 2FGWH 3QBTB 4L4TD 1X9QA 1DL7L 3MGOA 4OKDA 3U46A 1OAYH 3VXME 3W9EB 4ELMB 3UFGA 4OBRA 5LP6E 1ADQA 4YBQD 5HPMB 4GYSA 5A2JH 1FVCB 4WSJA 3HZ3A 4QX8B 1KUMA 2ORBL 3D39A 3N85L 1OTTD 3VXUE 1EO5A 2VM4A 4CAGA 5CCGE 4XP1L 4RMWA 1N64L 1JI2A 3KBTA 4EZMA 1JAEA 1Q9WA 5E6YA 4OIBA 2Q2EB 4UINL 3FPXA 5TTRA 3LRLA 3H3MA 2EH7H 3F65A 4PH8A 3JSSA 2Q9QD 1J8HE 1ADQL 3CSYA 2EXYD 3FSZA 3PUVF 1Y6KR 3VXRA 3W0WE 1UXWA 3C5JA 3Q1SL 4IBTA 2V8SV 1BYPA 2XQAA 3VXSE 1CMOA 2ZCKH 5GRYA 2NWBA 4OCXL 2H6UA 4XP6L 3MNDA 4NNYA 3BP6B 1FRGH 1G9EA 1JK9A 1BWMA 4OT1L 1W9RA 5DD3L 4RSYA 1MVFA 3OKKB 5I8OL 4PGCB 2L7EA 2JXMB 5I1KL 1CGYA 2NY6D 4GLRI 4UI2A 1JNLL 3HN5A 1QI4A 4XX1E 3WNJA 3QYMA 2GKIA 1KT2B 2A6JA 2FATH 2N1TE 4XP5L 5KZCD 3DNKA 4YGVB 3FZMB 2OKMA 4ZPVB 2A38A 1HG5A 2VW7A 4R7NB 5IK3A 5D1ZI 4DN4L 4C4UA 4Z91A 4KPHH 3A6CH 3Q2NA 4D7PA 4KXCA 3GS4A 4WW2B 1ZS8A 2HLAA 5EZJB 4Z7NB 2OYPA 2WOYA 1CLZH 4PJ8D 2OMUB 1UADC 4LLVA 3X1BA 1BZ7A 3WIHH 5MP6L 3R0NA 2AQQA 1SYSB 3G5XB 4QT5A 2XQBL 6PAZA 3S3SA 5BV7L 2W9DH 4K3EL 4Z7VE 3RAJH 1X4YA 3FU5A 3WFCL 1BQLL 5LG1A 4IMKC 1BFVH 4Z90A 5J1SC 3MRMB 3VKHA 4TLKA 4ZI3C 1YEDA 2XT1B 3CHSA 4FS0A 5HDBF 2IH1A 4MQ7B 3SJVE 1GC1H 3ECUA 4BUHA 1MCOH 1QR4A 1TQBC 5DHEA 3RUGA 3ULUF 2EIJB 2XM1A 1KN4L 1CXFA 3HC0A 5BV7C 1TZGH 4PGJA 2BNRB 1R5IA 2FL5A 3C8DA 1BLNA 4WFED 1F1AA 3VNYA 4R26H 3BP7A 4PWFA 2FDBP 1KXVA 3ERXA 2VVSA 3BH9B 3HI6L 5LYJE 1T2QH 1ORQA 3LVEA 3QORB 2E7LA 1DLHB 2Z31D 4LPUA 5D7LD 2DL9A 4PRHA 1UUSA 4YX2H 3UFIA 4WENB 3BE1L 4LFAT 1QW8A 3GSWA 4KROB 3UJIL 2D31B 2W61A 1MXGA 3I9PA 1ES0A 1Y7VA 5EC1A 2ZP0T 1N70A 5ILTL 3L3GA 5D8JH