4G2KA

Crystal structure of the marburg virus gp2 ectodomain in its post-fusion conformation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
110
structure length
110
Chain Sequence
b'MKQIEDKIEEILSKIYHIENEIARIKKLIGNLVSRLRRLANQTAKSLELLLRVTTEERTFSLINRHAIDFLLTRWGGTCKVLGPDCSIGIEDLSRNISEQIDQIKKDEQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General control protein GCN4, Envelope glycoprotein GP2 chim
publication title Crystal Structure of the Marburg Virus GP2 Core Domain in Its Postfusion Conformation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
total genus 50
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g2kA00
2EBOA 2MK3A 1QR9A 1Y4MA 2EZPA 3WFVA 3CYOA 1SZTA 2X7RB 4FK5C 1ENVA 5HFLA 3MHSC 2LP7A 1F23A 1QCEA 3K9AA 1DF5A 2M7WA 1JQ0A 4FIPC 1K34A 1DF4A 1EBOA 1MOFA 1MG1A 3MHHC 4G2KA 5H9CA 5KA5A 1DLBA 5HFMA 4N23A 2P6JA 3CP1A 1I5YA 1Y66A 3P30A 4JGSA 4N21A 5KA6A 1JPXA 1I5XA 1K33A 3B8NA 2EZOA 4FJCC 3GWOA 1QR8A 4JF3A 3B77A 1QBZA 3M99B 4E2LA 3B8MA 5CN0A 3H01A 5CMUA 2OT5A 4JPRA
chains in the Genus database with same CATH superfamily
2LW7A 5IT9N 3WFVA 4U3FH 3MD0A 4ZOLB 4KP4A 4B3SO 4KHPO 4X1YA 4JI2B 2DWEC 2XHBA 3TJTA 1MOFA 2KB1A 1PNKA 2VWJA 2JGDB 1IBKB 3B8NA 1OZ0A 3CCLV 3KZIZ 3EVKA 4Z1VA 3HKEA 1X59A 2LQTA 3CYOA 4AILC 1JOYA 2F4VO 5H5NA 3ZRWA 2DN9A 2V7QG 3E86A 1TA8A 3ETDA 3DC5A 3OT7A 4O4LB 3UO2A 3ABLC 4X62O 1QLNA 1H8HG 1PD3A 3OGIB 3OUSA 2ZT9B 3I5DA 3CD6V 1K5QA 1KMIZ 1R1BA 1I5XA 4O2BB 3BA9A 4UV9A 4DR5B 5KUMA 5KX5A 1YVWA 3RGBA 3SJBC 5EC2C 1JA8A 1XQ8A 3N2GB 1GKFA 3JAMN 2Y69C 4FLUA 3QG5A 1Y74A 3K57A 4NB5A 2Q5ZA 5KMGA 2Q7HA 4K0KB 2QDOA 2B1GA 2DW4A 2QKAA 5GTIZ 1AVMA 1KUQA 4QJFB 3HKDA 1K33A 2CDYA 1QQCA 3WB2A 4X8AA 5LMNO 1FD9A 1ZL8B 2DYSC 4YY3O 1JFFA 2QM8A 4A5UB 2K1EA 2XAGA 4PA7A 1SQFA 5B1NA 1IXMA 4X66O 3MHHC 4NXNB 1WB7A 1CXZB 4FVMA 2OCHA 4LF4O 1FXHA 3T1YO 1KECA 1D2DA 2UUAO 5EZYA 2ZM6O 4IHJA 4YIOA 3H9VA 4ZIBA 5LGNA 2Q7EA 3K9SA 4DV1O 1BS3A 4GX2A 3T2MA 5HFMA 4CS2A 3OFNG 1RM1B 2PI5A 3OR7C 5CB4B 1QR8A 5CBFA 5H6RA 1IURA 3DTUB 2WSSG 4D6TH 2KSDA 4JPRA 2UUCB 5J9PC 1Y76A 3ZHQA 4LFBO 3ZMZA 1GN3A 4CZZA 3CEIA 4FIPC 4DV3B 4N23A 2P6JA 3MDSA 4BW9A 4X20B 2BTOA 1NI8A 2ADQB 5FNVB 3U0ZA 2P22C 5LBQA 3U10A 4J7JA 2ZD9A 3E22B 2X6AA 3O9OA 4J9YB 4F6EA 4P2ZA 1IBKO 4B08A 2JDIG 3P3NA 4O4JB 2YI9A 2NN4A 1VQ6V 3AG4B 3A8TA 3G6EV 2X6CA 2CH7A 4TUYA 3KKYA 3ASOB 4J11A 1VQKV 5IYDO 2F23A 4ZHQA 4J42A 1Q86W 4X65B 4PA3A 3AK1A 3K5LA 2Q6AA 3CSXA 4DR5O 3L75H 4WFEA 3LDDA 4I0XB 5IJ0A 1FFTB 3JASB 3H1LH 4MSWC 1I7FA 1V9PA 3T1HB 1OCOB 4K0KO 2VS0A 1HNZO 2P4KA 1PNMA 3CRCA 1VF7A 4H37A 4HAMA 1Y4MA 2H8PC 1AR5A 4EFBA 4BW5A 3QO7A 3HKBB 2WLLB 2RDCA 5IJ9A 4G2KA 1NQTA 4X89A 1EN5A 2P4VA 4I7ZB 5BXZA 1NKDA 3SPHA 5LGTA 2BOCC 4DUYB 4ZOLA 2ODMA 1RM1C 2QTSA 1TGOA 3SYCA 2FYUH 2P7TC 5IYZB 1SKVA 5TISZ 3PN1A 5ITZA 2QWQB 2JGDA 3MHSC 1KQSU 1HW7A 3P32A 1IXBA 1I5YA 1YJWV 1FPOA 4O4IB 2CK3G 2WA4A 2M6YA 1G8MA 4O4LA 2GUZB 2DQ3A 1HR0B 1FXKB 2B9ZA 1QR9A 1BGYH 1GM9A 3ZHVA 3LNNA 3ZS8C 4UV8A 4O2BA 3X2QB 4B7EA 2Y0IA 2WA3A 2A9HA 1EN6A 4MT8A 1EZJA 3N2GA 3HPLC 2EIKB 1OCRC 1XI1A 2F66C 2Z5UA 3OAAG 3JD2A 1BHAA 3J80N 3D8CA 4LH6A 4R50A 1SC5B 5HFLA 5JWPA 3UT5A 4Z2WA 5LHGA 3RYCB 4DW0A 1WPBA 5H9CA 3BRCA 4PV1B 1ZL8A 5L3EA 2JRIA 5LMUB 3G4SV 3A2FA 1M4UA 2A0LA 1N0JA 4WFFA 1AI7A 4MTXA 3WU2Z 5KHKA 4PDLA 4I50B 2X7RB 1J5EB 3CCRV 2ITDC 1AR4A 2ZQMA 2QA4V 4EFEA 1WPXA 4X65O 1BHBA 4RWUA 2AGAA 2YUAA 1GN6A 5BZBA 3H1JH 4UB8Z 4RUEA 5B1AB 4JI6B 4DXWA 3IC7A 3CPWU 3C90A 2HEPA 2ZNJA 5KUKA 5CB4A 3W7SA 3T1HO 4TQFA 2E76B 3D36A 5B1BB 3FB5C 2JGUA 1XUQA 3HKEB 1XDCA 2P90A 1YIJV 4X9QA 2W6IG 2IW5A 2EJ7A 2R9AA 4AI8A 1HNWO 4WF9V 5BR8B 1CEZA 4G28B 4B3MB 4JYAO 1FXKC 4DUYO 4X20A 4GKKB 4FFBB 3K58A 2IH1C 5FNVA 2W0XA 1IBLB 1LNQA 1K34A 5KHJA 3X2QC 2PYLA 1FKAO 3E22A 3RWRD 2FTKA 1XNQB 1BT8A 1YEWA 2H94A 2FKXA 1N4CA 4O4JA 2EIKC 1GMGA 1W2BU 3IC9A 1DGSA 4B7KA 4LF6B 5B3SB 1XMQB 1MABG 3G80A 3JALB 2ZE8A 4DR4B 3GWKC 4YXWG 4J7KA 1HR0O 1G6UA 1L8DA 1Q6HA 3SR2C 2GTSA 5LGUA 5KAIZ 1XL4A 4UVBA 3SDLA 4WFGA 2BCCH 3E8HA 4J9ZB 5D5QA 1H2GA 3CMEV 5FL7G 4JI7B 1QVFU 3DSQA 3UQ8A 5LXTB 1V54C 4JAUA 5F2VO 4LP8A 4GUNA 5BMVB 1MG1A 1XNRB 4DR3O 1H2LA 2QGNA 2P06A 1VQLV 4IHJB 3HKBA 2WLLA 4ASUG 3OW2U 3FB7C 4LF7B 5B1AC 1SERA 5LMUO 1I94B 5FPRA 5K1XA 3CRQA 3DGEA 1YDXA 2YIAA 3ZN0A 3K04A 1EBOA 2UUBB 1IBMO 5B1BC 4UFZA 2E74B 5IYZA 3TXSA 1SQBH 2JS5A 4U7OA 2KG7B 4QE7A 1J5EO 1N32B 1ZTEA 4R8CA 2FL4A 2E75B 2HVKC 2OT5A 3Q4HB 2WLKA 3SGIA 1Z2GA 4O4IA 2ZXWB 1L0NH 1KB9F 3OEEG 3CWBH 2IH3C 2JIZG 2GUZA 3C3SA 4JI6O 2IJJA 1FXKA 1HWYA 1JJ2U 2YIBA 3JCUZ 1LUVA 2Y4TA 3LDCA 1TVKB 2HVJC 2LGWA 4FM2A 2QE7G 4XBFA 4QE9A 1NTZH 4MTOA 3E35A 1YTFD 1I0HA 1R3JC 5B3SC 2Y69B 2EULA 2O57A 1Q3EA 4O4HB 2M7WA 1GH6A 4MVQA 1N0NA 4HBNA 1ZSPA 4PDRA 4B3MO 4LF8O 3ZX6A 1P7GA 3K5MA 4GKKO 3ZMTA 3S3WA 1G4YB 4H33A 1KP2A 5BY1A 2EJRA 2DOSA 3FFQA 3RYCA 3B8MA 4NTXA 2ZIMA 1JX9A 2QWPB 4MVRA 4X1IB 2XAQA 4FLYA 5GONB 5CA3A 5A2QN 1NR1A 4DR7B 4PELA 3RFRA 1R3IC 3OMAB 1XMQO 3VOUA 3EHBB 1MZEA 3AG7A 3OM3B 4I50A 1JPXA 4DR4O 1J95A 4FLXA 1US6A 4LFCB 3SYQA 4UVAA 2V4DA 3FB6C 4QPJA 2A79B 2D3OW 3L72H 2AW9A 1WJZA 4IYHA 2EX3A 1B04A 1ZLZA 1MMMA 3R66A 4JI7O 1BCCH 4MW8A 3LDEA 2ZR2A 3DXRB 5ITZB 3CC7V 1XBLA 3TETA 5DM6V 1VQ7V 1YF2A 2CTPA 2FMLA 5EC1C 2XAFA 1XNRO 3JAKB 1B3QA 4YIPA 1Q7YW 4LFAB 1W59A 4KXRA 2Q8VA 2RCVA 1U96A 2ZXWC 3K5NA 1TUEB 3QNEA 4LC1A 1K92A 5C8YA 4UCSA 1F4MA 4LF7O 3CCUV 1AI5A 4B3RB 2JEUA 2XNDG 1I94O 1THZA 3TGUH 4FFBA 4JI8B 2AHYA 1VMGA 2YS8A 1IX9A 4DV0B 2IJIA 3OR6C 1KKCA 1OHHG 2N05A 4EEQA 3CB2A 3QTCA 3JALA 4JYBA 1LR1A 3UT5B 4KFMA 2QJ1A 1ORQC 2F95B 1SQGA 3L9DA 1YITV 2BTQB 1KU9A 4Q20A 2BOBC 2D2CB 1SRYA 3K3WA 2RQ6A 1T5EA 3K59A 2CTQA 3CCSV 2GBOA 1SA0B 2VRZA 3K79A 3R65A 5FPOA 1L1FA 3K06A 2UXCB 5LXTA 4TT3G 3WB0A 5BMVA 1FJGB 1E1RG 2CGOA 2MK3A 3JD4A 5LP6B 2ADPA 4J10A 4JI5B 4KL1A 4TWKA 2X6BA 3SYAA 2NLJC 2QKCA 2W0FC 3GB7C 1VP7A 1GN2A 2VQFO 1R6NA 1Z5VA 1M57B 3SPIA 2QTOA 4NR1A 1UJWB 1Q82W 2V1DA 1QHTA 4JYYA 2IU3A 1SETA 4FFKA 3CXHF 2WLHA 1LUWA 1WB8A 4JI3B 1MSWD 3CE2A 2HJFC 2ILMA 3UKMA 5EK0A 2KG7A 2LP7A 5IDJA 2Q7GA 2Z3YA 4LFCO 3AK3A 1IDSA 2QWOB 2UXDB 3Q4HA 2QM4A 1S3JA 3OTOB 1XL6A 5JCOC 1FAFA 4JI2O 3FYIB 4KUMA 3AG1B 4ZBMA 4U3JA 5IWAB 3K08A 1P7BA 2CTWA 2EZPA 3OMIB 3KG2A 3HKCA 3SPJA 2L6LA 1NBMG 1TVKA 1R73A 4NTWA 3ASNB 3KCXA 1VARA 1L0LH 2B1IA 1OCRB 1VEWA 3FYEB 5J2UB 1O9HA 2AXTZ 4I9WA 3SJCC 3B77A 1K5SA 4O4HA 1OCZB 4PD4F 3ZRXA 1R3LC 2DYRC 4B3RO 2QEXV 4AHCA 4FZ0A 1DTOA 2ETNA 4WBNB 3W7XA 2Q9LA 1GM7A 2IBZH 5B5EZ 4X1IA 5KHGA 4DV0O 2Q73A 3TK1A 5GONA 2F1MA 1S5LZ 3RVYA 3B4SA 4GLXA 2JVDA 5LP6C 2BE3A 2P67A 1WLEA 1S5JA 2WWWA 3CJHB 4EB6B 4CH4A 3RYFB 1YHQV 1K4DC 4GX1A 3ZHRA 2B5UA 1YZBA 1M57C 1JJOA 5CBGA 4NXNO 3DXRA 1K97A 2UXCO 4J41A 2AHZA 1FJGO 4E4EA 1XILA 3JAKA 2UXBB 3SPGA 3T4DA 2WAMA 3L70H 4LWSB 2QSAA 3AG1C 4MS2A 5KA6A 3ABMB 3AG2C 3CCVV 4DYLA 2LJ2A 3APOA 3BVOA 3W7UA 2A3QA 2HR3A 4PHZA 4BR6A 5CA0B 4GX0A 1PKXA 2QM7A 4TV9B 2UUCO 1YJNV 1R6TA 2XOKG 2L35A 1YSCA 3ASNC 3K0GA 1GRJA 2ZE6A 4JI1B 1NH2D 3LSUA 4DV3O 1WN7A 4K8ZA 2UXDO 1YJ9V 1OCZC 3OTOO 1KC8W 2RMKB 1NH2B 2N04A 4D7TA 1SZXA 5IWAO 1Z5WA 4DRXB 2BTQA 4HNAB 5IY5B 2AZ0A 2YXHA 5CA1B 4WFAV 1GM8A 1MNGA 3OD4A 4GT1A 1SA0A 4LCUC 4BWAA 3UM7A 2E3CA 4DV4B 1V54B 1NVPD 4FM0A 4L8JA 1VQOV 1K3EA 5LP6A 4DR2B 1N33B 3CS5A 5JQGB 1TUBB 4LF9B 4R6ZA 4DR1B 2HFEC 2EINB 2YI8A 3SJAC 4UCUA 4GKJB 3KCYA 1QCEA 3STZC 4JASA 1Q43A 5EYPA 3BAAA 2ZDIC 2FB5A 5E79Z 5IYCO 1JCHA 4F4LA 2YC0A 1NTKH 5JJEB 3CCJV 1MA1A 5C8YB 3CXCU 3E89A 4K8XA 1XHXA 3SYOA 4I5SA 3VQWA 3ABMC 3BCCH 4MTGA 3J7AU 3M8AA 2BSKB 5LHHA 4B3TB 3OMNB 3ZEDA 2KQXA 1YI2V 1Q6UA 5C93A 4QPKA 5K1PA 2LO1A 2GSMB 3L74H 2GHYA 3JARA 4L87A 1ZAUA 4HZ3A 3QO8A 1XREA 5JVDB 4CH3A 1YCIA 2ZCEA 3CCQV 1AB3A 2UXBO 4XDJA 3RYIB 3E83A 4JI0B 5J2UA 3E8GA 1M1KW 5A9GA 2EILC 2ZE5A 1DF4A 4D7SA 2PYJA 3JYCA 3DC6A 4AQYB 5IY5C 3GVMA 3M7MX 2OWOA 1WA8B 2Q4PA 4WBNA 1BE3H 4CS4A 1VIBA 1W0JG 2PTMA 2IU0A 4CH5A 3T4ZA 1Y6XA 4W4LA 3ZBHA 4JYCA 4JI1O 3K03A 1B6QA 3B40A 4DW1A 2DJVA 1DLBA 2WLNA 1WP8A 3RT3C 2QWRB 1FYJA 3H1KH 3CJHA 4EB6A 2XUMA 3RYFA 1UFIA 2CE4A 1DK1A 2EINC 1R3KC 4IGGA 2QKSA 1QVGU 4UB6Z 4FLVA 3G67A 4PA6A 2F4VB 1BSMA 1Q5OA 4TV8B 4DV4O 5LHIA 3ETGA 3S3XA 4X62B 2R9RB 2RN9A 5EIBD 4DV6B 2ZDIA 5KAFZ 1VF5B 2XAHA 1NJIW 1N36B 4FM1A 4PDVA 3BPZA 4LWSA 2PI4A 1DF5A 2XTAA 4U3JB 1N33O 1SS3A 3ABKB 4LF9O 5DN6G 3ZRVA 4DR1O 5LL6Y 3RBZA 1S77D 1GO3F 1E79G 3CCMV 3IJ4A 2HKOA 3HKCB 4GKJO 2JJ1G 2GTAA 2UXNA 1H2MA 2VQEB 3F5WC 5CA0A 1F4NA 5LYJB 1PL0A 3APQA 1H38A 1EN4A 4TV9A 4FK5C 4R7CA 4BAYA 4TSFG 1YTFB 1GTOA 3G6BA 5BR8O 3WB1A 4H13B 1SQVH 3BY6A 3BHPA 4RQEA 4UVCA 3TXQA 4X66B 1IBLO 2Y4UA 3RYHB 4DUZB 4UCVA 3RVZA 4DRXA 4MVSA 1XNQO 4HNAA 3RW0A 4LF4B 5CA1A 4DV7B 2LW1A 3CCEV 2ZKOA 3A0RA 4LF6O 1NU1H 4LF5B 4LBEC 4JI0O 1S76D 4PI2A 4DV1B 1IVSA 5LA6B 5CN0A 5L3BA 3LNMB 3UCSC 1FFXA 3N2KB 4AQYO 1CPYA 2DMXA 4NXMB 5H2FZ 5JQGA 1TUBA 4TQDA 2LFRA 3ZCCA 3IFXA 4RUFA 1EM1A 4FJCC 4QNHB 3JATB 3B2EE 1M56B 3L71H 5CMUA 1I08A 1S0VA 5KHHA 2Q69A 3F5TA 2DE0X 3HR0A 2JJ2G 1M93A 5EIBC 4I9QA 3B09A 3ABKC 2RNBA 1MSDA 2EIJB 3K0DA 2OYQA 2BSKA 4K35A 2MW2B 1QBZA 4ICGA 4FZ1A 2UUBO 3VQVA 1OCCC 1BL8A 1QNMA 3OTFA 2Y0PA 3FAVB 1E1QG 1PNLA 2OCCB 3LUTB 1N32O 2QWNB 5GW7A 5JVDA 5EBWC 4DV6O 4UXNA 5IYBO 3MAQA 1TAEA 1FS0G 1W0KG 4OGQB 1N36O 2Q0AA 1KYOF 3RYIA 4YHHB 2JK5C 1N34B 1O9GA 1AP6A 1RP3B 5FLXN 3JCZA 4XDLA 3F7VC 1HP8A 2DYRB 2ZE7A 4BIOA 1AP5A 4NYKA 4JV5B 4UUJC 2VQEO 1HNZB 3VQXA 4CS3A 1WA8A 1Q6IA 3ML0A 3SYPA 1IZ3A 3P30A 1BZKA 1S5HC 4ZI7B 1ZWIC 1A32A 3CRAA 2WPDG 1Q90D 2IJHA 3ETQA 3CC4V 2YXYA 2Z0AA 1P84F 4FLWA 1AILA 1KD1W 5L3DA 2RJZA 1BQ0A 1GK9A 4O2AB 3AEIA 4DUZO 1N8RW 4C7UA 5D5PA 3E8BA 4N21A 1PPJH 3H1IH 2WLIB 4DV7O 4I4TB 3ZJZA 3J81N 1MZFA 2R9IA 5EYPB 4DR7O 1KBHA 4RO2A 1VQ5V 1M56C 2CGNA 3ZN1A 4LF5O 1NR7A 2XASA 4OXSA 4LNUB 2ARHA 1GN4A 4TV8A 2OIGA 4MW3A 2ZIOA 3BEHA 2NNUA 4PA4A 3IAYA 5L3FA 3NR7A 2Q67A 2EIJC 3OGCC 5JJJB 3FX7A 4NXMO 1V55B 3AG2B 1Y67A 3EXAA 2QR4A 5LOVB 1RSOB 3JARB 3LSSA 1XOUA 2OCCC 4UCTA 2CTRA 5LYJA 2X0LA 4GYCB 3CHXA 5H6QA 2HJDA 2W6JG 4LFAO 4GZRB 4FMTA 4MVZA 1GAXA 4F6RB 2F93B 2XAJA 1CP9A 1X4TA 2E5LB 1COWG 2CUGA 4IIJB 2KKWA 4MVOA 1M90W 5J2TB 1Q81W 3CRMA 4JI8O 1AJNA 3RYHA 1RPRA 2PF4E 1ZX3A 2H3OA 2NR5A 4H0LB 1Q8IA 4HYOA 5JH7A 1VQNV 1PP9H 1K9MW 3H1HH 3E8FA 4PI0A 3E2EA 3L73H 2K9PA 4YHHO 1N34O 1HDJA 2OTJV 3ABTA 5KLVH 5LA6A 4BIZA 1AI6A 4JGSA 2HLDG 2ATKC 3N2KA 4JV5O 2XT9A 4YJ3B 1PM9A 4DR6B 3K5OA 2ZR3A 1VQ4V 1SZTA 3N27A 3C3TA 2A06H 1NTMH 3T1CA 4LH7A 3JATA 1HNWB 5DEDA 4JYAB 1QU7A 2C2AA 2YEVB 3ZHTA 4J7ZA 4X88A 3ZIAG 4JI5O 5JJNB 3D36C 2ZNIA 4X1KB 4K3AA 3I56V 2P5OA 1V55C 1RFYA 5JCOA 3BA8A 4YJ2B 3FD9A 2R72A 2HHHB 3ABUA 1WP7A 4NKGB 4JI3O 2YIBD 4IYIA 4JZ2A 2DWDC 1B06A 1AJQA 4P30A 1XEQA 3FAVA 4IT5A 4DK0A 3CMAV 2DQ0A 4NTYA 1UPGA 4DV5B 4FLTA 5B1OA 2VWKA 3JSNA 1VQPV 1D5NA 5AG2A 2HG5C 3JAWB 2EILB 2UXXA 3F7YC 3ZMVA 1HNXB 2G38A 4Z1MG 4QGPA 3AG4C 1SESA 5L3CA 4P9PA 3WG7B 3ASOC 3HB3B 4W4KA 3VQYA 4E2LA 2ZINA 4DR3B 2GV9A 1ROPA 1H8EG 1EFRG 4P9OA 4X64B 3P3PA 2EIMB 2ITCC 3VBBA 1JMKC 3ZHSA 2GDSA 4ZI7A 2E5LO 1XMOB 4ZKIA 3CP1A 5IE9A 1NT2B 1FFXB 4WCEV 4PDMA 2YICA 2YSUB 1NVPB 1IBMB 1OCOC 4O2AA 4WFHA 1NZ6A 4JZGA 1PL4A 1JVMA 2Q68A 2PUSA 4OPHA 2WLIA 1QLEB 4CH6A 4I4TA 2PGGA 4I55B 3BFRA 1P4RA 2WLMA 4X1YB 4WFBV 3OE7G 4BIUA 1R6KA 3AG3B 1F7YA 4LNUA 4OX9B 1G1XB 3THOA 1JR9A 4QIWF 4OPAA 3TCUA 3CC2V 1F51A 1AJPA 3D3QA 1BQZA 4MVUA 4DR6O 1EZVH 4IL6Z 4NVPA 1ZUQA 2WLJA 3ZRWB 5LOVA 4UCOA 1M5IA 4JTCB 4PA9A 3GWOA 1RSOA 3QF7A 3OEHG 2OIEA 4LF8B 4LR3A 1P49A 2AZ2A 4PJ0Z 5KX5B 4F6RA 2UU9B 3K9AA 3A0BZ 5KHIA 3BABA 3CX5F 1H2SB 1D5AA 4G27B 1NS1A 1Y66A 1K73W 1Y74B 4IIJA 2IM9A 5EBLC 5KMGB 5J2TA 4DV2B 3WG7C 2A7WA 3H01A 2HHHO 1VF6C 3ZHUA 3HKDB 2EIMC 3A0HZ 4JI4B 4DK1A 1M9NA 4GCZA 4MVMA 3PJSK 1JFFB 4DV5O 4JAVA 4CBCA 3ZMUA 1XHZA 4B3SB 4KHPB 1SQPH 2PY5A 3NXSA 4Q6GA 4EKWA 4I0XA 1HNXO 2EBOA 1OJHA 3CRRA 3JASA 2Q0OC 1VQ8V 1BMFG 2OTLV 1YXBA 4FLZA 1WNSA 1JQ0A 2CAZC 1QLEC 4YJ3A 5EZYB 4X64O 3G71V 2HP8A 2YXLA 3AG3C 4FPPA 3STLC 1XMOO 3ICXA 2YIDA 2YEVA 3ZMSA 1AI4A 1ENVA 4DR2O 4JAAA 1K4CC 5KA5A 4GX5A 4X1KA 3I55V 1Y76B 1VQ9V 3ETEA 2IJKA 2Y48A 4ABMA 1FXVA 1S72V 4YJ2A 2F43G 5GTHZ 5E1AC 2LGQA 1OCCB 1SQQH 3LSQA 1KP3A 2JS3A 3SJQC 4JTAB 3JD1A 3JSLA 1AR1B 3ABLB 4OX9O 1AROP 3FB8C 5LMNB 5EBMC 4YY3B 2JEXA 4MTFA 3W7WA 3U11A 2EZOA 3O65A 3JAWA 1SQXH 3JD0A 4JF3A 4B3TO 2PZSA 1VQMV 4J80A 2CH7B 4TUYB 4RQFA 1F23A 3T1YB 1KKDA 1OV9A 4ZHQB 1RPOA 5L3GA 3D3IA 3JD3A 1WAZA 1H2KA 1VF6A 5JH7B 2UUAB 3IGAC 2ZM6B 4U7NA 1SF9A 4TOIA 1U97A 3EFFK 5DECA 2UU9O 2LFSA 4RAIA 1PV0A 2DYSB 5IJ0B 3M99B 3RN4A 4H44B 2YDEA 3QO5A 4JTDB 3SPCA 2VQFB 3ZRSA 1K7DA 1H2NA 4DO2A 4DV2O 5CBHA 3AK2A 3W7TA 4CC6A 1K8AW 1URFA 2N74A 3FKSG 3UO3A 5B66Z 4LFBB 4JI4O 4XDKA 5IJ9B 4CC5A 3OUFA 3QVNA 4I55A 4UCRA 2R70A
chains in the Genus database with same CATH topology
1YJ9V 1OCZC 3WFVA 3MD0A 4KP4A 1KC8W 1QVFU 2DWEC 1NH2B 3LSSA 1V54C 4JAUA 2OCCC 4LP8A 1MOFA 1MG1A 2KB1A 2X0LA 5H6QA 1PNKA 2W6JG 5IY5B 1VQLV 4FMTA 4MVZA 3B8NA 1OZ0A 2XAJA 1CP9A 3CCLV 4WFAV 2WLLA 4ASUG 1GM8A 3OW2U 1COWG 3FB7C 5B1AC 1SERA 4GT1A 4MVOA 3CYOA 4LCUC 1M90W 1JOYA 3ZRWA 3UM7A 1Q81W 2V7QG 3E86A 3ETDA 1V54B 3DGEA 1NVPD 3ZN0A 3K04A 1EBOA 3ABLC 1AJNA 5B1BC 1QLNA 1VQOV 1H8HG 1PD3A 1K3EA 1RPRA 3OUSA 3CD6V 1K5QA 4U7OA 1I5XA 4QE7A 4UV9A 5KUMA 4R8CA 2HVKC 2OT5A 4HYOA 4R6ZA 5EC2C 2WLKA 1VQNV 1K9MW 2HFEC 1GKFA 2EINB 2Y69C 2ZXWB 3E8FA 3E2EA 3OEEG 3STZC 1QCEA 4JASA 2IH3C 2JIZG 2OTJV 2B1GA 3ABTA 2DW4A 2IJJA 1FXKA 1HWYA 1JJ2U 4BIZA 2ZDIC 4QJFB 1AI6A 4JGSA 2HLDG 1JCHA 2ATKC 4F4LA 5IYCO 1K33A 3LDCA 2HVJC 2QE7G 3CCJV 4XBFA 4QE9A 4X8AA 3CXCU 3E89A 3SYOA 2DYSC 2ZR3A 4I5SA 4MTOA 3E35A 1YTFD 1R3JC 3ABMC 2QM8A 5B3SC 2Y69B 1VQ4V 1SZTA 4MTGA 2K1EA 5LHHA 2XAGA 3T1CA 4PA7A 2M7WA 3OMNB 5B1NA 1IXMA 3MHHC 4MVQA 1YI2V 4PDRA 5C93A 4QPKA 2C2AA 2YEVB 2GSMB 3ZMTA 1FXHA 2GHYA 1G4YB 4H33A 4L87A 4X88A 3ZIAG 4HZ3A 1KP2A 3QO8A 2EJRA 1KECA 3B8MA 3CCQV 3I56V 1JX9A 4MVRA 1V55C 2XAQA 4XDJA 3E83A 5LGNA 1M1KW 3E8GA 5CA3A 1NR1A 2EILC 1DF4A 4PELA 4GX2A 3T2MA 5HFMA 3ABUA 1R3IC 3JYCA 3OMAB 3VOUA 3OFNG 1RM1B 2PI5A 3EHBB 2DWDC 3OM3B 3OR7C 1JPXA 1AJQA 5IY5C 4P30A 1J95A 1QR8A 5CBFA 5H6RA 3CMAV 3SYQA 3DTUB 2WSSG 2DQ0A 4UVAA 3FB6C 4JPRA 4QPJA 1W0JG 5B1OA 5J9PC 2A79B 2D3OW 2IU0A 1VQPV 3T4ZA 2HG5C 4JYCA 3ZMZA 4CZZA 3K03A 1B6QA 2EILB 2UXXA 3F7YC 3ZMVA 4FIPC 1DLBA 4MW8A 3LDEA 4N23A 2P6JA 2ZR2A 4Z1MG 3AG4C 2WLNA 1SESA 5L3CA 4P9PA 3CC7V 3WG7B 3TETA 5LBQA 5DM6V 1VQ7V 3ASOC 3HB3B 5EC1C 2ZD9A 4E2LA 2XAFA 1ROPA 1H8EG 1EFRG 2X6AA 4P9OA 1Q7YW 4J9YB 4P2ZA 2EIMB 2ITCC 3VBBA 2EINC 1R3KC 2JDIG 2ZXWC 1TUEB 3QNEA 2QKSA 4LC1A 1K92A 1QVGU 1F4MA 4ZKIA 1VQ6V 3CP1A 3AG4B 3G6EV 2X6CA 4PA6A 3CCUV 4WCEV 1AI5A 4PDMA 2JEUA 2XNDG 2YSUB 1NVPB 3ASOB 1THZA 1VQKV 5LHIA 3ETGA 5IYDO 2AHYA 1OCOC 2R9RB 1Q86W 4WFHA 4PA3A 2ZDIA 1JVMA 2IJIA 2Q68A 3OR6C 2XAHA 1NJIW 1OHHG 4PDVA 2Q6AA 2WLIA 1QLEB 2PI4A 1DF5A 4WFEA 3ABKB 3LDDA 1FFTB 5DN6G 3ZRVA 1P4RA 2WLMA 3RBZA 4WFBV 3OE7G 1GO3F 1S77D 1E79G 4BIUA 4JYBA 3CCMV 1R6KA 3AG3B 2HKOA 2JJ1G 2UXNA 4MSWC 1OCOB 4KFMA 3F5WC 1F4NA 1PNMA 1ORQC 4H37A 1YITV 1PL0A 1H38A 4HAMA 4Q20A 2BOBC 1Y4MA 1SRYA 2H8PC 3K3WA 4QIWF 4FK5C 4R7CA 4BAYA 4BW5A 3QO7A 3TCUA 3CC2V 1F51A 2WLLB 1AJPA 4G2KA 3CCSV 4TSFG 4MVUA 1NQTA 1GTOA 4X89A 1YTFB 1NKDA 3K79A 2WLJA 3SPHA 5LGTA 3R65A 3ZRWB 2BOCC 3BY6A 1L1FA 1RM1C 4JTCB 3K06A 4PA9A 4RQEA 3GWOA 4UVCA 3SYCA 4TT3G 2P7TC 3OEHG 1E1RG 3RVZA 2MK3A 4MVSA 3JD4A 3RW0A 4TWKA 3MHSC 2X6BA 3SYAA 3K9AA 3CCEV 1KQSU 3P32A 3A0RA 2NLJC 2W0FC 3GB7C 1I5YA 4G27B 1YJWV 1Y66A 1K73W 2CK3G 1R6NA 1M57B 5EBLC 4LBEC 3SPIA 2QTOA 1G8MA 1S76D 3WG7C 1UJWB 1Q82W 2DQ3A 2V1DA 2IU3A 5CN0A 3H01A 1FXKB 5L3BA 1SETA 2WLHA 3LNMB 1QR9A 1MSWD 1GM9A 2HJFC 3UKMA 1CPYA 2EIMC 2LP7A 5EK0A 5IDJA 4UV8A 3X2QB 2Z3YA 1M9NA 4GCZA 4MVMA 3PJSK 2A9HA 4MT8A 4JAVA 1S3JA 2LFRA 3ZCCA 4CBCA 1EZJA 3ZMUA 1XL6A 3IFXA 4RUFA 4FJCC 3HPLC 2EIKB 3FYIB 4KUMA 3AG1B 1OCRC 4QNHB 4ZBMA 3NXSA 1M56B 2Z5UA 3OAAG 3K08A 4EKWA 1P7BA 5CMUA 3JD2A 1BHAA 2EBOA 2EZPA 4R50A 1S0VA 3OMIB 3KG2A 1VQ8V 2Q69A 1BMFG 5HFLA 2OTLV 3SPJA 5LHGA 1NBMG 2JJ2G 1JQ0A 1R73A 5H9CA 1QLEC 3ABKC 5L3EA 3G71V 3ASNB 3G4SV 2B1IA 2EIJB 1OCRB 3K0DA 3FYEB 2A0LA 4I9WA 3AG3C 4FPPA 3B77A 1K5SA 1QBZA 4WFFA 1AI7A 3STLC 1OCZB 4MTXA 3ZRXA 1OCCC 1BL8A 1R3LC 4PDLA 2DYRC 2X7RB 2YEVA 3ZMSA 1AI4A 1ENVA 2QEXV 1E1QG 1PNLA 2OCCB 3CCRV 3LUTB 5GW7A 2ITDC 1DTOA 1K4CC 5KA5A 2ZQMA 4GX5A 2QA4V 3W7XA 1WPXA 5EBWC 1BHBA 1GM7A 4UXNA 5IYBO 3I55V 1VQ9V 3ETEA 2IJKA 1FS0G 1W0KG 3TK1A 2Y48A 1FXVA 1S72V 2JK5C 5BZBA 2F43G 3RVYA 5E1AC 3JCZA 1OCCB 4RUEA 5B1AB 4XDLA 3F7VC 4DXWA 3IC7A 3CPWU 2DYRB 3LSQA 1KP3A 3SJQC 4JTAB 3JD1A 5KUKA 4UUJC 1AR1B 3W7SA 3ABLB 5B1BB 3D36A 2P67A 1AROP 1WLEA 3FB5C 2WWWA 3FB8C 5EBMC 2P90A 3ML0A 1YIJV 3SYPA 1YHQV 3P30A 1K4DC 2JEXA 4MTFA 4GX1A 2W6IG 2IW5A 3W7WA 2EZOA 2B5UA 1S5HC 4JF3A 1M57C 3JD0A 1ZWIC 1VQMV 2WPDG 2IJHA 4WF9V 5CBGA 1CEZA 4G28B 3CC4V 1FXKC 4RQFA 1K97A 1KD1W 5L3DA 2IH1C 1F23A 2AHZA 1GK9A 1KKDA 1LNQA 1RPOA 3AEIA 1K34A 5L3GA 3X2QC 3D3IA 3JD3A 2FTKA 3IGAC 1N8RW 4U7NA 3SPGA 3T4DA 2WAMA 3E8BA 4N21A 3EFFK 2WLIB 2H94A 3ZJZA 2LFSA 4RAIA 2EIKC 1GMGA 2R9IA 3AG1C 2DYSB 1W2BU 3M99B 4MS2A 4RO2A 3ABMB 5KA6A 1VQ5V 1M56C 3AG2C 3QO5A 5B3SB 4JTDB 3CCVV 3SPCA 1MABG 3ZN1A 1NR7A 3ZRSA 1K7DA 3W7UA 2HR3A 2XASA 4OXSA 4YXWG 4DO2A 4MW3A 3BEHA 4GX0A 5CBHA 1PKXA 2NNUA 3W7TA 4PA4A 2QM7A 1K8AW 5L3FA 5LGUA 1YJNV 2XOKG 3FKSG 1XL4A 3ASNC 1YSCA 4UVBA 3K0GA 3E8HA 4WFGA 4XDKA 2Q67A 2EIJC 4J9ZB 1H2GA 3OGCC 3CMEV 5FL7G 3OUFA 1NH2D 1V55B 3AG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBO A;  2MK3 A;  1QR9 A;  1Y4M A;  2EZP A;  3WFV A;  3CYO A;  1SZT A;  2X7R B;  4FK5 C;  1ENV A;  5HFL A;  3MHS C;  2LP7 A;  1F23 A;  1QCE A;  3K9A A;  1DF5 A;  2M7W A;  1JQ0 A;  4FIP C;  1K34 A;  1DF4 A;  1EBO A;  1MOF A;  1MG1 A;  3MHH C;  4G2K A;  5H9C A;  5KA5 A;  1DLB A;  5HFM A;  4N23 A;  2P6J A;  3CP1 A;  1I5Y A;  1Y66 A;  3P30 A;  4JGS A;  4N21 A;  5KA6 A;  1JPX A;  1I5X A;  1K33 A;  3B8N A;  2EZO A;  4FJC C;  3GWO A;  1QR8 A;  4JF3 A;  3B77 A;  1QBZ A;  3M99 B;  4E2L A;  3B8M A;  5CN0 A;  3H01 A;  5CMU A;  2OT5 A;  4JPR A; 
#chains in the Genus database with same CATH topology
 2LW7 A;  5IT9 N;  3WFV A;  4U3F H;  3MD0 A;  4ZOL B;  4KP4 A;  4B3S O;  4KHP O;  4X1Y A;  4JI2 B;  2DWE C;  2XHB A;  3TJT A;  1MOF A;  2KB1 A;  1PNK A;  2VWJ A;  2JGD B;  1IBK B;  3B8N A;  1OZ0 A;  3CCL V;  3KZI Z;  3EVK A;  4Z1V A;  3HKE A;  1X59 A;  2LQT A;  3CYO A;  4AIL C;  1JOY A;  2F4V O;  5H5N A;  3ZRW A;  2DN9 A;  2V7Q G;  3E86 A;  1TA8 A;  3ETD A;  3DC5 A;  3OT7 A;  4O4L B;  3UO2 A;  3ABL C;  4X62 O;  1QLN A;  1H8H G;  1PD3 A;  3OGI B;  3OUS A;  2ZT9 B;  3I5D A;  3CD6 V;  1K5Q A;  1KMI Z;  1R1B A;  1I5X A;  4O2B B;  3BA9 A;  4UV9 A;  4DR5 B;  5KUM A;  5KX5 A;  1YVW A;  3RGB A;  3SJB C;  5EC2 C;  1JA8 A;  1XQ8 A;  3N2G B;  1GKF A;  3JAM N;  2Y69 C;  4FLU A;  3QG5 A;  1Y74 A;  3K57 A;  4NB5 A;  2Q5Z A;  5KMG A;  2Q7H A;  4K0K B;  2QDO A;  2B1G A;  2DW4 A;  2QKA A;  5GTI Z;  1AVM A;  1KUQ A;  4QJF B;  3HKD A;  1K33 A;  2CDY A;  1QQC A;  3WB2 A;  4X8A A;  5LMN O;  1FD9 A;  1ZL8 B;  2DYS C;  4YY3 O;  1JFF A;  2QM8 A;  4A5U B;  2K1E A;  2XAG A;  4PA7 A;  1SQF A;  5B1N A;  1IXM A;  4X66 O;  3MHH C;  4NXN B;  1WB7 A;  1CXZ B;  4FVM A;  2OCH A;  4LF4 O;  1FXH A;  3T1Y O;  1KEC A;  1D2D A;  2UUA O;  5EZY A;  2ZM6 O;  4IHJ A;  4YIO A;  3H9V A;  4ZIB A;  5LGN A;  2Q7E A;  3K9S A;  4DV1 O;  1BS3 A;  4GX2 A;  3T2M A;  5HFM A;  4CS2 A;  3OFN G;  1RM1 B;  2PI5 A;  3OR7 C;  5CB4 B;  1QR8 A;  5CBF A;  5H6R A;  1IUR A;  3DTU B;  2WSS G;  4D6T H;  2KSD A;  4JPR A;  2UUC B;  5J9P C;  1Y76 A;  3ZHQ A;  4LFB O;  3ZMZ A;  1GN3 A;  4CZZ A;  3CEI A;  4FIP C;  4DV3 B;  4N23 A;  2P6J A;  3MDS A;  4BW9 A;  4X20 B;  2BTO A;  1NI8 A;  2ADQ B;  5FNV B;  3U0Z A;  2P22 C;  5LBQ A;  3U10 A;  4J7J A;  2ZD9 A;  3E22 B;  2X6A A;  3O9O A;  4J9Y B;  4F6E A;  4P2Z A;  1IBK O;  4B08 A;  2JDI G;  3P3N A;  4O4J B;  2YI9 A;  2NN4 A;  1VQ6 V;  3AG4 B;  3A8T A;  3G6E V;  2X6C A;  2CH7 A;  4TUY A;  3KKY A;  3ASO B;  4J11 A;  1VQK V;  5IYD O;  2F23 A;  4ZHQ A;  4J42 A;  1Q86 W;  4X65 B;  4PA3 A;  3AK1 A;  3K5L A;  2Q6A A;  3CSX A;  4DR5 O;  3L75 H;  4WFE A;  3LDD A;  4I0X B;  5IJ0 A;  1FFT B;  3JAS B;  3H1L H;  4MSW C;  1I7F A;  1V9P A;  3T1H B;  1OCO B;  4K0K O;  2VS0 A;  1HNZ O;  2P4K A;  1PNM A;  3CRC A;  1VF7 A;  4H37 A;  4HAM A;  1Y4M A;  2H8P C;  1AR5 A;  4EFB A;  4BW5 A;  3QO7 A;  3HKB B;  2WLL B;  2RDC A;  5IJ9 A;  4G2K A;  1NQT A;  4X89 A;  1EN5 A;  2P4V A;  4I7Z B;  5BXZ A;  1NKD A;  3SPH A;  5LGT A;  2BOC C;  4DUY B;  4ZOL A;  2ODM A;  1RM1 C;  2QTS A;  1TGO A;  3SYC A;  2FYU H;  2P7T C;  5IYZ B;  1SKV A;  5TIS Z;  3PN1 A;  5ITZ A;  2QWQ B;  2JGD A;  3MHS C;  1KQS U;  1HW7 A;  3P32 A;  1IXB A;  1I5Y A;  1YJW V;  1FPO A;  4O4I B;  2CK3 G;  2WA4 A;  2M6Y A;  1G8M A;  4O4L A;  2GUZ B;  2DQ3 A;  1HR0 B;  1FXK B;  2B9Z A;  1QR9 A;  1BGY H;  1GM9 A;  3ZHV A;  3LNN A;  3ZS8 C;  4UV8 A;  4O2B A;  3X2Q B;  4B7E A;  2Y0I A;  2WA3 A;  2A9H A;  1EN6 A;  4MT8 A;  1EZJ A;  3N2G A;  3HPL C;  2EIK B;  1OCR C;  1XI1 A;  2F66 C;  2Z5U A;  3OAA G;  3JD2 A;  1BHA A;  3J80 N;  3D8C A;  4LH6 A;  4R50 A;  1SC5 B;  5HFL A;  5JWP A;  3UT5 A;  4Z2W A;  5LHG A;  3RYC B;  4DW0 A;  1WPB A;  5H9C A;  3BRC A;  4PV1 B;  1ZL8 A;  5L3E A;  2JRI A;  5LMU B;  3G4S V;  3A2F A;  1M4U A;  2A0L A;  1N0J A;  4WFF A;  1AI7 A;  4MTX A;  3WU2 Z;  5KHK A;  4PDL A;  4I50 B;  2X7R B;  1J5E B;  3CCR V;  2ITD C;  1AR4 A;  2ZQM A;  2QA4 V;  4EFE A;  1WPX A;  4X65 O;  1BHB A;  4RWU A;  2AGA A;  2YUA A;  1GN6 A;  5BZB A;  3H1J H;  4UB8 Z;  4RUE A;  5B1A B;  4JI6 B;  4DXW A;  3IC7 A;  3CPW U;  3C90 A;  2HEP A;  2ZNJ A;  5KUK A;  5CB4 A;  3W7S A;  3T1H O;  4TQF A;  2E76 B;  3D36 A;  5B1B B;  3FB5 C;  2JGU A;  1XUQ A;  3HKE B;  1XDC A;  2P90 A;  1YIJ V;  4X9Q A;  2W6I G;  2IW5 A;  2EJ7 A;  2R9A A;  4AI8 A;  1HNW O;  4WF9 V;  5BR8 B;  1CEZ A;  4G28 B;  4B3M B;  4JYA O;  1FXK C;  4DUY O;  4X20 A;  4GKK B;  4FFB B;  3K58 A;  2IH1 C;  5FNV A;  2W0X A;  1IBL B;  1LNQ A;  1K34 A;  5KHJ A;  3X2Q C;  2PYL A;  1FKA O;  3E22 A;  3RWR D;  2FTK A;  1XNQ B;  1BT8 A;  1YEW A;  2H94 A;  2FKX A;  1N4C A;  4O4J A;  2EIK C;  1GMG A;  1W2B U;  3IC9 A;  1DGS A;  4B7K A;  4LF6 B;  5B3S B;  1XMQ B;  1MAB G;  3G80 A;  3JAL B;  2ZE8 A;  4DR4 B;  3GWK C;  4YXW G;  4J7K A;  1HR0 O;  1G6U A;  1L8D A;  1Q6H A;  3SR2 C;  2GTS A;  5LGU A;  5KAI Z;  1XL4 A;  4UVB A;  3SDL A;  4WFG A;  2BCC H;  3E8H A;  4J9Z B;  5D5Q A;  1H2G A;  3CME V;  5FL7 G;  4JI7 B;  1QVF U;  3DSQ A;  3UQ8 A;  5LXT B;  1V54 C;  4JAU A;  5F2V O;  4LP8 A;  4GUN A;  5BMV B;  1MG1 A;  1XNR B;  4DR3 O;  1H2L A;  2QGN A;  2P06 A;  1VQL V;  4IHJ B;  3HKB A;  2WLL A;  4ASU G;  3OW2 U;  3FB7 C;  4LF7 B;  5B1A C;  1SER A;  5LMU O;  1I94 B;  5FPR A;  5K1X A;  3CRQ A;  3DGE A;  1YDX A;  2YIA A;  3ZN0 A;  3K04 A;  1EBO A;  2UUB B;  1IBM O;  5B1B C;  4UFZ A;  2E74 B;  5IYZ A;  3TXS A;  1SQB H;  2JS5 A;  4U7O A;  2KG7 B;  4QE7 A;  1J5E O;  1N32 B;  1ZTE A;  4R8C A;  2FL4 A;  2E75 B;  2HVK C;  2OT5 A;  3Q4H B;  2WLK A;  3SGI A;  1Z2G A;  4O4I A;  2ZXW B;  1L0N H;  1KB9 F;  3OEE G;  3CWB H;  2IH3 C;  2JIZ G;  2GUZ A;  3C3S A;  4JI6 O;  2IJJ A;  1FXK A;  1HWY A;  1JJ2 U;  2YIB A;  3JCU Z;  1LUV A;  2Y4T A;  3LDC A;  1TVK B;  2HVJ C;  2LGW A;  4FM2 A;  2QE7 G;  4XBF A;  4QE9 A;  1NTZ H;  4MTO A;  3E35 A;  1YTF D;  1I0H A;  1R3J C;  5B3S C;  2Y69 B;  2EUL A;  2O57 A;  1Q3E A;  4O4H B;  2M7W A;  1GH6 A;  4MVQ A;  1N0N A;  4HBN A;  1ZSP A;  4PDR A;  4B3M O;  4LF8 O;  3ZX6 A;  1P7G A;  3K5M A;  4GKK O;  3ZMT A;  3S3W A;  1G4Y B;  4H33 A;  1KP2 A;  5BY1 A;  2EJR A;  2DOS A;  3FFQ A;  3RYC A;  3B8M A;  4NTX A;  2ZIM A;  1JX9 A;  2QWP B;  4MVR A;  4X1I B;  2XAQ A;  4FLY A;  5GON B;  5CA3 A;  5A2Q N;  1NR1 A;  4DR7 B;  4PEL A;  3RFR A;  1R3I C;  3OMA B;  1XMQ O;  3VOU A;  3EHB B;  1MZE A;  3AG7 A;  3OM3 B;  4I50 A;  1JPX A;  4DR4 O;  1J95 A;  4FLX A;  1US6 A;  4LFC B;  3SYQ A;  4UVA A;  2V4D A;  3FB6 C;  4QPJ A;  2A79 B;  2D3O W;  3L72 H;  2AW9 A;  1WJZ A;  4IYH A;  2EX3 A;  1B04 A;  1ZLZ A;  1MMM A;  3R66 A;  4JI7 O;  1BCC H;  4MW8 A;  3LDE A;  2ZR2 A;  3DXR B;  5ITZ B;  3CC7 V;  1XBL A;  3TET A;  5DM6 V;  1VQ7 V;  1YF2 A;  2CTP A;  2FML A;  5EC1 C;  2XAF A;  1XNR O;  3JAK B;  1B3Q A;  4YIP A;  1Q7Y W;  4LFA B;  1W59 A;  4KXR A;  2Q8V A;  2RCV A;  1U96 A;  2ZXW C;  3K5N A;  1TUE B;  3QNE A;  4LC1 A;  1K92 A;  5C8Y A;  4UCS A;  1F4M A;  4LF7 O;  3CCU V;  1AI5 A;  4B3R B;  2JEU A;  2XND G;  1I94 O;  1THZ A;  3TGU H;  4FFB A;  4JI8 B;  2AHY A;  1VMG A;  2YS8 A;  1IX9 A;  4DV0 B;  2IJI A;  3OR6 C;  1KKC A;  1OHH G;  2N05 A;  4EEQ A;  3CB2 A;  3QTC A;  3JAL A;  4JYB A;  1LR1 A;  3UT5 B;  4KFM A;  2QJ1 A;  1ORQ C;  2F95 B;  1SQG A;  3L9D A;  1YIT V;  2BTQ B;  1KU9 A;  4Q20 A;  2BOB C;  2D2C B;  1SRY A;  3K3W A;  2RQ6 A;  1T5E A;  3K59 A;  2CTQ A;  3CCS V;  2GBO A;  1SA0 B;  2VRZ A;  3K79 A;  3R65 A;  5FPO A;  1L1F A;  3K06 A;  2UXC B;  5LXT A;  4TT3 G;  3WB0 A;  5BMV A;  1FJG B;  1E1R G;  2CGO A;  2MK3 A;  3JD4 A;  5LP6 B;  2ADP A;  4J10 A;  4JI5 B;  4KL1 A;  4TWK A;  2X6B A;  3SYA A;  2NLJ C;  2QKC A;  2W0F C;  3GB7 C;  1VP7 A;  1GN2 A;  2VQF O;  1R6N A;  1Z5V A;  1M57 B;  3SPI A;  2QTO A;  4NR1 A;  1UJW B;  1Q82 W;  2V1D A;  1QHT A;  4JYY A;  2IU3 A;  1SET A;  4FFK A;  3CXH F;  2WLH A;  1LUW A;  1WB8 A;  4JI3 B;  1MSW D;  3CE2 A;  2HJF C;  2ILM A;  3UKM A;  5EK0 A;  2KG7 A;  2LP7 A;  5IDJ A;  2Q7G A;  2Z3Y A;  4LFC O;  3AK3 A;  1IDS A;  2QWO B;  2UXD B;  3Q4H A;  2QM4 A;  1S3J A;  3OTO B;  1XL6 A;  5JCO C;  1FAF A;  4JI2 O;  3FYI B;  4KUM A;  3AG1 B;  4ZBM A;  4U3J A;  5IWA B;  3K08 A;  1P7B A;  2CTW A;  2EZP A;  3OMI B;  3KG2 A;  3HKC A;  3SPJ A;  2L6L A;  1NBM G;  1TVK A;  1R73 A;  4NTW A;  3ASN B;  3KCX A;  1VAR A;  1L0L H;  2B1I A;  1OCR B;  1VEW A;  3FYE B;  5J2U B;  1O9H A;  2AXT Z;  4I9W A;  3SJC C;  3B77 A;  1K5S A;  4O4H A;  1OCZ B;  4PD4 F;  3ZRX A;  1R3L C;  2DYR C;  4B3R O;  2QEX V;  4AHC A;  4FZ0 A;  1DTO A;  2ETN A;  4WBN B;  3W7X A;  2Q9L A;  1GM7 A;  2IBZ H;  5B5E Z;  4X1I A;  5KHG A;  4DV0 O;  2Q73 A;  3TK1 A;  5GON A;  2F1M A;  1S5L Z;  3RVY A;  3B4S A;  4GLX A;  2JVD A;  5LP6 C;  2BE3 A;  2P67 A;  1WLE A;  1S5J A;  2WWW A;  3CJH B;  4EB6 B;  4CH4 A;  3RYF B;  1YHQ V;  1K4D C;  4GX1 A;  3ZHR A;  2B5U A;  1YZB A;  1M57 C;  1JJO A;  5CBG A;  4NXN O;  3DXR A;  1K97 A;  2UXC O;  4J41 A;  2AHZ A;  1FJG O;  4E4E A;  1XIL A;  3JAK A;  2UXB B;  3SPG A;  3T4D A;  2WAM A;  3L70 H;  4LWS B;  2QSA A;  3AG1 C;  4MS2 A;  5KA6 A;  3ABM B;  3AG2 C;  3CCV V;  4DYL A;  2LJ2 A;  3APO A;  3BVO A;  3W7U A;  2A3Q A;  2HR3 A;  4PHZ A;  4BR6 A;  5CA0 B;  4GX0 A;  1PKX A;  2QM7 A;  4TV9 B;  2UUC O;  1YJN V;  1R6T A;  2XOK G;  2L35 A;  1YSC A;  3ASN C;  3K0G A;  1GRJ A;  2ZE6 A;  4JI1 B;  1NH2 D;  3LSU A;  4DV3 O;  1WN7 A;  4K8Z A;  2UXD O;  1YJ9 V;  1OCZ C;  3OTO O;  1KC8 W;  2RMK B;  1NH2 B;  2N04 A;  4D7T A;  1SZX A;  5IWA O;  1Z5W A;  4DRX B;  2BTQ A;  4HNA B;  5IY5 B;  2AZ0 A;  2YXH A;  5CA1 B;  4WFA V;  1GM8 A;  1MNG A;  3OD4 A;  4GT1 A;  1SA0 A;  4LCU C;  4BWA A;  3UM7 A;  2E3C A;  4DV4 B;  1V54 B;  1NVP D;  4FM0 A;  4L8J A;  1VQO V;  1K3E A;  5LP6 A;  4DR2 B;  1N33 B;  3CS5 A;  5JQG B;  1TUB B;  4LF9 B;  4R6Z A;  4DR1 B;  2HFE C;  2EIN B;  2YI8 A;  3SJA C;  4UCU A;  4GKJ B;  3KCY A;  1QCE A;  3STZ C;  4JAS A;  1Q43 A;  5EYP A;  3BAA A;  2ZDI C;  2FB5 A;  5E79 Z;  5IYC O;  1JCH A;  4F4L A;  2YC0 A;  1NTK H;  5JJE B;  3CCJ V;  1MA1 A;  5C8Y B;  3CXC U;  3E89 A;  4K8X A;  1XHX A;  3SYO A;  4I5S A;  3VQW A;  3ABM C;  3BCC H;  4MTG A;  3J7A U;  3M8A A;  2BSK B;  5LHH A;  4B3T B;  3OMN B;  3ZED A;  2KQX A;  1YI2 V;  1Q6U A;  5C93 A;  4QPK A;  5K1P A;  2LO1 A;  2GSM B;  3L74 H;  2GHY A;  3JAR A;  4L87 A;  1ZAU A;  4HZ3 A;  3QO8 A;  1XRE A;  5JVD B;  4CH3 A;  1YCI A;  2ZCE A;  3CCQ V;  1AB3 A;  2UXB O;  4XDJ A;  3RYI B;  3E83 A;  4JI0 B;  5J2U A;  3E8G A;  1M1K W;  5A9G A;  2EIL C;  2ZE5 A;  1DF4 A;  4D7S A;  2PYJ A;  3JYC A;  3DC6 A;  4AQY B;  5IY5 C;  3GVM A;  3M7M X;  2OWO A;  1WA8 B;  2Q4P A;  4WBN A;  1BE3 H;  4CS4 A;  1VIB A;  1W0J G;  2PTM A;  2IU0 A;  4CH5 A;  3T4Z A;  1Y6X A;  4W4L A;  3ZBH A;  4JYC A;  4JI1 O;  3K03 A;  1B6Q A;  3B40 A;  4DW1 A;  2DJV A;  1DLB A;  2WLN A;  1WP8 A;  3RT3 C;  2QWR B;  1FYJ A;  3H1K H;  3CJH A;  4EB6 A;  2XUM A;  3RYF A;  1UFI A;  2CE4 A;  1DK1 A;  2EIN C;  1R3K C;  4IGG A;  2QKS A;  1QVG U;  4UB6 Z;  4FLV A;  3G67 A;  4PA6 A;  2F4V B;  1BSM A;  1Q5O A;  4TV8 B;  4DV4 O;  5LHI A;  3ETG A;  3S3X A;  4X62 B;  2R9R B;  2RN9 A;  5EIB D;  4DV6 B;  2ZDI A;  5KAF Z;  1VF5 B;  2XAH A;  1NJI W;  1N36 B;  4FM1 A;  4PDV A;  3BPZ A;  4LWS A;  2PI4 A;  1DF5 A;  2XTA A;  4U3J B;  1N33 O;  1SS3 A;  3ABK B;  4LF9 O;  5DN6 G;  3ZRV A;  4DR1 O;  5LL6 Y;  3RBZ A;  1S77 D;  1GO3 F;  1E79 G;  3CCM V;  3IJ4 A;  2HKO A;  3HKC B;  4GKJ O;  2JJ1 G;  2GTA A;  2UXN A;  1H2M A;  2VQE B;  3F5W C;  5CA0 A;  1F4N A;  5LYJ B;  1PL0 A;  3APQ A;  1H38 A;  1EN4 A;  4TV9 A;  4FK5 C;  4R7C A;  4BAY A;  4TSF G;  1YTF B;  1GTO A;  3G6B A;  5BR8 O;  3WB1 A;  4H13 B;  1SQV H;  3BY6 A;  3BHP A;  4RQE A;  4UVC A;  3TXQ A;  4X66 B;  1IBL O;  2Y4U A;  3RYH B;  4DUZ B;  4UCV A;  3RVZ A;  4DRX A;  4MVS A;  1XNQ O;  4HNA A;  3RW0 A;  4LF4 B;  5CA1 A;  4DV7 B;  2LW1 A;  3CCE V;  2ZKO A;  3A0R A;  4LF6 O;  1NU1 H;  4LF5 B;  4LBE C;  4JI0 O;  1S76 D;  4PI2 A;  4DV1 B;  1IVS A;  5LA6 B;  5CN0 A;  5L3B A;  3LNM B;  3UCS C;  1FFX A;  3N2K B;  4AQY O;  1CPY A;  2DMX A;  4NXM B;  5H2F Z;  5JQG A;  1TUB A;  4TQD A;  2LFR A;  3ZCC A;  3IFX A;  4RUF A;  1EM1 A;  4FJC C;  4QNH B;  3JAT B;  3B2E E;  1M56 B;  3L71 H;  5CMU A;  1I08 A;  1S0V A;  5KHH A;  2Q69 A;  3F5T A;  2DE0 X;  3HR0 A;  2JJ2 G;  1M93 A;  5EIB C;  4I9Q A;  3B09 A;  3ABK C;  2RNB A;  1MSD A;  2EIJ B;  3K0D A;  2OYQ A;  2BSK A;  4K35 A;  2MW2 B;  1QBZ A;  4ICG A;  4FZ1 A;  2UUB O;  3VQV A;  1OCC C;  1BL8 A;  1QNM A;  3OTF A;  2Y0P A;  3FAV B;  1E1Q G;  1PNL A;  2OCC B;  3LUT B;  1N32 O;  2QWN B;  5GW7 A;  5JVD A;  5EBW C;  4DV6 O;  4UXN A;  5IYB O;  3MAQ A;  1TAE A;  1FS0 G;  1W0K G;  4OGQ B;  1N36 O;  2Q0A A;  1KYO F;  3RYI A;  4YHH B;  2JK5 C;  1N34 B;  1O9G A;  1AP6 A;  1RP3 B;  5FLX N;  3JCZ A;  4XDL A;  3F7V C;  1HP8 A;  2DYR B;  2ZE7 A;  4BIO A;  1AP5 A;  4NYK A;  4JV5 B;  4UUJ C;  2VQE O;  1HNZ B;  3VQX A;  4CS3 A;  1WA8 A;  1Q6I A;  3ML0 A;  3SYP A;  1IZ3 A;  3P30 A;  1BZK A;  1S5H C;  4ZI7 B;  1ZWI C;  1A32 A;  3CRA A;  2WPD G;  1Q90 D;  2IJH A;  3ETQ A;  3CC4 V;  2YXY A;  2Z0A A;  1P84 F;  4FLW A;  1AIL A;  1KD1 W;  5L3D A;  2RJZ A;  1BQ0 A;  1GK9 A;  4O2A B;  3AEI A;  4DUZ O;  1N8R W;  4C7U A;  5D5P A;  3E8B A;  4N21 A;  1PPJ H;  3H1I H;  2WLI B;  4DV7 O;  4I4T B;  3ZJZ A;  3J81 N;  1MZF A;  2R9I A;  5EYP B;  4DR7 O;  1KBH A;  4RO2 A;  1VQ5 V;  1M56 C;  2CGN A;  3ZN1 A;  4LF5 O;  1NR7 A;  2XAS A;  4OXS A;  4LNU B;  2ARH A;  1GN4 A;  4TV8 A;  2OIG A;  4MW3 A;  2ZIO A;  3BEH A;  2NNU A;  4PA4 A;  3IAY A;  5L3F A;  3NR7 A;  2Q67 A;  2EIJ C;  3OGC C;  5JJJ B;  3FX7 A;  4NXM O;  1V55 B;  3AG2 B;  1Y67 A;  3EXA A;  2QR4 A;  5LOV B;  1RSO B;  3JAR B;  3LSS A;  1XOU A;  2OCC C;  4UCT A;  2CTR A;  5LYJ A;  2X0L A;  4GYC B;  3CHX A;  5H6Q A;  2HJD A;  2W6J G;  4LFA O;  4GZR B;  4FMT A;  4MVZ A;  1GAX A;  4F6R B;  2F93 B;  2XAJ A;  1CP9 A;  1X4T A;  2E5L B;  1COW G;  2CUG A;  4IIJ B;  2KKW A;  4MVO A;  1M90 W;  5J2T B;  1Q81 W;  3CRM A;  4JI8 O;  1AJN A;  3RYH A;  1RPR A;  2PF4 E;  1ZX3 A;  2H3O A;  2NR5 A;  4H0L B;  1Q8I A;  4HYO A;  5JH7 A;  1VQN V;  1PP9 H;  1K9M W;  3H1H H;  3E8F A;  4PI0 A;  3E2E A;  3L73 H;  2K9P A;  4YHH O;  1N34 O;  1HDJ A;  2OTJ V;  3ABT A;  5KLV H;  5LA6 A;  4BIZ A;  1AI6 A;  4JGS A;  2HLD G;  2ATK C;  3N2K A;  4JV5 O;  2XT9 A;  4YJ3 B;  1PM9 A;  4DR6 B;  3K5O A;  2ZR3 A;  1VQ4 V;  1SZT A;  3N27 A;  3C3T A;  2A06 H;  1NTM H;  3T1C A;  4LH7 A;  3JAT A;  1HNW B;  5DED A;  4JYA B;  1QU7 A;  2C2A A;  2YEV B;  3ZHT A;  4J7Z A;  4X88 A;  3ZIA G;  4JI5 O;  5JJN B;  3D36 C;  2ZNI A;  4X1K B;  4K3A A;  3I56 V;  2P5O A;  1V55 C;  1RFY A;  5JCO A;  3BA8 A;  4YJ2 B;  3FD9 A;  2R72 A;  2HHH B;  3ABU A;  1WP7 A;  4NKG B;  4JI3 O;  2YIB D;  4IYI A;  4JZ2 A;  2DWD C;  1B06 A;  1AJQ A;  4P30 A;  1XEQ A;  3FAV A;  4IT5 A;  4DK0 A;  3CMA V;  2DQ0 A;  4NTY A;  1UPG A;  4DV5 B;  4FLT A;  5B1O A;  2VWK A;  3JSN A;  1VQP V;  1D5N A;  5AG2 A;  2HG5 C;  3JAW B;  2EIL B;  2UXX A;  3F7Y C;  3ZMV A;  1HNX B;  2G38 A;  4Z1M G;  4QGP A;  3AG4 C;  1SES A;  5L3C A;  4P9P A;  3WG7 B;  3ASO C;  3HB3 B;  4W4K A;  3VQY A;  4E2L A;  2ZIN A;  4DR3 B;  2GV9 A;  1ROP A;  1H8E G;  1EFR G;  4P9O A;  4X64 B;  3P3P A;  2EIM B;  2ITC C;  3VBB A;  1JMK C;  3ZHS A;  2GDS A;  4ZI7 A;  2E5L O;  1XMO B;  4ZKI A;  3CP1 A;  5IE9 A;  1NT2 B;  1FFX B;  4WCE V;  4PDM A;  2YIC A;  2YSU B;  1NVP B;  1IBM B;  1OCO C;  4O2A A;  4WFH A;  1NZ6 A;  4JZG A;  1PL4 A;  1JVM A;  2Q68 A;  2PUS A;  4OPH A;  2WLI A;  1QLE B;  4CH6 A;  4I4T A;  2PGG A;  4I55 B;  3BFR A;  1P4R A;  2WLM A;  4X1Y B;  4WFB V;  3OE7 G;  4BIU A;  1R6K A;  3AG3 B;  1F7Y A;  4LNU A;  4OX9 B;  1G1X B;  3THO A;  1JR9 A;  4QIW F;  4OPA A;  3TCU A;  3CC2 V;  1F51 A;  1AJP A;  3D3Q A;  1BQZ A;  4MVU A;  4DR6 O;  1EZV H;  4IL6 Z;  4NVP A;  1ZUQ A;  2WLJ A;  3ZRW B;  5LOV A;  4UCO A;  1M5I A;  4JTC B;  4PA9 A;  3GWO A;  1RSO A;  3QF7 A;  3OEH G;  2OIE A;  4LF8 B;  4LR3 A;  1P49 A;  2AZ2 A;  4PJ0 Z;  5KX5 B;  4F6R A;  2UU9 B;  3K9A A;  3A0B Z;  5KHI A;  3BAB A;  3CX5 F;  1H2S B;  1D5A A;  4G27 B;  1NS1 A;  1Y66 A;  1K73 W;  1Y74 B;  4IIJ A;  2IM9 A;  5EBL C;  5KMG B;  5J2T A;  4DV2 B;  3WG7 C;  2A7W A;  3H01 A;  2HHH O;  1VF6 C;  3ZHU A;  3HKD B;  2EIM C;  3A0H Z;  4JI4 B;  4DK1 A;  1M9N A;  4GCZ A;  4MVM A;  3PJS K;  1JFF B;  4DV5 O;  4JAV A;  4CBC A;  3ZMU A;  1XHZ A;  4B3S B;  4KHP B;  1SQP H;  2PY5 A;  3NXS A;  4Q6G A;  4EKW A;  4I0X A;  1HNX O;  2EBO A;  1OJH A;  3CRR A;  3JAS A;  2Q0O C;  1VQ8 V;  1BMF G;  2OTL V;  1YXB A;  4FLZ A;  1WNS A;  1JQ0 A;  2CAZ C;  1QLE C;  4YJ3 A;  5EZY B;  4X64 O;  3G71 V;  2HP8 A;  2YXL A;  3AG3 C;  4FPP A;  3STL C;  1XMO O;  3ICX A;  2YID A;  2YEV A;  3ZMS A;  1AI4 A;  1ENV A;  4DR2 O;  4JAA A;  1K4C C;  5KA5 A;  4GX5 A;  4X1K A;  3I55 V;  1Y76 B;  1VQ9 V;  3ETE A;  2IJK A;  2Y48 A;  4ABM A;  1FXV A;  1S72 V;  4YJ2 A;  2F43 G;  5GTH Z;  5E1A C;  2LGQ A;  1OCC B;  1SQQ H;  3LSQ A;  1KP3 A;  2JS3 A;  3SJQ C;  4JTA B;  3JD1 A;  3JSL A;  1AR1 B;  3ABL B;  4OX9 O;  1ARO P;  3FB8 C;  5LMN B;  5EBM C;  4YY3 B;  2JEX A;  4MTF A;  3W7W A;  3U11 A;  2EZO A;  3O65 A;  3JAW A;  1SQX H;  3JD0 A;  4JF3 A;  4B3T O;  2PZS A;  1VQM V;  4J80 A;  2CH7 B;  4TUY B;  4RQF A;  1F23 A;  3T1Y B;  1KKD A;  1OV9 A;  4ZHQ B;  1RPO A;  5L3G A;  3D3I A;  3JD3 A;  1WAZ A;  1H2K A;  1VF6 A;  5JH7 B;  2UUA B;  3IGA C;  2ZM6 B;  4U7N A;  1SF9 A;  4TOI A;  1U97 A;  3EFF K;  5DEC A;  2UU9 O;  2LFS A;  4RAI A;  1PV0 A;  2DYS B;  5IJ0 B;  3M99 B;  3RN4 A;  4H44 B;  2YDE A;  3QO5 A;  4JTD B;  3SPC A;  2VQF B;  3ZRS A;  1K7D A;  1H2N A;  4DO2 A;  4DV2 O;  5CBH A;  3AK2 A;  3W7T A;  4CC6 A;  1K8A W;  1URF A;  2N74 A;  3FKS G;  3UO3 A;  5B66 Z;  4LFB B;  4JI4 O;  4XDK A;  5IJ9 B;  4CC5 A;  3OUF A;  3QVN A;  4I55 A;  4UCR A;  2R70 A; 
#chains in the Genus database with same CATH homology
 1YJ9 V;  1OCZ C;  3WFV A;  3MD0 A;  4KP4 A;  1KC8 W;  1QVF U;  2DWE C;  1NH2 B;  3LSS A;  1V54 C;  4JAU A;  2OCC C;  4LP8 A;  1MOF A;  1MG1 A;  2KB1 A;  2X0L A;  5H6Q A;  1PNK A;  2W6J G;  5IY5 B;  1VQL V;  4FMT A;  4MVZ A;  3B8N A;  1OZ0 A;  2XAJ A;  1CP9 A;  3CCL V;  4WFA V;  2WLL A;  4ASU G;  1GM8 A;  3OW2 U;  1COW G;  3FB7 C;  5B1A C;  1SER A;  4GT1 A;  4MVO A;  3CYO A;  4LCU C;  1M90 W;  1JOY A;  3ZRW A;  3UM7 A;  1Q81 W;  2V7Q G;  3E86 A;  3ETD A;  1V54 B;  3DGE A;  1NVP D;  3ZN0 A;  3K04 A;  1EBO A;  3ABL C;  1AJN A;  5B1B C;  1QLN A;  1VQO V;  1H8H G;  1PD3 A;  1K3E A;  1RPR A;  3OUS A;  3CD6 V;  1K5Q A;  4U7O A;  1I5X A;  4QE7 A;  4UV9 A;  5KUM A;  4R8C A;  2HVK C;  2OT5 A;  4HYO A;  4R6Z A;  5EC2 C;  2WLK A;  1VQN V;  1K9M W;  2HFE C;  1GKF A;  2EIN B;  2Y69 C;  2ZXW B;  3E8F A;  3E2E A;  3OEE G;  3STZ C;  1QCE A;  4JAS A;  2IH3 C;  2JIZ G;  2OTJ V;  2B1G A;  3ABT A;  2DW4 A;  2IJJ A;  1FXK A;  1HWY A;  1JJ2 U;  4BIZ A;  2ZDI C;  4QJF B;  1AI6 A;  4JGS A;  2HLD G;  1JCH A;  2ATK C;  4F4L A;  5IYC O;  1K33 A;  3LDC A;  2HVJ C;  2QE7 G;  3CCJ V;  4XBF A;  4QE9 A;  4X8A A;  3CXC U;  3E89 A;  3SYO A;  2DYS C;  2ZR3 A;  4I5S A;  4MTO A;  3E35 A;  1YTF D;  1R3J C;  3ABM C;  2QM8 A;  5B3S C;  2Y69 B;  1VQ4 V;  1SZT A;  4MTG A;  2K1E A;  5LHH A;  2XAG A;  3T1C A;  4PA7 A;  2M7W A;  3OMN B;  5B1N A;  1IXM A;  3MHH C;  4MVQ A;  1YI2 V;  4PDR A;  5C93 A;  4QPK A;  2C2A A;  2YEV B;  2GSM B;  3ZMT A;  1FXH A;  2GHY A;  1G4Y B;  4H33 A;  4L87 A;  4X88 A;  3ZIA G;  4HZ3 A;  1KP2 A;  3QO8 A;  2EJR A;  1KEC A;  3B8M A;  3CCQ V;  3I56 V;  1JX9 A;  4MVR A;  1V55 C;  2XAQ A;  4XDJ A;  3E83 A;  5LGN A;  1M1K W;  3E8G A;  5CA3 A;  1NR1 A;  2EIL C;  1DF4 A;  4PEL A;  4GX2 A;  3T2M A;  5HFM A;  3ABU A;  1R3I C;  3JYC A;  3OMA B;  3VOU A;  3OFN G;  1RM1 B;  2PI5 A;  3EHB B;  2DWD C;  3OM3 B;  3OR7 C;  1JPX A;  1AJQ A;  5IY5 C;  4P30 A;  1J95 A;  1QR8 A;  5CBF A;  5H6R A;  3CMA V;  3SYQ A;  3DTU B;  2WSS G;  2DQ0 A;  4UVA A;  3FB6 C;  4JPR A;  4QPJ A;  1W0J G;  5B1O A;  5J9P C;  2A79 B;  2D3O W;  2IU0 A;  1VQP V;  3T4Z A;  2HG5 C;  4JYC A;  3ZMZ A;  4CZZ A;  3K03 A;  1B6Q A;  2EIL B;  2UXX A;  3F7Y C;  3ZMV A;  4FIP C;  1DLB A;  4MW8 A;  3LDE A;  4N23 A;  2P6J A;  2ZR2 A;  4Z1M G;  3AG4 C;  2WLN A;  1SES A;  5L3C A;  4P9P A;  3CC7 V;  3WG7 B;  3TET A;  5LBQ A;  5DM6 V;  1VQ7 V;  3ASO C;  3HB3 B;  5EC1 C;  2ZD9 A;  4E2L A;  2XAF A;  1ROP A;  1H8E G;  1EFR G;  2X6A A;  4P9O A;  1Q7Y W;  4J9Y B;  4P2Z A;  2EIM B;  2ITC C;  3VBB A;  2EIN C;  1R3K C;  2JDI G;  2ZXW C;  1TUE B;  3QNE A;  2QKS A;  4LC1 A;  1K92 A;  1QVG U;  1F4M A;  4ZKI A;  1VQ6 V;  3CP1 A;  3AG4 B;  3G6E V;  2X6C A;  4PA6 A;  3CCU V;  4WCE V;  1AI5 A;  4PDM A;  2JEU A;  2XND G;  2YSU B;  1NVP B;  3ASO B;  1THZ A;  1VQK V;  5LHI A;  3ETG A;  5IYD O;  2AHY A;  1OCO C;  2R9R B;  1Q86 W;  4WFH A;  4PA3 A;  2ZDI A;  1JVM A;  2IJI A;  2Q68 A;  3OR6 C;  2XAH A;  1NJI W;  1OHH G;  4PDV A;  2Q6A A;  2WLI A;  1QLE B;  2PI4 A;  1DF5 A;  4WFE A;  3ABK B;  3LDD A;  1FFT B;  5DN6 G;  3ZRV A;  1P4R A;  2WLM A;  3RBZ A;  4WFB V;  3OE7 G;  1GO3 F;  1S77 D;  1E79 G;  4BIU A;  4JYB A;  3CCM V;  1R6K A;  3AG3 B;  2HKO A;  2JJ1 G;  2UXN A;  4MSW C;  1OCO B;  4KFM A;  3F5W C;  1F4N A;  1PNM A;  1ORQ C;  4H37 A;  1YIT V;  1PL0 A;  1H38 A;  4HAM A;  4Q20 A;  2BOB C;  1Y4M A;  1SRY A;  2H8P C;  3K3W A;  4QIW F;  4FK5 C;  4R7C A;  4BAY A;  4BW5 A;  3QO7 A;  3TCU A;  3CC2 V;  1F51 A;  2WLL B;  1AJP A;  4G2K A;  3CCS V;  4TSF G;  4MVU A;  1NQT A;  1GTO A;  4X89 A;  1YTF B;  1NKD A;  3K79 A;  2WLJ A;  3SPH A;  5LGT A;  3R65 A;  3ZRW B;  2BOC C;  3BY6 A;  1L1F A;  1RM1 C;  4JTC B;  3K06 A;  4PA9 A;  4RQE A;  3GWO A;  4UVC A;  3SYC A;  4TT3 G;  2P7T C;  3OEH G;  1E1R G;  3RVZ A;  2MK3 A;  4MVS A;  3JD4 A;  3RW0 A;  4TWK A;  3MHS C;  2X6B A;  3SYA A;  3K9A A;  3CCE V;  1KQS U;  3P32 A;  3A0R A;  2NLJ C;  2W0F C;  3GB7 C;  1I5Y A;  4G27 B;  1YJW V;  1Y66 A;  1K73 W;  2CK3 G;  1R6N A;  1M57 B;  5EBL C;  4LBE C;  3SPI A;  2QTO A;  1G8M A;  1S76 D;  3WG7 C;  1UJW B;  1Q82 W;  2DQ3 A;  2V1D A;  2IU3 A;  5CN0 A;  3H01 A;  1FXK B;  5L3B A;  1SET A;  2WLH A;  3LNM B;  1QR9 A;  1MSW D;  1GM9 A;  2HJF C;  3UKM A;  1CPY A;  2EIM C;  2LP7 A;  5EK0 A;  5IDJ A;  4UV8 A;  3X2Q B;  2Z3Y A;  1M9N A;  4GCZ A;  4MVM A;  3PJS K;  2A9H A;  4MT8 A;  4JAV A;  1S3J A;  2LFR A;  3ZCC A;  4CBC A;  1EZJ A;  3ZMU A;  1XL6 A;  3IFX A;  4RUF A;  4FJC C;  3HPL C;  2EIK B;  3FYI B;  4KUM A;  3AG1 B;  1OCR C;  4QNH B;  4ZBM A;  3NXS A;  1M56 B;  2Z5U A;  3OAA G;  3K08 A;  4EKW A;  1P7B A;  5CMU A;  3JD2 A;  1BHA A;  2EBO A;  2EZP A;  4R50 A;  1S0V A;  3OMI B;  3KG2 A;  1VQ8 V;  2Q69 A;  1BMF G;  5HFL A;  2OTL V;  3SPJ A;  5LHG A;  1NBM G;  2JJ2 G;  1JQ0 A;  1R73 A;  5H9C A;  1QLE C;  3ABK C;  5L3E A;  3G71 V;  3ASN B;  3G4S V;  2B1I A;  2EIJ B;  1OCR B;  3K0D A;  3FYE B;  2A0L A;  4I9W A;  3AG3 C;  4FPP A;  3B77 A;  1K5S A;  1QBZ A;  4WFF A;  1AI7 A;  3STL C;  1OCZ B;  4MTX A;  3ZRX A;  1OCC C;  1BL8 A;  1R3L C;  4PDL A;  2DYR C;  2X7R B;  2YEV A;  3ZMS A;  1AI4 A;  1ENV A;  2QEX V;  1E1Q G;  1PNL A;  2OCC B;  3CCR V;  3LUT B;  5GW7 A;  2ITD C;  1DTO A;  1K4C C;  5KA5 A;  2ZQM A;  4GX5 A;  2QA4 V;  3W7X A;  1WPX A;  5EBW C;  1BHB A;  1GM7 A;  4UXN A;  5IYB O;  3I55 V;  1VQ9 V;  3ETE A;  2IJK A;  1FS0 G;  1W0K G;  3TK1 A;  2Y48 A;  1FXV A;  1S72 V;  2JK5 C;  5BZB A;  2F43 G;  3RVY A;  5E1A C;  3JCZ A;  1OCC B;  4RUE A;  5B1A B;  4XDL A;  3F7V C;  4DXW A;  3IC7 A;  3CPW U;  2DYR B;  3LSQ A;  1KP3 A;  3SJQ C;  4JTA B;  3JD1 A;  5KUK A;  4UUJ C;  1AR1 B;  3W7S A;  3ABL B;  5B1B B;  3D36 A;  2P67 A;  1ARO P;  1WLE A;  3FB5 C;  2WWW A;  3FB8 C;  5EBM C;  2P90 A;  3ML0 A;  1YIJ V;  3SYP A;  1YHQ V;  3P30 A;  1K4D C;  2JEX A;  4MTF A;  4GX1 A;  2W6I G;  2IW5 A;  3W7W A;  2EZO A;  2B5U A;  1S5H C;  4JF3 A;  1M57 C;  3JD0 A;  1ZWI C;  1VQM V;  2WPD G;  2IJH A;  4WF9 V;  5CBG A;  1CEZ A;  4G28 B;  3CC4 V;  1FXK C;  4RQF A;  1K97 A;  1KD1 W;  5L3D A;  2IH1 C;  1F23 A;  2AHZ A;  1GK9 A;  1KKD A;  1LNQ A;  1RPO A;  3AEI A;  1K34 A;  5L3G A;  3X2Q C;  3D3I A;  3JD3 A;  2FTK A;  3IGA C;  1N8R W;  4U7N A;  3SPG A;  3T4D A;  2WAM A;  3E8B A;  4N21 A;  3EFF K;  2WLI B;  2H94 A;  3ZJZ A;  2LFS A;  4RAI A;  2EIK C;  1GMG A;  2R9I A;  3AG1 C;  2DYS B;  1W2B U;  3M99 B;  4MS2 A;  4RO2 A;  3ABM B;  5KA6 A;  1VQ5 V;  1M56 C;  3AG2 C;  3QO5 A;  5B3S B;  4JTD B;  3CCV V;  3SPC A;  1MAB G;  3ZN1 A;  1NR7 A;  3ZRS A;  1K7D A;  3W7U A;  2HR3 A;  2XAS A;  4OXS A;  4YXW G;  4DO2 A;  4MW3 A;  3BEH A;  4GX0 A;  5CBH A;  1PKX A;  2NNU A;  3W7T A;  4PA4 A;  2QM7 A;  1K8A W;  5L3F A;  5LGU A;  1YJN V;  2XOK G;  3FKS G;  1XL4 A;  3ASN C;  1YSC A;  4UVB A;  3K0G A;  3E8H A;  4WFG A;  4XDK A;  2Q67 A;  2EIJ C;  4J9Z B;  1H2G A;  3OGC C;  3CME V;  5FL7 G;  3OUF A;  1NH2 D;  1V55 B;  3AG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...