4G2KA

Crystal structure of the marburg virus gp2 ectodomain in its post-fusion conformation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
110
structure length
110
Chain Sequence
MKQIEDKIEEILSKIYHIENEIARIKKLIGNLVSRLRRLANQTAKSLELLLRVTTEERTFSLINRHAIDFLLTRWGGTCKVLGPDCSIGIEDLSRNISEQIDQIKKDEQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General control protein GCN4, Envelope glycoprotein GP2 chim
publication title Crystal Structure of the Marburg Virus GP2 Core Domain in Its Postfusion Conformation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
total genus 50
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g2kA00
1K33A 2M7WA 1ENVA 5HFMA 4G2KA 1QR8A 5HFLA 4N23A 1DF4A 3B77A 3CYOA 1F23A 3MHHC 1EBOA 2EZOA 1I5XA 5CMUA 1Y4MA 3B8NA 1I5YA 1SZTA 3M99B 1DLBA 4E2LA 4JPRA 1Y66A 3B8MA 3H01A 2EZPA 4JF3A 1QBZA 1K34A 4N21A 1MOFA 5KA6A 1JPXA 1MG1A 4FIPC 2OT5A 4FJCC 3WFVA 3P30A 5KA5A 1JQ0A 2EBOA 4JGSA 5CN0A 3MHSC 1DF5A 2MK3A 2X7RB 3CP1A 2P6JA 1QCEA 1QR9A 3K9AA 3GWOA 4FK5C 2LP7A 5H9CA
chains in the Genus database with same CATH superfamily
4DO2A 3QO5A 1R3KC 4J10A 3N2GA 2KSDA 3LDCA 1JVMA 3ZMSA 4JI4B 3QVNA 5LL6Y 1Q6UA 3LDDA 4LP8A 3ABKC 1ZL8A 3KG2A 4JI1O 4X1IB 4PA9A 2CGOA 3ZHRA 5KHKA 2WLIA 3ETEA 1NR7A 3WB2A 2OTLV 4BW5A 3CRAA 1GO3F 1I5XA 2ZNIA 4LFBO 3UT5B 2HKOA 1WP8A 2EZPA 1MNGA 4ZIBA 1W2BU 4DV6B 3RYIA 2BSKB 2GTSA 2DN9A 5EC2C 1SA0A 3K3WA 4J9ZB 1NTZH 2DYSC 2BOBC 2JJ1G 3CRMA 4B3TO 4LFCB 2WLMA 2ZINA 5KX5B 4RO2A 4JI6B 3H1JH 1BS3A 1YIJV 4JYCA 1XHZA 5IJ0B 4Z1MG 5J9PC 4FFKA 2GUZB 5K1XA 4KP4A 3SYPA 1K3EA 1K5QA 3RGBA 3F5TA 4K35A 3HR0A 1SQQH 3UQ8A 2LP7A 4MW3A 2OWOA 5IY5C 4YJ2B 1M90W 4ZOLB 4C7UA 4U7NA 3K08A 3E83A 4PDRA 3FFQA 2DWDC 2IH1C 2Q68A 1NTKH 3WFVA 1AJNA 3RT3C 3GVMA 4DR4B 4G27B 3VOUA 3EHBB 2ARHA 1QCEA 5KHGA 2P4KA 4AQYO 4J80A 2P90A 5GTHZ 2LQTA 5LMUO 3TGUH 3H1IH 1SETA 3RYHB 3R66A 1P7BA 4JI1B 2YS8A 4LWSB 1X4TA 2UXDO 3AEIA 3CS5A 3L9DA 4JGSA 3ZHVA 5CBGA 2V1DA 5B1AC 5B5EZ 3B4SA 1V9PA 4PJ0Z 3VBBA 1IX9A 2QWRB 3CCMV 1M57C 4LFBB 1H2SB 3A8TA 4QPKA 3K5MA 4JF3A 1BZKA 2IJJA 1BE3H 5KMGA 1T5EA 3D3QA 3EVKA 4UCSA 1QNMA 2NNUA 1BQZA 2ETNA 1CEZA 3QNEA 2IM9A 3WU2Z 4B3TB 4UCRA 1M1KW 3C3TA 3CYOA 4GCZA 5JJJB 2YC0A 4NKGB 3JALB 1KD1W 4JI7O 3FD9A 1AP5A 2FL4A 2A9HA 1GN3A 1VQPV 1YTFB 3ZRXA 4UVCA 4DK0A 4JTAB 4O4HA 2LGWA 5BY1A 4FPPA 5LA6A 5ITZA 1E1RG 3TETA 1SKVA 4LF7O 1N33O 4KUMA 3ZRSA 3KCYA 2LFRA 3HKCB 1SZTA 2ZXWB 3RYFB 3K5NA 1P49A 4DV0B 1I0HA 2IBZH 3CC2V 2WLLB 3KKYA 2Q7GA 1Y74A 3AG4C 3FKSG 2HEPA 4FK5C 4AQYB 1QHTA 1FFTB 3QF7A 2ZNJA 5LMUB 4FFBB 1VQKV 1KMIZ 4EB6B 4KHPO 1BT8A 1O9HA 4EKWA 1Y76A 5D5QA 1XNQO 2FKXA 4LFAB 2UXDB 5B1AB 3UKMA 1TVKA 3CWBH 5LXTA 1V55C 1IBMO 3E22A 3ASNC 4MVZA 3CC4V 1J5EO 3TXQA 2HVJC 4F6EA 1RP3B 1L0NH 2CTPA 1URFA 2CE4A 4RAIA 2YI9A 5J2UA 3K04A 2Y0IA 1CP9A 1XL6A 3JYCA 1N0JA 3OTOO 5KAFZ 1H2KA 3P32A 1CPYA 3R65A 2DW4A 1JMKC 4GKJB 4H13B 3OEHG 2KG7A 1RFYA 4JI7B 4BIUA 5JQGA 3OT7A 2Q67A 1K4DC 2Y69C 1JJ2U 3TXSA 3CMAV 2CK3G 1HNWO 4U3JA 4FLZA 4LF7B 1N33B 2WLNA 2QWQB 2VWKA 4H37A 1AI7A 1PV0A 2YXLA 3ZEDA 1EFRG 1YZBA 1HNXO 4R6ZA 2GHYA 3UO2A 5C93A 4NXMB 4YJ3A 3MDSA 1FXKA 2Z5UA 2NLJC 4WF9V 3SYOA 3K9SA 2ZE5A 3ZMUA 1LNQA 1FYJA 1YSCA 3JD3A 5EYPB 3VQVA 1M56B 3CRQA 4FLXA 3CCQV 4PA6A 1K4CC 3STLC 3K0GA 4N23A 1NI8A 4X9QA 2LGQA 3I55V 5LP6B 1OCRB 4KHPB 3CC7V 1XNQB 1V55B 1M4UA 4F6RA 2B1IA 3H1LH 2YUAA 3LNMB 3ZS8C 3JARB 4ASUG 4CH6A 3CMEV 1KYOF 1J5EB 1JA8A 2JEXA 4FVMA 4XDKA 4UV8A 1X59A 2XNDG 4PHZA 4P9PA 1KUQA 5CBFA 4TV8A 1IXMA 2ADQB 4LF8O 3OTOB 1WNSA 2YEVA 3S3XA 1QU7A 1XBLA 5FNVA 4PDVA 4X1KB 3L75H 5JJNB 4UCVA 4WBNB 1XREA 4KL1A 4CBCA 2GDSA 3L74H 5IYZB 4XBFA 2KKWA 4JYYA 2P7TC 3FAVA 4WCEV 2WA3A 1VMGA 3SPIA 3VQYA 4U3JB 3AK1A 3B2EE 2F4VO 3OR7C 1TAEA 1ZAUA 3G4SV 5CB4A 1HNWB 1VF5B 1JX9A 2QM7A 3G6BA 3H1HH 5D5PA 4WFHA 3WB0A 1XQ8A 2ZCEA 2DWEC 1FXKB 4MW8A 5DN6G 2B1GA 4Q20A 1FKAO 1HNXB 3E2EA 4YHHO 3N2KB 2IU0A 2VQFO 2JDIG 4I4TB 4X20B 1MMMA 4DXWA 4FZ1A 3ASOC 3HKDB 3DSQA 4U3FH 3IAYA 1NU1H 5KAIZ 3L73H 1OCOB 4X1YA 4ZI7B 3CX5F 2ZM6O 2PY5A 1R1BA 1KB9F 3CRCA 1CXZB 5CA1A 1R3IC 2AW9A 5CBHA 2RMKB 4UB8Z 1QLEC 1JR9A 5IYDO 3T1CA 1J95A 4WFAV 4I5SA 2QM8A 1GKFA 2E76B 4O2AA 1VF6C 3QG5A 4CC5A 4CS2A 1HDJA 1IBLO 4DV5O 4UUJC 2MK3A 2UXBO 3JAKB 5DEDA 2QM4A 5EC1C 2CUGA 4G2KA 2PYLA 3B77A 4TV9B 1Q3EA 3TJTA 5JCOC 4H0LB 1Y66A 4KXRA 2EIMB 2ZIOA 2JEUA 4L87A 2F4VB 3SR2C 1TUBA 1YDXA 1Q43A 2ZDIA 3SYAA 2Z0AA 3Q4HA 4LFCO 1NQTA 2X0LA 3ZMVA 3BHPA 2VQFB 2BCCH 3ASOB 5LGUA 4CS4A 4B3SB 4DV2O 2F95B 2HJDA 2VS0A 1HWYA 2CH7B 2XUMA 3THOA 1VQMV 1IVSA 4LBEC 3CCSV 4TT3G 3DTUB 1PPJH 3ETGA 3O65A 2Q0OC 5EZYB 1QLEB 2R9IA 1GTOA 3OUFA 4QNHB 1SRYA 4DR7O 4CH3A 5IJ9B 3X2QC 5L3CA 2H94A 1R6KA 3E89A 1IDSA 3T4ZA 4IHJA 1AR4A 4FLUA 1N36O 2M6YA 1YVWA 1SQGA 3OM3B 2FB5A 4NR1A 1S3JA 2JGDB 2JVDA 4QE9A 3OE7G 2JRIA 5B3SC 1EN4A 5FPRA 4H33A 2L35A 1IBLB 4JZ2A 4DV5B 3I56V 4X64B 2UXBB 1VQ9V 1NZ6A 1Q82W 1WB8A 3SYQA 1VARA 3U0ZA 5IWAO 5C8YA 3QTCA 3ZHSA 1DF4A 4MT8A 1EBOA 1F4MA 2HLDG 5LOVB 3T4DA 3APQA 3SDLA 3RYCA 3ETDA 1R73A 2BE3A 3ABMC 4LF5O 2BTQA 3NR7A 2XHBA 4UV9A 1ORQC 4O4IB 3ZIAG 2UXNA 2PUSA 1M5IA 3ZRWB 2CGNA 2WLKA 4R8CA 2QKSA 3PJSK 3DXRB 2ZR2A 3EXAA 3G71V 5L3DA 3P3NA 5GONB 2E3CA 3STZC 1RSOA 4G28B 2OCCB 3OR6C 5KHJA 4DV2B 4FLVA 2F1MA 2F43G 1V54C 2WPDG 3JAWA 3RVZA 2H8PC 2Y4TA 4WFEA 3K06A 4A5UB 3ZN0A 1KECA 1VQ5V 5EK0A 2XT9A 1G6UA 3CXHF 4J41A 2YIBD 2UUAO 5J2TB 3DC6A 1H2NA 4FM0A 3X2QB 4DV0O 5KHHA 4FIPC 1KP3A 4X62O 4YXWG 4DR7B 3CCVV 4XDLA 2ZXWC 4TOIA 4MTXA 4MVQA 2W0XA 1N36B 3N2GB 5B3SB 3CPWU 3KCXA 2IW5A 1ZL8B 2LW7A 3JD0A 2ILMA 3BCCH 3RBZA 3B8MA 1XL4A 1R3LC 3BY6A 2WLIB 5FL7G 1A32A 4LFAO 2UU9O 5LHHA 3ZRVA 4TUYA 1YCIA 5IWAB 2Q7HA 3CE2A 2W0FC 2EINC 3ABMB 3IJ4A 4D6TH 5CA3A 2OTJV 1XHXA 4E4EA 3RYIB 4QPJA 4LF5B 2D3OW 1SA0B 3CCEV 3CJHA 5H5NA 5IDJA 3RN4A 1YTFD 2GTAA 2E5LO 5EBWC 2PF4E 3W7TA 4DR5B 5B1OA 3CSXA 3EFFK 2YSUB 4OXSA 3QO8A 3HKEA 2UUCO 4P2ZA 1WP7A 4ICGA 4GKJO 1D5NA 1P4RA 3SJAC 1IBKO 1V54B 1YJ9V 1PD3A 2W6JG 2HR3A 3ZCCA 3JAWB 2CAZC 1VQLV 2RNBA 1OV9A 4QIWF 4PELA 4LR3A 2P67A 3JD1A 2WA4A 1VQNV 2A3QA 1H2LA 4CC6A 2UUAB 1IURA 4WFGA 1VEWA 1O9GA 2HG5C 4NXMO 4X62B 1MG1A 2OT5A 2JIZG 3ZBHA 4I9WA 4EFBA 3SJQC 3H1KH 1QLNA 1PL0A 3U11A 4X89A 2X6CA 1WN7A 4K8XA 2QTOA 4K8ZA 4AHCA 1NH2B 4RUFA 1GM9A 3BEHA 3ZX6A 1Q86W 1GRJA 1XMOO 1M56C 1MABG 1JJOA 4YIOA 2YXHA 4LF9O 4UCTA 2UU9B 5LP6C 1OCRC 4I7ZB 1EN5A 3IC9A 4YY3O 2EINB 4LCUC 1XEQA 2QSAA 4J42A 5LYJA 3OGCC 2XAQA 4Z2WA 4DV4O 4IYHA 4D7TA 1K97A 1U96A 4CZZA 4MVRA 3LUTB 5AG2A 5CA0A 5CMUA 1NT2B 5K1PA 5KMGB 4DYLA 2ZE8A 4I55A 1XI1A 3OD4A 3RWRD 1JPXA 3ZHTA 1PL4A 4I50A 4LNUA 2AXTZ 2DE0X 4OX9O 3P3PA 2E5LB 2Z3YA 2HVKC 4KFMA 2R9RB 3BRCA 1I94B 4HNAA 2L6LA 2VRZA 2Q9LA 3E35A 3AG1B 2UUCB 1W0JG 3K57A 1AP6A 1IBKB 2ZE6A 3JD4A 4O4HB 4PDLA 5LA6B 5ITZB 2Y0PA 5B1BC 1THZA 2ODMA 5GTIZ 5E1AC 1SQPH 1KC8W 4HZ3A 3ZHQA 4FLTA 4HAMA 1PNKA 1Y74B 1XILA 1AILA 1FXKC 5F2VO 2B5UA 1DTOA 2WLJA 2FTKA 2GBOA 2OIEA 1Y76B 2QWOB 2ADPA 1XMOB 4E2LA 1M9NA 1NKDA 2A79B 4GUNA 4NYKA 1TVKB 2B9ZA 5LXTB 5BMVA 3ETQA 4LF9B 3E22B 2EBOA 4YY3B 1OCOC 1WPBA 1PKXA 5IE9A 4DV4B 4DRXA 3GWOA 1ZSPA 1RPRA 1QR8A 4ZHQA 3MAQA 1I08A 5J2UB 2Q6AA 2EZOA 1HNZB 4OGQB 3WB1A 2JS5A 4FM2A 4MSWC 4NXNO 1NJIW 3ABTA 3E8HA 1MOFA 1N0NA 3W7XA 1S0VA 4OX9B 3APOA 3HKBA 2EJ7A 3CRRA 1JFFA 1WLEA 4I0XA 4DW0A 4LF6O 1FFXA 1QR9A 2CTWA 4R50A 1AB3A 1BHBA 4K3AA 2KG7B 1PP9H 2RN9A 3BAAA 3JSLA 5JQGB 5B1BB 4BIOA 3A2FA 3OW2U 1B6QA 2EIMC 4O2BA 2P5OA 1F23A 4YJ3B 3CB2A 4X66B 2CDYA 1I5YA 1K8AW 2RJZA 1N4CA 2JK5C 4QJFB 3LDEA 5L3EA 4DR6O 4N21A 2Y48A 1TUEB 1F4NA 3MD0A 2P06A 4B3SO 4B3RO 1AI6A 1YI2V 3VQWA 3L72H 4QGPA 1NTMH 2PI4A 2QKAA 3JASA 5BMVB 3AG2B 4F6RB 2XASA 1Y4MA 3B8NA 2AHYA 4D7SA 3M99B 2Y4UA 1P84F 1XDCA 4TWKA 1LR1A 4O4LA 4DW1A 4FJCC 1Q6IA 4FM1A 2EILC 2DQ3A 2A06H 4JTCB 3JCUZ 1ENVA 3D36C 1YF2A 2QWNB 1HR0B 4PD4F 5B1NA 1WA8A 1AR1B 4J7ZA 4TSFG 1YXBA 3C90A 4NXNB 2XAHA 5IYBO 1BSMA 3G6EV 2WAMA 1K5SA 1PNLA 4TV8B 1JCHA 1WPXA 3H9VA 3DC5A 2YEVB 4LF6B 5FNVB 4LH6A 4X64O 2YICA 1R6NA 5LGNA 1IXBA 2OYQA 3CCJV 4DR3O 1OCZB 2N74A 4IIJA 4BR6A 1VF6A 3FAVB 3H01A 2ZIMA 3KZIZ 3RFRA 1UFIA 5CB4B 3BA9A 4X88A 4DUYO 4X1IA 2MW2B 1BHAA 2ZD9A 5JH7A 1Z5VA 5DECA 3B40A 4LF4B 3SJCC 1VQOV 5JCOA 3M7MX 1L8DA 4PA3A 3O9OA 4DR6B 1BQ0A 1QBZA 2F23A 3UT5A 5KHIA 2EIKC 4X65O 3B09A 3K5LA 4GKKB 4B3RB 3SGIA 3JCZA 1B3QA 3OMIB 2UXCO 2OCCC 4JI0O 1RPOA 4X1YB 4MTGA 3FYIB 1S76D 4IGGA 2EILB 5KX5A 1NS1A 4DV1B 1S5LZ 2IJKA 5CA1B 3K59A 3P30A 5IJ0A 2PYJA 3L71H 2VQEB 4UVBA 3AK3A 2GUZA 2E75B 1K33A 1Q6HA 3MHHC 4O2AB 3TCUA 2QTSA 2A0LA 4YJ2A 4WFFA 4ZOLA 4TQFA 1ZUQA 1Q81W 1FXHA 4MVUA 1D5AA 3JATA 5LHGA 1OCCB 2PGGA 4O4JA 3E86A 1LUWA 4DR3B 1S77D 3W7WA 4K0KB 3K79A 3E8GA 3CCRV 2YIAA 1AI5A 3A0BZ 1MSWD 3IC7A 4FZ0A 1H2MA 1R3JC 5FLXN 3RYHA 2YIBA 3A0HZ 1G8MA 1BGYH 1TUBB 3UO3A 3CHXA 1Q5OA 1HP8A 5KLVH 4PA7A 4DUYB 1FD9A 3SPHA 5JH7B 1QQCA 4LWSA 1GN4A 5DM6V 1NVPB 1MA1A 1W59A 4J9YB 1SC5B 3Q4HB 1Z2GA 5KUMA 4DR5O 2QDOA 3VQXA 2EIKB 1BL8A 3SPJA 5L3GA 4IT5A 4NTYA 1TGOA 2PI5A 1COWG 1Q8IA 1AROP 4UFZA 3BVOA 3LSSA 4X65B 3OAAG 4H44B 2E74B 3QO7A 4GZRB 2X7RB 1MSDA 3ICXA 1N8RW 2LFSA 2HFEC 2UXCB 2K1EA 1EM1A 4JI0B 3SPCA 4UB6Z 4UXNA 1TA8A 3HPLC 4GX1A 2EIJB 2QKCA 4BIZA 3AG3B 4DUZO 1US6A 1KKDA 5KA6A 3JALA 1Q7YW 1OJHA 2DJVA 2Q5ZA 3F5WC 4JAUA 3MHSC 4B3MB 1S72V 4B7EA 4IHJB 1FAFA 3K9AA 2OCHA 2ZQMA 3CD6V 5H2FZ 1H8HG 4PI2A 2ZKOA 4ABMA 1M93A 3JATB 1XNRO 2D2CB 4JAVA 1XMQB 3HKCA 4DV3O 3GWKC 3RYFA 4O4JB 4WFBV 2YIDA 4CH4A 2JJ2G 1Y6XA 1B04A 5C8YB 1U97A 3ZHUA 2WLLA 5BXZA 1VQ6V 4NTXA 4R7CA 4GX5A 1UJWB 3RYCB 2O57A 3ABKB 2BTQB 4MVSA 1S5JA 5B66Z 4FFBA 3LNNA 4EB6A 1BCCH 2F93B 3K0DA 2PTMA 2ITDC 1SZXA 5LGTA 3AG7A 4BW9A 5BZBA 3OEEG 4P9OA 3FB8C 2RCVA 1K7DA 4F4LA 2GV9A 5L3FA 3K58A 1I94O 1I7FA 2VWJA 3ZMTA 2Q73A 3TK1A 3U10A 1GN2A 4IYIA 2EULA 1RSOB 3CEIA 4BAYA 4JI8O 1SESA 2LO1A 2DYSB 3AG1C 1FS0G 2BOCC 1F7YA 4J7KA 4J11A 3T1HO 3OMAB 2M7WA 1SQFA 3M8AA 4JI5O 1HW7A 4HYOA 1NH2D 1AVMA 4DUZB 3W7SA 1YHQV 2C2AA 4MTOA 5FPOA 4MTFA 4CS3A 2Q4PA 1WB7A 5IY5B 4MVMA 3CP1A 2IJHA 3BFRA 2R70A 3OUSA 5H6RA 5A9GA 1SERA 4GT1A 3OMNB 3ABLC 1R6TA 5E79Z 4FLYA 4B08A 1XNRB 1GK9A 4PV1B 4W4KA 5TISZ 2EX3A 4DV3B 2AZ2A 4TUYB 2AHZA 1LUVA 2QR4A 2FMLA 2QE7G 1GN6A 2P6JA 2ATKC 3LSQA 1ROPA 1N32O 5H9CA 1PNMA 5EYPA 2P22C 3JAMN 3BA8A 4W4LA 4U7OA 3ZN1A 3T1YO 1N34O 3CJHB 1HNZO 3IGAC 5LP6A 4MS2A 2EJRA 2NN4A 4EFEA 1YITV 4JAAA 1VQ7V 2XAGA 2ZR3A 2IU3A 5GW7A 2X6AA 1M57B 3G67A 1W0KG 4RQFA 3JARA 3HKEB 2DYRC 2W6IG 3JSNA 4NVPA 2XTAA 2F66C 3I5DA 3SPGA 1RM1C 3E8FA 5JVDA 2HP8A 4B7KA 3FB5C 1VQ8V 4JI8B 4JPRA 1FJGO 3UCSC 4DR2O 2R72A 1IZ3A 5KA5A 1JQ0A 2BTOA 5LMNO 2QGNA 1GM8A 1KP2A 4GLXA 3T1HB 1GH6A 4DK1A 1Y67A 1VF7A 3D8CA 4RWUA 4JI5B 1Z5WA 2JS3A 4UCUA 1S5HC 1DLBA 4X1KA 4X66O 4XDJA 1VQ4V 4WBNA 3W7UA 4GYCB 4FLWA 1P7GA 5IYZA 2WLHA 3SYCA 3ABLB 3ZJZA 2UXXA 3FB6C 4JYBA 2ZT9B 3F7YC 1B06A 2PZSA 1VP7A 1DK1A 4JI3O 4DR1O 3PN1A 2HJFC 3AG4B 3FYEB 5BR8O 2YDEA 4OPHA 4QE7A 1PM9A 4UVAA 3AG2C 3ML0A 5LYJB 1QVGU 3GB7C 4JASA 1DGSA 3N2KA 2YI8A 1JOYA 2OIGA 1N32B 4I4TA 4X20A 3N27A 1ZX3A 5CA0B 3CCLV 1MZFA 5HFMA 4JYAO 3HKDA 4I55B 3OTFA 1EZVH 4ZKIA 1HR0O 3CCUV 4PA4A 3T1YB 1N34B 1SQVH 4I50B 4LNUB 1MZEA 1L1FA 2H3OA 3ASNB 2IH3C 3JD2A 2RDCA 4ZI7A 3DGEA 1FPOA 4FMTA 4DV7O 1K73W 2DYRB 3WG7C 1IBMB 4OPAA 1DF5A 3FB7C 1KKCA 1RM1B 4HNAB 2V7QG 5JVDB 2AZ0A 1E1QG 2QJ1A 1OHHG 5EIBC 5IT9N 1FJGB 4BWAA 4JV5O 4DR2B 1BMFG 1G1XB 2KB1A 2LW1A 1OCZC 4LH7A 4JTDB 2XAFA 4L8JA 5LMNB 4UCOA 3UM7A 1NR1A 2DMXA 2ITCC 4YIPA 4HBNA 2GSMB 3JAKA 5L3BA 2JGUA 4LF4O 3L70H 3F7VC 2Y69B 4TV9A 4I9QA 3K03A 4IL6Z 2XAJA 4RQEA 1VIBA 2KQXA 4EEQA 4NTWA 2P4VA 3OGIB 2WWWA 2HHHO 2LJ2A 4GKKO 1YJNV 2Q0AA 3J81N 2R9AA 2WSSG 3T2MA 1K9MW 1AR5A 3RW0A 4JI3B 4DR1B 2QA4V 5LBQA 5BR8B 4JI2O 1H38A 4P30A 3G80A 1YJWV 3AK2A 1H2GA 4DV1O 1GM7A 3ZMZA 4DRXB 2N04A 3IFXA 4NB5A 5EIBD 4ZHQB 3C3SA 1KQSU 4JZGA 2VQEO 2NR5A 2CH7A 4CH5A 4JYAB 2CTRA 1UPGA 3BABA 4J7JA 4Q6GA 1GAXA 3OFNG 1KU9A 3WG7B 3SJBC 1YEWA 3A0RA 1XOUA 1XUQA 4ZBMA 3HKBB 2A7WA 4I0XB 3BPZA 1JFFB 4DV7B 1GMGA 1FFXB 5IYCO 3J80N 2YXYA 1SF9A 5EZYA 2UUBO 1L0LH 1H8EG 2XOKG 3D36A 5IJ9A 1OCCC 4K0KO 5H6QA 4JV5B 4JI4O 2AGAA 2JGDA 5EBMC 4LC1A 2G38A 1AJPA 2DOSA 3ABUA 4LF8B 1ZLZA 5LHIA 4GX2A 4O2BB 1WAZA 5JWPA 1F51A 1QVFU 1NBMG 2ZDIC 5HFLA 4Z1VA 1Q90D 2Q7EA 1D2DA 4AILC 1EZJA 1OZ0A 2Q69A 4MVOA 5LOVA 1K34A 1SQBH 4DV6O 2CTQA 2RQ6A 2DQ0A 1SS3A 2Q8VA 1G4YB 2BSKA 3E8BA 3LSUA 2HHHB 4O4IA 3JASB 4PDMA 4GX0A 3ZRWA 4RUEA 2IJIA 1K92A 4TQDA 3RVYA 4PI0A 3DXRA 4JI6O 4O4LB 1ZTEA 1KBHA 4YHHB 2ZE7A 4JI2B 1E79G 3CXCU 4AI8A 5GONA 2QWPB 2QEXV 2EIJC 3AG3C 4B3MO 3NXSA 4X8AA 1WA8B 2K9PA 2FYUH 3S3WA 1EN6A 2N05A 2X6BA 1AI4A 2V4DA 3FX7A 3HB3B 5A2QN 3K5OA 1AJQA 2ZM6B 1XMQO 1ZWIC 1FXVA 1WJZA 5J2TA 5CN0A 5JJEB 3D3IA 4DR4O 3J7AU 2UUBB 1SQXH 1NVPD 5KUKA 5EBLC 4IIJB
chains in the Genus database with same CATH topology
4DO2A 3QO5A 5E1AC 5L3FA 3ZMTA 1KC8W 3TK1A 1R3KC 1OCOB 3LDCA 4HZ3A 1JVMA 4BAYA 3ZMSA 4HAMA 1SESA 1PNKA 2DYSB 3AG1C 3LDDA 3ABKC 4LP8A 3KG2A 4PA9A 1FS0G 2BOCC 1FXKC 2B5UA 2WLIA 3ETEA 1DTOA 1NR7A 2WLJA 2OTLV 2FTKA 1R3IC 5CBHA 1QLEC 4BW5A 5IYDO 3OMAB 2M7WA 1GO3F 3T1CA 1J95A 4WFAV 4I5SA 4HYOA 1I5XA 1NH2D 2QM8A 4E2LA 1M9NA 1NKDA 2A79B 1GKFA 2HKOA 3W7SA 2EZPA 1YHQV 2C2AA 4MTOA 1W2BU 4MTFA 5EC2C 2EBOA 1OCOC 5IY5B 4MVMA 4UUJC 2MK3A 3CP1A 1PKXA 3K3WA 2IJHA 4J9ZB 3OUSA 2DYSC 5H6RA 1SERA 2BOBC 3GWOA 2JJ1G 4GT1A 5EC1C 1RPRA 3OMNB 4G2KA 1QR8A 2WLMA 3ABLC 3B77A 2Q6AA 2EZOA 4RO2A 1GK9A 1YIJV 4JYCA 1YJ9V 4MSWC 1Y66A 1NJIW 3ABTA 4Z1MG 2EIMB 3E8HA 5J9PC 1MOFA 2JEUA 3W7XA 1S0VA 2AHZA 4L87A 4KP4A 3SYPA 1K3EA 1K5QA 1WLEA 2QE7G 2P6JA 2ATKC 1QR9A 3LSQA 1ROPA 2ZDIA 2LP7A 5H9CA 4MW3A 1PNMA 4R50A 5IY5C 3SYAA 1BHBA 1M90W 4U7NA 1NQTA 4U7OA 2X0LA 3ZN1A 3K08A 3ZMVA 3E83A 4PDRA 3IGAC 2DWDC 2IH1C 4MS2A 2EJRA 2Q68A 5B1BB 3ASOB 3WFVA 1AJNA 5LGUA 1YITV 1VQ7V 2XAGA 4G27B 2ZR3A 3VOUA 2IU3A 3EHBB 5GW7A 1HWYA 3OW2U 2X6AA 1B6QA 1QCEA 1M57B 2EIMC 1W0KG 4RQFA 2DYRC 1VQMV 2P90A 2W6IG 3SPGA 1RM1C 1F23A 3E8FA 3FB5C 4LBEC 1SETA 3CCSV 1I5YA 4TT3G 1K8AW 1VQ8V 3DTUB 2JK5C 4JPRA 4QJFB 3ETGA 3LDEA 1P7BA 5L3EA 4N21A 1QLEB 2R9IA 2Y48A 1GTOA 3AEIA 3OUFA 4QNHB 1JQ0A 1SRYA 4JGSA 5KA5A 1TUEB 1GM8A 5CBGA 1KP2A 1F4NA 3MD0A 3X2QC 5L3CA 1AI6A 2V1DA 5B1AC 1YI2V 2H94A 1R6KA 3E89A 3T4ZA 2PI4A 3OM3B 3VBBA 3CCMV 3AG2B 1S5HC 1M57C 2XASA 1S3JA 1Y4MA 3B8NA 2AHYA 3M99B 1DLBA 4QE9A 4QPKA 3OE7G 4XDJA 5B3SC 1VQ4V 4JF3A 4TWKA 3W7UA 2IJJA 4H33A 4FJCC 5EBLC 3I56V 2WLHA 1VQ9V 2EILC 3SYCA 2DQ3A 3ABLB 3ZJZA 1Q82W 2UXXA 3FB6C 4JYBA 2NNUA 3SYQA 3F7YC 4JTCB 1CEZA 3QNEA 1ENVA 1M1KW 1DF4A 3CYOA 4MT8A 4GCZA 1EBOA 1F4MA 5B1NA 1AR1B 2HLDG 3T4DA 3ETDA 4TSFG 1R73A 3ABMC 2HJFC 2XAHA 3AG4B 5IYBO 1KD1W 3FYEB 3G6EV 2WAMA 1K5SA 1PNLA 4QE7A 4UV9A 4UVAA 3AG2C 3ML0A 1ORQC 1JCHA 2A9HA 1WPXA 1VQPV 3ZIAG 1QVGU 2UXNA 3GB7C 1YTFB 4JASA 3ZRXA 2YEVB 4UVCA 4JTAB 1JOYA 1R6NA 4FPPA 5LGNA 3ZRWB 2WLKA 4R8CA 3TETA 1E1RG 2QKSA 3CCLV 3PJSK 3CCJV 5HFMA 1OCZB 2ZR2A 4KUMA 3ZRSA 4ZKIA 2LFRA 3G71V 3CCUV 4PA4A 5L3DA 1SZTA 2ZXWB 3STZC 3H01A 1L1FA 3ASNB 2IH3C 3JD2A 4G28B 3DGEA 4FMTA 1K73W 2OCCB 3OR6C 2DYRB 4X88A 3WG7C 3CC2V 2WLLB 1DF5A 3FB7C 1RM1B 3AG4C 2F43G 3FKSG 1V54C 1BHAA 2V7QG 2WPDG 4FK5C 3RVZA 1FFTB 1E1QG 2H8PC 2ZD9A 3K06A 4WFEA 3ZN0A 1VQOV 1KECA 1OHHG 1VQ5V 1VQKV 5EK0A 4PA3A 4EKWA 1BMFG 2KB1A 1OCZC 1QBZA 3X2QB 4JTDB 2XAFA 5B1AB 4FIPC 1KP3A 3UKMA 4YXWG 2EIKC 3CCVV 3UM7A 4XDLA 2ZXWC 1NR1A 1V55C 4MTXA 2ITCC 4MVQA 3ASNC 3JCZA 3OMIB 4MVZA 3CC4V 2GSMB 2OCCC 1RPOA 5B3SB 5L3BA 3CPWU 2HVJC 2IW5A 4MTGA 3F7VC 2Y69B 3FYIB 3JD0A 1S76D 4RAIA 2EILB 3B8MA 3RBZA 1XL4A 1R3LC 3BY6A 2WLIB 2XAJA 3K03A 3K04A 5FL7G 4RQEA 2IJKA 3P30A 5LHHA 3ZRVA 1CP9A 1XL6A 3JYCA 2WWWA 4UVBA 1YJNV 1K33A 2W0FC 2EINC 3ABMB 5CA3A 2OTJV 3P32A 1CPYA 3R65A 2WSSG 3T2MA 2DW4A 3MHHC 1K9MW 3RW0A 3TCUA 4QPJA 2A0LA 4WFFA 3OEHG 2D3OW 2QA4V 5LBQA 1Q81W 1FXHA 4MVUA 4P30A 1H38A 3CCEV 4BIUA 5LHGA 1YJWV 1H2GA 1GM7A 3ZMZA 5IDJA 2Q67A 1OCCB 1K4DC 2Y69C 3IFXA 1JJ2U 1YTFD 3CMAV 5EBWC 2CK3G 1KQSU 3W7TA 3E86A 5B1OA 2WLNA 1S77D 3EFFK 4H37A 3W7WA 2YSUB 4OXSA 3QO8A 1AI7A 3K79A 3E8GA 4P2ZA 3CCRV 3OFNG 1AI5A 1MSWD 1EFRG 3WG7B 3IC7A 4R6ZA 2GHYA 1P4RA 5C93A 3A0RA 1R3JC 1V54B 1FXKA 4ZBMA 2Z5UA 1PD3A 2NLJC 2HR3A 2W6JG 3ZCCA 4WF9V 1G8MA 1GMGA 3SYOA 5IYCO 1VQLV 4PA7A 3ZMUA 3SPHA 1LNQA 5DM6V 1YSCA 1NVPB 4J9YB 3JD3A 2XOKG 1H8EG 1M56B 5KUMA 3D36A 4QIWF 4PELA 3CCQV 4PA6A 2P67A 1K4CC 3JD1A 3STLC 1OCCC 3K0GA 4N23A 1VQNV 3I55V 1OCRB 2EIKB 5H6QA 3CC7V 1BL8A 3SPJA 5L3GA 1V55B 4WFGA 2HG5C 2PI5A 1COWG 2B1IA 5EBMC 1AROP 4LC1A 1MG1A 2OT5A 3LSSA 3OAAG 2JIZG 3LNMB 3QO7A 1AJPA 3ABUA 4ASUG 4I9WA 2X7RB 1N8RW 5LHIA 2LFSA 3SJQC 4GX2A 3CMEV 2HFEC 2K1EA 1QLNA 1PL0A 4X89A 3SPCA 2X6CA 1F51A 1QVFU 1NBMG 2ZDIC 5HFLA 2QTOA 4UXNA 2JEXA 4RUFA 1GM9A 3BEHA 3HPLC 4GX1A 4XDKA 1EZJA 1NH2B 1Q86W 1OZ0A 2EIJB 2Q69A 1M56C 1MABG 4UV8A 4BIZA 4MVOA 2XNDG 3AG3B 4P9PA 1K34A 1KKDA 5KA6A 1Q7YW 5CBFA 3F5WC 1OCRC 4JAUA 2DQ0A 3MHSC 2EINB 1IXMA 4LCUC 1S72V 1G4YB 3OGCC 3E8BA 2XAQA 3K9AA 3CD6V 2ZQMA 4PDMA 2YEVA 4GX0A 1H8HG 1K97A 4CZZA 4PDVA 4MVRA 3ZRWA 4RUEA 2IJIA 3LUTB 1K92A 5CMUA 3RVYA 4CBCA 4JAVA 1E79G 3CXCU 4XBFA 2P7TC 1JPXA 4WFBV 4WCEV 3SPIA 2QEXV 2EIJC 2JJ2G 3OR7C 3AG3C 3G4SV 2WLLA 2HVKC 2Z3YA 3NXSA 1JX9A 2QM7A 4KFMA 1VQ6V 4X8AA 2R9RB 4R7CA 4GX5A 3E35A 1UJWB 4WFHA 3AG1B 3ABKB 2DWEC 1W0JG 2X6BA 1FXKB 1AI4A 4MVSA 4MW8A 5DN6G 2B1GA 4Q20A 3HB3B 3E2EA 1AJQA 3JD4A 1ZWIC 1FXVA 2IU0A 2JDIG 3K0DA 4PDLA 5CN0A 3D3IA 2ITDC 5LGTA 4DXWA 3OEEG 5B1BC 4P9OA 5BZBA 3FB8C 1K7DA 1NVPD 1THZA 5KUKA 3ASOC 4F4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K33 A;  2M7W A;  1ENV A;  5HFM A;  4G2K A;  1QR8 A;  5HFL A;  4N23 A;  1DF4 A;  3B77 A;  3CYO A;  1F23 A;  3MHH C;  1EBO A;  2EZO A;  1I5X A;  5CMU A;  1Y4M A;  3B8N A;  1I5Y A;  1SZT A;  3M99 B;  1DLB A;  4E2L A;  4JPR A;  1Y66 A;  3B8M A;  3H01 A;  2EZP A;  4JF3 A;  1QBZ A;  1K34 A;  4N21 A;  1MOF A;  5KA6 A;  1JPX A;  1MG1 A;  4FIP C;  2OT5 A;  4FJC C;  3WFV A;  3P30 A;  5KA5 A;  1JQ0 A;  2EBO A;  4JGS A;  5CN0 A;  3MHS C;  1DF5 A;  2MK3 A;  2X7R B;  3CP1 A;  2P6J A;  1QCE A;  1QR9 A;  3K9A A;  3GWO A;  4FK5 C;  2LP7 A;  5H9C A; 
#chains in the Genus database with same CATH topology
 4DO2 A;  3QO5 A;  1R3K C;  4J10 A;  3N2G A;  2KSD A;  3LDC A;  1JVM A;  3ZMS A;  4JI4 B;  3QVN A;  5LL6 Y;  1Q6U A;  3LDD A;  4LP8 A;  3ABK C;  1ZL8 A;  3KG2 A;  4JI1 O;  4X1I B;  4PA9 A;  2CGO A;  3ZHR A;  5KHK A;  2WLI A;  3ETE A;  1NR7 A;  3WB2 A;  2OTL V;  4BW5 A;  3CRA A;  1GO3 F;  1I5X A;  2ZNI A;  4LFB O;  3UT5 B;  2HKO A;  1WP8 A;  2EZP A;  1MNG A;  4ZIB A;  1W2B U;  4DV6 B;  3RYI A;  2BSK B;  2GTS A;  2DN9 A;  5EC2 C;  1SA0 A;  3K3W A;  4J9Z B;  1NTZ H;  2DYS C;  2BOB C;  2JJ1 G;  3CRM A;  4B3T O;  4LFC B;  2WLM A;  2ZIN A;  5KX5 B;  4RO2 A;  4JI6 B;  3H1J H;  1BS3 A;  1YIJ V;  4JYC A;  1XHZ A;  5IJ0 B;  4Z1M G;  5J9P C;  4FFK A;  2GUZ B;  5K1X A;  4KP4 A;  3SYP A;  1K3E A;  1K5Q A;  3RGB A;  3F5T A;  4K35 A;  3HR0 A;  1SQQ H;  3UQ8 A;  2LP7 A;  4MW3 A;  2OWO A;  5IY5 C;  4YJ2 B;  1M90 W;  4ZOL B;  4C7U A;  4U7N A;  3K08 A;  3E83 A;  4PDR A;  3FFQ A;  2DWD C;  2IH1 C;  2Q68 A;  1NTK H;  3WFV A;  1AJN A;  3RT3 C;  3GVM A;  4DR4 B;  4G27 B;  3VOU A;  3EHB B;  2ARH A;  1QCE A;  5KHG A;  2P4K A;  4AQY O;  4J80 A;  2P90 A;  5GTH Z;  2LQT A;  5LMU O;  3TGU H;  3H1I H;  1SET A;  3RYH B;  3R66 A;  1P7B A;  4JI1 B;  2YS8 A;  4LWS B;  1X4T A;  2UXD O;  3AEI A;  3CS5 A;  3L9D A;  4JGS A;  3ZHV A;  5CBG A;  2V1D A;  5B1A C;  5B5E Z;  3B4S A;  1V9P A;  4PJ0 Z;  3VBB A;  1IX9 A;  2QWR B;  3CCM V;  1M57 C;  4LFB B;  1H2S B;  3A8T A;  4QPK A;  3K5M A;  4JF3 A;  1BZK A;  2IJJ A;  1BE3 H;  5KMG A;  1T5E A;  3D3Q A;  3EVK A;  4UCS A;  1QNM A;  2NNU A;  1BQZ A;  2ETN A;  1CEZ A;  3QNE A;  2IM9 A;  3WU2 Z;  4B3T B;  4UCR A;  1M1K W;  3C3T A;  3CYO A;  4GCZ A;  5JJJ B;  2YC0 A;  4NKG B;  3JAL B;  1KD1 W;  4JI7 O;  3FD9 A;  1AP5 A;  2FL4 A;  2A9H A;  1GN3 A;  1VQP V;  1YTF B;  3ZRX A;  4UVC A;  4DK0 A;  4JTA B;  4O4H A;  2LGW A;  5BY1 A;  4FPP A;  5LA6 A;  5ITZ A;  1E1R G;  3TET A;  1SKV A;  4LF7 O;  1N33 O;  4KUM A;  3ZRS A;  3KCY A;  2LFR A;  3HKC B;  1SZT A;  2ZXW B;  3RYF B;  3K5N A;  1P49 A;  4DV0 B;  1I0H A;  2IBZ H;  3CC2 V;  2WLL B;  3KKY A;  2Q7G A;  1Y74 A;  3AG4 C;  3FKS G;  2HEP A;  4FK5 C;  4AQY B;  1QHT A;  1FFT B;  3QF7 A;  2ZNJ A;  5LMU B;  4FFB B;  1VQK V;  1KMI Z;  4EB6 B;  4KHP O;  1BT8 A;  1O9H A;  4EKW A;  1Y76 A;  5D5Q A;  1XNQ O;  2FKX A;  4LFA B;  2UXD B;  5B1A B;  3UKM A;  1TVK A;  3CWB H;  5LXT A;  1V55 C;  1IBM O;  3E22 A;  3ASN C;  4MVZ A;  3CC4 V;  1J5E O;  3TXQ A;  2HVJ C;  4F6E A;  1RP3 B;  1L0N H;  2CTP A;  1URF A;  2CE4 A;  4RAI A;  2YI9 A;  5J2U A;  3K04 A;  2Y0I A;  1CP9 A;  1XL6 A;  3JYC A;  1N0J A;  3OTO O;  5KAF Z;  1H2K A;  3P32 A;  1CPY A;  3R65 A;  2DW4 A;  1JMK C;  4GKJ B;  4H13 B;  3OEH G;  2KG7 A;  1RFY A;  4JI7 B;  4BIU A;  5JQG A;  3OT7 A;  2Q67 A;  1K4D C;  2Y69 C;  1JJ2 U;  3TXS A;  3CMA V;  2CK3 G;  1HNW O;  4U3J A;  4FLZ A;  4LF7 B;  1N33 B;  2WLN A;  2QWQ B;  2VWK A;  4H37 A;  1AI7 A;  1PV0 A;  2YXL A;  3ZED A;  1EFR G;  1YZB A;  1HNX O;  4R6Z A;  2GHY A;  3UO2 A;  5C93 A;  4NXM B;  4YJ3 A;  3MDS A;  1FXK A;  2Z5U A;  2NLJ C;  4WF9 V;  3SYO A;  3K9S A;  2ZE5 A;  3ZMU A;  1LNQ A;  1FYJ A;  1YSC A;  3JD3 A;  5EYP B;  3VQV A;  1M56 B;  3CRQ A;  4FLX A;  3CCQ V;  4PA6 A;  1K4C C;  3STL C;  3K0G A;  4N23 A;  1NI8 A;  4X9Q A;  2LGQ A;  3I55 V;  5LP6 B;  1OCR B;  4KHP B;  3CC7 V;  1XNQ B;  1V55 B;  1M4U A;  4F6R A;  2B1I A;  3H1L H;  2YUA A;  3LNM B;  3ZS8 C;  3JAR B;  4ASU G;  4CH6 A;  3CME V;  1KYO F;  1J5E B;  1JA8 A;  2JEX A;  4FVM A;  4XDK A;  4UV8 A;  1X59 A;  2XND G;  4PHZ A;  4P9P A;  1KUQ A;  5CBF A;  4TV8 A;  1IXM A;  2ADQ B;  4LF8 O;  3OTO B;  1WNS A;  2YEV A;  3S3X A;  1QU7 A;  1XBL A;  5FNV A;  4PDV A;  4X1K B;  3L75 H;  5JJN B;  4UCV A;  4WBN B;  1XRE A;  4KL1 A;  4CBC A;  2GDS A;  3L74 H;  5IYZ B;  4XBF A;  2KKW A;  4JYY A;  2P7T C;  3FAV A;  4WCE V;  2WA3 A;  1VMG A;  3SPI A;  3VQY A;  4U3J B;  3AK1 A;  3B2E E;  2F4V O;  3OR7 C;  1TAE A;  1ZAU A;  3G4S V;  5CB4 A;  1HNW B;  1VF5 B;  1JX9 A;  2QM7 A;  3G6B A;  3H1H H;  5D5P A;  4WFH A;  3WB0 A;  1XQ8 A;  2ZCE A;  2DWE C;  1FXK B;  4MW8 A;  5DN6 G;  2B1G A;  4Q20 A;  1FKA O;  1HNX B;  3E2E A;  4YHH O;  3N2K B;  2IU0 A;  2VQF O;  2JDI G;  4I4T B;  4X20 B;  1MMM A;  4DXW A;  4FZ1 A;  3ASO C;  3HKD B;  3DSQ A;  4U3F H;  3IAY A;  1NU1 H;  5KAI Z;  3L73 H;  1OCO B;  4X1Y A;  4ZI7 B;  3CX5 F;  2ZM6 O;  2PY5 A;  1R1B A;  1KB9 F;  3CRC A;  1CXZ B;  5CA1 A;  1R3I C;  2AW9 A;  5CBH A;  2RMK B;  4UB8 Z;  1QLE C;  1JR9 A;  5IYD O;  3T1C A;  1J95 A;  4WFA V;  4I5S A;  2QM8 A;  1GKF A;  2E76 B;  4O2A A;  1VF6 C;  3QG5 A;  4CC5 A;  4CS2 A;  1HDJ A;  1IBL O;  4DV5 O;  4UUJ C;  2MK3 A;  2UXB O;  3JAK B;  5DED A;  2QM4 A;  5EC1 C;  2CUG A;  4G2K A;  2PYL A;  3B77 A;  4TV9 B;  1Q3E A;  3TJT A;  5JCO C;  4H0L B;  1Y66 A;  4KXR A;  2EIM B;  2ZIO A;  2JEU A;  4L87 A;  2F4V B;  3SR2 C;  1TUB A;  1YDX A;  1Q43 A;  2ZDI A;  3SYA A;  2Z0A A;  3Q4H A;  4LFC O;  1NQT A;  2X0L A;  3ZMV A;  3BHP A;  2VQF B;  2BCC H;  3ASO B;  5LGU A;  4CS4 A;  4B3S B;  4DV2 O;  2F95 B;  2HJD A;  2VS0 A;  1HWY A;  2CH7 B;  2XUM A;  3THO A;  1VQM V;  1IVS A;  4LBE C;  3CCS V;  4TT3 G;  3DTU B;  1PPJ H;  3ETG A;  3O65 A;  2Q0O C;  5EZY B;  1QLE B;  2R9I A;  1GTO A;  3OUF A;  4QNH B;  1SRY A;  4DR7 O;  4CH3 A;  5IJ9 B;  3X2Q C;  5L3C A;  2H94 A;  1R6K A;  3E89 A;  1IDS A;  3T4Z A;  4IHJ A;  1AR4 A;  4FLU A;  1N36 O;  2M6Y A;  1YVW A;  1SQG A;  3OM3 B;  2FB5 A;  4NR1 A;  1S3J A;  2JGD B;  2JVD A;  4QE9 A;  3OE7 G;  2JRI A;  5B3S C;  1EN4 A;  5FPR A;  4H33 A;  2L35 A;  1IBL B;  4JZ2 A;  4DV5 B;  3I56 V;  4X64 B;  2UXB B;  1VQ9 V;  1NZ6 A;  1Q82 W;  1WB8 A;  3SYQ A;  1VAR A;  3U0Z A;  5IWA O;  5C8Y A;  3QTC A;  3ZHS A;  1DF4 A;  4MT8 A;  1EBO A;  1F4M A;  2HLD G;  5LOV B;  3T4D A;  3APQ A;  3SDL A;  3RYC A;  3ETD A;  1R73 A;  2BE3 A;  3ABM C;  4LF5 O;  2BTQ A;  3NR7 A;  2XHB A;  4UV9 A;  1ORQ C;  4O4I B;  3ZIA G;  2UXN A;  2PUS A;  1M5I A;  3ZRW B;  2CGN A;  2WLK A;  4R8C A;  2QKS A;  3PJS K;  3DXR B;  2ZR2 A;  3EXA A;  3G71 V;  5L3D A;  3P3N A;  5GON B;  2E3C A;  3STZ C;  1RSO A;  4G28 B;  2OCC B;  3OR6 C;  5KHJ A;  4DV2 B;  4FLV A;  2F1M A;  2F43 G;  1V54 C;  2WPD G;  3JAW A;  3RVZ A;  2H8P C;  2Y4T A;  4WFE A;  3K06 A;  4A5U B;  3ZN0 A;  1KEC A;  1VQ5 V;  5EK0 A;  2XT9 A;  1G6U A;  3CXH F;  4J41 A;  2YIB D;  2UUA O;  5J2T B;  3DC6 A;  1H2N A;  4FM0 A;  3X2Q B;  4DV0 O;  5KHH A;  4FIP C;  1KP3 A;  4X62 O;  4YXW G;  4DR7 B;  3CCV V;  4XDL A;  2ZXW C;  4TOI A;  4MTX A;  4MVQ A;  2W0X A;  1N36 B;  3N2G B;  5B3S B;  3CPW U;  3KCX A;  2IW5 A;  1ZL8 B;  2LW7 A;  3JD0 A;  2ILM A;  3BCC H;  3RBZ A;  3B8M A;  1XL4 A;  1R3L C;  3BY6 A;  2WLI B;  5FL7 G;  1A32 A;  4LFA O;  2UU9 O;  5LHH A;  3ZRV A;  4TUY A;  1YCI A;  5IWA B;  2Q7H A;  3CE2 A;  2W0F C;  2EIN C;  3ABM B;  3IJ4 A;  4D6T H;  5CA3 A;  2OTJ V;  1XHX A;  4E4E A;  3RYI B;  4QPJ A;  4LF5 B;  2D3O W;  1SA0 B;  3CCE V;  3CJH A;  5H5N A;  5IDJ A;  3RN4 A;  1YTF D;  2GTA A;  2E5L O;  5EBW C;  2PF4 E;  3W7T A;  4DR5 B;  5B1O A;  3CSX A;  3EFF K;  2YSU B;  4OXS A;  3QO8 A;  3HKE A;  2UUC O;  4P2Z A;  1WP7 A;  4ICG A;  4GKJ O;  1D5N A;  1P4R A;  3SJA C;  1IBK O;  1V54 B;  1YJ9 V;  1PD3 A;  2W6J G;  2HR3 A;  3ZCC A;  3JAW B;  2CAZ C;  1VQL V;  2RNB A;  1OV9 A;  4QIW F;  4PEL A;  4LR3 A;  2P67 A;  3JD1 A;  2WA4 A;  1VQN V;  2A3Q A;  1H2L A;  4CC6 A;  2UUA B;  1IUR A;  4WFG A;  1VEW A;  1O9G A;  2HG5 C;  4NXM O;  4X62 B;  1MG1 A;  2OT5 A;  2JIZ G;  3ZBH A;  4I9W A;  4EFB A;  3SJQ C;  3H1K H;  1QLN A;  1PL0 A;  3U11 A;  4X89 A;  2X6C A;  1WN7 A;  4K8X A;  2QTO A;  4K8Z A;  4AHC A;  1NH2 B;  4RUF A;  1GM9 A;  3BEH A;  3ZX6 A;  1Q86 W;  1GRJ A;  1XMO O;  1M56 C;  1MAB G;  1JJO A;  4YIO A;  2YXH A;  4LF9 O;  4UCT A;  2UU9 B;  5LP6 C;  1OCR C;  4I7Z B;  1EN5 A;  3IC9 A;  4YY3 O;  2EIN B;  4LCU C;  1XEQ A;  2QSA A;  4J42 A;  5LYJ A;  3OGC C;  2XAQ A;  4Z2W A;  4DV4 O;  4IYH A;  4D7T A;  1K97 A;  1U96 A;  4CZZ A;  4MVR A;  3LUT B;  5AG2 A;  5CA0 A;  5CMU A;  1NT2 B;  5K1P A;  5KMG B;  4DYL A;  2ZE8 A;  4I55 A;  1XI1 A;  3OD4 A;  3RWR D;  1JPX A;  3ZHT A;  1PL4 A;  4I50 A;  4LNU A;  2AXT Z;  2DE0 X;  4OX9 O;  3P3P A;  2E5L B;  2Z3Y A;  2HVK C;  4KFM A;  2R9R B;  3BRC A;  1I94 B;  4HNA A;  2L6L A;  2VRZ A;  2Q9L A;  3E35 A;  3AG1 B;  2UUC B;  1W0J G;  3K57 A;  1AP6 A;  1IBK B;  2ZE6 A;  3JD4 A;  4O4H B;  4PDL A;  5LA6 B;  5ITZ B;  2Y0P A;  5B1B C;  1THZ A;  2ODM A;  5GTI Z;  5E1A C;  1SQP H;  1KC8 W;  4HZ3 A;  3ZHQ A;  4FLT A;  4HAM A;  1PNK A;  1Y74 B;  1XIL A;  1AIL A;  1FXK C;  5F2V O;  2B5U A;  1DTO A;  2WLJ A;  2FTK A;  2GBO A;  2OIE A;  1Y76 B;  2QWO B;  2ADP A;  1XMO B;  4E2L A;  1M9N A;  1NKD A;  2A79 B;  4GUN A;  4NYK A;  1TVK B;  2B9Z A;  5LXT B;  5BMV A;  3ETQ A;  4LF9 B;  3E22 B;  2EBO A;  4YY3 B;  1OCO C;  1WPB A;  1PKX A;  5IE9 A;  4DV4 B;  4DRX A;  3GWO A;  1ZSP A;  1RPR A;  1QR8 A;  4ZHQ A;  3MAQ A;  1I08 A;  5J2U B;  2Q6A A;  2EZO A;  1HNZ B;  4OGQ B;  3WB1 A;  2JS5 A;  4FM2 A;  4MSW C;  4NXN O;  1NJI W;  3ABT A;  3E8H A;  1MOF A;  1N0N A;  3W7X A;  1S0V A;  4OX9 B;  3APO A;  3HKB A;  2EJ7 A;  3CRR A;  1JFF A;  1WLE A;  4I0X A;  4DW0 A;  4LF6 O;  1FFX A;  1QR9 A;  2CTW A;  4R50 A;  1AB3 A;  1BHB A;  4K3A A;  2KG7 B;  1PP9 H;  2RN9 A;  3BAA A;  3JSL A;  5JQG B;  5B1B B;  4BIO A;  3A2F A;  3OW2 U;  1B6Q A;  2EIM C;  4O2B A;  2P5O A;  1F23 A;  4YJ3 B;  3CB2 A;  4X66 B;  2CDY A;  1I5Y A;  1K8A W;  2RJZ A;  1N4C A;  2JK5 C;  4QJF B;  3LDE A;  5L3E A;  4DR6 O;  4N21 A;  2Y48 A;  1TUE B;  1F4N A;  3MD0 A;  2P06 A;  4B3S O;  4B3R O;  1AI6 A;  1YI2 V;  3VQW A;  3L72 H;  4QGP A;  1NTM H;  2PI4 A;  2QKA A;  3JAS A;  5BMV B;  3AG2 B;  4F6R B;  2XAS A;  1Y4M A;  3B8N A;  2AHY A;  4D7S A;  3M99 B;  2Y4U A;  1P84 F;  1XDC A;  4TWK A;  1LR1 A;  4O4L A;  4DW1 A;  4FJC C;  1Q6I A;  4FM1 A;  2EIL C;  2DQ3 A;  2A06 H;  4JTC B;  3JCU Z;  1ENV A;  3D36 C;  1YF2 A;  2QWN B;  1HR0 B;  4PD4 F;  5B1N A;  1WA8 A;  1AR1 B;  4J7Z A;  4TSF G;  1YXB A;  3C90 A;  4NXN B;  2XAH A;  5IYB O;  1BSM A;  3G6E V;  2WAM A;  1K5S A;  1PNL A;  4TV8 B;  1JCH A;  1WPX A;  3H9V A;  3DC5 A;  2YEV B;  4LF6 B;  5FNV B;  4LH6 A;  4X64 O;  2YIC A;  1R6N A;  5LGN A;  1IXB A;  2OYQ A;  3CCJ V;  4DR3 O;  1OCZ B;  2N74 A;  4IIJ A;  4BR6 A;  1VF6 A;  3FAV B;  3H01 A;  2ZIM A;  3KZI Z;  3RFR A;  1UFI A;  5CB4 B;  3BA9 A;  4X88 A;  4DUY O;  4X1I A;  2MW2 B;  1BHA A;  2ZD9 A;  5JH7 A;  1Z5V A;  5DEC A;  3B40 A;  4LF4 B;  3SJC C;  1VQO V;  5JCO A;  3M7M X;  1L8D A;  4PA3 A;  3O9O A;  4DR6 B;  1BQ0 A;  1QBZ A;  2F23 A;  3UT5 A;  5KHI A;  2EIK C;  4X65 O;  3B09 A;  3K5L A;  4GKK B;  4B3R B;  3SGI A;  3JCZ A;  1B3Q A;  3OMI B;  2UXC O;  2OCC C;  4JI0 O;  1RPO A;  4X1Y B;  4MTG A;  3FYI B;  1S76 D;  4IGG A;  2EIL B;  5KX5 A;  1NS1 A;  4DV1 B;  1S5L Z;  2IJK A;  5CA1 B;  3K59 A;  3P30 A;  5IJ0 A;  2PYJ A;  3L71 H;  2VQE B;  4UVB A;  3AK3 A;  2GUZ A;  2E75 B;  1K33 A;  1Q6H A;  3MHH C;  4O2A B;  3TCU A;  2QTS A;  2A0L A;  4YJ2 A;  4WFF A;  4ZOL A;  4TQF A;  1ZUQ A;  1Q81 W;  1FXH A;  4MVU A;  1D5A A;  3JAT A;  5LHG A;  1OCC B;  2PGG A;  4O4J A;  3E86 A;  1LUW A;  4DR3 B;  1S77 D;  3W7W A;  4K0K B;  3K79 A;  3E8G A;  3CCR V;  2YIA A;  1AI5 A;  3A0B Z;  1MSW D;  3IC7 A;  4FZ0 A;  1H2M A;  1R3J C;  5FLX N;  3RYH A;  2YIB A;  3A0H Z;  1G8M A;  1BGY H;  1TUB B;  3UO3 A;  3CHX A;  1Q5O A;  1HP8 A;  5KLV H;  4PA7 A;  4DUY B;  1FD9 A;  3SPH A;  5JH7 B;  1QQC A;  4LWS A;  1GN4 A;  5DM6 V;  1NVP B;  1MA1 A;  1W59 A;  4J9Y B;  1SC5 B;  3Q4H B;  1Z2G A;  5KUM A;  4DR5 O;  2QDO A;  3VQX A;  2EIK B;  1BL8 A;  3SPJ A;  5L3G A;  4IT5 A;  4NTY A;  1TGO A;  2PI5 A;  1COW G;  1Q8I A;  1ARO P;  4UFZ A;  3BVO A;  3LSS A;  4X65 B;  3OAA G;  4H44 B;  2E74 B;  3QO7 A;  4GZR B;  2X7R B;  1MSD A;  3ICX A;  1N8R W;  2LFS A;  2HFE C;  2UXC B;  2K1E A;  1EM1 A;  4JI0 B;  3SPC A;  4UB6 Z;  4UXN A;  1TA8 A;  3HPL C;  4GX1 A;  2EIJ B;  2QKC A;  4BIZ A;  3AG3 B;  4DUZ O;  1US6 A;  1KKD A;  5KA6 A;  3JAL A;  1Q7Y W;  1OJH A;  2DJV A;  2Q5Z A;  3F5W C;  4JAU A;  3MHS C;  4B3M B;  1S72 V;  4B7E A;  4IHJ B;  1FAF A;  3K9A A;  2OCH A;  2ZQM A;  3CD6 V;  5H2F Z;  1H8H G;  4PI2 A;  2ZKO A;  4ABM A;  1M93 A;  3JAT B;  1XNR O;  2D2C B;  4JAV A;  1XMQ B;  3HKC A;  4DV3 O;  3GWK C;  3RYF A;  4O4J B;  4WFB V;  2YID A;  4CH4 A;  2JJ2 G;  1Y6X A;  1B04 A;  5C8Y B;  1U97 A;  3ZHU A;  2WLL A;  5BXZ A;  1VQ6 V;  4NTX A;  4R7C A;  4GX5 A;  1UJW B;  3RYC B;  2O57 A;  3ABK B;  2BTQ B;  4MVS A;  1S5J A;  5B66 Z;  4FFB A;  3LNN A;  4EB6 A;  1BCC H;  2F93 B;  3K0D A;  2PTM A;  2ITD C;  1SZX A;  5LGT A;  3AG7 A;  4BW9 A;  5BZB A;  3OEE G;  4P9O A;  3FB8 C;  2RCV A;  1K7D A;  4F4L A;  2GV9 A;  5L3F A;  3K58 A;  1I94 O;  1I7F A;  2VWJ A;  3ZMT A;  2Q73 A;  3TK1 A;  3U10 A;  1GN2 A;  4IYI A;  2EUL A;  1RSO B;  3CEI A;  4BAY A;  4JI8 O;  1SES A;  2LO1 A;  2DYS B;  3AG1 C;  1FS0 G;  2BOC C;  1F7Y A;  4J7K A;  4J11 A;  3T1H O;  3OMA B;  2M7W A;  1SQF A;  3M8A A;  4JI5 O;  1HW7 A;  4HYO A;  1NH2 D;  1AVM A;  4DUZ B;  3W7S A;  1YHQ V;  2C2A A;  4MTO A;  5FPO A;  4MTF A;  4CS3 A;  2Q4P A;  1WB7 A;  5IY5 B;  4MVM A;  3CP1 A;  2IJH A;  3BFR A;  2R70 A;  3OUS A;  5H6R A;  5A9G A;  1SER A;  4GT1 A;  3OMN B;  3ABL C;  1R6T A;  5E79 Z;  4FLY A;  4B08 A;  1XNR B;  1GK9 A;  4PV1 B;  4W4K A;  5TIS Z;  2EX3 A;  4DV3 B;  2AZ2 A;  4TUY B;  2AHZ A;  1LUV A;  2QR4 A;  2FML A;  2QE7 G;  1GN6 A;  2P6J A;  2ATK C;  3LSQ A;  1ROP A;  1N32 O;  5H9C A;  1PNM A;  5EYP A;  2P22 C;  3JAM N;  3BA8 A;  4W4L A;  4U7O A;  3ZN1 A;  3T1Y O;  1N34 O;  3CJH B;  1HNZ O;  3IGA C;  5LP6 A;  4MS2 A;  2EJR A;  2NN4 A;  4EFE A;  1YIT V;  4JAA A;  1VQ7 V;  2XAG A;  2ZR3 A;  2IU3 A;  5GW7 A;  2X6A A;  1M57 B;  3G67 A;  1W0K G;  4RQF A;  3JAR A;  3HKE B;  2DYR C;  2W6I G;  3JSN A;  4NVP A;  2XTA A;  2F66 C;  3I5D A;  3SPG A;  1RM1 C;  3E8F A;  5JVD A;  2HP8 A;  4B7K A;  3FB5 C;  1VQ8 V;  4JI8 B;  4JPR A;  1FJG O;  3UCS C;  4DR2 O;  2R72 A;  1IZ3 A;  5KA5 A;  1JQ0 A;  2BTO A;  5LMN O;  2QGN A;  1GM8 A;  1KP2 A;  4GLX A;  3T1H B;  1GH6 A;  4DK1 A;  1Y67 A;  1VF7 A;  3D8C A;  4RWU A;  4JI5 B;  1Z5W A;  2JS3 A;  4UCU A;  1S5H C;  1DLB A;  4X1K A;  4X66 O;  4XDJ A;  1VQ4 V;  4WBN A;  3W7U A;  4GYC B;  4FLW A;  1P7G A;  5IYZ A;  2WLH A;  3SYC A;  3ABL B;  3ZJZ A;  2UXX A;  3FB6 C;  4JYB A;  2ZT9 B;  3F7Y C;  1B06 A;  2PZS A;  1VP7 A;  1DK1 A;  4JI3 O;  4DR1 O;  3PN1 A;  2HJF C;  3AG4 B;  3FYE B;  5BR8 O;  2YDE A;  4OPH A;  4QE7 A;  1PM9 A;  4UVA A;  3AG2 C;  3ML0 A;  5LYJ B;  1QVG U;  3GB7 C;  4JAS A;  1DGS A;  3N2K A;  2YI8 A;  1JOY A;  2OIG A;  1N32 B;  4I4T A;  4X20 A;  3N27 A;  1ZX3 A;  5CA0 B;  3CCL V;  1MZF A;  5HFM A;  4JYA O;  3HKD A;  4I55 B;  3OTF A;  1EZV H;  4ZKI A;  1HR0 O;  3CCU V;  4PA4 A;  3T1Y B;  1N34 B;  1SQV H;  4I50 B;  4LNU B;  1MZE A;  1L1F A;  2H3O A;  3ASN B;  2IH3 C;  3JD2 A;  2RDC A;  4ZI7 A;  3DGE A;  1FPO A;  4FMT A;  4DV7 O;  1K73 W;  2DYR B;  3WG7 C;  1IBM B;  4OPA A;  1DF5 A;  3FB7 C;  1KKC A;  1RM1 B;  4HNA B;  2V7Q G;  5JVD B;  2AZ0 A;  1E1Q G;  2QJ1 A;  1OHH G;  5EIB C;  5IT9 N;  1FJG B;  4BWA A;  4JV5 O;  4DR2 B;  1BMF G;  1G1X B;  2KB1 A;  2LW1 A;  1OCZ C;  4LH7 A;  4JTD B;  2XAF A;  4L8J A;  5LMN B;  4UCO A;  3UM7 A;  1NR1 A;  2DMX A;  2ITC C;  4YIP A;  4HBN A;  2GSM B;  3JAK A;  5L3B A;  2JGU A;  4LF4 O;  3L70 H;  3F7V C;  2Y69 B;  4TV9 A;  4I9Q A;  3K03 A;  4IL6 Z;  2XAJ A;  4RQE A;  1VIB A;  2KQX A;  4EEQ A;  4NTW A;  2P4V A;  3OGI B;  2WWW A;  2HHH O;  2LJ2 A;  4GKK O;  1YJN V;  2Q0A A;  3J81 N;  2R9A A;  2WSS G;  3T2M A;  1K9M W;  1AR5 A;  3RW0 A;  4JI3 B;  4DR1 B;  2QA4 V;  5LBQ A;  5BR8 B;  4JI2 O;  1H38 A;  4P30 A;  3G80 A;  1YJW V;  3AK2 A;  1H2G A;  4DV1 O;  1GM7 A;  3ZMZ A;  4DRX B;  2N04 A;  3IFX A;  4NB5 A;  5EIB D;  4ZHQ B;  3C3S A;  1KQS U;  4JZG A;  2VQE O;  2NR5 A;  2CH7 A;  4CH5 A;  4JYA B;  2CTR A;  1UPG A;  3BAB A;  4J7J A;  4Q6G A;  1GAX A;  3OFN G;  1KU9 A;  3WG7 B;  3SJB C;  1YEW A;  3A0R A;  1XOU A;  1XUQ A;  4ZBM A;  3HKB B;  2A7W A;  4I0X B;  3BPZ A;  1JFF B;  4DV7 B;  1GMG A;  1FFX B;  5IYC O;  3J80 N;  2YXY A;  1SF9 A;  5EZY A;  2UUB O;  1L0L H;  1H8E G;  2XOK G;  3D36 A;  5IJ9 A;  1OCC C;  4K0K O;  5H6Q A;  4JV5 B;  4JI4 O;  2AGA A;  2JGD A;  5EBM C;  4LC1 A;  2G38 A;  1AJP A;  2DOS A;  3ABU A;  4LF8 B;  1ZLZ A;  5LHI A;  4GX2 A;  4O2B B;  1WAZ A;  5JWP A;  1F51 A;  1QVF U;  1NBM G;  2ZDI C;  5HFL A;  4Z1V A;  1Q90 D;  2Q7E A;  1D2D A;  4AIL C;  1EZJ A;  1OZ0 A;  2Q69 A;  4MVO A;  5LOV A;  1K34 A;  1SQB H;  4DV6 O;  2CTQ A;  2RQ6 A;  2DQ0 A;  1SS3 A;  2Q8V A;  1G4Y B;  2BSK A;  3E8B A;  3LSU A;  2HHH B;  4O4I A;  3JAS B;  4PDM A;  4GX0 A;  3ZRW A;  4RUE A;  2IJI A;  1K92 A;  4TQD A;  3RVY A;  4PI0 A;  3DXR A;  4JI6 O;  4O4L B;  1ZTE A;  1KBH A;  4YHH B;  2ZE7 A;  4JI2 B;  1E79 G;  3CXC U;  4AI8 A;  5GON A;  2QWP B;  2QEX V;  2EIJ C;  3AG3 C;  4B3M O;  3NXS A;  4X8A A;  1WA8 B;  2K9P A;  2FYU H;  3S3W A;  1EN6 A;  2N05 A;  2X6B A;  1AI4 A;  2V4D A;  3FX7 A;  3HB3 B;  5A2Q N;  3K5O A;  1AJQ A;  2ZM6 B;  1XMQ O;  1ZWI C;  1FXV A;  1WJZ A;  5J2T A;  5CN0 A;  5JJE B;  3D3I A;  4DR4 O;  3J7A U;  2UUB B;  1SQX H;  1NVP D;  5KUK A;  5EBL C;  4IIJ B; 
#chains in the Genus database with same CATH homology
 4DO2 A;  3QO5 A;  5E1A C;  5L3F A;  3ZMT A;  1KC8 W;  3TK1 A;  1R3K C;  1OCO B;  3LDC A;  4HZ3 A;  1JVM A;  4BAY A;  3ZMS A;  4HAM A;  1SES A;  1PNK A;  2DYS B;  3AG1 C;  3LDD A;  3ABK C;  4LP8 A;  3KG2 A;  4PA9 A;  1FS0 G;  2BOC C;  1FXK C;  2B5U A;  2WLI A;  3ETE A;  1DTO A;  1NR7 A;  2WLJ A;  2OTL V;  2FTK A;  1R3I C;  5CBH A;  1QLE C;  4BW5 A;  5IYD O;  3OMA B;  2M7W A;  1GO3 F;  3T1C A;  1J95 A;  4WFA V;  4I5S A;  4HYO A;  1I5X A;  1NH2 D;  2QM8 A;  4E2L A;  1M9N A;  1NKD A;  2A79 B;  1GKF A;  2HKO A;  3W7S A;  2EZP A;  1YHQ V;  2C2A A;  4MTO A;  1W2B U;  4MTF A;  5EC2 C;  2EBO A;  1OCO C;  5IY5 B;  4MVM A;  4UUJ C;  2MK3 A;  3CP1 A;  1PKX A;  3K3W A;  2IJH A;  4J9Z B;  3OUS A;  2DYS C;  5H6R A;  1SER A;  2BOB C;  3GWO A;  2JJ1 G;  4GT1 A;  5EC1 C;  1RPR A;  3OMN B;  4G2K A;  1QR8 A;  2WLM A;  3ABL C;  3B77 A;  2Q6A A;  2EZO A;  4RO2 A;  1GK9 A;  1YIJ V;  4JYC A;  1YJ9 V;  4MSW C;  1Y66 A;  1NJI W;  3ABT A;  4Z1M G;  2EIM B;  3E8H A;  5J9P C;  1MOF A;  2JEU A;  3W7X A;  1S0V A;  2AHZ A;  4L87 A;  4KP4 A;  3SYP A;  1K3E A;  1K5Q A;  1WLE A;  2QE7 G;  2P6J A;  2ATK C;  1QR9 A;  3LSQ A;  1ROP A;  2ZDI A;  2LP7 A;  5H9C A;  4MW3 A;  1PNM A;  4R50 A;  5IY5 C;  3SYA A;  1BHB A;  1M90 W;  4U7N A;  1NQT A;  4U7O A;  2X0L A;  3ZN1 A;  3K08 A;  3ZMV A;  3E83 A;  4PDR A;  3IGA C;  2DWD C;  2IH1 C;  4MS2 A;  2EJR A;  2Q68 A;  5B1B B;  3ASO B;  3WFV A;  1AJN A;  5LGU A;  1YIT V;  1VQ7 V;  2XAG A;  4G27 B;  2ZR3 A;  3VOU A;  2IU3 A;  3EHB B;  5GW7 A;  1HWY A;  3OW2 U;  2X6A A;  1B6Q A;  1QCE A;  1M57 B;  2EIM C;  1W0K G;  4RQF A;  2DYR C;  1VQM V;  2P90 A;  2W6I G;  3SPG A;  1RM1 C;  1F23 A;  3E8F A;  3FB5 C;  4LBE C;  1SET A;  3CCS V;  1I5Y A;  4TT3 G;  1K8A W;  1VQ8 V;  3DTU B;  2JK5 C;  4JPR A;  4QJF B;  3ETG A;  3LDE A;  1P7B A;  5L3E A;  4N21 A;  1QLE B;  2R9I A;  2Y48 A;  1GTO A;  3AEI A;  3OUF A;  4QNH B;  1JQ0 A;  1SRY A;  4JGS A;  5KA5 A;  1TUE B;  1GM8 A;  5CBG A;  1KP2 A;  1F4N A;  3MD0 A;  3X2Q C;  5L3C A;  1AI6 A;  2V1D A;  5B1A C;  1YI2 V;  2H94 A;  1R6K A;  3E89 A;  3T4Z A;  2PI4 A;  3OM3 B;  3VBB A;  3CCM V;  3AG2 B;  1S5H C;  1M57 C;  2XAS A;  1S3J A;  1Y4M A;  3B8N A;  2AHY A;  3M99 B;  1DLB A;  4QE9 A;  4QPK A;  3OE7 G;  4XDJ A;  5B3S C;  1VQ4 V;  4JF3 A;  4TWK A;  3W7U A;  2IJJ A;  4H33 A;  4FJC C;  5EBL C;  3I56 V;  2WLH A;  1VQ9 V;  2EIL C;  3SYC A;  2DQ3 A;  3ABL B;  3ZJZ A;  1Q82 W;  2UXX A;  3FB6 C;  4JYB A;  2NNU A;  3SYQ A;  3F7Y C;  4JTC B;  1CEZ A;  3QNE A;  1ENV A;  1M1K W;  1DF4 A;  3CYO A;  4MT8 A;  4GCZ A;  1EBO A;  1F4M A;  5B1N A;  1AR1 B;  2HLD G;  3T4D A;  3ETD A;  4TSF G;  1R73 A;  3ABM C;  2HJF C;  2XAH A;  3AG4 B;  5IYB O;  1KD1 W;  3FYE B;  3G6E V;  2WAM A;  1K5S A;  1PNL A;  4QE7 A;  4UV9 A;  4UVA A;  3AG2 C;  3ML0 A;  1ORQ C;  1JCH A;  2A9H A;  1WPX A;  1VQP V;  3ZIA G;  1QVG U;  2UXN A;  3GB7 C;  1YTF B;  4JAS A;  3ZRX A;  2YEV B;  4UVC A;  4JTA B;  1JOY A;  1R6N A;  4FPP A;  5LGN A;  3ZRW B;  2WLK A;  4R8C A;  3TET A;  1E1R G;  2QKS A;  3CCL V;  3PJS K;  3CCJ V;  5HFM A;  1OCZ B;  2ZR2 A;  4KUM A;  3ZRS A;  4ZKI A;  2LFR A;  3G71 V;  3CCU V;  4PA4 A;  5L3D A;  1SZT A;  2ZXW B;  3STZ C;  3H01 A;  1L1F A;  3ASN B;  2IH3 C;  3JD2 A;  4G28 B;  3DGE A;  4FMT A;  1K73 W;  2OCC B;  3OR6 C;  2DYR B;  4X88 A;  3WG7 C;  3CC2 V;  2WLL B;  1DF5 A;  3FB7 C;  1RM1 B;  3AG4 C;  2F43 G;  3FKS G;  1V54 C;  1BHA A;  2V7Q G;  2WPD G;  4FK5 C;  3RVZ A;  1FFT B;  1E1Q G;  2H8P C;  2ZD9 A;  3K06 A;  4WFE A;  3ZN0 A;  1VQO V;  1KEC A;  1OHH G;  1VQ5 V;  1VQK V;  5EK0 A;  4PA3 A;  4EKW A;  1BMF G;  2KB1 A;  1OCZ C;  1QBZ A;  3X2Q B;  4JTD B;  2XAF A;  5B1A B;  4FIP C;  1KP3 A;  3UKM A;  4YXW G;  2EIK C;  3CCV V;  3UM7 A;  4XDL A;  2ZXW C;  1NR1 A;  1V55 C;  4MTX A;  2ITC C;  4MVQ A;  3ASN C;  3JCZ A;  3OMI B;  4MVZ A;  3CC4 V;  2GSM B;  2OCC C;  1RPO A;  5B3S B;  5L3B A;  3CPW U;  2HVJ C;  2IW5 A;  4MTG A;  3F7V C;  2Y69 B;  3FYI B;  3JD0 A;  1S76 D;  4RAI A;  2EIL B;  3B8M A;  3RBZ A;  1XL4 A;  1R3L C;  3BY6 A;  2WLI B;  2XAJ A;  3K03 A;  3K04 A;  5FL7 G;  4RQE A;  2IJK A;  3P30 A;  5LHH A;  3ZRV A;  1CP9 A;  1XL6 A;  3JYC A;  2WWW A;  4UVB A;  1YJN V;  1K33 A;  2W0F C;  2EIN C;  3ABM B;  5CA3 A;  2OTJ V;  3P32 A;  1CPY A;  3R65 A;  2WSS G;  3T2M A;  2DW4 A;  3MHH C;  1K9M W;  3RW0 A;  3TCU A;  4QPJ A;  2A0L A;  4WFF A;  3OEH G;  2D3O W;  2QA4 V;  5LBQ A;  1Q81 W;  1FXH A;  4MVU A;  4P30 A;  1H38 A;  3CCE V;  4BIU A;  5LHG A;  1YJW V;  1H2G A;  1GM7 A;  3ZMZ A;  5IDJ A;  2Q67 A;  1OCC B;  1K4D C;  2Y69 C;  3IFX A;  1JJ2 U;  1YTF D;  3CMA V;  5EBW C;  2CK3 G;  1KQS U;  3W7T A;  3E86 A;  5B1O A;  2WLN A;  1S77 D;  3EFF K;  4H37 A;  3W7W A;  2YSU B;  4OXS A;  3QO8 A;  1AI7 A;  3K79 A;  3E8G A;  4P2Z A;  3CCR V;  3OFN G;  1AI5 A;  1MSW D;  1EFR G;  3WG7 B;  3IC7 A;  4R6Z A;  2GHY A;  1P4R A;  5C93 A;  3A0R A;  1R3J C;  1V54 B;  1FXK A;  4ZBM A;  2Z5U A;  1PD3 A;  2NLJ C;  2HR3 A;  2W6J G;  3ZCC A;  4WF9 V;  1G8M A;  1GMG A;  3SYO A;  5IYC O;  1VQL V;  4PA7 A;  3ZMU A;  3SPH A;  1LNQ A;  5DM6 V;  1YSC A;  1NVP B;  4J9Y B;  3JD3 A;  2XOK G;  1H8E G;  1M56 B;  5KUM A;  3D36 A;  4QIW F;  4PEL A;  3CCQ V;  4PA6 A;  2P67 A;  1K4C C;  3JD1 A;  3STL C;  1OCC C;  3K0G A;  4N23 A;  1VQN V;  3I55 V;  1OCR B;  2EIK B;  5H6Q A;  3CC7 V;  1BL8 A;  3SPJ A;  5L3G A;  1V55 B;  4WFG A;  2HG5 C;  2PI5 A;  1COW G;  2B1I A;  5EBM C;  1ARO P;  4LC1 A;  1MG1 A;  2OT5 A;  3LSS A;  3OAA G;  2JIZ G;  3LNM B;  3QO7 A;  1AJP A;  3ABU A;  4ASU G;  4I9W A;  2X7R B;  1N8R W;  5LHI A;  2LFS A;  3SJQ C;  4GX2 A;  3CME V;  2HFE C;  2K1E A;  1QLN A;  1PL0 A;  4X89 A;  3SPC A;  2X6C A;  1F51 A;  1QVF U;  1NBM G;  2ZDI C;  5HFL A;  2QTO A;  4UXN A;  2JEX A;  4RUF A;  1GM9 A;  3BEH A;  3HPL C;  4GX1 A;  4XDK A;  1EZJ A;  1NH2 B;  1Q86 W;  1OZ0 A;  2EIJ B;  2Q69 A;  1M56 C;  1MAB G;  4UV8 A;  4BIZ A;  4MVO A;  2XND G;  3AG3 B;  4P9P A;  1K34 A;  1KKD A;  5KA6 A;  1Q7Y W;  5CBF A;  3F5W C;  1OCR C;  4JAU A;  2DQ0 A;  3MHS C;  2EIN B;  1IXM A;  4LCU C;  1S72 V;  1G4Y B;  3OGC C;  3E8B A;  2XAQ A;  3K9A A;  3CD6 V;  2ZQM A;  4PDM A;  2YEV A;  4GX0 A;  1H8H G;  1K97 A;  4CZZ A;  4PDV A;  4MVR A;  3ZRW A;  4RUE A;  2IJI A;  3LUT B;  1K92 A;  5CMU A;  3RVY A;  4CBC A;  4JAV A;  1E79 G;  3CXC U;  4XBF A;  2P7T C;  1JPX A;  4WFB V;  4WCE V;  3SPI A;  2QEX V;  2EIJ C;  2JJ2 G;  3OR7 C;  3AG3 C;  3G4S V;  2WLL A;  2HVK C;  2Z3Y A;  3NXS A;  1JX9 A;  2QM7 A;  4KFM A;  1VQ6 V;  4X8A A;  2R9R B;  4R7C A;  4GX5 A;  3E35 A;  1UJW B;  4WFH A;  3AG1 B;  3ABK B;  2DWE C;  1W0J G;  2X6B A;  1FXK B;  1AI4 A;  4MVS A;  4MW8 A;  5DN6 G;  2B1G A;  4Q20 A;  3HB3 B;  3E2E A;  1AJQ A;  3JD4 A;  1ZWI C;  1FXV A;  2IU0 A;  2JDI G;  3K0D A;  4PDL A;  5CN0 A;  3D3I A;  2ITD C;  5LGT A;  4DXW A;  3OEE G;  5B1B C;  4P9O A;  5BZB A;  3FB8 C;  1K7D A;  1NVP D;  1THZ A;  5KUK A;  3ASO C;  4F4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...