4G2KA

Crystal structure of the marburg virus gp2 ectodomain in its post-fusion conformation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
110
structure length
110
Chain Sequence
MKQIEDKIEEILSKIYHIENEIARIKKLIGNLVSRLRRLANQTAKSLELLLRVTTEERTFSLINRHAIDFLLTRWGGTCKVLGPDCSIGIEDLSRNISEQIDQIKKDEQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General control protein GCN4, Envelope glycoprotein GP2 chim
publication title Crystal Structure of the Marburg Virus GP2 Core Domain in Its Postfusion Conformation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Viral protein
total genus 50
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g2kA00
2OT5A 3CP1A 4FK5C 4FJCC 4JF3A 1Y66A 3GWOA 2EZPA 3P30A 2P6JA 3K9AA 1QR8A 2X7RB 1K34A 1K33A 3H01A 1ENVA 2MK3A 1DF4A 1DF5A 3B8NA 4N23A 1F23A 5H9CA 2EBOA 1MOFA 5CN0A 1JPXA 4JGSA 4FIPC 5CMUA 5HFMA 3B8MA 4E2LA 2LP7A 4N21A 4JPRA 1Y4MA 3MHHC 3WFVA 2EZOA 3CYOA 1DLBA 2M7WA 5KA5A 1I5XA 1I5YA 3M99B 1SZTA 3B77A 1QCEA 3MHSC 1QBZA 1QR9A 4G2KA 1EBOA 5HFLA 1MG1A 5KA6A 1JQ0A
chains in the Genus database with same CATH superfamily
2UXDO 3ZRSA 4MVQA 1KQSU 4O4HA 2UXCB 4FMTA 1OCOC 5L3CA 4YIPA 1S5JA 3GWKC 5LHHA 2UUAB 3CB2A 2LQTA 1VQPV 2JS3A 3B77A 4P30A 4JI4O 1XREA 2OCCB 5D5PA 1BQ0A 1W0JG 4JI8O 1SQFA 4LF6B 3U10A 2MK3A 2C2AA 3C3TA 2R70A 1JJ2U 1VQ7V 4DV0B 2AZ2A 3OTOO 3CMAV 1AROP 2DE0X 3A0RA 4DR2B 3T1HO 1Q7YW 1CXZB 4TOIA 1QBZA 5L3FA 4TQFA 2ILMA 3SPGA 5FPOA 1WA8B 3ASOB 3P30A 1ZX3A 3W7TA 4DV6B 2PI4A 1P49A 4NXMO 3OMIB 5ITZA 2QWNB 3K5NA 2ADQB 4GZRB 4X62O 3JATA 5BY1A 2HP8A 3BABA 1KC8W 1N36O 1SZTA 3D8CA 3QF7A 2KG7A 3K59A 3JAKB 1FKAO 4DV5B 3D3QA 1HNXO 2OTJV 1IBLO 2A06H 5LGNA 1OCCC 1AJNA 1GRJA 3DXRA 5CMUA 4NB5A 4E2LA 4DV3B 1PKXA 1G6UA 4CC5A 5C93A 1P84F 4UXNA 5JJJB 4OGQB 2OCHA 1IBMO 3ZS8C 4I4TB 3RYCB 1TVKB 1HR0O 3ZN0A 3TK1A 2HKOA 2DYRC 1SRYA 1QVFU 1FJGO 3ABMB 2G38A 5LMUB 2XASA 3J7AU 4DRXA 3OEEG 1H2GA 1DLBA 4ZI7A 5LP6A 3N27A 4X65B 1WB7A 4ASUG 4IT5A 1NTZH 4MTGA 3RGBA 3FD9A 4UCSA 2YI8A 1K8AW 3RYFB 3W7XA 3RYHB 1DF5A 3ETQA 1TUBA 3I55V 3F7YC 1U97A 2P67A 1AI6A 4O2AA 5B1AB 2D3OW 3SPIA 5A9GA 2L35A 1Y67A 5LBQA 2OTLV 3FB6C 5IYCO 4NKGB 5EBWC 3GWOA 2P6JA 2Q4PA 5BZBA 4LNUB 5KX5A 2UUCO 5JH7A 1KKDA 1AVMA 2OCCC 1F7YA 1XMQB 2Y4TA 3HKCA 4B08A 4JTDB 2OIGA 1YXBA 1N33B 3BHPA 3N2KB 1CPYA 3PJSK 5LHIA 1FXVA 1SKVA 3ZHRA 4GKJB 1NTMH 1T5EA 5LXTA 3JD1A 1Y76A 1EZVH 2UXDB 4DR4B 1R3JC 2IH3C 1DGSA 3BFRA 3ABLB 3ASOC 1Y4MA 1YI2V 2QSAA 4DYLA 2HG5C 1CEZA 2FB5A 3G6EV 3DTUB 2R9IA 2B1IA 3OMAB 2M6YA 1S77D 4DR1O 2CH7B 5KMGB 3VQWA 4PDLA 3JD3A 1FFXA 1K5QA 5CA1B 4JI8B 4PELA 1S72V 2XAQA 4WFGA 3ZMSA 2F93B 2DW4A 4LFCO 4IL6Z 3LNNA 3OTOB 2LGWA 3G6BA 1JCHA 1G4YB 1JVMA 4P9OA 5KUMA 4DR3B 4LH7A 4O4LB 4AI8A 2QE7G 3ZN1A 3HPLC 2ZCEA 5LOVA 1XDCA 4NXMB 1Y74B 5IE9A 1NZ6A 4X62B 2YICA 3UQ8A 2EIMB 5KAIZ 3WB2A 3OW2U 5CBFA 4FIPC 4ZOLB 1HNXB 5EZYB 4ZHQA 3CE2A 5L3GA 1GK9A 3ZEDA 4B3SO 3ZX6A 4FPPA 1OCRB 2QKSA 3UO2A 1FFTB 4HBNA 3SYPA 1XBLA 5B1AC 1IURA 4WFEA 4P2ZA 2HHHO 1IBMB 2N74A 1JPXA 3FFQA 3T1YB 2N04A 1HR0B 4JI3B 4YY3B 2CTPA 1VIBA 3CCMV 4FLUA 1IXBA 1SZXA 2MW2B 2M7WA 1FJGB 1S5LZ 2GBOA 3CMEV 2A3QA 3AG3C 1QCEA 3ZHTA 2F95B 4DV1O 4EB6B 2GUZB 1BMFG 4MW3A 4YXWG 1FD9A 5EBLC 2PUSA 2YIAA 2FKXA 5FPRA 5C8YA 5KHGA 4W4KA 3VOUA 3WG7B 3CX5F 3AG2B 3HKDA 2X6CA 1UJWB 3K5OA 4I55A 5L3BA 1IZ3A 4UCUA 3HR0A 2QTSA 4IYIA 1SETA 1YHQV 2NN4A 3GVMA 4EEQA 4DV4O 3ABLC 1ORQC 5CBHA 3SYAA 2GTSA 3LUTB 5LYJA 2ODMA 3JAWB 4JI6B 3K57A 3JD4A 3JALB 4LF9B 2F1MA 3MDSA 1WAZA 2BE3A 1THZA 3H1KH 3RVYA 2UUCB 1K5SA 5LHGA 4DR6O 1AJPA 4BW9A 3P3NA 2RMKB 4ICGA 2YEVB 1H2NA 2WLLA 5B3SB 1AI4A 1VQ4V 1Z5WA 3LDDA 4FZ1A 3OFNG 3JD0A 2HVJC 3L75H 4PHZA 4NR1A 3SJAC 2DMXA 4WBNB 2AW9A 1S5HC 3EXAA 1D5AA 4MTXA 4GKKO 1R3KC 3QO5A 3KKYA 3G80A 3K58A 4I0XB 1O9HA 3SDLA 4BWAA 3O9OA 4FZ0A 3KCYA 4YJ2A 1JX9A 5J2TA 1SF9A 3BA9A 1Q43A 1B3QA 3G71V 4JZ2A 1F23A 2LO1A 4QPJA 2Y0IA 5CBGA 4JYAO 1GN6A 3D36C 1M57C 2EIMC 1M1KW 4MW8A 1NKDA 5CA3A 1V55B 1YJWV 1XMOO 1EBOA 1HNZO 2NNUA 4LFCB 1NS1A 4PV1B 3U11A 4FFBB 5FNVA 1NH2D 1RP3B 1BSMA 4X89A 2Q0AA 2LP7A 3CHXA 1EN5A 1G8MA 1B6QA 1TUEB 4RWUA 4X64O 3ZCCA 2RN9A 2AHYA 3N2GA 4DR5O 1CP9A 3UO3A 2AHZA 1YJNV 2ZIOA 4A5UB 1BZKA 2GTAA 1H2SB 4B7EA 1K34A 2LW7A 2ZE7A 1GM9A 4PI0A 2ZE6A 2ZR3A 4QNHB 1KB9F 3SPCA 1WN7A 3OUSA 2JK5C 3L73H 2FYUH 1OV9A 4X1IB 2W0FC 1I5XA 3BA8A 2BSKB 1KU9A 4FLVA 1TA8A 5TISZ 1TGOA 3AG2C 4UCOA 4B3SB 3E83A 2QM7A 1EN6A 3E8BA 3EFFK 5LGTA 1HDJA 5IJ0B 1J5EO 3OE7G 2WPDG 2HHHB 1I94O 1YIJV 1AI5A 4CC6A 1I5YA 3LSSA 4H37A 1OCCB 1GM8A 5HFLA 3FYEB 1MNGA 5IYBO 3AG4B 4IIJB 1L1FA 4DV1B 1XUQA 2XAFA 1N34O 3ZRWB 1SQPH 2QKCA 4CH5A 2IJHA 3CJHB 2JIZG 4LFBO 5EBMC 1AR5A 3E89A 3Q4HB 5LP6C 2PTMA 2ZNJA 2P7TC 3H1JH 5KA5A 3CXHF 3CS5A 2FL4A 4J41A 1ZAUA 2RNBA 4MVUA 2DYRB 4J10A 4J11A 5IDJA 4FLXA 3KZIZ 2RJZA 4UB8Z 2DWEC 2P22C 1XL4A 1XHXA 4KHPO 4KP4A 1K73W 1GN2A 3OGCC 1P7GA 3ABUA 2XUMA 1L0NH 1D5NA 4CS2A 1HNWO 4XDKA 1AR4A 1ZL8A 1Q3EA 4PJ0Z 5E1AC 1DK1A 4TV9A 2GDSA 1JR9A 2CK3G 2W6IG 1ZUQA 4O4IB 4NXNB 1US6A 3TCUA 5DN6G 4AHCA 2Q5ZA 3CC7V 2B1GA 2YDEA 4X1KB 2DQ3A 4D7SA 2UUBO 2JJ2G 2IJJA 1V55C 4K8ZA 2Q67A 4ZBMA 1HW7A 1XOUA 4JYBA 4GKKB 3WB0A 3CC2V 3ETDA 3ML0A 5L3DA 4JAAA 1AI7A 4U7OA 3OTFA 1M56B 4X20B 2QTOA 4DV2O 4MVZA 4OPHA 2ZKOA 1PNKA 1Y74A 1SQQH 5L3EA 4B3RB 1NTKH 2ZT9B 4BAYA 1Q6HA 4HAMA 5JQGB 2F66C 1PM9A 3M8AA 4LP8A 4U7NA 4PA9A 2XAJA 4LF4B 2Q68A 4I50B 1SESA 4JYAB 4J7ZA 2ZXWC 4EFBA 2A0LA 3ZHQA 4D7TA 1HP8A 4LF8O 1XMOB 1KD1W 2EIJB 2ZQMA 3JASB 3R66A 2WLHA 2YXYA 1RSOB 4C7UA 4RUEA 4MVRA 2GV9A 2YS8A 4X9QA 3RT3C 2LFSA 2JGDA 5LGUA 2BTQA 4OX9O 2UXXA 1JQ0A 4X64B 2YIBA 2F4VO 3ZHVA 4UCVA 3E86A 3AG4C 4D6TH 2K9PA 1KUQA 1EZJA 1NVPD 3CP1A 1Y66A 4CZZA 5DM6V 2VWJA 4JI5B 5JVDA 3RW0A 3HKBA 4YHHO 4KXRA 1NVPB 3IC9A 2HFEC 1XQ8A 3ZRXA 1MA1A 1J95A 3DC6A 3HKEA 4H44B 4IHJB 1N0JA 3LDEA 3JAWA 4HNAB 2ATKC 1J5EB 5J2UA 1K92A 3CCJV 5KA6A 2ADPA 2QM8A 1NBMG 3VQYA 4U3JA 2Q7HA 3K0DA 1Q81W 5KHHA 4LWSA 5CB4B 1OJHA 4WFFA 4GX2A 1SS3A 2YXLA 2WA4A 2UXBO 2YSUB 2YUAA 1TAEA 3MHSC 4LFBB 1VF7A 3P3PA 4F6RA 4DUZO 4AQYB 3ABKB 4JZGA 1PP9H 1VMGA 4PA7A 5KHIA 3AG3B 3C90A 1GTOA 4GUNA 4YIOA 1M56C 3CWBH 4RQEA 4O4JB 3D3IA 3SGIA 1X4TA 1IX9A 3CRMA 4Z1VA 1NR1A 1HNWB 2VQEO 4EKWA 3ZJZA 4UVBA 1NT2B 3JCUZ 1FXKB 3UT5B 4BIUA 1Q5OA 1U96A 5EYPA 1RPRA 3BRCA 2P06A 1SQXH 4PA4A 2ZNIA 2R9RB 5BMVB 3VQXA 1SA0B 3LNMB 5LMNO 2UUBB 3A0HZ 3FB5C 3VBBA 1XNRO 2EIJC 3JYCA 1KMIZ 2FMLA 4EFEA 4J7JA 4TV8A 4YJ3B 4H0LB 1R3IC 2JJ1G 2B9ZA 5K1XA 3JARB 2VS0A 5GONA 3M7MX 1RM1C 1AP5A 3OEHG 4JI4B 4KL1A 4UB6Z 1COWG 4DV2B 2CE4A 1L0LH 2HJFC 3ICXA 2JEXA 2P4KA 4NTWA 3CYOA 1S76D 3FAVB 4TT3G 1O9GA 5CA0A 2QKAA 2QWRB 5LA6A 2WA3A 5H5NA 1AILA 4X1YB 1HWYA 4LF5O 4O2BA 1ZLZA 5IYZB 3T1HB 3BAAA 2V7QG 2UXNA 2L6LA 2WLIA 3CPWU 4TUYA 4JGSA 3C3SA 2W6JG 1QQCA 4O4HB 5EIBD 4LFAO 2RQ6A 1Q8IA 2LJ2A 3S3WA 2BOBC 4I9QA 3AEIA 1KECA 4X8AA 4JTCB 1OCZB 3AG1C 1N36B 1K33A 4B3TO 1M57B 2JS5A 5JCOC 1VEWA 4OX9B 1PV0A 1K7DA 3CCRV 1Q82W 4RO2A 2P4VA 5B1BC 3RBZA 3CRRA 2F4VB 4XDLA 1IBLB 4G27B 1W59A 2IM9A 3QO8A 2HEPA 2QJ1A 3STLC 4FM1A 3CCEV 2BCCH 1QLEB 1MG1A 1VF5B 3B40A 3FX7A 1QR8A 4PDRA 2QWOB 3B8NA 1MSDA 4XDJA 3BVOA 1QU7A 4PDVA 2XT9A 2CUGA 3L71H 4YHHB 3JSLA 4GX0A 1Z2GA 3ABKC 4GX5A 2JGUA 5ITZB 3A0BZ 2Q7EA 1M4UA 1QR9A 5IJ9A 1GAXA 1URFA 3JATB 1BQZA 3E22A 3ABTA 1VQMV 4MS2A 4KUMA 2YIBD 3APOA 2KG7B 3L70H 1AP6A 1BL8A 1FXKC 3BEHA 1W2BU 2YXHA 1E1QG 3DXRB 1VQ8V 2D2CB 4LBEC 4B7KA 3TXQA 1YTFD 1Y6XA 4MVSA 1DF4A 2V4DA 3CRAA 1PPJH 4DW0A 4DUZB 1YTFB 1BGYH 4OXSA 4H13B 1GH6A 5BR8O 3CRQA 4N21A 1K4DC 2CAZC 3FB8C 4K0KO 3FYIB 1PNLA 2H3OA 2JEUA 4DRXB 1UPGA 1IXMA 4JI0O 4ZI7B 5LP6B 3IC7A 4GYCB 3TXSA 4UV9A 1UFIA 4R6ZA 3L74H 5KHJA 3AK1A 2XAGA 4Q20A 1QHTA 2F23A 1WA8A 3AK2A 2JDIG 3SJCC 4TSFG 1TUBB 2B5UA 2CTQA 4XBFA 2QWQB 3OGIB 3G4SV 3BPZA 4FLTA 4O2AB 2K1EA 1VARA 2H94A 4P9PA 3B2EE 2QGNA 5EIBC 4GCZA 4DR1B 3JAKA 3W7WA 2EINB 5DECA 1OCZC 4QE9A 4FVMA 5KX5B 2UU9O 5JH7B 2E74B 4WFAV 2X6AA 1RPOA 4QGPA 2RDCA 2JVDA 1VQNV 3APQA 5IT9N 3HKCB 4UV8A 3ZMVA 4DR2O 3F7VC 3J80N 3F5WC 1QLEC 4Z2WA 3E8GA 3AG7A 1K9MW 1VF6A 3JD2A 3PN1A 4I4TA 3K5MA 3RYCA 1NH2B 1TVKA 5LXTB 4RUFA 3DC5A 1K97A 1V54C 1Y76B 2WLJA 4WCEV 4DV6O 3SYQA 1BS3A 2O57A 5DEDA 1IBKO 4R8CA 2E75B 4W4LA 2ZDIA 3SR2C 1QVGU 2EBOA 2LFRA 2ZXWB 4B3TB 3CRCA 3MD0A 3ZMUA 3ZMTA 1QLNA 3RYFA 2A9HA 2P90A 3RYHA 1FFXB 5BXZA 1N4CA 4I5SA 4CS3A 5LL6Y 2R9AA 3FKSG 1JA8A 3WU2Z 3UCSC 4BIOA 3A8TA 4B3MO 1N8RW 1XL6A 2Z3YA 4F4LA 4K8XA 1B06A 3SPJA 3LDCA 3CCUV 2P5OA 4QIWF 1EN4A 1F4MA 4MVMA 2Z0AA 1A32A 4LNUA 1VQKV 1GKFA 3LSUA 1NU1H 5LOVB 3OUFA 2EILC 2Y69C 3K9AA 3B4SA 2Q8VA 5LMUO 4J7KA 3RVZA 5JJNB 3RYIB 1AB3A 1JFFB 3N2KA 4ZIBA 4AILC 4LF7O 2QA4V 3CD6V 4GLXA 4DR7O 1OZ0A 3SYCA 3E2EA 1WNSA 4ZHQB 1R6KA 3IJ4A 4JYCA 2QEXV 1ENVA 3ASNC 4Q6GA 4DV4B 1MABG 2W0XA 5H2FZ 3FB7C 2ZD9A 4Z1MG 2ITDC 3X2QB 4LC1A 2NR5A 3BY6A 2CH7A 5KMGA 2VQFO 1VQ9V 3MAQA 4J80A 1I08A 2PGGA 3ZBHA 3K9SA 2X6BA 1JOYA 3H1HH 5CA1A 5FL7G 2EINC 2OT5A 3F5TA 4DR6B 2QDOA 1XMQO 1H2MA 5CN0A 4FM0A 4QPKA 4GT1A 1PL4A 3CCQV 4JI0B 1D2DA 5B5EZ 4JV5O 5C8YB 3K3WA 1GM7A 1H2KA 4O4LA 3CSXA 3HKDB 1AJQA 4DR4O 4ZKIA 4I55B 1SQVH 4JASA 3OAAG 1FXHA 2KSDA 4JI2O 3IGAC 1I0HA 1E1RG 3T2MA 5LYJB 3CXCU 3D36A 2ITCC 1H8EG 1R6TA 3O65A 2XAHA 1KKCA 4ZOLA 1VP7A 2UU9B 5EZYA 1N32O 4CH6A 2YI9A 1HNZB 2WLLB 1MZEA 4NTYA 1RM1B 4G28B 1LNQA 4DR3O 2HVKC 1LUVA 1Q6IA 1WPXA 3IAYA 2Y48A 4J9YB 4DR5B 4TQDA 4YJ2B 5KAFZ 5J2TB 2OYQA 1IBKB 1R3LC 4EB6A 2GUZA 3OR7C 1MSWD 4NTXA 1XILA 1YDXA 2E3CA 3T4ZA 5A2QN 4MTOA 4HYOA 1P7BA 3H9VA 3H1LH 3RN4A 1ROPA 3JCZA 4JYYA 1K4CC 2EX3A 4X66O 1MZFA 5GTIZ 2ETNA 5B1OA 4UFZA 1YSCA 2ZINA 5HFMA 3B8MA 4X88A 4L8JA 1BHBA 3LSQA 4MTFA 5FNVB 3AG1B 4DUYO 1VQOV 2E5LO 4B3MB 1Z5VA 1G1XB 4J42A 4KFMA 1BE3H 2DYSC 3DGEA 3JALA 1L8DA 2R72A 5B1NA 4CBCA 3L72H 3X2QC 3T1YO 1I94B 2NLJC 1FS0G 5B1BB 4JI7O 4JI3O 1R1BA 4YY3O 2IH1C 3N2GB 3K5LA 2KB1A 2YEVA 2PZSA 4DK1A 1WPBA 1N34B 4WBNA 1XNQO 1I7FA 2Y4UA 4LF7B 4FLWA 4LH6A 4PD4F 3U0ZA 3KG2A 2YC0A 4I0XA 4DR7B 3I5DA 3TGUH 5IYDO 4JAUA 3NXSA 4UUJC 2XTAA 5EC1C 3QTCA 2VRZA 4JPRA 4KHPB 3WFVA 3QVNA 1P4RA 4PA3A 1MMMA 4JI6O 2VQFB 4F6EA 1F51A 1F4NA 4LF9O 4JF3A 1GO3F 1S3JA 4IGGA 2CTWA 3I56V 3CC4V 4N23A 1MOFA 2GSMB 2ZM6O 2IJIA 2HR3A 3P32A 2DQ0A 3G67A 3T4DA 4FFBA 1VQLV 4UVCA 5H6QA 4G2KA 1VQ5V 4JV5B 3H01A 4NYKA 1Q6UA 2AZ0A 4WFHA 2RCVA 4JI2B 4TWKA 2Q0OC 3RFRA 4JTAB 3MHHC 4PDMA 2KKWA 4R7CA 4ABMA 3ETEA 4K35A 4BR6A 2WLMA 4RQFA 1ZL8B 3SPHA 3ZRVA 3QG5A 2HJDA 2V1DA 2EZPA 3EVKA 1YF2A 4TV9B 3HB3B 4X1IA 1SERA 2FTKA 1E79G 4R50A 1LUWA 1SC5B 2WLNA 1N32B 1BCCH 2BSKA 4FLZA 2PF4E 1M5IA 4LF8B 4FLYA 1NR7A 1YVWA 2Q6AA 1JJOA 4HZ3A 4MT8A 2JRIA 1WP8A 4H33A 1W0KG 4DO2A 5KHKA 5IJ0A 2CGNA 2ZE8A 3K79A 3NR7A 3KCXA 2WWWA 1Q90D 3ZHUA 1GN4A 1VF6C 1PD3A 5IY5B 3L9DA 1YCIA 3W7UA 4IIJA 5KLVH 1NQTA 3A2FA 2A7WA 3ABMC 3RYIA 3ZRWA 1ZWIC 1JFFA 1Q86W 1B04A 3H1IH 4FJCC 3CJHA 4JI1O 2ZDIC 3SYOA 2Y0PA 3Q4HA 1KYOF 2YIDA 2EULA 1V54B 3QO7A 1OHHG 4X66B 4WFBV 1EM1A 1WLEA 4OPAA 2A79B 4MSWC 3CCVV 2EZOA 3OM3B 1M90W 1YZBA 2GHYA 4LR3A 1ZSPA 3THOA 1SQBH 4DUYB 2E5LB 3JAMN 3OMNB 1YEWA 2JGDB 2IJKA 2BTQB 4GX1A 5JWPA 3CCLV 4JI7B 4O4IA 5JJEB 4X1KA 2PYLA 2DJVA 5AG2A 3ZHSA 4NVPA 2BOCC 1KP3A 3IFXA 1XNQB 2UXBB 1M9NA 2DN9A 3ZMZA 5GW7A 2N05A 3UM7A 3ZIAG 4DV7O 1QNMA 4X20A 4LCUC 5JVDB 2E76B 3HKBB 2EILB 2Y69B 3STZC 2EJ7A 2XNDG 3EHBB 1NI8A 3VQVA 4I9WA 5KUKA 1H8HG 3HKEB 4E4EA 5JQGA 2ZR2A 1KP2A 2VQEB 1NJIW 3SJBC 5IWAO 2AXTZ 5J2UB 4I50A 4L87A 1YJ9V 3K06A 3CEIA 1BT8A 3OD4A 4NXNO 3TJTA 4MVOA 4CH3A 4U3JB 2ZM6B 3TETA 1WB8A 2IU0A 1WP7A 3M99B 3JASA 5LMNB 4LWSB 3ASNB 2UXCO 3B09A 1X59A 1RSOA 2PY5A 1EFRG 4FK5C 1XNRB 1AR1B 5FLXN 4K3AA 1JMKC 3J81N 2UUAO 3W7SA 2ARHA 4DXWA 2EIKB 2LGQA 4F6RB 1WJZA 1BHAA 1N0NA 5B66Z 3K03A 4LF6O 1FYJA 2PI5A 5IY5C 4B3RO 4QE7A 2Q73A 1DTOA 4DV0O 1PNMA 4LF5B 4LF4O 4QJFB 4J9ZB 5F2VO 3K0GA 5EYPB 3CCSV 2AGAA 5GTHZ 2ZIMA 1OCOB 2HLDG 4RAIA 5D5QA 1FPOA 1V9PA 3ETGA 4UVAA 4CH4A 1FAFA 4LFAB 3UKMA 1R6NA 1GMGA 2X7RB 1KBHA 4IHJA 1OCRC 5JCOA 4CS4A 4HNAA 4TV8B 3K04A 1XHZA 1SQGA 5GONB 4IYHA 4DV5O 1ZTEA 2Z5UA 4JAVA 1YITV 5CB4A 2WAMA 2ZE5A 4PI2A 3E8HA 4FM2A 4DV3O 5EC2C 5H9CA 5CA0B 2WSSG 5LA6B 4UCRA 3S3XA 4JI1B 3K08A 2DWDC 3R65A 4O2BB 2KQXA 5K1PA 3GB7C 3BCCH 2WLIB 3JSNA 4TUYB 2PYJA 4JI5O 4BIZA 5H6RA 2H8PC 3WG7C 1VQ6V 3DSQA 5EK0A 3SJQC 4O4JA 4U3FH 1M93A 4DW1A 3QNEA 2OIEA 4DK0A 2CDYA 4FFKA 1IDSA 2BTOA 4X65O 2Q9LA 3UT5A 1FXKA 2VWKA 3OR6C 2DOSA 1XEQA 1H2LA 5BMVA 2EJRA 1PL0A 2WLKA 1RFYA 1SA0A 2LW1A 4PA6A 3WB1A 1S0VA 5B3SC 4BW5A 2DYSB 2IU3A 5J9PC 1IVSA 4YJ3A 1GN3A 4AQYO 3JARA 4I7ZB 2IW5A 5BR8B 2EIKC 2QWPB 3E35A 4DV7B 2F43G 2CTRA 3AK3A 4WF9V 4K0KB 4UCTA 2Q69A 2Q7GA 1XI1A 3E8FA 2QM4A 3RWRD 2X0LA 2CGOA 3FAVA 1H38A 2XHBA 5IJ9B 3T1CA 4X1YA 3OT7A 3E22B 2IBZH 5E79Z 1N33O 5IWAB 5IYZA 2QR4A 4GKJO 1R73A 2OWOA 2XOKG 1K3EA 1LR1A
chains in the Genus database with same CATH topology
3KG2A 3ZRSA 4MVQA 1KQSU 1QR8A 4PDRA 3B8NA 4FMTA 1OCOC 1NH2D 5IYDO 4XDJA 4JAUA 5L3CA 3NXSA 4UUJC 4X89A 4PDVA 2LP7A 5EC1C 5LHHA 4JPRA 1G8MA 4GX0A 3ABKC 1B6QA 1TUEB 3WFVA 1P4RA 3ZCCA 2AHYA 1VQPV 4GX5A 1CP9A 3B77A 4PA3A 1QR9A 2AHZA 1YJNV 4P30A 1F51A 1F4NA 2OCCB 4JF3A 1W0JG 1GO3F 1S3JA 3ABTA 3I56V 4MS2A 1VQMV 1K34A 3CC4V 4KUMA 1GM9A 2MK3A 4N23A 2C2AA 1MOFA 2GSMB 2ZR3A 4QNHB 1JJ2U 1VQ7V 1BL8A 1FXKC 3SPCA 2IJIA 2HR3A 3CMAV 3OUSA 2JK5C 3P32A 2DQ0A 3BEHA 1W2BU 1AROP 3A0RA 2W0FC 3T4DA 1E1QG 1I5XA 1VQLV 4UVCA 1Q7YW 5H6QA 1QBZA 5L3FA 4G2KA 1VQ5V 3SPGA 1VQ8V 3AG2C 4LBEC 3ASOB 3E83A 2QM7A 3P30A 1YTFD 3H01A 3E8BA 4MVSA 3EFFK 1DF4A 5LGTA 3W7TA 2PI4A 1YTFB 4OXSA 3OMIB 4N21A 4WFHA 4TWKA 1K4DC 3OE7G 2WPDG 4JTAB 3MHHC 4PDMA 4R7CA 3FB8C 1YIJV 3ETEA 3FYIB 1AI5A 2WLMA 1KC8W 1I5YA 3LSSA 1SZTA 4H37A 1OCCB 1GM8A 1PNLA 4RQFA 5HFLA 3FYEB 3SPHA 3ZRVA 2JEUA 2V1DA 5IYBO 2EZPA 3AG4B 1L1FA 2OTJV 1IXMA 3HB3B 5LGNA 1SERA 2FTKA 1E79G 1AJNA 1OCCC 3IC7A 4R50A 2XAFA 3ZRWB 5CMUA 2WLNA 4UV9A 4E2LA 4R6ZA 2IJHA 2XAGA 4Q20A 2JIZG 1PKXA 5EBMC 1NR7A 3E89A 2JDIG 2Q6AA 5C93A 2P7TC 4HZ3A 4MT8A 4UXNA 5KA5A 4TSFG 2B5UA 4XBFA 4H33A 1W0KG 4DO2A 4MVUA 2DYRB 3G4SV 5IDJA 2DWEC 2K1EA 1XL4A 3ZN0A 2H94A 3K79A 4P9PA 2WWWA 4KP4A 1K73W 3TK1A 2HKOA 3OGCC 2DYRC 3ABUA 1SRYA 1QVFU 4GCZA 1PD3A 3ABMB 5IY5B 4XDKA 2XASA 3W7WA 2EINB 1OCZC 3W7UA 4QE9A 3OEEG 5E1AC 1H2GA 1DLBA 4WFAV 1NQTA 2CK3G 2X6AA 2W6IG 1RPOA 3ABMC 3ZRWA 1ZWIC 4ASUG 1Q86W 3TCUA 5DN6G 4MTGA 1VQNV 4FJCC 3CC7V 2B1GA 2ZDIC 3SYOA 1K8AW 2DQ3A 3W7XA 4UV8A 1DF5A 2JJ2G 3ZMVA 2IJJA 1V55C 1V54B 3QO7A 3I55V 3F7VC 3F7YC 3F5WC 1QLEC 1OHHG 2Q67A 3E8GA 4ZBMA 4WFBV 1K9MW 1WLEA 3JD2A 1NH2B 4JYBA 2P67A 1AI6A 2A79B 4RUFA 4MSWC 3CCVV 2EZOA 1K97A 3OM3B 1V54C 5B1AB 2WLJA 4WCEV 2D3OW 3SPIA 1M90W 3CC2V 2GHYA 3ETDA 3ML0A 5LBQA 5L3DA 2OTLV 3FB6C 1AI7A 4U7OA 3SYQA 5IYCO 1M56B 2QTOA 5EBWC 3GWOA 4MVZA 2P6JA 3OMNB 4R8CA 5BZBA 1PNKA 2ZDIA 5L3EA 2IJKA 1QVGU 2EBOA 4GX1A 3CCLV 1KKDA 4BAYA 2OCCC 4HAMA 2LFRA 2ZXWB 3MD0A 4LP8A 3ZMUA 4U7NA 4PA9A 3ZMTA 2XAJA 1QLNA 2A9HA 2P90A 4JTDB 2Q68A 1SESA 4I5SA 2ZXWC 1CPYA 3PJSK 2A0LA 2BOCC 5LHIA 1FXVA 3FKSG 1KP3A 3IFXA 1M9NA 3ZMZA 1KD1W 3JD1A 2EIJB 2ZQMA 2WLHA 1R3JC 2IH3C 5GW7A 1N8RW 1XL6A 2Z3YA 3UM7A 4F4LA 3ABLB 3ZIAG 3ASOC 1Y4MA 3LDCA 4RUEA 3SPJA 3CCUV 4MVRA 4LCUC 1F4MA 2HG5C 4MVMA 4QIWF 1YI2V 1CEZA 2EILB 2Y69B 3G6EV 3DTUB 3STZC 2R9IA 2LFSA 2XNDG 3EHBB 5LGUA 1VQKV 1GKFA 2B1IA 3OMAB 4I9WA 2UXXA 5KUKA 1JQ0A 1S77D 1H8HG 3OUFA 2EILC 2Y69C 2ZR2A 3K9AA 1KP2A 1NJIW 3RVZA 4PDLA 3JD3A 1K5QA 4L87A 1YJ9V 3K06A 4PELA 3E86A 3AG4C 1S72V 2XAQA 4MVOA 4WFGA 3ZMSA 2DW4A 2QA4V 3TETA 2IU0A 3CD6V 3M99B 1OZ0A 3ASNB 3SYCA 1EZJA 3E2EA 1EFRG 1NVPD 1JCHA 3CP1A 4FK5C 1R6KA 1Y66A 4CZZA 1AR1B 1G4YB 5DM6V 4JYCA 1JVMA 2QEXV 3RW0A 1ENVA 4P9OA 1NVPB 3ASNC 5KUMA 3W7SA 4DXWA 1MABG 2EIKB 2HFEC 3ZRXA 3FB7C 2ZD9A 4Z1MG 2QE7G 3ZN1A 1BHAA 3HPLC 2ITDC 3X2QB 1J95A 4LC1A 3BY6A 1VQ9V 3K03A 3LDEA 2ATKC 2X6BA 2PI5A 1JOYA 1K92A 5IY5C 3CCJV 5FL7G 5KA6A 2EINC 2OT5A 4QE7A 2QM8A 1NBMG 2EIMB 1DTOA 3K0DA 1PNMA 3OW2U 1Q81W 5CN0A 5CBFA 4FIPC 4QJFB 4QPKA 4J9ZB 4GT1A 4WFFA 3K0GA 3CCQV 5L3GA 4GX2A 1GK9A 3CCSV 1OCOB 2YSUB 2HLDG 3K3WA 4FPPA 4RAIA 1GM7A 1OCRB 3MHSC 3ETGA 2QKSA 4UVAA 1AJQA 4ZKIA 3UKMA 1FFTB 4JASA 1R6NA 3SYPA 3OAAG 1GMGA 3ABKB 1FXHA 2X7RB 5B1AC 4WFEA 3IGAC 4P2ZA 1OCRC 4PA7A 1JPXA 3AG3B 3T2MA 1E1RG 1GTOA 3K04A 1M56C 4RQEA 3D3IA 3CCMV 3CXCU 3D36A 1NR1A 1H8EG 2ITCC 2M7WA 3CMEV 3AG3C 1QCEA 4EKWA 2Z5UA 4JAVA 1YITV 3ZJZA 2XAHA 4UVBA 2WAMA 1BMFG 4MW3A 4BIUA 1FXKB 3E8HA 4YXWG 5EBLC 1RPRA 1EBOA 4PA4A 5EC2C 5H9CA 2WSSG 2R9RB 2WLLB 3K08A 2DWDC 3LNMB 3R65A 3VOUA 3WG7B 3GB7C 3AG2B 2X6CA 1UJWB 3FB5C 3VBBA 2EIJC 2WLIB 3JYCA 5L3BA 1RM1B 4G28B 4BIZA 5H6RA 1SETA 1YHQV 2H8PC 3WG7C 1VQ6V 1LNQA 2HVKC 3ABLC 1ORQC 1R3IC 2JJ1G 1WPXA 5EK0A 3SJQC 3SYAA 5CBHA 3LUTB 2Y48A 4J9YB 3QNEA 1RM1C 3OEHG 1COWG 3JD4A 1THZA 1R3LC 3OR7C 1FXKA 2HJFC 3OR6C 3RVYA 1MSWD 1K5SA 2JEXA 5LHGA 3T4ZA 1AJPA 3CYOA 1S76D 2YEVB 4MTOA 4TT3G 1P7BA 4HYOA 2EJRA 2WLLA 1PL0A 2WLKA 5B3SB 1HWYA 1AI4A 1VQ4V 3LDDA 1ROPA 3JCZA 3OFNG 1K4CC 3JD0A 2HVJC 4PA6A 1S0VA 2V7QG 2UXNA 2WLIA 5B1OA 3CPWU 1S5HC 5B3SC 1YSCA 4JGSA 4MTXA 5HFMA 3B8MA 4BW5A 4X88A 1R3KC 3QO5A 2DYSB 2IU3A 5J9PC 1BHBA 2W6JG 3LSQA 4MTFA 3AG1B 1VQOV 2IW5A 4KFMA 2EIKC 1JX9A 2DYSC 3E35A 2F43G 3DGEA 4CBCA 2BOBC 5B1NA 4WF9V 3X2QC 3AEIA 2NLJC 1FS0G 1KECA 5B1BB 4X8AA 2Q69A 4JTCB 1OCZB 3AG1C 3G71V 1K33A 1M57B 3E8FA 2IH1C 1F23A 1K7DA 2KB1A 2X0LA 1H38A 2YEVA 3CCRV 1Q82W 4RO2A 4QPJA 3T1CA 5B1BC 3RBZA 5CBGA 4XDLA 4G27B 1M57C 2EIMC 3QO8A 1M1KW 4MW8A 1NKDA 5CA3A 3STLC 1R73A 1V55B 1YJWV 3CCEV 2XOKG 1QLEB 1MG1A 1K3EA 2NNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OT5 A;  3CP1 A;  4FK5 C;  4FJC C;  4JF3 A;  1Y66 A;  3GWO A;  2EZP A;  3P30 A;  2P6J A;  3K9A A;  1QR8 A;  2X7R B;  1K34 A;  1K33 A;  3H01 A;  1ENV A;  2MK3 A;  1DF4 A;  1DF5 A;  3B8N A;  4N23 A;  1F23 A;  5H9C A;  2EBO A;  1MOF A;  5CN0 A;  1JPX A;  4JGS A;  4FIP C;  5CMU A;  5HFM A;  3B8M A;  4E2L A;  2LP7 A;  4N21 A;  4JPR A;  1Y4M A;  3MHH C;  3WFV A;  2EZO A;  3CYO A;  1DLB A;  2M7W A;  5KA5 A;  1I5X A;  1I5Y A;  3M99 B;  1SZT A;  3B77 A;  1QCE A;  3MHS C;  1QBZ A;  1QR9 A;  4G2K A;  1EBO A;  5HFL A;  1MG1 A;  5KA6 A;  1JQ0 A; 
#chains in the Genus database with same CATH topology
 2UXD O;  3ZRS A;  4MVQ A;  1KQS U;  4O4H A;  2UXC B;  4FMT A;  1OCO C;  5L3C A;  4YIP A;  1S5J A;  3GWK C;  5LHH A;  2UUA B;  3CB2 A;  2LQT A;  1VQP V;  2JS3 A;  3B77 A;  4P30 A;  4JI4 O;  1XRE A;  2OCC B;  5D5P A;  1BQ0 A;  1W0J G;  4JI8 O;  1SQF A;  4LF6 B;  3U10 A;  2MK3 A;  2C2A A;  3C3T A;  2R70 A;  1JJ2 U;  1VQ7 V;  4DV0 B;  2AZ2 A;  3OTO O;  3CMA V;  1ARO P;  2DE0 X;  3A0R A;  4DR2 B;  3T1H O;  1Q7Y W;  1CXZ B;  4TOI A;  1QBZ A;  5L3F A;  4TQF A;  2ILM A;  3SPG A;  5FPO A;  1WA8 B;  3ASO B;  3P30 A;  1ZX3 A;  3W7T A;  4DV6 B;  2PI4 A;  1P49 A;  4NXM O;  3OMI B;  5ITZ A;  2QWN B;  3K5N A;  2ADQ B;  4GZR B;  4X62 O;  3JAT A;  5BY1 A;  2HP8 A;  3BAB A;  1KC8 W;  1N36 O;  1SZT A;  3D8C A;  3QF7 A;  2KG7 A;  3K59 A;  3JAK B;  1FKA O;  4DV5 B;  3D3Q A;  1HNX O;  2OTJ V;  1IBL O;  2A06 H;  5LGN A;  1OCC C;  1AJN A;  1GRJ A;  3DXR A;  5CMU A;  4NB5 A;  4E2L A;  4DV3 B;  1PKX A;  1G6U A;  4CC5 A;  5C93 A;  1P84 F;  4UXN A;  5JJJ B;  4OGQ B;  2OCH A;  1IBM O;  3ZS8 C;  4I4T B;  3RYC B;  1TVK B;  1HR0 O;  3ZN0 A;  3TK1 A;  2HKO A;  2DYR C;  1SRY A;  1QVF U;  1FJG O;  3ABM B;  2G38 A;  5LMU B;  2XAS A;  3J7A U;  4DRX A;  3OEE G;  1H2G A;  1DLB A;  4ZI7 A;  5LP6 A;  3N27 A;  4X65 B;  1WB7 A;  4ASU G;  4IT5 A;  1NTZ H;  4MTG A;  3RGB A;  3FD9 A;  4UCS A;  2YI8 A;  1K8A W;  3RYF B;  3W7X A;  3RYH B;  1DF5 A;  3ETQ A;  1TUB A;  3I55 V;  3F7Y C;  1U97 A;  2P67 A;  1AI6 A;  4O2A A;  5B1A B;  2D3O W;  3SPI A;  5A9G A;  2L35 A;  1Y67 A;  5LBQ A;  2OTL V;  3FB6 C;  5IYC O;  4NKG B;  5EBW C;  3GWO A;  2P6J A;  2Q4P A;  5BZB A;  4LNU B;  5KX5 A;  2UUC O;  5JH7 A;  1KKD A;  1AVM A;  2OCC C;  1F7Y A;  1XMQ B;  2Y4T A;  3HKC A;  4B08 A;  4JTD B;  2OIG A;  1YXB A;  1N33 B;  3BHP A;  3N2K B;  1CPY A;  3PJS K;  5LHI A;  1FXV A;  1SKV A;  3ZHR A;  4GKJ B;  1NTM H;  1T5E A;  5LXT A;  3JD1 A;  1Y76 A;  1EZV H;  2UXD B;  4DR4 B;  1R3J C;  2IH3 C;  1DGS A;  3BFR A;  3ABL B;  3ASO C;  1Y4M A;  1YI2 V;  2QSA A;  4DYL A;  2HG5 C;  1CEZ A;  2FB5 A;  3G6E V;  3DTU B;  2R9I A;  2B1I A;  3OMA B;  2M6Y A;  1S77 D;  4DR1 O;  2CH7 B;  5KMG B;  3VQW A;  4PDL A;  3JD3 A;  1FFX A;  1K5Q A;  5CA1 B;  4JI8 B;  4PEL A;  1S72 V;  2XAQ A;  4WFG A;  3ZMS A;  2F93 B;  2DW4 A;  4LFC O;  4IL6 Z;  3LNN A;  3OTO B;  2LGW A;  3G6B A;  1JCH A;  1G4Y B;  1JVM A;  4P9O A;  5KUM A;  4DR3 B;  4LH7 A;  4O4L B;  4AI8 A;  2QE7 G;  3ZN1 A;  3HPL C;  2ZCE A;  5LOV A;  1XDC A;  4NXM B;  1Y74 B;  5IE9 A;  1NZ6 A;  4X62 B;  2YIC A;  3UQ8 A;  2EIM B;  5KAI Z;  3WB2 A;  3OW2 U;  5CBF A;  4FIP C;  4ZOL B;  1HNX B;  5EZY B;  4ZHQ A;  3CE2 A;  5L3G A;  1GK9 A;  3ZED A;  4B3S O;  3ZX6 A;  4FPP A;  1OCR B;  2QKS A;  3UO2 A;  1FFT B;  4HBN A;  3SYP A;  1XBL A;  5B1A C;  1IUR A;  4WFE A;  4P2Z A;  2HHH O;  1IBM B;  2N74 A;  1JPX A;  3FFQ A;  3T1Y B;  2N04 A;  1HR0 B;  4JI3 B;  4YY3 B;  2CTP A;  1VIB A;  3CCM V;  4FLU A;  1IXB A;  1SZX A;  2MW2 B;  2M7W A;  1FJG B;  1S5L Z;  2GBO A;  3CME V;  2A3Q A;  3AG3 C;  1QCE A;  3ZHT A;  2F95 B;  4DV1 O;  4EB6 B;  2GUZ B;  1BMF G;  4MW3 A;  4YXW G;  1FD9 A;  5EBL C;  2PUS A;  2YIA A;  2FKX A;  5FPR A;  5C8Y A;  5KHG A;  4W4K A;  3VOU A;  3WG7 B;  3CX5 F;  3AG2 B;  3HKD A;  2X6C A;  1UJW B;  3K5O A;  4I55 A;  5L3B A;  1IZ3 A;  4UCU A;  3HR0 A;  2QTS A;  4IYI A;  1SET A;  1YHQ V;  2NN4 A;  3GVM A;  4EEQ A;  4DV4 O;  3ABL C;  1ORQ C;  5CBH A;  3SYA A;  2GTS A;  3LUT B;  5LYJ A;  2ODM A;  3JAW B;  4JI6 B;  3K57 A;  3JD4 A;  3JAL B;  4LF9 B;  2F1M A;  3MDS A;  1WAZ A;  2BE3 A;  1THZ A;  3H1K H;  3RVY A;  2UUC B;  1K5S A;  5LHG A;  4DR6 O;  1AJP A;  4BW9 A;  3P3N A;  2RMK B;  4ICG A;  2YEV B;  1H2N A;  2WLL A;  5B3S B;  1AI4 A;  1VQ4 V;  1Z5W A;  3LDD A;  4FZ1 A;  3OFN G;  3JD0 A;  2HVJ C;  3L75 H;  4PHZ A;  4NR1 A;  3SJA C;  2DMX A;  4WBN B;  2AW9 A;  1S5H C;  3EXA A;  1D5A A;  4MTX A;  4GKK O;  1R3K C;  3QO5 A;  3KKY A;  3G80 A;  3K58 A;  4I0X B;  1O9H A;  3SDL A;  4BWA A;  3O9O A;  4FZ0 A;  3KCY A;  4YJ2 A;  1JX9 A;  5J2T A;  1SF9 A;  3BA9 A;  1Q43 A;  1B3Q A;  3G71 V;  4JZ2 A;  1F23 A;  2LO1 A;  4QPJ A;  2Y0I A;  5CBG A;  4JYA O;  1GN6 A;  3D36 C;  1M57 C;  2EIM C;  1M1K W;  4MW8 A;  1NKD A;  5CA3 A;  1V55 B;  1YJW V;  1XMO O;  1EBO A;  1HNZ O;  2NNU A;  4LFC B;  1NS1 A;  4PV1 B;  3U11 A;  4FFB B;  5FNV A;  1NH2 D;  1RP3 B;  1BSM A;  4X89 A;  2Q0A A;  2LP7 A;  3CHX A;  1EN5 A;  1G8M A;  1B6Q A;  1TUE B;  4RWU A;  4X64 O;  3ZCC A;  2RN9 A;  2AHY A;  3N2G A;  4DR5 O;  1CP9 A;  3UO3 A;  2AHZ A;  1YJN V;  2ZIO A;  4A5U B;  1BZK A;  2GTA A;  1H2S B;  4B7E A;  1K34 A;  2LW7 A;  2ZE7 A;  1GM9 A;  4PI0 A;  2ZE6 A;  2ZR3 A;  4QNH B;  1KB9 F;  3SPC A;  1WN7 A;  3OUS A;  2JK5 C;  3L73 H;  2FYU H;  1OV9 A;  4X1I B;  2W0F C;  1I5X A;  3BA8 A;  2BSK B;  1KU9 A;  4FLV A;  1TA8 A;  5TIS Z;  1TGO A;  3AG2 C;  4UCO A;  4B3S B;  3E83 A;  2QM7 A;  1EN6 A;  3E8B A;  3EFF K;  5LGT A;  1HDJ A;  5IJ0 B;  1J5E O;  3OE7 G;  2WPD G;  2HHH B;  1I94 O;  1YIJ V;  1AI5 A;  4CC6 A;  1I5Y A;  3LSS A;  4H37 A;  1OCC B;  1GM8 A;  5HFL A;  3FYE B;  1MNG A;  5IYB O;  3AG4 B;  4IIJ B;  1L1F A;  4DV1 B;  1XUQ A;  2XAF A;  1N34 O;  3ZRW B;  1SQP H;  2QKC A;  4CH5 A;  2IJH A;  3CJH B;  2JIZ G;  4LFB O;  5EBM C;  1AR5 A;  3E89 A;  3Q4H B;  5LP6 C;  2PTM A;  2ZNJ A;  2P7T C;  3H1J H;  5KA5 A;  3CXH F;  3CS5 A;  2FL4 A;  4J41 A;  1ZAU A;  2RNB A;  4MVU A;  2DYR B;  4J10 A;  4J11 A;  5IDJ A;  4FLX A;  3KZI Z;  2RJZ A;  4UB8 Z;  2DWE C;  2P22 C;  1XL4 A;  1XHX A;  4KHP O;  4KP4 A;  1K73 W;  1GN2 A;  3OGC C;  1P7G A;  3ABU A;  2XUM A;  1L0N H;  1D5N A;  4CS2 A;  1HNW O;  4XDK A;  1AR4 A;  1ZL8 A;  1Q3E A;  4PJ0 Z;  5E1A C;  1DK1 A;  4TV9 A;  2GDS A;  1JR9 A;  2CK3 G;  2W6I G;  1ZUQ A;  4O4I B;  4NXN B;  1US6 A;  3TCU A;  5DN6 G;  4AHC A;  2Q5Z A;  3CC7 V;  2B1G A;  2YDE A;  4X1K B;  2DQ3 A;  4D7S A;  2UUB O;  2JJ2 G;  2IJJ A;  1V55 C;  4K8Z A;  2Q67 A;  4ZBM A;  1HW7 A;  1XOU A;  4JYB A;  4GKK B;  3WB0 A;  3CC2 V;  3ETD A;  3ML0 A;  5L3D A;  4JAA A;  1AI7 A;  4U7O A;  3OTF A;  1M56 B;  4X20 B;  2QTO A;  4DV2 O;  4MVZ A;  4OPH A;  2ZKO A;  1PNK A;  1Y74 A;  1SQQ H;  5L3E A;  4B3R B;  1NTK H;  2ZT9 B;  4BAY A;  1Q6H A;  4HAM A;  5JQG B;  2F66 C;  1PM9 A;  3M8A A;  4LP8 A;  4U7N A;  4PA9 A;  2XAJ A;  4LF4 B;  2Q68 A;  4I50 B;  1SES A;  4JYA B;  4J7Z A;  2ZXW C;  4EFB A;  2A0L A;  3ZHQ A;  4D7T A;  1HP8 A;  4LF8 O;  1XMO B;  1KD1 W;  2EIJ B;  2ZQM A;  3JAS B;  3R66 A;  2WLH A;  2YXY A;  1RSO B;  4C7U A;  4RUE A;  4MVR A;  2GV9 A;  2YS8 A;  4X9Q A;  3RT3 C;  2LFS A;  2JGD A;  5LGU A;  2BTQ A;  4OX9 O;  2UXX A;  1JQ0 A;  4X64 B;  2YIB A;  2F4V O;  3ZHV A;  4UCV A;  3E86 A;  3AG4 C;  4D6T H;  2K9P A;  1KUQ A;  1EZJ A;  1NVP D;  3CP1 A;  1Y66 A;  4CZZ A;  5DM6 V;  2VWJ A;  4JI5 B;  5JVD A;  3RW0 A;  3HKB A;  4YHH O;  4KXR A;  1NVP B;  3IC9 A;  2HFE C;  1XQ8 A;  3ZRX A;  1MA1 A;  1J95 A;  3DC6 A;  3HKE A;  4H44 B;  4IHJ B;  1N0J A;  3LDE A;  3JAW A;  4HNA B;  2ATK C;  1J5E B;  5J2U A;  1K92 A;  3CCJ V;  5KA6 A;  2ADP A;  2QM8 A;  1NBM G;  3VQY A;  4U3J A;  2Q7H A;  3K0D A;  1Q81 W;  5KHH A;  4LWS A;  5CB4 B;  1OJH A;  4WFF A;  4GX2 A;  1SS3 A;  2YXL A;  2WA4 A;  2UXB O;  2YSU B;  2YUA A;  1TAE A;  3MHS C;  4LFB B;  1VF7 A;  3P3P A;  4F6R A;  4DUZ O;  4AQY B;  3ABK B;  4JZG A;  1PP9 H;  1VMG A;  4PA7 A;  5KHI A;  3AG3 B;  3C90 A;  1GTO A;  4GUN A;  4YIO A;  1M56 C;  3CWB H;  4RQE A;  4O4J B;  3D3I A;  3SGI A;  1X4T A;  1IX9 A;  3CRM A;  4Z1V A;  1NR1 A;  1HNW B;  2VQE O;  4EKW A;  3ZJZ A;  4UVB A;  1NT2 B;  3JCU Z;  1FXK B;  3UT5 B;  4BIU A;  1Q5O A;  1U96 A;  5EYP A;  1RPR A;  3BRC A;  2P06 A;  1SQX H;  4PA4 A;  2ZNI A;  2R9R B;  5BMV B;  3VQX A;  1SA0 B;  3LNM B;  5LMN O;  2UUB B;  3A0H Z;  3FB5 C;  3VBB A;  1XNR O;  2EIJ C;  3JYC A;  1KMI Z;  2FML A;  4EFE A;  4J7J A;  4TV8 A;  4YJ3 B;  4H0L B;  1R3I C;  2JJ1 G;  2B9Z A;  5K1X A;  3JAR B;  2VS0 A;  5GON A;  3M7M X;  1RM1 C;  1AP5 A;  3OEH G;  4JI4 B;  4KL1 A;  4UB6 Z;  1COW G;  4DV2 B;  2CE4 A;  1L0L H;  2HJF C;  3ICX A;  2JEX A;  2P4K A;  4NTW A;  3CYO A;  1S76 D;  3FAV B;  4TT3 G;  1O9G A;  5CA0 A;  2QKA A;  2QWR B;  5LA6 A;  2WA3 A;  5H5N A;  1AIL A;  4X1Y B;  1HWY A;  4LF5 O;  4O2B A;  1ZLZ A;  5IYZ B;  3T1H B;  3BAA A;  2V7Q G;  2UXN A;  2L6L A;  2WLI A;  3CPW U;  4TUY A;  4JGS A;  3C3S A;  2W6J G;  1QQC A;  4O4H B;  5EIB D;  4LFA O;  2RQ6 A;  1Q8I A;  2LJ2 A;  3S3W A;  2BOB C;  4I9Q A;  3AEI A;  1KEC A;  4X8A A;  4JTC B;  1OCZ B;  3AG1 C;  1N36 B;  1K33 A;  4B3T O;  1M57 B;  2JS5 A;  5JCO C;  1VEW A;  4OX9 B;  1PV0 A;  1K7D A;  3CCR V;  1Q82 W;  4RO2 A;  2P4V A;  5B1B C;  3RBZ A;  3CRR A;  2F4V B;  4XDL A;  1IBL B;  4G27 B;  1W59 A;  2IM9 A;  3QO8 A;  2HEP A;  2QJ1 A;  3STL C;  4FM1 A;  3CCE V;  2BCC H;  1QLE B;  1MG1 A;  1VF5 B;  3B40 A;  3FX7 A;  1QR8 A;  4PDR A;  2QWO B;  3B8N A;  1MSD A;  4XDJ A;  3BVO A;  1QU7 A;  4PDV A;  2XT9 A;  2CUG A;  3L71 H;  4YHH B;  3JSL A;  4GX0 A;  1Z2G A;  3ABK C;  4GX5 A;  2JGU A;  5ITZ B;  3A0B Z;  2Q7E A;  1M4U A;  1QR9 A;  5IJ9 A;  1GAX A;  1URF A;  3JAT B;  1BQZ A;  3E22 A;  3ABT A;  1VQM V;  4MS2 A;  4KUM A;  2YIB D;  3APO A;  2KG7 B;  3L70 H;  1AP6 A;  1BL8 A;  1FXK C;  3BEH A;  1W2B U;  2YXH A;  1E1Q G;  3DXR B;  1VQ8 V;  2D2C B;  4LBE C;  4B7K A;  3TXQ A;  1YTF D;  1Y6X A;  4MVS A;  1DF4 A;  2V4D A;  3CRA A;  1PPJ H;  4DW0 A;  4DUZ B;  1YTF B;  1BGY H;  4OXS A;  4H13 B;  1GH6 A;  5BR8 O;  3CRQ A;  4N21 A;  1K4D C;  2CAZ C;  3FB8 C;  4K0K O;  3FYI B;  1PNL A;  2H3O A;  2JEU A;  4DRX B;  1UPG A;  1IXM A;  4JI0 O;  4ZI7 B;  5LP6 B;  3IC7 A;  4GYC B;  3TXS A;  4UV9 A;  1UFI A;  4R6Z A;  3L74 H;  5KHJ A;  3AK1 A;  2XAG A;  4Q20 A;  1QHT A;  2F23 A;  1WA8 A;  3AK2 A;  2JDI G;  3SJC C;  4TSF G;  1TUB B;  2B5U A;  2CTQ A;  4XBF A;  2QWQ B;  3OGI B;  3G4S V;  3BPZ A;  4FLT A;  4O2A B;  2K1E A;  1VAR A;  2H94 A;  4P9P A;  3B2E E;  2QGN A;  5EIB C;  4GCZ A;  4DR1 B;  3JAK A;  3W7W A;  2EIN B;  5DEC A;  1OCZ C;  4QE9 A;  4FVM A;  5KX5 B;  2UU9 O;  5JH7 B;  2E74 B;  4WFA V;  2X6A A;  1RPO A;  4QGP A;  2RDC A;  2JVD A;  1VQN V;  3APQ A;  5IT9 N;  3HKC B;  4UV8 A;  3ZMV A;  4DR2 O;  3F7V C;  3J80 N;  3F5W C;  1QLE C;  4Z2W A;  3E8G A;  3AG7 A;  1K9M W;  1VF6 A;  3JD2 A;  3PN1 A;  4I4T A;  3K5M A;  3RYC A;  1NH2 B;  1TVK A;  5LXT B;  4RUF A;  3DC5 A;  1K97 A;  1V54 C;  1Y76 B;  2WLJ A;  4WCE V;  4DV6 O;  3SYQ A;  1BS3 A;  2O57 A;  5DED A;  1IBK O;  4R8C A;  2E75 B;  4W4L A;  2ZDI A;  3SR2 C;  1QVG U;  2EBO A;  2LFR A;  2ZXW B;  4B3T B;  3CRC A;  3MD0 A;  3ZMU A;  3ZMT A;  1QLN A;  3RYF A;  2A9H A;  2P90 A;  3RYH A;  1FFX B;  5BXZ A;  1N4C A;  4I5S A;  4CS3 A;  5LL6 Y;  2R9A A;  3FKS G;  1JA8 A;  3WU2 Z;  3UCS C;  4BIO A;  3A8T A;  4B3M O;  1N8R W;  1XL6 A;  2Z3Y A;  4F4L A;  4K8X A;  1B06 A;  3SPJ A;  3LDC A;  3CCU V;  2P5O A;  4QIW F;  1EN4 A;  1F4M A;  4MVM A;  2Z0A A;  1A32 A;  4LNU A;  1VQK V;  1GKF A;  3LSU A;  1NU1 H;  5LOV B;  3OUF A;  2EIL C;  2Y69 C;  3K9A A;  3B4S A;  2Q8V A;  5LMU O;  4J7K A;  3RVZ A;  5JJN B;  3RYI B;  1AB3 A;  1JFF B;  3N2K A;  4ZIB A;  4AIL C;  4LF7 O;  2QA4 V;  3CD6 V;  4GLX A;  4DR7 O;  1OZ0 A;  3SYC A;  3E2E A;  1WNS A;  4ZHQ B;  1R6K A;  3IJ4 A;  4JYC A;  2QEX V;  1ENV A;  3ASN C;  4Q6G A;  4DV4 B;  1MAB G;  2W0X A;  5H2F Z;  3FB7 C;  2ZD9 A;  4Z1M G;  2ITD C;  3X2Q B;  4LC1 A;  2NR5 A;  3BY6 A;  2CH7 A;  5KMG A;  2VQF O;  1VQ9 V;  3MAQ A;  4J80 A;  1I08 A;  2PGG A;  3ZBH A;  3K9S A;  2X6B A;  1JOY A;  3H1H H;  5CA1 A;  5FL7 G;  2EIN C;  2OT5 A;  3F5T A;  4DR6 B;  2QDO A;  1XMQ O;  1H2M A;  5CN0 A;  4FM0 A;  4QPK A;  4GT1 A;  1PL4 A;  3CCQ V;  4JI0 B;  1D2D A;  5B5E Z;  4JV5 O;  5C8Y B;  3K3W A;  1GM7 A;  1H2K A;  4O4L A;  3CSX A;  3HKD B;  1AJQ A;  4DR4 O;  4ZKI A;  4I55 B;  1SQV H;  4JAS A;  3OAA G;  1FXH A;  2KSD A;  4JI2 O;  3IGA C;  1I0H A;  1E1R G;  3T2M A;  5LYJ B;  3CXC U;  3D36 A;  2ITC C;  1H8E G;  1R6T A;  3O65 A;  2XAH A;  1KKC A;  4ZOL A;  1VP7 A;  2UU9 B;  5EZY A;  1N32 O;  4CH6 A;  2YI9 A;  1HNZ B;  2WLL B;  1MZE A;  4NTY A;  1RM1 B;  4G28 B;  1LNQ A;  4DR3 O;  2HVK C;  1LUV A;  1Q6I A;  1WPX A;  3IAY A;  2Y48 A;  4J9Y B;  4DR5 B;  4TQD A;  4YJ2 B;  5KAF Z;  5J2T B;  2OYQ A;  1IBK B;  1R3L C;  4EB6 A;  2GUZ A;  3OR7 C;  1MSW D;  4NTX A;  1XIL A;  1YDX A;  2E3C A;  3T4Z A;  5A2Q N;  4MTO A;  4HYO A;  1P7B A;  3H9V A;  3H1L H;  3RN4 A;  1ROP A;  3JCZ A;  4JYY A;  1K4C C;  2EX3 A;  4X66 O;  1MZF A;  5GTI Z;  2ETN A;  5B1O A;  4UFZ A;  1YSC A;  2ZIN A;  5HFM A;  3B8M A;  4X88 A;  4L8J A;  1BHB A;  3LSQ A;  4MTF A;  5FNV B;  3AG1 B;  4DUY O;  1VQO V;  2E5L O;  4B3M B;  1Z5V A;  1G1X B;  4J42 A;  4KFM A;  1BE3 H;  2DYS C;  3DGE A;  3JAL A;  1L8D A;  2R72 A;  5B1N A;  4CBC A;  3L72 H;  3X2Q C;  3T1Y O;  1I94 B;  2NLJ C;  1FS0 G;  5B1B B;  4JI7 O;  4JI3 O;  1R1B A;  4YY3 O;  2IH1 C;  3N2G B;  3K5L A;  2KB1 A;  2YEV A;  2PZS A;  4DK1 A;  1WPB A;  1N34 B;  4WBN A;  1XNQ O;  1I7F A;  2Y4U A;  4LF7 B;  4FLW A;  4LH6 A;  4PD4 F;  3U0Z A;  3KG2 A;  2YC0 A;  4I0X A;  4DR7 B;  3I5D A;  3TGU H;  5IYD O;  4JAU A;  3NXS A;  4UUJ C;  2XTA A;  5EC1 C;  3QTC A;  2VRZ A;  4JPR A;  4KHP B;  3WFV A;  3QVN A;  1P4R A;  4PA3 A;  1MMM A;  4JI6 O;  2VQF B;  4F6E A;  1F51 A;  1F4N A;  4LF9 O;  4JF3 A;  1GO3 F;  1S3J A;  4IGG A;  2CTW A;  3I56 V;  3CC4 V;  4N23 A;  1MOF A;  2GSM B;  2ZM6 O;  2IJI A;  2HR3 A;  3P32 A;  2DQ0 A;  3G67 A;  3T4D A;  4FFB A;  1VQL V;  4UVC A;  5H6Q A;  4G2K A;  1VQ5 V;  4JV5 B;  3H01 A;  4NYK A;  1Q6U A;  2AZ0 A;  4WFH A;  2RCV A;  4JI2 B;  4TWK A;  2Q0O C;  3RFR A;  4JTA B;  3MHH C;  4PDM A;  2KKW A;  4R7C A;  4ABM A;  3ETE A;  4K35 A;  4BR6 A;  2WLM A;  4RQF A;  1ZL8 B;  3SPH A;  3ZRV A;  3QG5 A;  2HJD A;  2V1D A;  2EZP A;  3EVK A;  1YF2 A;  4TV9 B;  3HB3 B;  4X1I A;  1SER A;  2FTK A;  1E79 G;  4R50 A;  1LUW A;  1SC5 B;  2WLN A;  1N32 B;  1BCC H;  2BSK A;  4FLZ A;  2PF4 E;  1M5I A;  4LF8 B;  4FLY A;  1NR7 A;  1YVW A;  2Q6A A;  1JJO A;  4HZ3 A;  4MT8 A;  2JRI A;  1WP8 A;  4H33 A;  1W0K G;  4DO2 A;  5KHK A;  5IJ0 A;  2CGN A;  2ZE8 A;  3K79 A;  3NR7 A;  3KCX A;  2WWW A;  1Q90 D;  3ZHU A;  1GN4 A;  1VF6 C;  1PD3 A;  5IY5 B;  3L9D A;  1YCI A;  3W7U A;  4IIJ A;  5KLV H;  1NQT A;  3A2F A;  2A7W A;  3ABM C;  3RYI A;  3ZRW A;  1ZWI C;  1JFF A;  1Q86 W;  1B04 A;  3H1I H;  4FJC C;  3CJH A;  4JI1 O;  2ZDI C;  3SYO A;  2Y0P A;  3Q4H A;  1KYO F;  2YID A;  2EUL A;  1V54 B;  3QO7 A;  1OHH G;  4X66 B;  4WFB V;  1EM1 A;  1WLE A;  4OPA A;  2A79 B;  4MSW C;  3CCV V;  2EZO A;  3OM3 B;  1M90 W;  1YZB A;  2GHY A;  4LR3 A;  1ZSP A;  3THO A;  1SQB H;  4DUY B;  2E5L B;  3JAM N;  3OMN B;  1YEW A;  2JGD B;  2IJK A;  2BTQ B;  4GX1 A;  5JWP A;  3CCL V;  4JI7 B;  4O4I A;  5JJE B;  4X1K A;  2PYL A;  2DJV A;  5AG2 A;  3ZHS A;  4NVP A;  2BOC C;  1KP3 A;  3IFX A;  1XNQ B;  2UXB B;  1M9N A;  2DN9 A;  3ZMZ A;  5GW7 A;  2N05 A;  3UM7 A;  3ZIA G;  4DV7 O;  1QNM A;  4X20 A;  4LCU C;  5JVD B;  2E76 B;  3HKB B;  2EIL B;  2Y69 B;  3STZ C;  2EJ7 A;  2XND G;  3EHB B;  1NI8 A;  3VQV A;  4I9W A;  5KUK A;  1H8H G;  3HKE B;  4E4E A;  5JQG A;  2ZR2 A;  1KP2 A;  2VQE B;  1NJI W;  3SJB C;  5IWA O;  2AXT Z;  5J2U B;  4I50 A;  4L87 A;  1YJ9 V;  3K06 A;  3CEI A;  1BT8 A;  3OD4 A;  4NXN O;  3TJT A;  4MVO A;  4CH3 A;  4U3J B;  2ZM6 B;  3TET A;  1WB8 A;  2IU0 A;  1WP7 A;  3M99 B;  3JAS A;  5LMN B;  4LWS B;  3ASN B;  2UXC O;  3B09 A;  1X59 A;  1RSO A;  2PY5 A;  1EFR G;  4FK5 C;  1XNR B;  1AR1 B;  5FLX N;  4K3A A;  1JMK C;  3J81 N;  2UUA O;  3W7S A;  2ARH A;  4DXW A;  2EIK B;  2LGQ A;  4F6R B;  1WJZ A;  1BHA A;  1N0N A;  5B66 Z;  3K03 A;  4LF6 O;  1FYJ A;  2PI5 A;  5IY5 C;  4B3R O;  4QE7 A;  2Q73 A;  1DTO A;  4DV0 O;  1PNM A;  4LF5 B;  4LF4 O;  4QJF B;  4J9Z B;  5F2V O;  3K0G A;  5EYP B;  3CCS V;  2AGA A;  5GTH Z;  2ZIM A;  1OCO B;  2HLD G;  4RAI A;  5D5Q A;  1FPO A;  1V9P A;  3ETG A;  4UVA A;  4CH4 A;  1FAF A;  4LFA B;  3UKM A;  1R6N A;  1GMG A;  2X7R B;  1KBH A;  4IHJ A;  1OCR C;  5JCO A;  4CS4 A;  4HNA A;  4TV8 B;  3K04 A;  1XHZ A;  1SQG A;  5GON B;  4IYH A;  4DV5 O;  1ZTE A;  2Z5U A;  4JAV A;  1YIT V;  5CB4 A;  2WAM A;  2ZE5 A;  4PI2 A;  3E8H A;  4FM2 A;  4DV3 O;  5EC2 C;  5H9C A;  5CA0 B;  2WSS G;  5LA6 B;  4UCR A;  3S3X A;  4JI1 B;  3K08 A;  2DWD C;  3R65 A;  4O2B B;  2KQX A;  5K1P A;  3GB7 C;  3BCC H;  2WLI B;  3JSN A;  4TUY B;  2PYJ A;  4JI5 O;  4BIZ A;  5H6R A;  2H8P C;  3WG7 C;  1VQ6 V;  3DSQ A;  5EK0 A;  3SJQ C;  4O4J A;  4U3F H;  1M93 A;  4DW1 A;  3QNE A;  2OIE A;  4DK0 A;  2CDY A;  4FFK A;  1IDS A;  2BTO A;  4X65 O;  2Q9L A;  3UT5 A;  1FXK A;  2VWK A;  3OR6 C;  2DOS A;  1XEQ A;  1H2L A;  5BMV A;  2EJR A;  1PL0 A;  2WLK A;  1RFY A;  1SA0 A;  2LW1 A;  4PA6 A;  3WB1 A;  1S0V A;  5B3S C;  4BW5 A;  2DYS B;  2IU3 A;  5J9P C;  1IVS A;  4YJ3 A;  1GN3 A;  4AQY O;  3JAR A;  4I7Z B;  2IW5 A;  5BR8 B;  2EIK C;  2QWP B;  3E35 A;  4DV7 B;  2F43 G;  2CTR A;  3AK3 A;  4WF9 V;  4K0K B;  4UCT A;  2Q69 A;  2Q7G A;  1XI1 A;  3E8F A;  2QM4 A;  3RWR D;  2X0L A;  2CGO A;  3FAV A;  1H38 A;  2XHB A;  5IJ9 B;  3T1C A;  4X1Y A;  3OT7 A;  3E22 B;  2IBZ H;  5E79 Z;  1N33 O;  5IWA B;  5IYZ A;  2QR4 A;  4GKJ O;  1R73 A;  2OWO A;  2XOK G;  1K3E A;  1LR1 A; 
#chains in the Genus database with same CATH homology
 3KG2 A;  3ZRS A;  4MVQ A;  1KQS U;  1QR8 A;  4PDR A;  3B8N A;  4FMT A;  1OCO C;  1NH2 D;  5IYD O;  4XDJ A;  4JAU A;  5L3C A;  3NXS A;  4UUJ C;  4X89 A;  4PDV A;  2LP7 A;  5EC1 C;  5LHH A;  4JPR A;  1G8M A;  4GX0 A;  3ABK C;  1B6Q A;  1TUE B;  3WFV A;  1P4R A;  3ZCC A;  2AHY A;  1VQP V;  4GX5 A;  1CP9 A;  3B77 A;  4PA3 A;  1QR9 A;  2AHZ A;  1YJN V;  4P30 A;  1F51 A;  1F4N A;  2OCC B;  4JF3 A;  1W0J G;  1GO3 F;  1S3J A;  3ABT A;  3I56 V;  4MS2 A;  1VQM V;  1K34 A;  3CC4 V;  4KUM A;  1GM9 A;  2MK3 A;  4N23 A;  2C2A A;  1MOF A;  2GSM B;  2ZR3 A;  4QNH B;  1JJ2 U;  1VQ7 V;  1BL8 A;  1FXK C;  3SPC A;  2IJI A;  2HR3 A;  3CMA V;  3OUS A;  2JK5 C;  3P32 A;  2DQ0 A;  3BEH A;  1W2B U;  1ARO P;  3A0R A;  2W0F C;  3T4D A;  1E1Q G;  1I5X A;  1VQL V;  4UVC A;  1Q7Y W;  5H6Q A;  1QBZ A;  5L3F A;  4G2K A;  1VQ5 V;  3SPG A;  1VQ8 V;  3AG2 C;  4LBE C;  3ASO B;  3E83 A;  2QM7 A;  3P30 A;  1YTF D;  3H01 A;  3E8B A;  4MVS A;  3EFF K;  1DF4 A;  5LGT A;  3W7T A;  2PI4 A;  1YTF B;  4OXS A;  3OMI B;  4N21 A;  4WFH A;  4TWK A;  1K4D C;  3OE7 G;  2WPD G;  4JTA B;  3MHH C;  4PDM A;  4R7C A;  3FB8 C;  1YIJ V;  3ETE A;  3FYI B;  1AI5 A;  2WLM A;  1KC8 W;  1I5Y A;  3LSS A;  1SZT A;  4H37 A;  1OCC B;  1GM8 A;  1PNL A;  4RQF A;  5HFL A;  3FYE B;  3SPH A;  3ZRV A;  2JEU A;  2V1D A;  5IYB O;  2EZP A;  3AG4 B;  1L1F A;  2OTJ V;  1IXM A;  3HB3 B;  5LGN A;  1SER A;  2FTK A;  1E79 G;  1AJN A;  1OCC C;  3IC7 A;  4R50 A;  2XAF A;  3ZRW B;  5CMU A;  2WLN A;  4UV9 A;  4E2L A;  4R6Z A;  2IJH A;  2XAG A;  4Q20 A;  2JIZ G;  1PKX A;  5EBM C;  1NR7 A;  3E89 A;  2JDI G;  2Q6A A;  5C93 A;  2P7T C;  4HZ3 A;  4MT8 A;  4UXN A;  5KA5 A;  4TSF G;  2B5U A;  4XBF A;  4H33 A;  1W0K G;  4DO2 A;  4MVU A;  2DYR B;  3G4S V;  5IDJ A;  2DWE C;  2K1E A;  1XL4 A;  3ZN0 A;  2H94 A;  3K79 A;  4P9P A;  2WWW A;  4KP4 A;  1K73 W;  3TK1 A;  2HKO A;  3OGC C;  2DYR C;  3ABU A;  1SRY A;  1QVF U;  4GCZ A;  1PD3 A;  3ABM B;  5IY5 B;  4XDK A;  2XAS A;  3W7W A;  2EIN B;  1OCZ C;  3W7U A;  4QE9 A;  3OEE G;  5E1A C;  1H2G A;  1DLB A;  4WFA V;  1NQT A;  2CK3 G;  2X6A A;  2W6I G;  1RPO A;  3ABM C;  3ZRW A;  1ZWI C;  4ASU G;  1Q86 W;  3TCU A;  5DN6 G;  4MTG A;  1VQN V;  4FJC C;  3CC7 V;  2B1G A;  2ZDI C;  3SYO A;  1K8A W;  2DQ3 A;  3W7X A;  4UV8 A;  1DF5 A;  2JJ2 G;  3ZMV A;  2IJJ A;  1V55 C;  1V54 B;  3QO7 A;  3I55 V;  3F7V C;  3F7Y C;  3F5W C;  1QLE C;  1OHH G;  2Q67 A;  3E8G A;  4ZBM A;  4WFB V;  1K9M W;  1WLE A;  3JD2 A;  1NH2 B;  4JYB A;  2P67 A;  1AI6 A;  2A79 B;  4RUF A;  4MSW C;  3CCV V;  2EZO A;  1K97 A;  3OM3 B;  1V54 C;  5B1A B;  2WLJ A;  4WCE V;  2D3O W;  3SPI A;  1M90 W;  3CC2 V;  2GHY A;  3ETD A;  3ML0 A;  5LBQ A;  5L3D A;  2OTL V;  3FB6 C;  1AI7 A;  4U7O A;  3SYQ A;  5IYC O;  1M56 B;  2QTO A;  5EBW C;  3GWO A;  4MVZ A;  2P6J A;  3OMN B;  4R8C A;  5BZB A;  1PNK A;  2ZDI A;  5L3E A;  2IJK A;  1QVG U;  2EBO A;  4GX1 A;  3CCL V;  1KKD A;  4BAY A;  2OCC C;  4HAM A;  2LFR A;  2ZXW B;  3MD0 A;  4LP8 A;  3ZMU A;  4U7N A;  4PA9 A;  3ZMT A;  2XAJ A;  1QLN A;  2A9H A;  2P90 A;  4JTD B;  2Q68 A;  1SES A;  4I5S A;  2ZXW C;  1CPY A;  3PJS K;  2A0L A;  2BOC C;  5LHI A;  1FXV A;  3FKS G;  1KP3 A;  3IFX A;  1M9N A;  3ZMZ A;  1KD1 W;  3JD1 A;  2EIJ B;  2ZQM A;  2WLH A;  1R3J C;  2IH3 C;  5GW7 A;  1N8R W;  1XL6 A;  2Z3Y A;  3UM7 A;  4F4L A;  3ABL B;  3ZIA G;  3ASO C;  1Y4M A;  3LDC A;  4RUE A;  3SPJ A;  3CCU V;  4MVR A;  4LCU C;  1F4M A;  2HG5 C;  4MVM A;  4QIW F;  1YI2 V;  1CEZ A;  2EIL B;  2Y69 B;  3G6E V;  3DTU B;  3STZ C;  2R9I A;  2LFS A;  2XND G;  3EHB B;  5LGU A;  1VQK V;  1GKF A;  2B1I A;  3OMA B;  4I9W A;  2UXX A;  5KUK A;  1JQ0 A;  1S77 D;  1H8H G;  3OUF A;  2EIL C;  2Y69 C;  2ZR2 A;  3K9A A;  1KP2 A;  1NJI W;  3RVZ A;  4PDL A;  3JD3 A;  1K5Q A;  4L87 A;  1YJ9 V;  3K06 A;  4PEL A;  3E86 A;  3AG4 C;  1S72 V;  2XAQ A;  4MVO A;  4WFG A;  3ZMS A;  2DW4 A;  2QA4 V;  3TET A;  2IU0 A;  3CD6 V;  3M99 B;  1OZ0 A;  3ASN B;  3SYC A;  1EZJ A;  3E2E A;  1EFR G;  1NVP D;  1JCH A;  3CP1 A;  4FK5 C;  1R6K A;  1Y66 A;  4CZZ A;  1AR1 B;  1G4Y B;  5DM6 V;  4JYC A;  1JVM A;  2QEX V;  3RW0 A;  1ENV A;  4P9O A;  1NVP B;  3ASN C;  5KUM A;  3W7S A;  4DXW A;  1MAB G;  2EIK B;  2HFE C;  3ZRX A;  3FB7 C;  2ZD9 A;  4Z1M G;  2QE7 G;  3ZN1 A;  1BHA A;  3HPL C;  2ITD C;  3X2Q B;  1J95 A;  4LC1 A;  3BY6 A;  1VQ9 V;  3K03 A;  3LDE A;  2ATK C;  2X6B A;  2PI5 A;  1JOY A;  1K92 A;  5IY5 C;  3CCJ V;  5FL7 G;  5KA6 A;  2EIN C;  2OT5 A;  4QE7 A;  2QM8 A;  1NBM G;  2EIM B;  1DTO A;  3K0D A;  1PNM A;  3OW2 U;  1Q81 W;  5CN0 A;  5CBF A;  4FIP C;  4QJF B;  4QPK A;  4J9Z B;  4GT1 A;  4WFF A;  3K0G A;  3CCQ V;  5L3G A;  4GX2 A;  1GK9 A;  3CCS V;  1OCO B;  2YSU B;  2HLD G;  3K3W A;  4FPP A;  4RAI A;  1GM7 A;  1OCR B;  3MHS C;  3ETG A;  2QKS A;  4UVA A;  1AJQ A;  4ZKI A;  3UKM A;  1FFT B;  4JAS A;  1R6N A;  3SYP A;  3OAA G;  1GMG A;  3ABK B;  1FXH A;  2X7R B;  5B1A C;  4WFE A;  3IGA C;  4P2Z A;  1OCR C;  4PA7 A;  1JPX A;  3AG3 B;  3T2M A;  1E1R G;  1GTO A;  3K04 A;  1M56 C;  4RQE A;  3D3I A;  3CCM V;  3CXC U;  3D36 A;  1NR1 A;  1H8E G;  2ITC C;  2M7W A;  3CME V;  3AG3 C;  1QCE A;  4EKW A;  2Z5U A;  4JAV A;  1YIT V;  3ZJZ A;  2XAH A;  4UVB A;  2WAM A;  1BMF G;  4MW3 A;  4BIU A;  1FXK B;  3E8H A;  4YXW G;  5EBL C;  1RPR A;  1EBO A;  4PA4 A;  5EC2 C;  5H9C A;  2WSS G;  2R9R B;  2WLL B;  3K08 A;  2DWD C;  3LNM B;  3R65 A;  3VOU A;  3WG7 B;  3GB7 C;  3AG2 B;  2X6C A;  1UJW B;  3FB5 C;  3VBB A;  2EIJ C;  2WLI B;  3JYC A;  5L3B A;  1RM1 B;  4G28 B;  4BIZ A;  5H6R A;  1SET A;  1YHQ V;  2H8P C;  3WG7 C;  1VQ6 V;  1LNQ A;  2HVK C;  3ABL C;  1ORQ C;  1R3I C;  2JJ1 G;  1WPX A;  5EK0 A;  3SJQ C;  3SYA A;  5CBH A;  3LUT B;  2Y48 A;  4J9Y B;  3QNE A;  1RM1 C;  3OEH G;  1COW G;  3JD4 A;  1THZ A;  1R3L C;  3OR7 C;  1FXK A;  2HJF C;  3OR6 C;  3RVY A;  1MSW D;  1K5S A;  2JEX A;  5LHG A;  3T4Z A;  1AJP A;  3CYO A;  1S76 D;  2YEV B;  4MTO A;  4TT3 G;  1P7B A;  4HYO A;  2EJR A;  2WLL A;  1PL0 A;  2WLK A;  5B3S B;  1HWY A;  1AI4 A;  1VQ4 V;  3LDD A;  1ROP A;  3JCZ A;  3OFN G;  1K4C C;  3JD0 A;  2HVJ C;  4PA6 A;  1S0V A;  2V7Q G;  2UXN A;  2WLI A;  5B1O A;  3CPW U;  1S5H C;  5B3S C;  1YSC A;  4JGS A;  4MTX A;  5HFM A;  3B8M A;  4BW5 A;  4X88 A;  1R3K C;  3QO5 A;  2DYS B;  2IU3 A;  5J9P C;  1BHB A;  2W6J G;  3LSQ A;  4MTF A;  3AG1 B;  1VQO V;  2IW5 A;  4KFM A;  2EIK C;  1JX9 A;  2DYS C;  3E35 A;  2F43 G;  3DGE A;  4CBC A;  2BOB C;  5B1N A;  4WF9 V;  3X2Q C;  3AEI A;  2NLJ C;  1FS0 G;  1KEC A;  5B1B B;  4X8A A;  2Q69 A;  4JTC B;  1OCZ B;  3AG1 C;  3G71 V;  1K33 A;  1M57 B;  3E8F A;  2IH1 C;  1F23 A;  1K7D A;  2KB1 A;  2X0L A;  1H38 A;  2YEV A;  3CCR V;  1Q82 W;  4RO2 A;  4QPJ A;  3T1C A;  5B1B C;  3RBZ A;  5CBG A;  4XDL A;  4G27 B;  1M57 C;  2EIM C;  3QO8 A;  1M1K W;  4MW8 A;  1NKD A;  5CA3 A;  3STL C;  1R73 A;  1V55 B;  1YJW V;  3CCE V;  2XOK G;  1QLE B;  1MG1 A;  1K3E A;  2NNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...