4G2MA

Structure of a lys-hct mutant from coffea canephora (crystal form 2)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
434
structure length
418
Chain Sequence
MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
publication title A structural basis for the biosynthesis of the major chlorogenic acids found in coffee.
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
total genus 117
structure length 418
sequence length 434
ec nomenclature ec 2.3.1.99: Quinate O-hydroxycinnamoyltransferase.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g2mA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g2mA01
2I9DA 3CLAA 5KJTA 3FOTA 2VSQA 2XR7A 1DPBA 5KJVA 1PD5A 2IHWA 2RKVA 4JN3A 5DU9A 3U9BA 5KJUA 1CLAA 2II5A 3FP0A 4KECA 3B30A 1CIAA 5FANA 2RKTA 1XL7A 4G22A 5KJSA 2E1TA 4JN5A 3L60A 1E2OA 5DUAA 4HVMA 1EAEA 1XL8A 3U9FA 1EAAA 1C4TA 4N72A 4CLAA 1EAFA 1Q23A 4G2MA 1QCAA 2II3A 1EABA 1NOCB 2II4A 2XHGA 2ZBAA 4G0BA 1DPDA 2E1UA 4KE4A 1L5AA 1DPCA 1XMCA 1SCZA 5T3EA 3B2SA 2CLAA 1XMDA 5FALA 2BGHA 2E1VA 5KJWA 1EACA 3MAEA 2JGPA 1Q9JA 1EADA
chains in the Genus database with same CATH superfamily
2VSQA 2XR7A 2H3PA 2IHWA 1NDBA 2II5A 3FP0A 4KECA 4EPHA 5FANA 1Q6XA 1NM8A 1C4TA 4G2MA 2H3WA 2FY3A 3B2SA 2JGPA 1T7QA 1EADA 3FOTA 2FW3A 5KJVA 3U9BA 1T7NA 2RKTA 1S5OA 4G22A 5KJSA 1NDFA 4JN5A 3L60A 1E2OA 3U9FA 1XL8A 1QCAA 1EABA 2XHGA 4KE4A 1DPDA 1T7OA 5T3EA 1T1UA 1SCZA 1XMDA 1EACA 2ZBAA 5KJTA 2H3UA 2FY5A 5KJUA 2H4TA 1XL7A 2FY2A 4N72A 4CLAA 5DU9A 2II4A 4G0BA 2E1UA 4EYWA 2CLAA 1NDIA 2BGHA 5FALA 2E1VA 3MAEA 2RCUA 1Q9JA 2I9DA 3CLAA 2FY4A 1DPBA 1PD5A 4JN3A 2RKVA 1CLAA 3B30A 1CIAA 4EP9A 2E1TA 4HVMA 5DUAA 1EAEA 1EAAA 1EAFA 2FYOA 1Q23A 2II3A 1NOCB 1L5AA 1DPCA 1XMCA 2DEBA 5KJWA
chains in the Genus database with same CATH topology
2I9DA 3CLAA 5KJTA 3FOTA 2VSQA 2XR7A 1DPBA 5KJVA 1PD5A 2IHWA 2RKVA 4JN3A 5DU9A 3U9BA 5KJUA 1CLAA 2II5A 3FP0A 4KECA 3B30A 1CIAA 5FANA 2RKTA 1XL7A 4G22A 5KJSA 2E1TA 4JN5A 3L60A 1E2OA 5DUAA 4HVMA 1EAEA 1XL8A 3U9FA 1EAAA 1C4TA 4N72A 4CLAA 1EAFA 1Q23A 4G2MA 1QCAA 2II3A 1EABA 1NOCB 2II4A 2XHGA 2ZBAA 4G0BA 1DPDA 2E1UA 4KE4A 1L5AA 1DPCA 1XMCA 1SCZA 5T3EA 3B2SA 2CLAA 1XMDA 5FALA 2BGHA 2E1VA 5KJWA 1EACA 3MAEA 2JGPA 1Q9JA 1EADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9D A;  3CLA A;  5KJT A;  3FOT A;  2VSQ A;  2XR7 A;  1DPB A;  5KJV A;  1PD5 A;  2IHW A;  2RKV A;  4JN3 A;  5DU9 A;  3U9B A;  5KJU A;  1CLA A;  2II5 A;  3FP0 A;  4KEC A;  3B30 A;  1CIA A;  5FAN A;  2RKT A;  1XL7 A;  4G22 A;  5KJS A;  2E1T A;  4JN5 A;  3L60 A;  1E2O A;  5DUA A;  4HVM A;  1EAE A;  1XL8 A;  3U9F A;  1EAA A;  1C4T A;  4N72 A;  4CLA A;  1EAF A;  1Q23 A;  4G2M A;  1QCA A;  2II3 A;  1EAB A;  1NOC B;  2II4 A;  2XHG A;  2ZBA A;  4G0B A;  1DPD A;  2E1U A;  4KE4 A;  1L5A A;  1DPC A;  1XMC A;  1SCZ A;  5T3E A;  3B2S A;  2CLA A;  1XMD A;  5FAL A;  2BGH A;  2E1V A;  5KJW A;  1EAC A;  3MAE A;  2JGP A;  1Q9J A;  1EAD A; 
#chains in the Genus database with same CATH topology
 2VSQ A;  2XR7 A;  2H3P A;  2IHW A;  1NDB A;  2II5 A;  3FP0 A;  4KEC A;  4EPH A;  5FAN A;  1Q6X A;  1NM8 A;  1C4T A;  4G2M A;  2H3W A;  2FY3 A;  3B2S A;  2JGP A;  1T7Q A;  1EAD A;  3FOT A;  2FW3 A;  5KJV A;  3U9B A;  1T7N A;  2RKT A;  1S5O A;  4G22 A;  5KJS A;  1NDF A;  4JN5 A;  3L60 A;  1E2O A;  3U9F A;  1XL8 A;  1QCA A;  1EAB A;  2XHG A;  4KE4 A;  1DPD A;  1T7O A;  5T3E A;  1T1U A;  1SCZ A;  1XMD A;  1EAC A;  2ZBA A;  5KJT A;  2H3U A;  2FY5 A;  5KJU A;  2H4T A;  1XL7 A;  2FY2 A;  4N72 A;  4CLA A;  5DU9 A;  2II4 A;  4G0B A;  2E1U A;  4EYW A;  2CLA A;  1NDI A;  2BGH A;  5FAL A;  2E1V A;  3MAE A;  2RCU A;  1Q9J A;  2I9D A;  3CLA A;  2FY4 A;  1DPB A;  1PD5 A;  4JN3 A;  2RKV A;  1CLA A;  3B30 A;  1CIA A;  4EP9 A;  2E1T A;  4HVM A;  5DUA A;  1EAE A;  1EAA A;  1EAF A;  2FYO A;  1Q23 A;  2II3 A;  1NOC B;  1L5A A;  1DPC A;  1XMC A;  2DEB A;  5KJW A; 
#chains in the Genus database with same CATH homology
 2I9D A;  3CLA A;  5KJT A;  3FOT A;  2VSQ A;  2XR7 A;  1DPB A;  5KJV A;  1PD5 A;  2IHW A;  2RKV A;  4JN3 A;  5DU9 A;  3U9B A;  5KJU A;  1CLA A;  2II5 A;  3FP0 A;  4KEC A;  3B30 A;  1CIA A;  5FAN A;  2RKT A;  1XL7 A;  4G22 A;  5KJS A;  2E1T A;  4JN5 A;  3L60 A;  1E2O A;  5DUA A;  4HVM A;  1EAE A;  1XL8 A;  3U9F A;  1EAA A;  1C4T A;  4N72 A;  4CLA A;  1EAF A;  1Q23 A;  4G2M A;  1QCA A;  2II3 A;  1EAB A;  1NOC B;  2II4 A;  2XHG A;  2ZBA A;  4G0B A;  1DPD A;  2E1U A;  4KE4 A;  1L5A A;  1DPC A;  1XMC A;  1SCZ A;  5T3E A;  3B2S A;  2CLA A;  1XMD A;  5FAL A;  2BGH A;  2E1V A;  5KJW A;  1EAC A;  3MAE A;  2JGP A;  1Q9J A;  1EAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...