4G2MA

Structure of a lys-hct mutant from coffea canephora (crystal form 2)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
434
structure length
418
Chain Sequence
MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for the biosynthesis of the major chlorogenic acids found in coffee.
pubmed doi rcsb
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
molecule tags Transferase
source organism Coffea canephora
total genus 117
structure length 418
sequence length 434
ec nomenclature ec 2.3.1.99: Quinate O-hydroxycinnamoyltransferase.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g2mA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g2mA01
3MAEA 1XMCA 4KE4A 1NOCB 5DU9A 2ZBAA 1XMDA 3FOTA 3B2SA 3L60A 4HVMA 1C4TA 2E1VA 1Q9JA 2I9DA 1EADA 1EAEA 5KJWA 1L5AA 2II4A 5KJTA 2E1UA 4JN5A 2II5A 2E1TA 3B30A 3FP0A 1DPBA 3U9FA 5FALA 1EAFA 4KECA 2IHWA 5FANA 2RKTA 1CIAA 2VSQA 2XHGA 2II3A 1EABA 1XL7A 3CLAA 1CLAA 5KJUA 5T3EA 1SCZA 2XR7A 5KJVA 1Q23A 1DPCA 2JGPA 2RKVA 5KJSA 4N72A 2BGHA 4JN3A 1QCAA 1EAAA 1E2OA 4G2MA 1PD5A 4G22A 1EACA 1DPDA 1XL8A 4G0BA 4CLAA 2CLAA 3U9BA 5DUAA
chains in the Genus database with same CATH superfamily
1T1UA 4KE4A 4EPHA 1C4TA 1NDIA 5KJWA 1L5AA 2II4A 5KJTA 3FP0A 1EAFA 2IHWA 2XHGA 5T3EA 1Q23A 1DPDA 2FY4A 1XL8A 1NOCB 2FYOA 5DU9A 3FOTA 1Q9JA 2H4TA 2E1UA 3B30A 1NM8A 3U9FA 5FALA 1NDBA 1S5OA 3CLAA 2XR7A 1DPCA 5KJSA 4N72A 4EP9A 1NDFA 4G22A 2FW3A 1T7OA 3MAEA 2FY5A 1XMDA 3L60A 3B2SA 4HVMA 2H3PA 2I9DA 1EAEA 4JN5A 2E1TA 1DPBA 4KECA 5FANA 2RKTA 1CIAA 4EYWA 2H3UA 2FY2A 2FY3A 1EABA 5KJUA 1CLAA 5KJVA 2JGPA 2BGHA 1EAAA 4G2MA 2DEBA 2RCUA 4G0BA 2CLAA 3U9BA 1XMCA 2ZBAA 2E1VA 1EADA 2II5A 2VSQA 2II3A 1T7QA 1XL7A 1SCZA 2RKVA 2H3WA 4JN3A 1QCAA 1Q6XA 1E2OA 1PD5A 1T7NA 1EACA 4CLAA 5DUAA
chains in the Genus database with same CATH topology
3MAEA 1XMCA 4KE4A 1NOCB 5DU9A 2ZBAA 1XMDA 3FOTA 3B2SA 3L60A 4HVMA 1C4TA 2E1VA 1Q9JA 2I9DA 1EADA 1EAEA 5KJWA 1L5AA 2II4A 5KJTA 2E1UA 4JN5A 2II5A 2E1TA 3B30A 3FP0A 1DPBA 3U9FA 5FALA 1EAFA 4KECA 2IHWA 5FANA 2RKTA 1CIAA 2VSQA 2XHGA 2II3A 1EABA 1XL7A 3CLAA 1CLAA 5KJUA 5T3EA 1SCZA 2XR7A 5KJVA 1Q23A 1DPCA 2JGPA 2RKVA 5KJSA 4N72A 2BGHA 4JN3A 1QCAA 1EAAA 1E2OA 4G2MA 1PD5A 4G22A 1EACA 1DPDA 1XL8A 4G0BA 4CLAA 2CLAA 3U9BA 5DUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAE A;  1XMC A;  4KE4 A;  1NOC B;  5DU9 A;  2ZBA A;  1XMD A;  3FOT A;  3B2S A;  3L60 A;  4HVM A;  1C4T A;  2E1V A;  1Q9J A;  2I9D A;  1EAD A;  1EAE A;  5KJW A;  1L5A A;  2II4 A;  5KJT A;  2E1U A;  4JN5 A;  2II5 A;  2E1T A;  3B30 A;  3FP0 A;  1DPB A;  3U9F A;  5FAL A;  1EAF A;  4KEC A;  2IHW A;  5FAN A;  2RKT A;  1CIA A;  2VSQ A;  2XHG A;  2II3 A;  1EAB A;  1XL7 A;  3CLA A;  1CLA A;  5KJU A;  5T3E A;  1SCZ A;  2XR7 A;  5KJV A;  1Q23 A;  1DPC A;  2JGP A;  2RKV A;  5KJS A;  4N72 A;  2BGH A;  4JN3 A;  1QCA A;  1EAA A;  1E2O A;  4G2M A;  1PD5 A;  4G22 A;  1EAC A;  1DPD A;  1XL8 A;  4G0B A;  4CLA A;  2CLA A;  3U9B A;  5DUA A; 
#chains in the Genus database with same CATH topology
 1T1U A;  4KE4 A;  4EPH A;  1C4T A;  1NDI A;  5KJW A;  1L5A A;  2II4 A;  5KJT A;  3FP0 A;  1EAF A;  2IHW A;  2XHG A;  5T3E A;  1Q23 A;  1DPD A;  2FY4 A;  1XL8 A;  1NOC B;  2FYO A;  5DU9 A;  3FOT A;  1Q9J A;  2H4T A;  2E1U A;  3B30 A;  1NM8 A;  3U9F A;  5FAL A;  1NDB A;  1S5O A;  3CLA A;  2XR7 A;  1DPC A;  5KJS A;  4N72 A;  4EP9 A;  1NDF A;  4G22 A;  2FW3 A;  1T7O A;  3MAE A;  2FY5 A;  1XMD A;  3L60 A;  3B2S A;  4HVM A;  2H3P A;  2I9D A;  1EAE A;  4JN5 A;  2E1T A;  1DPB A;  4KEC A;  5FAN A;  2RKT A;  1CIA A;  4EYW A;  2H3U A;  2FY2 A;  2FY3 A;  1EAB A;  5KJU A;  1CLA A;  5KJV A;  2JGP A;  2BGH A;  1EAA A;  4G2M A;  2DEB A;  2RCU A;  4G0B A;  2CLA A;  3U9B A;  1XMC A;  2ZBA A;  2E1V A;  1EAD A;  2II5 A;  2VSQ A;  2II3 A;  1T7Q A;  1XL7 A;  1SCZ A;  2RKV A;  2H3W A;  4JN3 A;  1QCA A;  1Q6X A;  1E2O A;  1PD5 A;  1T7N A;  1EAC A;  4CLA A;  5DUA A; 
#chains in the Genus database with same CATH homology
 3MAE A;  1XMC A;  4KE4 A;  1NOC B;  5DU9 A;  2ZBA A;  1XMD A;  3FOT A;  3B2S A;  3L60 A;  4HVM A;  1C4T A;  2E1V A;  1Q9J A;  2I9D A;  1EAD A;  1EAE A;  5KJW A;  1L5A A;  2II4 A;  5KJT A;  2E1U A;  4JN5 A;  2II5 A;  2E1T A;  3B30 A;  3FP0 A;  1DPB A;  3U9F A;  5FAL A;  1EAF A;  4KEC A;  2IHW A;  5FAN A;  2RKT A;  1CIA A;  2VSQ A;  2XHG A;  2II3 A;  1EAB A;  1XL7 A;  3CLA A;  1CLA A;  5KJU A;  5T3E A;  1SCZ A;  2XR7 A;  5KJV A;  1Q23 A;  1DPC A;  2JGP A;  2RKV A;  5KJS A;  4N72 A;  2BGH A;  4JN3 A;  1QCA A;  1EAA A;  1E2O A;  4G2M A;  1PD5 A;  4G22 A;  1EAC A;  1DPD A;  1XL8 A;  4G0B A;  4CLA A;  2CLA A;  3U9B A;  5DUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...