4G2NA

Crystal structure of putative d-isomer specific 2-hydroxyacid dehydrogenase, nad-binding from polaromonas sp. js6 66
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
319
structure length
319
Chain Sequence
PIQKAFLCRRFTPAIEAELRQRFDLEVNLEDTVLTPSGIASRAHGAEVLFVTATEAITAEVIRKLQPGLKTIATLSVGYDHIDMAAARSLGIKVLHTPDVLSDACAEIAMLLVLNACRRGYEADRMVRSGSWPGWGPTQLLGMGLTGRRLGIFGMGRIGRAIATRARGFGLAIHYHNRTRLSHALEEGAIYHDTLDSLLGASDIFLIAAPGRPELKGFLDHDRIAKIPEGAVVINISRGDLINDDALIEALRSKHLFAAGLDVFANEPAIDPRYRSLDNIFLTPHIGSATHETRDAMGWLLIQGIEALNQSDVPDNLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding from Polaromonas sp. JS6 66
rcsb
source organism Polaromonas sp. js666
molecule tags Oxidoreductase
molecule keywords D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
total genus 100
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4g2nA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4g2nA01
3BHIA 4RZIA 4BO3A 3W4KA 1BDBA 1DXYA 2P9EA 4RORA 2UYYA 1LNQA 4MKXA 4R1TA 3GVIA 4U0KA 3W8EA 3WJAA 1K6JA 3C7AA 1T4BA 1X13A 2Y93A 4MIYA 4N7RA 4R4JA 5G0UA 4MP8A 1WZIA 3D4OA 4H15A 1PGPA 2RIRA 1QV7A 1WMAA 1M76A 1SC6A 4CM7A 5TGDA 3FR8A 4II3A 3AY3A 1YONA 4JJGA 3PZBA 4ND2A 1JDJA 1RM0A 2NTJA 3A14A 3RKRA 4Y8VA 4J7UA 5L95A 1BXGA 1XCBA 1H2BA 5THKA 1SOVA 3ANMA 3MWDB 4CLRB 4E32A 1RM3A 3BMCB 2DC1A 2BMAA 1H6CA 1U28A 5CEFA 2NU8A 2V6GA 1QKIA 4JJIA 1JA9A 1R0LA 3MOIA 3DONA 4DWVA 4N54A 4CLDA 4YPOA 1NPTO 4IIVA 1GYRA 2Q4EA 1ZK2A 1ZSYA 2XPCA 4EITA 1JTVA 2HUNA 3I9JA 3CPSA 4YT5A 4DGSA 3JQEA 3WQQA 1ZIDA 3NGXA 1DBVO 2YDYA 2AMFA 3VKUA 5JAMA 2ZQYA 1Z6ZA 3QVTA 5ILGA 3ZHBA 4UVHA 2X6TA 2IXAA 3MJSA 5TIIA 4B4UA 1HE3A 1DEHA 5A9TA 2NU7A 4J3FA 4IGEA 4RGBA 1CYDA 4K28A 3EW7A 1YL7A 4R41A 4XIYA 3HJAA 2Q50A 1PJLA 1DIHA 3BMCA 1XA0A 3GGGA 4E4YA 2GNAA 4E2ZA 3AI3A 3UHAA 5ER6A 1E3IA 3OEYA 4U6SA 1Y81A 1MC4A 5DT9A 3I9NA 1X7DA 3KTDA 1UP6A 3KRTA 3STHA 4YRAA 1ZSNA 4E2XA 3HSKA 4YRDA 3T4XA 1E3WB 2FZEA 2GLXA 2R00A 3GDFA 2CDCA 2PFGA 4BKOA 5IJZA 4RZHA 4FC7A 3WICA 5EQDA 3W4JA 3ORFA 1N1GA 5JDCA 3RWBA 4GSLA 4KMSA 3VTZA 1X15A 3CUKA 1LU9A 1NAIA 5K6AC 3RVDA 4AJKA 1RWBA 5I9NA 4D42A 2AQHA 2X9NA 4MKZA 3R6DA 1E7MA 1E5LA 1JAXA 4ALKA 2NUAA 3PP8A 1LI4A 1M6HA 1FXSA 3COSA 2HMUA 3H3FA 4MVJM 4CUJA 1QORA 4RDHA 1EMDA 1P1IA 2BKAA 4ID9A 5HM8A 4Q3EA 1FJHA 5ICSA 1KVTA 1YOVB 2PH3A 3INTA 4XR9A 4PLHA 3CZRA 4CJXA 3JQ9A 3T7EA 4O59O 3RQSA 3FNFA 1NR1A 3AOEA 3IOYA 9LDBA 1TA4A 1D1SA 3KBOA 3JQ6A 1KVUA 1B0AA 1HYGA 1PL6A 2VNAA 4DQVA 4ESOA 3UN1A 3F1KA 1LLCA 4D7AA 1GTMA 4IZHA 3M1LA 4Y6PA 3TNLA 2GSDA 3WX0A 4BHTA 3QWIA 3DHYA 4NK5A 3S2FA 2ET6A 2GZ2A 3DXFA 4E5YA 3OH8A 1WDLA 2CVQA 1Q7CA 3PZRA 2D5AA 3PHLA 1PSDA 1HTBA 2DLDA 2OL4A 1R4NA 3WFJA 4S1VA 2FRDA 3U09A 2AQ8A 2BH9A 2C2YA 2V65A 4BQPA 5DDIP 5CAEA 1AHHA 2CZCA 3I6IA 4WCFB 1UZLA 4MVJI 1BW9B 1PZFA 1U3WA 1ZFNA 2ZJ0A 3HHPA 4QT0A 1Q0HA 4NU5A 4WOJA 3SEFA 4JN6B 3W4IA 4CLRA 1ZZEA 1U4OA 4N18A 3BMQB 1YB1A 3B6ZA 3BMOA 3AOEC 4J1SA 1QMGA 5JYDA 2D59A 5JW6A 3AWDA 1Y8RB 4NNJA 4NK4A 5TSDA 1EVZA 2I67A 3L4BA 1W4ZA 1VL8A 3L6DA 2Y0EA 5EMHA 2X86A 4WEOA 2Q99A 5JCXA 4DIBA 1I2ZA 2O50A 1DJQA 1OC4A 1J49A 4I1IA 1I01A 5EN4A 3UAGA 5C7OO 5HA5A 1Q7BA 4MVJG 4QFCA 1AHIA 3ZWAA 1XR3A 1WW8A 5JPIA 2JD1A 4H3VA 3LF1A 3W1VA 1ONPA 4D79A 4CMGA 5IFLA 1LDNA 2YFHA 3VKVA 1VL6A 3ETEA 3QVOA 5DBFA 1LQTA 4NFYA 4DMMA 1HDYA 4R1NA 3VPXA 1BDMA 4M86A 4PFJA 3KLPX 4M89A 4MOWA 2DUWA 3BMNA 1ZJZA 2NTNA 4XYMA 2PH5A 1IY8A 3V1UA 4W82A 5BSEA 2DVMA 3O03A 2O7QA 3F47A 4L4XA 2C5EA 3ZCXA 4PCVA 4OHUA 1I5RA 2OGUA 5A3VA 3TQHA 3DMYA 3QV1A 1AUPA 5JAIA 2P4QA 1IZ9A 4CMHA 2EV9A 2NQ8A 2C0CA 2NV6A 4O1MA 4NH4A 4WOKA 3ZZNA 1I2CA 4J1NA 1W0CA 1VRWA 2HRBA 4WLEA 2P5UA 3TOXA 3RUDA 2ZTUA 5ITWA 3SXPA 4CQLA 3ONFA 4FJ2A 5EJ2A 1ENOA 3IMFA 4YQYA 5F1KA 1NFFA 2GR9A 1Y8QB 3AUTA 3FWZA 3KYDB 4RF3A 3OIGA 4CM4B 1XYGA 4I9NA 3WG9A 1H6DA 4WASA 1C14A 1A72A 4NMHA 4MVJH 5COQA 3T7CA 1NQOA 4IJWA 2VWPA 4HADA 3QY9A 3NT2A 5F5NA 4P8RA 2EHDA 1LDYA 4KUGA 4WLVA 3TFQA 5KVVA 3UW3A 2Q1UA 2POQX 3WWZA 3AI1A 2WE8A 1NASA 4WE3A 2GERA 1NPYA 3BTUA 4BO0A 2JFFA 1ZK4A 1HETA 5J23A 1CDOA 3ROQA 2Z1MA 3RSHA 4RF2A 5ICMA 5DOZA 3EHEA 4J9VA 5JE8A 3KSZO 1T2DA 1PQWA 3AY7A 2VCYA 4MVJA 1PX0A 1QR6A 1YBMA 2YUTA 2D3TA 4DPKA 1UUFA 2H5LA 3WYCA 1E1MA 1ISIA 3GNQA 3I9KA 3HDYA 4WLFA 4D41A 1FDVA 1DFHA 3GLQA 3LYLA 2VWQA 3ST7A 5JC8A 3W8DA 4R9RA 1JKJA 4A5OA 2YDXA 4A03A 4XB1A 1GR0A 2G82A 1MG0A 3E9MA 4OAQA 3RFTA 3GVHA 4B4VA 5BSHA 3E5MA 2PV7A 4WLNA 1GDHA 4W9NC 2CVZA 4YA6A 3JV7A 4RVSA 4A27A 3C24A 3FNHA 3DBLB 4JNKA 1T2FA 2PR2A 2FMUA 4Z9FA 1M2WA 2OP1A 2F1KA 4Z9YA 4DPLA 4DIOA 3PYMA 1N7GA 3Q9NA 3DFZA 4YDRA 5G0SA 5B4TA 3ANLA 3MZ0A 4BNLA 1ADFA 1VJ1A 3OETA 1XQ6A 3FSRA 1UDAA 4ZJUA 1QYWA 2YYYA 1W8DA 1X0XA 1F8GA 2GN9A 4L8VA 1KBZA 2GN6A 5ER9A 2HK8A 1UH5A 3NKLA 3LVFO 1RYDA 5AXAA 3BYZA 5A05A 1BXGB 2JD2A 4J7XA 3Q6IA 1P1HA 2QRKA 4QSMA 2Y05A 5ITVA 1ZO8A 4IM7A 4EYEA 1P74A 4CM1A 4ZN6A 1Z7BA 2YQ4A 1B7GO 4XYEA 1JVBA 3OJOA 4BNTA 1MFZA 2CFCA 3CZMA 3LT0A 1KC1A 4AJHA 2W8ZA 1YRLA 4IDAA 1OAAA 3K2EA 2PKQP 5EQFA 4RVDA 1LX6A 4IQ8A 3TRIA 4UEJA 2EW8A 2WEKA 4YBZA 1X1EA 3GPDG 3C7CB 5JFOA 3DR3A 1A7KA 1NAHA 4XKJA 3WGZA 3GC6A 3GDOA 4J7CA 2YQ5A 3QVSA 4Q3CA 4ZQFA 5DBIA 1E5QA 2PGLA 4BGVA 4KOAA 4YAJA 2GASA 3V2HA 4AJOA 4TROA 4N5LA 3PQFA 1OMOA 3GFGA 4JIGA 4J0FA 2O4UX 4AG3A 3WTCA 2ZYDA 1E7SA 3GGOA 4FBGA 3NDRA 1MX3A 3QIVA 1ISJA 2FPGA 2VQ3A 3GF4A 3H3JA 3FN4A 4CM5A 3FF4A 5B12A 1XSEA 2X9VA 1WPQA 3K5PA 3B1KA 2OP0A 1ZCJA 4EJMA 2PNFA 2Q1TA 3EZYA 3PVZA 2Y0DA 5IZCA 2AE1A 2PKRA 4R69A 1YKFA 2NU6A 4GKBA 4I5EA 1C0LA 3OIFA 3HB4X 3SJ7A 4D0RA 3MJTA 2J5KA 4M8SA 4DQXA 4TVBA 1DDOA 3BZUA 4PLWA 4KWIA 1XU9A 3PHHA 4M55A 4YQZA 4AICA 1T25A 4XQEA 4D44A 1P31A 2Q1SA 3A9WA 1P1RA 1C0PA 4XWYA 3ENKA 1Y9AA 3BXXA 2JFHA 4OL9A 4BKQA 3L77A 2GPTA 1LC0A 4YJGB 1ZK0A 4D43A 4EW6A 1K6XA 3KV3O 1ISGA 4KQWA 3ITDA 2J5RA 3WNQA 1GEGA 4Q39A 3ZHZA 2EJVA 1XLTA 4Y67A 5L40A 4GWKA 3PGJA 3PLRA 1IPFA 1LLDA 2BGMA 3C8MA 3QJ5A 1UZNA 4YJDA 4PGFA 3QVXA 5KVCA 3FHLA 3DMTA 4ONEA 3GOHA 4JGBA 4HFRA 2VHWA 4H16A 3ZI0A 1XWFA 2BGKA 1EFKA 4INAA 2WM3A 2YHIA 2VHXA 2YZ7A 3FPLA 4TRNA 4XRGA 4J2OA 4OSPA 1QSGA 1GZ4A 1ORRA 3F6YA 3OMLA 5MDHA 3OA0A 3LSYA 1R0SA 2PKQO 1Y7TA 2BI7A 3GUYA 4QX6A 1VC2A 4ZQEA 1EUDA 3EK2A 1ZNQO 2J3JA 3GEGA 2FY8A 1UP7A 3RC7A 3GGPA 2AEFA 3BMQA 4YCAA 7ADHA 1HYEA 1X7HA 3WGYA 1RJWA 2OO5A 5L7TA 5KIAA 1QXSA 1JN0A 4HV4A 4Q9NA 1JVSA 1EQUA 3KUXA 4NPCA 1PL7A 1I8TA 1UXGA 1HSZA 1E7RA 1KY4A 3AJRA 1MB4A 1JKIA 2VWHA 1BMDA 2X8LA 3H9QA 4DBZA 1L7DA 3AM5A 3WGOA 1JW9B 1UR5A 4GMGA 1UAYA 5FFFA 5BT9A 1C1XA 3ZWNA 3B70A 2D1YA 4R3NA 2G0TA 1Q7GA 1VM6A 3I5MA 1N9GA 4BO6A 4WUVA 1DRVA 2Y67A 4Z0TA 3NX4A 3HWRA 1GEEA 4ZA2A 1DOHA 1BVRA 4BS9A 5K6AA 4KDEA 4L73A 2QX7A 3OSUA 2EJWA 1NFRA 5F5LA 1Y1PA 2X0NA 3WFIA 1PJCA 1J6UA 5EPOA 3OJ0A 4Z0HO 2VHYA 1HDXA 2Y1DA 3B1JA 3EC7A 2WD7B 1Q0LA 3CINA 1VSVA 3R1IA 4I5DA 4J4HA 1NPDA 4NJOA 4ZRMA 2W90A 3NDIA 1GZ6A 3BIOA 3U49A 6ADHA 4W99A 2UUPA 3C3XA 5C5IA 2DKNA 2DPGA 2QZZA 3WMXA 4TRMA 1HE4A 3ROMA 2PTGA 3DBRA 1YH3A 1E6UA 2PGDA 3F9IA 2ZTLA 3OFSA 4DIFA 2G5CA 4IQGA 4PZDA 3U4HA 3EAGA 3I83A 2EG9A 2PZJA 2XOXA 4EUEA 4RPHA 3VDQA 3ADPA 3CMMA 1O89A 3JTMA 3I52A 2NSDA 4MP6A 1GUYA 2VT2A 4PG4A 2YJZA 3LQFA 4EEXA 5GMOA 2ZJ1A 2Y1EA 1YDWA 3D1LA 3O8QA 4E33A 3LU1A 3F3SA 1E0DA 4K6FA 1N5DA 2AE2A 2H9IA 5KNLA 5A1TA 4JBGA 2VYNA 3MJVA 5B4UA 2JKVA 3JQCA 1PJ2A 4HY3A 3BTOA 5CEEA 2QYTA 3U4DA 5T8KA 5F3RA 5HS4A 2GCGA 2CY0A 4MINA 3O9ZA 1U9JA 2P2SA 4YVFA 1Y5RA 1PZGA 3EYWA 1KVSA 2XF8A 3WLEA 1NYTA 4TMFA 5JDCC 3SBOA 1B8VA 2EGHA 1G0OA 3SVTA 1UAGA 4Z9XA 3NJ8A 3TJRA 4YJHA 3ADOA 3VPHA 5L51A 1S7CA 3D64A 1RYEA 3D3EA 3SX2A 4CM4A 3O38A 5HWSA 4J4BA 3Q0EA 5KKAA 3WGTA 1TVEA 1F12A 4AJEA 2O3UA 6LDHA 1TI7A 2HCTA 1T2CA 4R5HA 3KVOA 1HDCA 1PS9A 3ZV6A 5L4NA 2EF1A 3GNSA 2NACA 3GNTA 4YAIA 5K9ZA 4U0JA 1GQ2A 1Y6JA 2FSVA 3CEAA 1Z45A 2O3RA 3ZN2A 2AHRA 1DC5A 1QYVA 2Q4BA 3D5QA 3TDKA 5JXWA 2HMSA 1A9ZA 3FNGA 2O2SA 2YV1A 3ZWCA 5JY6A 2IYPA 2NTVA 2IYOA 1B3BA 3GH3A 3PHJA 1X7GA 1LLQA 5ENDA 4ROSA 1EUCA 4OOFA 2WMDA 2I6TA 5FF9A 3GAFA 3KLMX 3WGQA 4HX5A 5KJEA 4DBVO 3UOGA 3E9NA 3FWNA 4Z3KA 4O6VA 2EWMA 3BAZA 1O6ZA 2OBYA 4GLLA 1UDCA 4II2A 4CLOB 4RF5A 3WBFA 3NGLA 4FFMA 3GRKA 4CLEA 5G4KA 4BUCA 4I9HA 1GU7A 2J6IA 4FFPA 3DAPA 1H94A 4RVUA 8LDHA 4LMRA 4TVOA 1U4SA 4LSMA 3QP9A 2VRCA 5TT0A 2P9CA 2X23A 4YB8A 3EUWA 4R51A 5KJFA 1C1DB 2GRAA 1RM4A 1PGQA 4IMRA 3DAGA 4RPJA 4PG8A 2VRBA 1I10A 3E8XA 5BSGA 1DC4A 5IDWA 1ZEMA 4IINA 4I5GA 4R16A 4TSKA 4PN3A 3I9MA 4PZEA 4D0SA 3QWHA 1P3DA 3F5SA 3JYLA 4D46A 4YT4A 3WYBA 3FRJA 3UVEA 2Q2QA 3UF0A 2Q3EA 5I8ZA 4DTIA 1HL3A 4BNMA 5CDYA 3H5AA 1ARZA 1IL0A 2PK3A 3WBBA 5IDQA 4YEDA 5HBRA 1SEPA 4OXNA 4DREA 1G6KA 1NNUA 3AU9A 1EK5A 4ALMA 3GY0A 2C2XA 1KS9A 4CLXA 3GG2A 4QUKA 3HG7A 2NWQA 5H82A 3PYLA 3U3XA 3WGIA 3O4RA 1E3EA 3PFWO 2FPPA 3QVWA 1ISMA 1UP4A 1U2GA 2NADA 5L4SA 4R9SA 5AQ1A 3IIEA 5JDIA 3DO5A 1A27A 1HRDA 3QW2A 1T26A 3UUWA 3BMNB 2H6EA 3I6QA 3HE3A 4RVGA 3L9XA 5CDTA 3FBGA 2B4TO 1SOWA 3CTMA 3QHAA 3FNEA 2PGJA 4OXKA 4MVJE 5A5FA 4XDYA 1WXDA 3OQ1A 3D4NA 4GVXA 4YAEA 2F00A 1BSVA 1K2WA 5BNFA 3DDNA 2DBRA 4WEQA 3P5SA 1Q1NA 2GO1A 3KYCA 3DAFA 5CHEA 3KSUA 4JJFA 2HLPA 3VZQA 5HRUA 1ONNA 2IEBA 1HSOA 3HDQA 3ROKA 2ZATA 3A1NA 4IBOA 4XR4A 3OJFA 5DP1A 3PLNA 4ND4A 1MC5A 1AXEA 2WD7A 3P2OA 3AM3A 1H6AA 4JBIA 4ZQBA 1TLTA 3WIEA 4W7HA 4E0BA 4JP3A 3G3EA 4RPKA 4HFNA 4W7IA 1N92A 3RUHA 1LDBA 1MP0A 1XELA 1E1KA 3DC2A 3P2YA 3IDSA 5IN4A 2HO5A 1FK8A 3C7DB 4YJFB 2GDZA 1U3VA 3PK0A 2BHLA 1HXHA 2JHGA 2QRJA 4IDEA 1WDKA 4RQTA 2HKIA 1YQDA 4IXWA 1KVQA 4TZKA 2X0JA 2QW8A 3G79A 2O7SA 4OO3A 4IS3A 3K8ZA 5G2OA 5DBGA 4WNIA 1CETA 1CF2O 4JK3A 2ZB8A 3GZNA 1MA0A 2AQIA 3O8QB 2VOJA 4NZ9A 3WLFA 5A02A 1P0FA 3ZV4A 4DC1A 4HFJA 1BWSA 3RUFA 1GZ3A 4F6CA 1R12A 2X0IA 4Y98A 5THQA 4EJ0A 3FR7A 5CDGA 4RV9A 3JQBC 4A7PA 2X9GA 1ADCA 3DBHB 4HXYA 2VTEA 3EVTA 4BNXA 3A28A 2O3TA 2GGSA 1VLLA 2OOSA 4LW8A 3INGA 4LGVA 4NR0A 1EZ4A 3RC1A 1IOLA 1ZXBA 4OKIA 2DPHA 3P7MA 3EGOA 5KWEA 1X0VA 2ZK7A 1I33A 4U7WA 3GG9A 4OMUA 4EGFA 2FR1A 2XXBA 2X5KO 4CM9A 1F06A 3OJLA 3WGHA 4AJJA 5CG2A 4OOEA 4GGOA 3K2BA 4IZIA 4WGGA 2EEZA 1XEAA 3PDUA 4O5OA 3GVCA 3DBVO 1PQUA 2DFVA 4YJFA 4BMNA 2EXXA 3IUPA 4L4RA 2VZ8A 3R3JA 4ZRNA 2VUUA 2ZCUA 4AJ4A 2CF5A 4YJGA 4R3WA 3GHHA 4JP2A 1KC3A 4R1UA 1YB5A 1OC2A 1YJ8A 3S55A 4JX8A 2PZLA 5AXCA 1ML3A 1P1JA 3MJCA 3GZ4A 1ZBQA 4L9RA 1BXKA 5U4QA 3S2GA 4CM9D 2C7GA 3SLKA 1U5CA 1WP4A 3LC2O 3U4IA 4B79A 1KVRA 5F1OA 1CQIA 1I0ZA 4CMEC 4IDBA 5LDGA 3LZ6A 4J49A 3FD8A 1XU7A 4PLYA 2G17A 2Q1WA 3LDHA 4FGSA 1I3MA 1IUKA 3A06A 5JAQA 2VHZA 2JAPA 1H9BA 4RVHA 1NXQA 1K89A 1WVGA 3CIFA 2PD3A 2IRWA 1O95A 4FR5A 4NBWA 4U8GA 4CUKA 5JYEA 3AOGA 1RM5A 3BMOB 2Y1FA 3QLJA 3ON5A 3ZU4A 4E5MA 4AL4A 1SB8A 2PY6A 4Z0PA 5IF3A 1NHWA 5BSFA 4XJSA 1EVJA 5TS3A 4A73A 4PRKA 3C1TA 3I3OA 3NV9A 2E6UX 3V2UA 4ND3A 3DZJA 3U5TA 3V5NA 3K9QO 1DFIA 4DC0A 2VNSA 1U7HA 1GYQA 2B83A 1CIVA 1H5QA 1C0IA 4BNYA 3V1TC 1FF9A 1A5ZA 5I7EA 2Q49A 3PIDA 1NR7A 4LSWA 1L7EA 5A03A 3ZV5A 1MXHA 4GL4A 2P5YA 3KYBA 4FJ0A 4DMLA 5IZCC 3K6JA 2OUIA 1GCOA 2AW5A 1UDBA 4B7CA 1ZW1A 5B4VA 2FHSA 1Q2XA 1QYXA 1SZJG 1T1SA 4FFOA 3QA9A 3AY6A 5LCXA 1T4DA 3VHRA 1UXIA 2E37A 4QXMA 3GR6A 4GAEA 4WK6A 3H2ZA 3JQ7B 4PRLA 4CMBA 1B15A 3GZNB 1LDGA 3PQEA 3WSVA 3L9WA 3DZKA 2PZMA 3NJ4A 4OH1A 3ETGA 3H7AA 3SC6A 1KYQA 1KEWA 4OKNA 3VPSA 3FPCA 3S1LA 4LCJA 4DLLA 5H83A 4PG6A 5T64A 5JSFA 3PQDA 3VDRA 4C7JA 4HKTA 2HJSA 3H5NA 1P33A 5JDIC 1M66A 3LC7O 2GZ1A 3RU7A 4RDIA 3RBZA 2VWGA 1U3UA 5AVOA 3RJ5A 2I66A 1F14A 3R3SA 3K30A 3Q11A 4FJ1A 4N5NA 2D0IA 2W2LD 3AM4A 3H4VA 3OF2A 4ZGWA 3DZBA 1VPDA 1CWUA 1F0YA 4BNNA 2HMTA 3JQAB 1XGKA 1FDSA 3H9UA 4E5NA 3QSGA 1E7YA 5A04A 4RLHA 2LDBA 4OSOA 4S3MA 2CDBA 3ANNA 4LRTB 3RASA 1ZVMA 1PJ4A 1IHYA 4NHEA 3R0IA 1YGYA 2JAHA 4NBUA 1EE2A 1W73A 2BFAA 3TZHA 4MIOA 5MGBA 1GUZA 2AXQA 2IZZA 4CL8A 2HJRA 3KOUA 4IDGA 4N5MA 2RH4A 2DT5A 5DP2A 3PDJA 4WKGA 2BELA 4C7KA 1YL6A 3JYOA 5IXSA 2P4HX 1Y5MA 3OEWA 4PLZA 1PU2A 3K73O 4EDFA 2HK9A 2VRCD 3ZDFA 3JQ8B 4GVLA 4ALIA 4HP8A 1KETA 4F46A 4GX2A 1HDZA 3G0OA 4YJHB 2VUSA 4ALLA 2H1SA 3VPFA 5JBIA 3VH3A 5HTOA 3IC5A 1Y8QA 2J3IA 2JCVA 2X4GA 1LSJA 3KB6A 4LK3A 1NQAO 2IZ1A 4BQRA 2J3HA 3JD1A 3NTRA 3GVPA 4RLSA 5GZ3A 2I99A 3UH1A 3U0BA 1BVUA 2RHCA 2WWRA 3UICA 2LDXA 4JXKA 1B3RA 2YV3A 4FW8A 2C7VA 2GZ3A 3N7UA 4CR8A 1ADGA 3UCXA 3VPGA 4CR6A 1SBYA 4W6ZA 2E4AA 1R16A 3E48A 1Z74A 4E2WA 4Z6KA 1IZ0A 1DC6A 1GY8A 4B8ZA 4EBFA 2GYYA 1DRUA 3RAJA 4CLHA 3JQ7A 1P1KA 3FCOA 2A94A 1HYHA 4OQZA 4U6QA 3JQBA 3ITKA 5IDYA 2FP4A 1AXGA 4Q3AA 4R5MA 3RU9A 3GN1A 3GMDA 3GRPA 1YQGA 3OP4A 3LT4A 4G2NA 1B16A 4TKLA 2IEDA 2V7PA 2EP5A 4B7UA 4BGIA 4UVIA 3JQFA 1EE9A 3NT5A 3RROA 4UUMA 3RFXA 1B14A 1D3AA 2G1UA 1GCUA 3MTGA 5A06A 1B8UA 2D4AA 4PLVA 4LVCA 2EKLA 1QLJA 4E3ZA 1P44A 3KSDO 4D3DA 2ZIZA 1PR3A 3H9GA 3WS7A 4OGWA 4E31A 1O8CA 2J5QA 3H9EO 1ULSA 2B4QA 1ENZA 4CQMB 4CQMA 3NRCA 3ZWMA 3PTZA 4W9NA 3IP3A 1W6UA 1QP8A 4IUYA 5CP8A 4K1LA 3DZHA 5G4KB 2CVOA 3PXXA 1U3TA 3ABIA 1OZAA 3M6IA 1LQUA 3MWEB 1ULUA 1LSOA 1BRMA 1NQ5A 2BF7A 2IXBA 4HWKA 3SC4A 3T4EA 3TPCA 2IDZA 9LDTA 3ICCA 1VSUA 1MG5A 1X1TA 3H9JA 1U2DA 2GF2A 3F1LA 3WIDA 3X2FA 1OFGA 1G0NA 4D3SA 4XCVA 1HF3A 2DTDA 1NQTA 1A4IA 1L1FA 2EERA 3ICPA 1VJ0A 1TXGA 4WNCA 4P4LA 5I7VA 1H93A 4L0QA 4PLFA 4GLOA 1PGJA 4CV0A 4GQAA 1MV8A 2HAEA 1A7AA 4A26A 1E7QA 2GUGA 1KOLA 1QG6A 3WXBA 3SJUA 4BOYA 1EDZA 1ZKMA 3P19A 2X1HA 3LT1A 1SO8A 4M54A 4URFA 3GUCA 3JD2A 2QRLA 1ENPA 4DYDA 5BQFA 1V9LA 2FOIA 4Z3DA 1I2BA 3ZWOA 3HFSA 5JS6A 1YDEA 1PGNA 4E13A 5H81A 3RFVA 1FDTA 4EJ6A 4BNJA 2C20A 5TRTA 4YRBA 2BI8A 5I9LA 3KO8A 4LMPA 4F6LA 3BTVA 4UREA 2EKPA 3AU8A 4ALJA 1MLDA 5EESA 1BGVA 2GN8A 1NVMB 1YVEI 2W98A 3JQGA 2IE0A 3DTTA 1SPXA 1ZK1A 5TF4A 3RCBA 1R37A 1GPJA 2I65A 2FR8A 8ADHA 1LEHA 1OOEA 4BGUA 4WLUA 4YYZA 4XGIA 4X54A 2UVDA 3DL2A 1MUUA 4CPDA 2XAAA 3TZ6A 2NVUA 3E6AA 1NWHA 3TL2A 4UUPA 4BKUA 4YAKA 3BHMA 2VTDA 5I9MA 2XXJA 4YT8A 3E1KA 5DULA 1FDUA 2I76A 1J5PA 1V3UA 3U9LA 4BMVA 2Q2WA 3RIHA 1I32A 1SEVA 5A9SB 4QECA 4CM3A 1I3LA 1GUFA 3PJDA 2UDPA 1BW9A 3JSAA 3A4VA 1PGOA 1PWZA 5AYVA 2V6BA 4EI2A 3D4PA 3ASVA 4HFMA 2RBEA 2BGLA 5JMPA 4A10A 4KZPA 5JO9A 3IJPA 1MGOA 1LLUA 2DTXA 1C0KA 1E7WA 3AUUA 3PJEA 4P4GA 1U8XX 2A92A 5BNIA 2R6JA 4BV8A 4PG7A 1P1FA 5BNTA 1R15A 1T24A 4FFRA 1K5HA 3ZNNA 4P4NA 4CLOA 2VYND 4TRRA 1KEUA 3LF2A 2FSSA 4YT2A 3V8BA 2AEJA 2ZTVA 4FGWA 3E03A 3ZNOA 5KVQA 2CD9A 5LDHA 2DM6A 1EK6A 2B5VA 4IPTA 1ID1A 1KERA 4FC6A 1GV0A 4XX0A 4DRYA 2EGGA 1GAEO 3JCZA 3W6ZA 4AJPA 3DBRB 1PZEA 1RKXA 3IJRA 1N2SA 4BIIA 3ZU2A 4Q3NA 1ZK3A 3VOSA 1DIGA 2O3JA 1LRJA 3EZLA 4OXYA 3X2EA 3ENNA 4RCVA 1JU9A 1V6AA 3GFBA 3OECA 5IDXA 4K6CA 4BNFA 4JLWA 5JLAA 5DZSA 3H65A 3LLSA 4LCEA 4GX5A 1V3TA 2FR0A 3IUSA 4M1QA 4PVDA 4WLOA 3PYXA 4YXFA 1J0XO 1I36A 1IPEA 1E77A 2V6FA 2JL1A 4BKPA 1K6IA 2YHUA 4XJTA 4EEZA 5L53A 3S8MA 2ZB7A 4A0SA 5I7SA 4K9DA 4P22A 1CRWG 3ZWXA 4Y9DA 1PJBA 1WAMA 3LK7A 1SCUA 3WTBA 3NTQA 4CMAA 5KJCA 2QIOA 3PFFA 3ZWWA 3CH6A 1ZSVA 4R54A 4CM8A 4CM8B 3ZH2A 2Q46A 3ONDA 1YBVA 2DBQA 3MTJA 1A71A 2FN7A 2Y68A 4FOOA 1FMCA 4F45A 3OQBA 5CEJA 1GV1A 2UV8A 1O94A 3I23A 4ZHSA 4QO7A 4FS3A 1OBFO 4UVDA 4GBJA 1GFSA 4E21A 2PLAA 4NI5A 2DQ4A 4XQ9A 3TZQA 5IG2A 3ZWYA 4R01A 1DB3A 4BMSA 2WD8A 1A9YA 1DLJA 4ILKA 4BO7A 5TC4A 3TFOA 1VE9A 4WECA 4BNZA 3OICA 5DCWA 4D45A 5L9AA 2OXIA 3L4SO 4J1QA 4LRSB 3UCEA 3AFMA 4UEOA 2CDAA 2WTBA 3RI3A 1K0UA 3PPIA 4GKVA 2R00C 1ZMOA 3K96A 1P0CA 1GQYA 5F1PA 1SAYA 3LT2A 3Q2IA 1HEUA 3K92A 4DPMA 1P45A 1TB4A 4I8XA 4BGEA 2AA3A 2B35A 3DOCA 3U62A 3JD4A 3NT4A 4XA8A 2QYSA 4FDAA 4ALNA 4P38A 2BLLA 4RQUA 4E5KA 2DAPA 2SCUA 4JCOA 2Y0CA 3RUAA 1PR9A 3F46A 3DOOA 4WPGA 3TZKA 4WCFA 1EBUA 1H6BA 5JMWA 3C1OA 3VH1A 1E3WA 1V35A 5T5QA 4RL6A 4UAGA 2CF6A 1PL8A 3DBHA 3N74A 3ZNPA 5FI5A 4HNGA 2AG8A 1YL5A 1HLDA 3HNPA 4AJ2A 1ZJYA 1Z75A 2HQ1A 2ZB3A 3TL3A 3VVCA 4B7XA 5TLSA 2Q45A 5IZ4A 3L4BC 2OHXA 5EIOA 3CXRA 3G1TA 4KWHA 1TT5A 4CMKA 4G5HA 4J16A 5DN9A 1DIAA 4BV9A 4CMJA 5B1YA 1DAPA 4NQZA 4ITUA 3QWAA 4XGKA 1QV6A 5AOVA 3RD5A 3QWBA 3NEPX 1EQ2A 1DJNA 3VC7A 4FB5A 2C29D 3GEMA 3IKTA 5G0TA 2GD1O 5EINA 1XHLA 1LA2A 4NJMB 3HN7A 5K0ZA 2QHXA 3I4CA 1I3NA 1LDMA 3Q3CA 2A9FA 4UVGA 1U5AA 1YJQA 3WMWA 3MCVA 2HK7A 3C85A 3Q9UA 5KKCA 1H0KA 5DOVA 4O63O 4B3IA 2B4RO 3TSCA 2B37A 2Y1GA 4FFLA 4L74A 4PLGA 4BNVA 5CG1A 4TRJA 1KEVA 2JCYA 3VTFA 4XZ3A 1UZMA 2NLOA 1LUAA 2IZ0A 3GMSA 4MIEA 3WQRA 2FPIA 1QYCA 3UKOA 4BO9A 2VN8A 3KXDA 1CJCA 1YOVA 1E6EA 1ZH8A 1ZEJA 4CMCA 2RH8A 1VL0A 1WLYA 1DHRA 3CE6A 3NUGA 3OHSX 3GN2A 1HKUA 4FD3A 4O0LA 4QFDA 3OIDA 2ZYAA 1ADBA 3FBTA 4TKMA 4J91A 1BTOA 2WE7A 4CR7A 1LSSA 5JAZA 4OYRA 2QQ5A 2EKQA 4GI2A 3UFXA 3QQPA 3PHGA 3MOGA 4B4WA 3PGXA 1Q0QA 3PIIA 1XKQA 4JBHA 3IP1A 5ENVA 3DOJA 1EDOA 4NU6A 3TZCA 5IAAA 4AJIA 4J6FA 4EUFA 3GPIA 2C82A 2DU8A 4PLTA 5T6BA 5COBA 1F17A 1DHTA 1E92A 1EFLA 1AE1A 2GN4A 2I5PO 1PJQA 2B69A 1R4MA 5EL0A 4BNKA 4GMFA 4Q3DA 4GPD1 3EMKA 4IGFA 1D7OA 3GAZA 4DA9A 2Y66A 1Z82A 1C1XB 1RPNA 4G65A 5DCUA 1LXCA 4C4OA 3DWFA 2X5OA 4BO5A 2Z5LA 2X22A 4QEDA 1P9LA 3FTNA 3KEOA 4XB2A 1KEPA 2BRUA 1I3KA 1QLHA 3GHYA 1E1NA 1M75A 4I9UA 1AGNA 2HDHA 4JROA 1DPGA 4YWJA 4W4TA 1P77A 5KJ6A 5L45A 5TQVA 4KUHA 2B0JA 1GL3A 2UAGA 4CV2A 2DTEA 1PIWA 1T2EA 4NBRA 4RPGA 1N8KA 3NYWA 5CFZA 3WWYA 1VKOA 2OBNA 3GK3A 5CPBA 1GPDG 1U8FO 3VVBA 4RJTA 2CUKA 5A5EA 5COAA 2FWMX 3WJ7A 3E9QA 2P68A 4BNGA 1S6YA 2QZ9A 1X14A 3ZW9A 2PD6A 3RBXA 3HB5X 4NBTA 5LC1A 1HZZA 2IODA 4CODB 5ES3A 4XIJA 3PI7A 5TJ9A 3I9OA 1JWAB 3JQAA 3JQFC 2RCYA 4J9UE 2EP7A 2X0RA 3VH2A 3ZU5A 3H5RA 3RC9A 3D0OA 3DQPA 3F4BA 3HDJA 3PWKA 1A4UA 1F8FA 2DUUA 2E48A 4IJUA 4BO4A 1HWYA 3B1FA 3PEFA 5AXDA 1Z73A 2B36A 3KYDA 5C37A 4NIMA 2I3GA 1T1RA 3M2TA 4BO2A 1C3VA 3B20A 5L7YA 3EY4A 1IB6A 3MEQA 1VI2A 2NM0A 4CUZA 4R1SA 3HUDA 1ENYA 3DHEA 5DNAA 3AW9A 1YBAA 1GADO 4LISA 4CQMD 3NAQA 1TT7A 1SNYA 1LBEA 2JCXA 2NVUB 4BO1A 4CMEA 1TT5B 3D5TA 3VH4A 4XD2A 3H6KA 3I4FA 1UXHA 4Y6SA 4E6PA 4DYVA 5JY1A 1V3VA 3WDSA 3S2EA 5JNLA 2I3AA 2O2YA 3JQ8A 4KDFA 1I24A 1DRWA 4TZTA 3DZIA 1R4NB 3CSDA 3KZVA 3JD0A 3MJEA 3E5RA 2ZCVA 1HT0A 1UJMA 1YXMA 4IS2A 3PWZA 3Q2KA 1KY5A 1EVIA 4J4TA 5ILOA 4BNHA 1D1TA 3QRWA 4QTZA 2P9GA 4MDHA 2ZYGA 1NWCA 2AG5A 4UULA 1N9GB 2YW9A 4NFHA 4PZCA 2C59A 2W2KA 3S2IA 2W2KB 4BNIA 2X58A 4JQCA 1B2LA 1B8PA 5U9CA 3F5QA 4UUNA 4EUHA 3ZHYA 5U1PA 1NVTA 3ZW8A 1ISHA 1NM5A 4NBVA 2WYVA 3E82A 1DLIA 4PIVA 5TX7A 2BD0A 1NX6A 1IYZA 1Z7EA 5TJHA 3CMCO 2NVWA 5DCYA 3AFNA 2WJPA 2ZTMA 5TT1A 3M2PA 3PHIA 3WR5A 4YTEA 2EIHA 3FTPA 4FN4A 2O3QA 2A35A 4GH5A 1N7HA 4D3FA 2TMDA 3VZSA 3ETDA 1LRKA 4IXTA 5T8KC 1O0SA 4FCCA 3GT0A 5G0VA 3ZV3A 2ZKLA 2C07A 3ASUA 4GSKA 3UGKA 4BKRA 4BO8A 2JHFA 4B4OA 4CMIB 2ZQZA 1OI7A 2VOEA 4R68A 2G76A 4AJ1A 4YACA 1PTJA 1PJTA 5A4DA 3PWSA 2DFDA 3JD3A 4HBGA 3OM9A 5GZ1A 3RUCA 2ILTA 5C7LO 1IHXA 1JQBA 3ZWPA 2P91A 3JYNA 1ONOA 3ZWBA 1IE3A 4RO0A 1WZEA 1NP3A 4KTVE 1U1IA 3MJ4A 2OORA 3QE3A 1NHGA 4IDCA 4FIZA 1R66A 1YWGO 3AUAA 2DBVO 3WGGA 1LC3A 3OJEA 1EBFA 3H8VA 2W4QA 3G17A 4OIMA 5A3JA 1NVGA 4BVAA 1DO8A 5I8WA 1ZXLA 2O3SA 3PRJA 4B3JA 2YFQA 3AK4A 1I30A 5CDUA 4DQUA 1C1DA 1CERA 2BFMA 2C54A 1V8BA 3V1YA 2WYUA 3F4LA 3HADA 4BNWA 1LSUA 1V0JA 1Y8RA 2CMDA 1XIVA 3D3WB 4RVFA 2WDZA 1UXKA 1GQQA 3GVXA 5BR7A 1WWKA 3UXYA 3BTSA 4DLAA 2NQTA 1DC3A 7MDHA 4E5PA 4IQ0A 3VAZA 5FEUA 1HDOA 4FSHA 4IIUA 3PJGA 2O48X 4GX0A 2VT3A 3ULKA 1VJTA 2O4CA 4XYGA 3U4CA 2AQKA 3NDJA 1AN9A 1PWXA 3L6EA 4IMPA 3HFGA 3SLGA 2OZPA 2JJYA 2TMGA 5FWNA 4LN1A 2X5JO 4KTTE 2E49A 2W2LA 4IJVA 4DLBA 4XDZA 1DFGA 1PEDA 5JC1A 1PJSA 4FOSA 5KOIA 2HRZA 2V6MA 1E3LA 5L7WA 2HMWA 4WCFC 1DAOA 4Y6RA 3N58A 4AVYA 5C3MA 3DBLA 2B5WA 4L75A 4AJLA 2R2GA 4MVJP 2RAFA 2YY7A 2NVBA 3K31A 2WYWA 4G81A 2Y1OA 1YQXA 1GYPA 1R0KA 3JQGB 3TN7A 1ISFA 2Y99A 2Y1CA 4L4SA 2I9PA 3E18A 4B8WA 3D7LA 3TOZA 1PQPA 3L07A 3EVNA 4LVUA 5HS6A 4DL9A 4E30A 4I5FA 4PG5A 1HE2A 3LC1O 4J0EA 2VYVA 2Q2VA 1YO6A 4XYLA 3EDMA 1MXFA 3L0DA 3CKYA 4A2CA 1SB9A 1H2HA 2VUTA 3JQDA 4NG5A 1ZUD1 2WSBA 3Q1LA 3W6UA 1CQJA 5EERA 3RKUA 2JFGA 3M1AA 2H63A 5T67A 3TWOA 5B37A 3KEQA 3AI2A 3JYQA 4UUOA 3DEYX 4J1TA 3WYEA 4MO2A 3ZU3A 4AFNA 1E3SA 1DIBA 4MPDA 2QG4A 3VZPA 4PLPA 3KETA 3RUIA 1T2AA 4GGPA 2JD0A 4UEKA 5L4LA 1O5IA 1ZMTA 4XRRA 2O23A 5G4LA 3WQSB 1JLLA 2HU2A 3HDHA 4PVCA 4Q3BA 4H7PA 4ZQHA 1UXJA 1SMKA 2AEMA 2PD4A 3GQVA 5G0WA 3ZGYA 2NNLD 4RPLA 1LJ8A 3G1UA 3OQ6A 4MJLA 5KTKA 4KP7A 3INRA 1CEQA 4BL5A 4M49A 1GD1O 1PS0A 1BHSA 3OA2A 4XQGA 5DF1A 3W8FA 4B3HA 2Z95A 4HNHA 4NFSA 4CM6A 1E3JA 1HLPA 1G1AA 3H2SA 2HSDA 4YAGA 5ADHA 3BA1A 2VYVD 3BHJA 4BNUA 5IXYA 1NFQA 2Z1NA 4J43A 5AXBA 4GWGA 4CL3A 3I9LA 3KM0A 2PA3A 3KHUA 1QRRA 3DHNA 1LDEA 4J2HA 4CV3A 1YE3A 3DZFA 1DIRA 4ZVVA 4E12A 1BXZA 2NU9A 2PZKA 4CV1A 3FI9A 4KQXA 3WNVA 3PJFA 5FI3A 1D8AA 1YS4A 1JKFA 3ONEA 5GY7A 4ZU3A 2VZ9A 3UCFA 3DMTC 1EVYA 5T57A 4DXHA 1PZHA 1H9AA 1M6WA 4QQRA 2E82A 4U5QA 2D2IA 1NBOA 1E1LA 1WNTA 4OJNA 2VHVA 4DUPA 1HDGO 3O26A 3DFUA 2BFOA 1K3TA 4FPXA 1EUZA 1D4FA 4J90A 4XQCA 3WOHA 4WJZA 3ZNQA 3RUEA 1KIFA 5A9RA 3OBBA 5FYDA 1R4MB 1MFPA 3D3WA 3IKVA 4MKRA 1VKNA 3L6OO 2X7HA 2OMEA 4K26A 4NJMA 4TQGA 4AJNA 2A4KA 4ZICA 5KJ1A 1E6WA 2D5CA 2VZ0A 2YHIB 5GZ6A 4MVJF 5C7IO 5KVSA 1IULA 3IQDB 3DB2A 3JQ9C 1B26A 5JCJD 1HZJA 4KUEA 1XG5A 2CNBA 4ND1A 4IDDA 2OFPA 1JAYA 5L3ZA 2EW2A 4FFNA 3ROPA 3V2GA 4OQYA 1LTHR 5TNXA 4F3YA 4QO8A 3ZHXA 3WB9A 4MP3A 4BB6A 4OM8A 4YR9A 3HQ4O 1XQ1A 1O9BA 1QYDA 3KYCB 4MVJD 3RBVA 2BFPA 3G49A 1FDWA 2FZWA 4XYBA 1N1EA 1TEHA 5F21A 3I1JA 1NTOA 2J8ZA 2UUOA 1YB4A 3VZRA 1PS8A 1WDMA 2RHRA 4EZBA 3JYPA 1J4AA 3IL2A 4TWRA 3IAHA 4M87A 1PJ3A 2J3KA 1R6DA 2HMVA 5I7FA 1M67A 5CDSA 3GDGA 4BB5A 1WMBA 2DBZA 2YV2A 4NDNE 3GEDA 4E2YA 1HDRA 4I08A 4CMIA 3IS3A 4PLCA 1U7TA 4L76A 1DSSG 4UVEA 4IDFA 4WCDA 1LRLA 4HUJA 4RF4A 3HZZA 3RJ9A 3NTOA 5KCZA 4CQLB 3WSWA 3DTYA 4GX1A 2PWZA 3GA0A 3QWFA 1Y9EA 4ZD6A 5A9SA 2CSUA 1HE5A 2C5AA 3AUSA 3C1AA 3DZGA 3JQAD 1XDWA 2D8AA 5CPFA 4DVJA 5JO0A 3TF5A 5JCJA 3RC2A 4XGNA 4XEHA 4FQ8A 1BG6A 4ZQGA 3HN2A 3ZWVA 4IY1A 5IN5A 2ZB4A 4IJKA 1JWBB 4ND5A 3LLVA 1EEHA
chains in the Genus database with same CATH superfamily
1JIUA 4KLZA 4RORA 5IABA 3PEUA 1LNQA 4MKXA 3GVIA 1E99A 4GG1A 4U0KA 3WJAA 2IJGX 3GJQA 3LWZA 3LXRA 1K6JA 4TGLA 1UIRA 1RP1A 3L5OA 1Z0SA 1SBHA 3I2YX 4MS4A 3O74A 3KKPA 5FTMA 2V9PA 2Y93A 1LBSA 2I55A 2VP5A 2ZBUA 4FYIA 1VFNA 4N7RA 3UHFA 4EFDA 3D4OA 3T5MA 1QV7A 3S7TA 1MAWA 2RGXA 2BKUA 4Q34A 5LNK6 4PO1A 4CM7A 3FR8A 3VKWA 2Q5CA 2I54A 1MX1A 2NTJA 1Q21A 3A14A 1UOOA 2AK2A 1DXQA 2WIAA 521PA 3RKRA 1P61B 4ZCTA 3I4LA 5ECWA 3WWCA 1BOFA 2VJKA 3B5JA 5L95A 4HLDA 5FJJA 1KEEA 3MWDB 4TSRA 1NBHA 3DQQA 3HJTA 1JFVA 1NVKA 1BWQA 3O0DA 4D02A 1RM3A 2DC1A 2BMAA 1IHPA 1JSZA 3SEZA 3FY4A 4A82A 4CKBB 2NU8A 3AVOA 2V6GA 4HB3A 5HUQA 3HU2A 1PJ8A 1L5OA 3M89A 2B8TA 1DO0A 1T36B 1UBKS 4DQLA 3N8KA 3GRRA 2A5YB 1NPTO 3QVVA 4IIVA 1GYRA 3TSWA 3MTEA 3R41A 1ZSYA 5ALZA 4KN9S 2I1VB 3R3HA 1JTVA 4HLQB 1KMMA 4OHYA 2PFKA 2XGSA 3LY9A 4YT5A 5IVIA 4DGSA 2RKWA 3AVTA 1WSDA 1ZIDA 2X8WA 4OL0A 3O75A 4YAFA 3TLMA 4YMWA 1UT8A 4KQHA 2ZQYA 1Z6ZA 3ZS9A 4S2UA 3ZHBA 5JRDS 3T5PA 1D8TA 3CLUC 1NN1A 1H0RA 3A7DA 1ORDA 2NT3A 4B4UA 4G4IA 3GFPA 4V3CA 1RRGA 4HX2A 4LPKA 5AVZA 4HK4A 4F2HA 1CYDA 3R9XB 4R41A 1R6XA 1CRZA 2HWYA 2IYUA 3COWA 4XIYA 1XEXA 3K1AA 5IARA 3HCRA 3OD5A 1QVZA 2GEDA 2GVNA 2Q50A 3CF4G 4G4SO 4V39A 1UADA 4G36A 4KXUA 3BMCA 1UAAA 1RACA 1NXVA 1XA0A 2YNMC 4LZNA 5DX8A 4LC0A 5DM2A 1LPAB 5H70A 4O5AA 1HE8B 4DUZB 5HBGA 3BL8A 4KMRA 2C5GA 1CUIA 4MUHA 3I9NA 2J3EA 1X7DA 3UK6A 1G291 3SKVA 3U1VA 2EX4A 1ORTA 4OQFA 3KRTA 3STHA 4JXZA 4QEKA 4L9SA 1KTVA 4R1MA 2AJLI 5AKJA 3LZDA 3MT7A 4FN5A 5CGZA 1W25A 1J00A 1ZSNA 3HSKA 2Q4DA 4EJSA 1GGMA 2R00A 1P2BA 4Y2SA 2PFGA 3L02A 4BKOA 3W04A 4RZHA 3WICA 3EA0A 1N2JA 3L8EA 3RTGA 2XE8A 1SKAA 3C8UA 3RWBA 5EPEA 4UMVA 3VTZA 3E3AA 2JFBA 1AKVA 2P2GA 3QMPA 1P6XA 4D42A 5LZ2A 2X9NA 2EFCB 3GV0A 4H2DA 1VYVA 1UPCA 3KAJA 3ZDRA 5HJEA 2V8BA 5CBPA 4L72A 4O4IA 3WL6A 3UOAB 3WK4A 1JAZA 3QE0A 3R6DA 4BJ3A 3TNDA 4C6HA 1ID8A 1E5LA 1KMHB 2NUAA 1T91A 3KJNA 1F7VA 3PP8A 4RVCA 1T4MA 1QORA 1QZZA 1IUOA 1UBRS 3PGLA 4HHEA 3BWEA 3ZY3A 2C5BA 3R3ZA 5HZHA 4CTJA 1K8YB 3STVA 3CUSA 1TLFA 4D8YA 2OENG 4Q3EA 2P3OA 4N82A 5E1BA 2Q8QA 1MPTA 4YP0A 2Q07A 3NKVA 3N86A 2QROA 3R5KA 3A10A 4IV8A 4HQOA 4CJXA 3JQ9A 1FNNA 2VZLA 4UAJA 3T7EA 2PFSA 3E53A 3RQSA 2RGBA 9LDBA 3RH0A 3TW8A 1TA4A 5FBHA 4OATA 4QTUB 4EG0A 1EQAA 2J0QA 1ISSA 3ONNA 3ZE6A 4XM0A 3IPYA 1JUDA 2I2CA 4P54A 3A70A 1HQCA 4AAYA 4XSGA 1AKTA 4EG3A 2WHRA 4O2BA 3ZE1B 4A0RA 3F1KA 3IJ5A 1LLCA 4LHEA 2GPSA 2JIMA 3HV2A 1BX3A 3KVNA 3WX0A 3TNLA 1C8VB 2O8FB 4NK5A 2H1IA 4CTKA 5DN6A 4YUYA 3VJRA 3EMBA 1RU3A 2B1QA 3EXHA 1R9NA 3EHDA 4X84A 3RHZA 4G63A 2XMZA 3PHLA 3PZRA 4TPKA 5HF9A 1JEYB 1HTBA 4QLOA 2BAGA 4HB4A 4O2BF 1JXAA 3U7HB 4MVCA 4EGSA 2ORWA 5JYCA 1NW4A 2BH9A 2C2YA 2NPOA 2ZRGA 3GLHA 2PZEA 3MTBA 2CBZA 4BQPA 1DAIA 4DADA 1QDUA 2AN9A 2VF8A 3OCVA 3I6IA 2F4NA 2QAGC 5EWLB 1HNZB 3B8HA 3DFMA 1PZFA 4MO9A 5CA1F 1D5WA 2ZIXB 3AIIA 1DJPA 2ZJ0A 4A1FA 4D1YA 3HHPA 4QTYA 3D6VA 2K6GA 3DCYA 2RK4A 3K7EA 1B6SA 4JKIA 4RL4A 4BMDA 1G16A 3EH1A 3MERA 3W4IA 3CUYA 1ZZEA 3O83A 3GRVA 4BIMA 1Y1QA 4FMDB 4N18A 1GQRA 1GVNB 4P08A 1KFKB 2Z08A 5BYBA 4AMVA 2YWGA 3QPAA 2NT4A 3EIFA 4YRGA 1MD9A 4AU1A 1Y0BA 1YB1A 1T1JA 4JMPA 4YP6A 3RS2A 2DPXA 2QSJA 3OKCA 3AOEC 1W4CA 1H8EA 1NJ2A 3I1FA 1EDEA 4GYWA 4MW0A 5JYDA 1OB5A 2D59A 4EH1A 2BMFA 1N0WA 5JW6A 3GIDA 4ERXA 1KI9A 1V41E 4NNJA 5ARBA 1S89A 3N9IA 1THZA 3BZBA 4DLRA 4RTNA 1QH0A 1VL8A 5EMHA 1Y63A 2X86A 2YZGA 1GNTA 2Q99A 1L3BA 4PTLA 3MOSA 1I2ZA 4DIBA 4E5DA 1DJQA 5DI9A 3W77A 5K4HA 1KBQA 2HCBA 4OUKX 1W1IA 3I28A 1L5HA 3JTEA 4WY2A 3TD6A 1JEAA 3X1XA 1QWSA 3FPBA 4MK4A 4Q4AA 4JITA 4LQLA 5HA5A 1L1QA 3WMFA 3II6X 2ZXEA 5U4XA 1ABFA 3JAKA 5JNRA 2ZI7A 1XR3A 1WW8A 2JHPA 5JPIA 4Q9LA 2X76A 3IQFA 3UJ3X 2F8TA 5CLLA 3W1VA 4B74A 3FPKA 1AHPA 1DKMA 1LDNA 1Q7EA 1GG9A 3VKVA 3I9FA 5DM1A 4ZYUA 3Q2OA 4EKGA 3F7TA 5HIAA 1CFZA 1T0PA 3AEYA 4R1NA 2GEFA 5KNDH 1BDMA 4HLNA 3MGCA 4ZOEA 3ZBTA 1PFGA 2WJZB 1XVTA 3HY4A 3R24A 1DG3A 1X70A 4JUAA 3ZCPA 1KP2A 2Q5LA 5JG7A 3IPCA 2QD4A 2PH5A 2IW1A 4W82A 3C48A 4ASUA 5BSEA 1N5MA 1KGSA 2DVMA 2QD1A 4NMMA 1VHQA 1O4WA 5T4BA 4X71A 2P6RA 1NIJA 3ESYA 1MJHA 5GADl 5DYTA 4GI5A 3VVMA 3I62A 3LDAA 1YQUA 3UBMA 1K1EA 1K08A 1ULHA 3HSYA 1XQVA 2IZOA 3V4RA 1IZ9A 2V7GA 1J56A 2I2XB 4DE5A 1SCIA 4CMHA 1JKXA 1SPBS 2G9QA 3CFYA 2NQ8A 2L0XA 1ESZA 3EXEA 4O1MA 4URZR 4BB9A 4WKCA 2HRBA 2VPXA 4WLEA 3QMVA 1NATA 2OHOA 3TOXA 3RUDA 1S1CA 4CIBA 5IT9A 2GZDA 2W8BA 4WQMA 5BW4A 5ITWA 3NBYC 4IFEA 2IYWA 4X64B 4YQYA 1AY0A 3IMFA 1J33A 4NCKA 5F1KA 2GR9A 4LF6B 2IPNA 4RF3A 3NTVA 2XRZA 4X1YA 4PBRA 1XYGA 3I04A 2DULA 4I9NA 1FZTA 1H6DA 1QHGA 1A72A 4FI3C 1LVUA 4NMHA 1J7JA 3M5PA 2VWPA 4ZCQA 5KOHA 2WQ7A 2MSDB 3H75A 4O4HB 3ISTA 4ZK2A 3NT2A 3VNSA 4HLCA 4P8RA 4CETA 5KHLB 1Y4AE 5ALHA 2J07A 1IK6A 3LXUX 4MRAA 3WRYC 3PF9A 2NXJA 5KVVA 3GLGE 2I7XA 3W9SA 2A1TR 2POQX 1RXYA 2I34A 4JD5A 3DR5A 4MQFB 1SXHA 3AI1A 5FPYA 2FG7C 2Q3BA 3OMWA 1A4XA 4NYMR 3FSJX 2XYRA 2FW0A 4WE3A 1NPYA 3BTUA 3MAGA 1ZK4A 3KL4A 3K6KA 1HETA 1U2PA 4X6UA 2O8FA 2HSZA 4ZCSA 3DUFB 1NJ8A 2OEPA 4JYZA 3BN3A 4RF2A 3RSHA 2IPOA 5DOZA 1ESCA 5TPWA 3ABOB 1IN6A 4J9VA 3QKSB 1IRXA 3F6SA 5TEWA 2VCYA 1AH2A 5DX1A 3KR1A 3U4MA 4QUHA 1HQKA 3O8NA 5CYGA 3OQPA 3RANA 4LWOA 3W9YA 4OQXA 4LNUB 2H5LA 3WYCA 2HY7A 1E1MA 4HDNA 3A27A 1BD4A 1FA9A 1OSNA 2WWXA 1DFHA 1YMVA 5K6TA 3ST7A 1XHEA 5JC8A 3BXHA 4PPNA 3N2KA 1MB0A 2BUCA 1WUKS 2YDXA 4XOIA 4A5OA 1Y8ZA 3IXMA 2ES4A 1U7PA 4GXTA 2EJUA 2CNLA 1JA0A 1OF1A 3FH0A 1BE6A 4BLQA 2XLBA 4WLNA 1HT3A 2W6QA 2AFHA 3O7WA 4W9NC 3IQZA 3TOSA 3DEIA 3JV7A 1FW6A 1RHKA 3DEHA 5FQOA 3TGWA 2FE1A 3VVLA 4Z9FA 1M2WA 1P60A 2C2GA 3HUUA 3PYMA 2A3RA 2QDXA 1M2NA 3HKEA 1DTWB 3A6DA 3ANLA 3QXGA 1VJ1A 1UQRA 2Q29A 1Z29A 1VFPA 4KOEC 1GZUA 3AVUA 1EPUA 1QYWA 2UZ3A 4MJ3A 4MUYA 2QL9A 3PDHA 2GN9A 1V7PC 3I2HA 4JBXA 2ISSD 2C57A 4UPDA 4H1UA 2WMOB 2CGEA 4U8HA 1TZ2A 5AXAA 4QODA 3R0QA 1WHSA 3TTWA 1V8ZA 3LBIA 3R8XA 4E5VA 3Q6IA 4QSMA 4B3IA 4ZAFA 1EE1A 1DV2A 4GMXA 4RD2A 5F23A 1XMOB 1Z7BA 2RGEA 3FWPA 4ROTA 5FYQA 1JQLB 1JVBA 3OCWA 1SCKA 4OFWA 1N32B 1XUOA 4YBRA 3IYLW 3CZMA 2R48A 1KC1A 4AJHA 4BU0A 1GAXA 4UBMA 4C22A 5LBTA 4XPIB 4Q93A 1EX9A 3V33A 4A15A 2X4IA 2IQ5A 1OAAA 1W4RA 3ZVLA 1DIOB 2A5GA 1QG2A 2BBWA 1KO4A 2PKQP 4KK3A 4Q1EA 1A0OA 4TQAA 2HBQA 1LX6A 2WJGA 1GG8A 1UDRA 3D3NA 1T5IA 2GAJA 1N2IA 2GN0A 3I58A 4YBZA 1X1EA 1NT4A 1N3IA 1A7KA 3ZHCA 2B99A 2VDPB 5AVJA 4AZ0A 2YQ5A 3LWBA 3QVSA 4Q3CA 5DBIA 5AK0A 5H7XA 4KOAA 4WX2B 3AUYA 2A59A 4YRPA 4ZDIA 1V11A 4N5LA 5FA8A 2ZDGA 3ZGVA 3UH0A 3M4ZA 3NETA 3IAS1 1MNQA 1OI4A 2EFHB 2PZ8A 2WUWE 2O4UX 1G42A 4WMLA 3LAWA 3WTCA 2QE7A 3AEQB 4AG3A 3PDCA 4HXEB 3KJXA 2BDUA 1PNOA 1RADA 3GGOA 2CHFA 4HQ6A 3B7WA 4L5JA 2FPGB 1X7YB 1CJSA 2H92A 5B12A 1XSEA 2X9VA 1WPQA 2BJWA 3PVCA 1FX0A 2PUBA 1NLZA 3CPJB 2ID7A 3EZYA 3E22A 4YONB 1N6PA 4PO9A 4RMHA 3QY0A 1C3JA 1K27A 3TOCA 2J1LA 2JJ1D 1V8DA 4OMCA 4R69A 2V4ZA 1QGOA 2VDRB 1YKFA 4FGUA 4I5EA 1XJ5A 3OIFA 4P32A 3SJ7A 5HJ7A 1N1DA 1RQPA 1TA9A 4NENA 2IGBA 1MB9A 5ALOA 4M8SA 5CLGA 1NP6A 3IPXA 2YASA 2NQ2C 1D6SA 4PLWA 4AICA 1GGNA 1E0SA 3G8BA 3PD7A 5DWQA 3HCPA 2Q2OA 1SKMA 4TXJA 1KRHA 1P31A 2Q1SA 4F2DA 3LHKA 1P1RA 1Z33A 1T5HX 1VJCA 3CRW1 2J67A 2IS6A 4M0KA 2R6ZA 3ENKA 1Y9AA 2WFMA 2JFHA 3L77A 3HEMA 1U7OA 1ZK0A 2YC2C 4X24A 4JLNA 3WWOA 3BIJA 3FKSA 1TJPB 1OXUA 4IO0A 2C95A 3VZDA 4R05A 1JDUA 3BE8A 2ONKA 1GPAA 1MPXA 4ITVA 3UW1A 4RH0A 5K3DA 1LF5A 1V1MA 3KQWA 3MVEA 5L40A 1G8YA 4B2IA 4C7OB 2PZAA 1TCVA 4PXAA 2BGMA 2ST1A 4ZVUA 4YJDA 1QVRA 2F9FA 4TQ9A 5BN5B 4AMZA 4RKWA 4U63A 4W6QA 5KVCA 2Z6AA 1ZDMA 3FHLA 3AL2A 2J87A 3IAXA 3UJDA 1TUBA 1XWIA 3EJWA 3WYFA 3GCZA 1XWFA 2BGKA 3EUFA 3ODPA 4INAA 4GRAA 4UBLA 1J5EB 4OSPA 1GZ4A 2ECOA 3OMLA 4NTZA 5MDHA 4ZYZA 4HNQA 2Z6QA 3BWVA 4BMPB 3IIIA 2VEOA 2VPIA 1SA0B 2PKQO 4JLVA 5DB4A 1ECGA 1TLLA 2CUNA 2Q3CA 2WZBA 3FKSD 3KJQA 1NI4A 1WABA 1TZJA 1ZYUA 1KAMA 2F43A 1VSBA 3DMGA 3Q7EA 2GD6A 3CR8A 4P36A 4ZQEA 4C0LA 1EUDB 2CJWA 2H2HA 4QDXA 4ZEXA 3KVYA 4LJ6A 3GEGA 3IQGX 2X4DA 3QKRB 3A1UA 4KO1S 1T34A 1GRVA 1KQPA 4YUWA 1NBME 1P2VA 1ZIXA 3O4IA 5TB5A 1KDVA 3OOWA 3WGYA 3HC7A 2OO5A 4JU9A 2ZYTX 5EHGA 4Q12A 2BGIA 2OBLA 4UNPA 3S7ZA 1UXGA 3TBKA 3PRKE 2Q5EA 2VWHA 3AJRA 3KPUA 1AV7A 2X8LA 3WLSA 3G9TA 3AKYA 5ALPA 3B6IA 4HBZA 1C8KA 1FU7A 3K0SA 5BT9A 1QQ5A 3A31A 1C1XA 2CKDA 3UGJA 2LIPA 3E15A 4R3NA 2RGCA 5J47A 2FOXA 1U8CB 4BMXA 1Q7GA 4YC7A 4EABA 5AFSA 4BO6A 1KFJB 1DRVA 1CIPA 3BBPA 4RV4A 3VSBA 4CG1A 2YWCA 5JHGB 1YKSA 2YMMA 1GEEA 4HDMB 2QQEA 1PFKA 5DPMA 3K71B 4OQEA 2IOFA 1BVRA 4BS9A 4KDEA 3ORYA 1HLGA 5DI3A 3GGJA 1QVAA 2BFNA 2KJQA 4I1UA 4R2JA 2EC5A 1JI3A 2XTJA 1N2XA 4FHDA 3T0GA 1D0SA 3D54D 3GUZA 3MT8A 3OWHA 4Z9AA 1RVV1 4OCZA 2OPHA 3MHTA 5JJLA 2Q6VA 2X0NA 2CWWA 3L18A 1PJCA 4LFCB 3FNIA 3WFIA 1UWLA 2VP4A 2D3WA 1NLMA 5C3UA 4E6EA 3FOFC 2VH1A 3USCS 1VSVA 3U13A 2O1XA 2IYVA 4J4HA 1MQSA 4ZRMA 2W90A 4GI7A 3N2KB 4QOEA 3EXAA 4G5SA 2BE9A 2ZE6A 2QR2A 1XDDA 4D4MA 4EJSC 1B76A 1SURA 2IHBA 2QZZA 3WMXA 2QQ0A 3L0PA 4EGQA 3BM5A 4HMOA 2VXBA 3LX5A 5EMKA 2PMEA 5IUNC 4DIFA 4PZDA 3U4HA 3I83A 4X6XA 3REOA 1V2GA 3HR4A 3OOYA 4YJ3A 3UBTA 4HUTA 2FPIB 3CMMA 1TO1E 1GIAA 2GJ9A 2ZDQA 2WB2A 2IH5A 4KNYA 1AK2A 2WG0A 2ZIFA 3PPXA 2NXWA 3R74A 1GUYA 4XH9B 5IC6A 2VT2A 1DBPA 1PBTA 2JAOA 2YJZA 3MBOA 4DG8A 3TEFA 1AKNA 2BGRA 1PT9A 4ZO9A 4E33A 1E2DA 3IVCA 4PPFA 4NENB 4K6FA 5A4AA 1N5DA 4AIRA 5KNLA 3FOAA 3O8DA 3GP8A 2H07A 2ZYUX 3MJVA 4AZSA 5B4UA 5JWRA 1TKRA 5CUQA 4E3WA 4I19A 3WRXC 4D97A 5BR8B 5EG5A 5I47A 3G88A 2V59A 1IEVA 5T8KA 3W0LB 5HS4A 1F3LA 3QW4B 3QXCA 1IY0A 3O9ZA 3RSFA 3VI3B 1PZGA 3HRIA 2W8BB 4RK0A 3KQSA 4KLCA 4TMFA 5FP0A 5I5GA 2Y1KA 3PT5A 3SVTA 1QO9A 1UAGA 2G6TA 5KS2A 3TJRA 1M6NA 2CKMA 2XMDA 3MUFA 4ZTUB 2H17A 2Z09A 3HYCA 4L08A 2ZU6A 2J31A 4QGFA 3HM2A 3WDLA 1ANKA 3PD1A 4CM4A 4J4BA 3U17A 3HXTA 4AJEA 6LDHA 1QE3A 2FZ4A 3QLTA 4OQMA 3RRYA 3L49A 4O25A 4R5HA 5JZOA 1KR2A 1QAOA 2P78A 2W6CX 3KVOA 3VYRB 1WS6A 3ZV6A 2EF1A 3TBHA 5AR1A 5K9ZA 3WAGA 2FSVA 3CEAA 2NO1A 2O3RA 2YJNA 3QF4B 4P4SA 5AM1A 3FFTA 3R7NA 1RXWA 1DC5A 2Q4BA 2JGNA 4Q6BA 4Z51A 2LE0A 1X7YA 4C2BA 4MJXA 5JXWA 1R4AA 4GYJA 5ALIA 1OBOA 1NG1A 3HZHA 3KSAC 5JY6A 6Q21A 2P9ZA 4V0LA 2ZBVA 2NO5A 3A1VA 3LUKA 3WLRA 2NTVA 4BRSA 2Q27A 1WDWB 1RIIA 2FW8A 3SHWA 4LE2A 2FUEA 5ENDA 4EMBA 3LTNC 4OOFA 1THGA 2I6TA 2XQJA 4TXNA 2JI4A 3KJEA 3KLMX 1QFZA 2AF4C 2AOTA 4DBVO 10MHA 2EWMA 3NWBA 4GLLA 3NGMA 2PWAA 1PK9A 2QX4A 4Q0MA 1U2DC 3E2MA 1AQ6A 1GAQA 4H7FA 4RF5A 4BN0A 2I87A 4FFMA 3ZHRA 3U7FB 3Q41A 3ANXA 5AKEA 4I50F 4RFVA 2XGGA 4I9HA 4M9QA 1VJ5A 3HO6A 1C2TA 3LCMA 5KQLA 2B1RA 1YZKA 5AMXA 3TQFA 5DNCA 4KE8A 5LQMA 2BEWA 1E79A 4I1VA 4KGZA 3RTDA 1CJTC 3KD3A 3ZE9A 4PR3A 4AMGA 1JZTA 4EG7A 2YJ6A 4RVUA 3G5AA 4IHQA 3UMYA 4I4TF 3SX0A 1WXQA 5A7GA 2UYOA 1DKOA 3QP9A 5JTUA 2P9CA 2HXYA 5F9HA 2XRFA 2JRLA 4M1OA 4K2HA 2VDLB 3PXDA 3EUWA 4I6GA 4LQ4A 2ZSDA 4R51A 1ZCFA 3ACDA 5TR9A 1Q0TA 5DWDA 1YR6A 3TLAA 3DP9A 3T54A 4A8JA 4IMRA 3DAGA 4WERA 3WKBA 2VRBA 3AF3A 1SXJB 2RGNC 3GT3A 3E8XA 3GXOA 3L1JA 5BSGA 1AKWA 1OH6A 5LYJA 3I9MA 2QN3A 4D0SA 1PL0A 3H11B 1WEKA 2P8SA 5EKXA 2UXCB 4KRXA 1U8AA 3M6AA 3HEBA 3A1FA 2DHRA 2BYTA 2Q3EA 2XNHA 4KR6A 2WI8A 3PEWA 1M5TA 3ZWQA 2C7PA 1EGMB 5ILQA 1QTQA 2QD5A 2ZR7A 3F6RA 2WILA 4XIFA 4P2BA 4D92A 1IL0A 4EI9A 5TE9A 1KWKA 2C2KA 2CB0A 3HXKA 1NW6A 1DKPA 4YEDA 5IDQA 1SEPA 1XTPA 1G6KA 1NNUA 3FYUC 3TIGA 1Y9DA 4ALMA 3GY0A 1HNNA 1CDDA 1ZD1A 3C4QA 1KS9A 4TV9A 4CLXA 4DMCA 3H4MA 1MENA 2VSQA 5FLEX 1EP9A 1TUEA 3EIEA 1NSFA 2HA3A 2I1WA 3K5IA 1SCQA 1WG8A 3PYLA 2H5EA 3MC1A 3MTQA 5JI3E 3C6KA 1E1DA 2HRCA 3PFWO 5KNBH 3QVWA 1ISMA 1UP4A 4QAJA 4KCGA 4JLPA 4WXPA 4Q3OA 2JNWA 3VMFA 1PK8A 4PC1A 2V6IA 5DMXA 4PAOA 2JJ2A 5CX4A 2G6BA 1A27A 3WMEA 2W9XA 1HRDA 1M0SA 2O8NA 4ED9A 1RZRA 3M49A 1DARA 1P5RA 4PM4A 3VO1A 2PKCA 4BWGA 2FSUA 3HE3A 2F2TA 3N2EA 3VSEA 5JXHA 1TW3A 2FKAA 4KDCA 1Z63A 3MGBA 3IAM1 4PAQA 3HLTA 1GZDA 1M34B 3BEOA 1R0XA 2O8EA 1WXDA 4MV0A 2GHQA 3QBTA 1WTAA 4W8GA 1E6MA 1XV5A 2JK1A 1R64A 3OQ1A 1K9SA 3T95A 4AK9A 5IK2D 4YAEA 2F00A 1CZNA 1D5CA 3EA4A 5BNFA 3O2SB 3QFRA 3KYCA 2GO1A 1CYEA 4GMHA 3EXEB 3H2IA 4NNPA 2C5SA 3C4VA 4PQRA 1PVDA 2IK8A 2HLPA 4I4NA 5CVJA 1YR7A 3QFHA 4HNTA 1L5QA 1HSOA 3U3RA 4IBOA 1GARA 1DDGA 5DP1A 1GA1A 3PLNA 2X0EA 4FXOA 3KT8A 3M0EA 4ID3A 4YRIA 1COWA 2LW7A 4DW8A 3KDAA 1CEYA 2GCIA 3M6VA 4UTXA 3FMFA 2OQVA 4C06A 2BRUC 3LQQA 4E0BA 2Q8PA 3G3EA 5F1YA 2IWRA 4ZVNA 4W7IA 2XOKA 1LDBA 4W5JA 3RUHA 1BS2A 2Z2JA 3O3NB 2P5SA 2YFYA 3HI6A 3P2YA 3T34A 2D00A 5IN4A 3ADKA 5FHQA 3ERCA 5JCOC 1FK8A 3C7DB 4DSAA 4XTRA 3NI2A 1HXHA 1T8WA 4B32A 3B53X 4IZ6A 2ZIUB 3PC3A 4EZEA 5JVDF 4TZKA 2ZT8A 4BLTA 3FMPB 4WOBA 1VG9B 4OO3A 5ECDA 2HU8A 2KLHA 1PNQA 4NCIA 3K2IA 5FOUA 3VO2A 3K8ZA 5G2OA 4LKRA 4UNNA 1SG9A 3UG6A 3OZIA 5K01A 1QQAA 1EWTA 1X1QA 5F78A 3NXKA 3OI7A 4OI2A 2Y92A 4FEEA 4U2EA 1QH8A 4W1QA 2ZUEA 2R79A 1YR1A 4NZ9A 3W79A 4LYEA 1P0FA 2B92A 3MGGA 1E9FA 2HSWA 2OYSA 4HFJA 3SIWA 1D4AA 4V0RA 2ZBEA 3T9EA 4P3XA 3ZK9A 1GZ3A 2PWYA 2QXTA 2H1FA 4WSOA 4Y98A 5DTEA 4F6CA 2F6RA 3GP5A 3M1IA 4RADA 2YBEA 2J9FB 3FR7A 5E6RA 4JT9A 5J59A 5CDGA 3BXEA 1G5PA 4PYNA 4RH1A 2OHGA 1OLXA 5AKXA 3QEKA 4HXYA 4DLXA 4HNRA 4XUDA 5KYWB 4BNXA 5B1DA 2IUEA 2D2VA 1K8ZB 2FWRA 2WNHA 3LK6A 3PIRA 3QOFA 1C4KA 4UKDA 2PSJA 4IV5A 3ZDCA 1UK9A 1EZ4A 3DDZX 3K6RA 4HATA 4S0XA 4G8DA 4QYSA 2R66A 4AF6A 2SICE 3M5CA 1H0SA 3NS7A 1CNEA 3OAAA 1NGSA 1L7NA 3PNMA 2ATVA 4MV7A 5JS8A 1OLUB 2BEJA 1VSTA 2HL6A 3L06A 4G0NA 1X0VA 4GZLA 5CYPA 1ZY2A 4EY6A 5JSYA 3USZA 1L4FA 4GEKA 4OMUA 1ZL2A 2FR1A 2X5KO 2IYFA 1TM7E 1F06A 2OFWA 3TW6A 1ZM2A 4BPBA 3UV3A 3VBCA 4GGOA 4PRZA 2O2IA 3BSWA 4ZAWA 2FSIA 1CZHA 5JH7B 1RQ7A 1WM1A 5EJIA 3PVSA 1QMPA 4R2KA 5J2TA 4DARA 4LOKA 1JNYA 4BE4A 2FWJA 1DNPA 3IR5A 1EP2B 3R3JA 1JJVA 3X1JA 2CF5A 1L4LA 4IGKA 3MWKA 4XSHA 5L3QA 4CW7A 3W90A 3QQ5A 3GHHA 3IP8A 4JP2A 1QH1B 3B60A 3TOVA 2HF7A 3FKQA 3NANA 3E7PA 1OV4A 4H1HA 4YP7A 1BU5A 3LO5A 2DMRA 1QIIA 1ML3A 4FXPA 4FGJA 1ZBQA 1JILA 1ZM7A 5JJBA 2FEOA 2FFBA 2X8AA 2DKFA 1G3QA 4Z49A 3MTAA 5HUJA 4DLKA 4YNBA 4B79A 4S35A 4B33A 3OU6A 3RT7A 3QVGB 1U8EA 4H6WA 1RRKA 2C61A 4IDBA 4JVLA 4YJ3F 4XJXA 5DJ5A 2PX5A 4J49A 4JASB 4MV8A 1IJKA 3PKIA 4X3OA 3BFXA 5GVRA 2G17A 3LDHA 5LZ5A 3SICE 1BGWA 4AQ7A 3IH5A 5AVTA 3GPLA 4MMXB 1P0QA 2VHZA 4OB8A 4A8JC 4DANA 5BWLA 2JAPA 1H9BA 4EMSA 4HMPA 2ZJ5A 1DCTA 1K89A 1WVGA 1OJ7A 3OT1A 3O8OB 4FR5A 1O95A 2ERYA 2PRKA 2QDKA 1BGXT 1WVIA 2UVPA 3C1UA 2COKA 3L7LA 2G0NA 3I32A 2RB5A 1P9NA 1RM5A 1UKEA 3AHFA 3HACA 4DLYA 1OGJA 3EB9A 1MX5A 4AL4A 1SB8A 2PY6A 4GP9A 1M0EA 1N6HA 1CR0A 1N34B 1CY0A 3RSGA 1PNTA 1EVJA 3MK31 2WJ3A 1EWYA 3WRVA 2VBCA 1O77A 3ZTTA 5F9FA 1U3CA 1QFYA 3RU2A 4MUXA 1PDWA 1T10A 2Z2ZA 3UPTA 2GHIA 3DZJA 4UU7A 5HHTA 3U5TA 5E2IA 3AFOA 2R2AA 4H7KA 3VGJA 1UQTA 3FJYA 2EATA 2XIJA 1GYQA 2JGIA 5DNVA 2WT8A 4RK1A 4D0NA 1U99A 4PC3A 3CSSA 3BGIA 5J1TB 4UQPA 1M8FA 2HPVA 4UDYX 5EJ9A 1OWNA 5LFAA 3D1JA 4LSWA 1QC5A 1UWVA 3B2QA 1WXEA 1V8FA 1MRSA 1JR4A 4FK8A 5DSZA 3G2JA 5IT0A 1LJLA 2D1QA 2JLAA 3OESA 3K1ZA 2P5YA 4FJ0A 4MTLA 1BVYF 3ZVNA 4TOIA 4ZANA 3K6JA 1CW2B 2IUFA 3N8DA 1SQSA 1GCOA 1P29A 2CMGA 2FHPA 4II7A 1Q2XA 1SZJG 1OASA 3P0IA 1JEOA 2E3JA 1T1SA 5JSHA 2IPLA 2NP7A 4OQLA 2QYOA 4IJQA 1GHTA 1UXIA 3VV2A 4DOMA 4BTLA 2E18A 1G60A 1ZOIA 5AHKA 4BCCA 2JFPA 1KZGB 1S2LA 2B6NA 2A7QA 2DWUA 3KKEA 1KJZA 1OFTA 3EVFA 4CN9A 1KYQA 5ARCA 3KALA 4C3VA 3VPSA 4QG3A 4L5YA 3B52X 2XVZA 3KB8A 1Z6AA 2MSNA 3S1LA 1M5RA 1TMGE 4CEIA 1U0OC 2IF2A 5HJ5A 1XK6A 2JASA 1OXVA 3BWDD 4MW1A 2Q0HA 2DRIA 4YCLA 4MA5A 3PQDA 3VDRA 5AWFC 3QXJA 1USIA 4MYCA 1JDSA 4EF5A 3D8BA 3H5NA 1E2IA 1R5JA 4PV7A 3REQA 2CEAA 3O2QB 3RU7A 1TF2A 2H59A 3CEMA 4FE7A 4TZ6A 2BOVA 4JV5B 5CH3A 3I01A 3LCJA 4ARAA 5IKPA 5JECA 1H65A 3E35A 3MXOA 4MR9B 4Z2YA 4OHFA 3RJZA 4B0PA 2PX4A 5JH7F 1VPDA 2J4DA 4LKOA 1CWUA 3GQBA 2HMTA 4C0XA 4QNNA 1S8FA 3CCFA 4V1CB 4CEIB 1V45E 5K99A 2C9ZA 2FPPB 4EHNA 1Z6XA 3VI4B 4FS8A 2VKQA 4NAVA 2BCGY 1BD3A 5GOTA 1OXMA 3VR6D 4NXMB 4OX9Y 1H42A 4LOJA 1W0JD 4Z4QA 1ZVMA 4OB6A 6YASA 2AYZA 3ILYA 3WIUA 3WA6A 1JS1X 1YGYA 2JAHA 2RHLA 3IBFA 2GDJA 3TZHA 1RKUA 2OCPA 4CHGA 1XDBA 2AFHE 4YCDA 4LXXA 1R6VA 1GUZA 2AXQA 3PNSA 3LA8A 4RACA 4EFMA 2AF3C 4CL8A 1Y6GA 4NCXA 1CZKA 4Q1DA 1K75A 2RH4A 5A0VA 4MKGA 1FQOA 5DP2A 3RVOA 2RD2A 3USES 2BELA 3KWJA 3S4YA 3JYOA 2FA9A 4G5RA 4QJIA 3SVLA 3PFKA 4LFBB 4X41A 5DXJA 4KKXB 3K73O 4RTQA 4EDFA 2IGTA 4YMIA 5C7YA 3CX8A 3ZDFA 4PYIA 5E9AA 1V9SA 2O7VA 4J3NA 1VA4A 4UCFA 1ODCA 1N25A 2I4TA 3IHTA 2QGFA 2FV8A 4AY4A 2WIDA 4GR4A 3QJYA 4ANFA 3KB6A 1Q91A 3IR7A 1KZHA 1JHMA 1N2EA 4EP1A 3L05A 5NULA 2J3HA 3D02A 1XFDA 3NTRA 4LZPA 3DCJA 1M2KA 2VJNA 4GI3A 4WFQA 4XFKA 5FUYA 1Z37A 2IPMA 4IIFA 1ZPDA 1KOFA 2M1XA 3U0BA 1N6KA 2RHCA 1ORIA 2OD7A 2R6AA 2WWRA 3ENWA 1GCGA 4JXKA 2YV3A 4HAZA 5IASA 4K9NA 2ZBGA 4TYMA 3T7JA 2HBRA 3SZUA 3C3JA 1EFTA 3E48A 2WWVD 2XV1A 2A5FA 3TVTA 1A1SA 1IZ0A 1DC6A 4MPPA 4EBFA 3IOEA 1TGVA 1XDSA 2C7RA 3EIOA 1DRUA 5F2KA 5J2TF 3JQ7A 1O97D 2P0EA 2Q21A 2XB9A 1EZZA 3AONB 4N9WA 4OQZA 1BDIA 1Z2PX 5IDYA 3RC3A 5ICEA 1XTBA 2FP4A 1AXGA 2HI0A 4JA2A 3RU9A 3GN1A 5AI5A 1O0CA 2V96A 3GMDA 1YQGA 1DADA 3FSEA 3OP4A 4R8VA 3LT4A 3Q4GA 1OTHA 2QM0A 1GFZA 1FP1D 1P39A 4K87A 2V7PA 1QGYA 4ICIA 4BQSA 5JANA 2WF9A 5ALMA 2FGKA 1NVEA 3RROA 3RFXA 1B14A 1D3AA 1NZDA 1OPRA 2FSPA 3Q6MA 3HUFA 4M76B 4ZPJA 3TE7A 4FE4A 5BN3B 3OZVA 1TAGA 5AVVA 4EF6A 1JRLA 2EKLA 4H31A 3K0FA 4GLFA 3C97A 2LPMA 3LHIA 1QIGA 1PR3A 5K0LA 1T8RA 4D8TA 3H42B 2YXLA 5KPDA 1DKQA 2Z30A 4E31A 5EJ6A 3TRFA 3KHKA 4CQMB 3PNQA 5JXJA 1N78A 3AF1A 3NHKA 3R6TA 4I46A 3ZWMA 1DUIA 4GXRA 3PTZA 4PAGA 3ZDEA 3G0DA 3FNQA 3IP3A 1DEXA 4EYSA 1QP8A 1NNEA 4K1LA 4F5EA 3GI1A 2VO1A 2PZBA 1UODA 1FVXA 3IB6A 3P9SA 4KN5A 1SKYB 1CKEA 2GKSA 1R1DA 3WY9A 2Y77A 4TN5A 3EWNA 1Y6RA 1Q0RA 5KDOA 2BF7A 3CBGA 3TPCA 3EG5A 4HWKA 1DG9A 1O95D 4BJ1A 2W2OA 3BGSA 4I3GA 3ICCA 4KFTA 1SQ6A 1MG5A 3LL7A 2WWYA 3MB5A 3H9JA 1U2DA 4UM9D 1PRYA 4RAQA 4U9UA 1WXXA 1KIMA 5CJJA 1V7CA 4MWTA 1X1RA 3F1LA 3GU3A 4PYLA 4R84A 2F43B 1T1EA 3I8OA 2IIPA 1FFEA 1LW6E 4KMMA 1OFGA 2I7TA 5TMEA 3K8YA 4YXWD 3Q15C 1HF3A 1PX2A 2Z5FA 3UC5A 5KQRA 4RGQA 4BFLA 1CIJA 3TIVA 4MGKR 1L1FA 4Y2UA 1QDLB 2ETXA 1U04A 3DPSA 3GMTA 1U9CA 4GR5A 4TMVA 4P93A 1UK7A 1L5GB 4FWTA 1J0EA 3OJCA 4EHBA 1ZHFA 3IMGA 2CJXA 4L0QA 1ZONA 2R751 2PS9A 1WLSA 1RC1A 5FBQB 1UZUA 1MV8A 1XN4A 5AJXA 1A7AA 1CZOA 1CY8A 4A3SA 3I0NA 1F48A 2GUGA 1M1ZA 1J09A 5TV2A 5EP4A 3LGXA 3KOYA 3NASA 1E4EB 4IOJA 4BOYA 3BXZA 3P19A 2SKCA 1SO8A 1SVSA 4L07A 3GUCA 4URFA 2ROQA 2R8YA 5HUHA 3Q7IA 1ENPA 2ZT7A 1TMKA 1JZQA 3B7GA 4L15A 4C5AA 4DYDA 4CT5A 1V9LA 5BQFA 5I5EA 3ND9A 1W5SA 2Q4OA 1A76A 1AKRA 1W46A 2J85A 1B6RA 2XTMA 3B1XA 3DEAA 3K0AB 3VHQA 2ABWA 3ENQA 4E13A 4XM1A 1FDTA 5KNCD 1MIHA 2VF2A 5TRTA 1JDNA 2HBYA 2BI8A 2X7XA 1C1HA 3ES9A 2D5IA 5I9LA 3MJDA 4LMPA 1EG7A 4I55B 4F9EA 1AXRA 4ZT3A 3A2KA 4S1OA 4PCAA 1NVMB 1P5HA 1RHUA 5IC4A 1PVOA 1EAYA 1OZHA 4J16C 3KEFA 1SPXA 4YDQA 3UB4A 4ARIA 4PAMA 1R37A 3EGXB 3V4SA 3E23A 2COEA 3KLNA 4ARCA 1KSFX 4C6RA 1DELA 1UJCA 1WY7A 2R6DA 5JQGA 2XYHA 3DE7X 2IBTA 2VXCA 3UMBA 2NVUA 1JPJA 2J7KA 2V9ZA 4IF4A 2R84A 1E98A 4UBNA 3TL2A 5KYXB 1DINA 1L2TA 1PR6A 1XTQA 3BHMA 3KPWA 4AYTA 1ZISA 2XXJA 3E1KA 3SC2A 2QJTA 3ZD9A 1NVVR 3X44A 2WWWA 4F9TA 1UFOA 3GFOA 5B6PA 1U2QA 3RRNA 4BUJA 2I76A 2IIVA 5JNSA 3U9LA 1QLWA 3OZTA 4LXUA 1PV2A 2W2MA 4TT8A 1M8KA 1ZG3A 3C70A 4CM3A 4UC0A 1P4SA 2UZAA 1GUFA 3NC1C 3K0HA 4M98A 4Q47A 4FHZA 3SM9A 2IUSA 4CHTA 3LSTA 1V8OA 2RI0A 3O94A 4Q4JB 3JWGA 2GHRA 5AYVA 2P6UA 1J24A 1NDQA 2EFJA 3R0XA 4JLMA