4G3KA

Crystal structure of a. aeolicus nlh1 gaf domain in an inactive state
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
170
structure length
155
Chain Sequence
DLKVEIETLYEVSKILSSSLNLETTVPYIFRLLKKLMGFERLTLTIYDPSTDQIVVRATSSGKFPKEGFKKGEGITGKVWKHGVPIVIPDISQKKIAFIAVPIKSGGKVIGVLSADKEINEKDSLDEYTRFLSMIATLIANSFSLERKVQAERKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator nlh1
publication title Structural mechanism of GAF-regulated delta(54) activators from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 39
structure length 155
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4g3kA00
4IUHA 4Y5FA 3NOTC 2OOLA 4LRZE 3KSGA 2O0YA 4O8GA 2K2NA 4BWIA 3NOPC 2W3DA 4Q0HA 3DBAA 4Y2FA 4O0PA 4RQ9A 4G3WA 4IUKA 4Z1WA 1VHMA 1YKDA 2O9BA 2VZWA 4Q0IA 2Y79A 5HPIA 4PAUA 1STZA 4R6LA 2M7UA 2LB9A 4ME4A 5C5KA 3OOVA 2VKSA 3IBJA 3NOUC 4DN0A 3W2ZA 5AJGA 4G3KA 3MQ0A 2Y8HA 3EEAA 3TRCA 2W3HA 3CITA 1TD5A 4MDZA 5LBRA 3MF0A 4MMNA 4EUVA 3S7QA 3S7OA 3BJNA 2XROA 3O5YA 2LB5A 3VV4A 4E04A 3R4KA 4CQHA 1F5MA 5HSQA 1YSPA 4GW9A 1ZTUA 2VJWA 2B18A 3S7NA 2IA2A 2W1TB 4O01A 3ZQ5A 2XRNA 5TJJA 4G3VA 3C2WA 4FOFA 4MCWA 5HL6A 5L8MA 2W3FA 4ZRRA 4MN7A 3D3OA 3KSIA 3RFBA 2O9AA 3NHQA 2K31A 3CI6A 4LRXC 5DFYA 3LFVA 2G7UA 2HGVA 3S7PA 4GLQA 1TF1A 1YSQA 4DMZA 2M7VA 5K5BA 2O9CA 2KOIA 3E98A 1MC0A 3IBRA 4Q0JA 4ETXA 5HPFA 2W1TA 4QPRA 3K2NA 3HCYA 4YNRA 2W3EA 2GX5A 4ETZA 2ZMFA 4Y3IA 3KO6A 2VEAA 3OBFA 4R70A 4EU0A 2W3GA 3G6OA 3KSHA 3MMHA 4IJGA 5I5LA 2W1RA 2XSSA 4LRYC 2O99A 3KSFA 5DFXA 2QYBA 4YOFA 1MKMA 3E0YA 2KLIA
chains in the Genus database with same CATH superfamily
2WGWB 3LEQA 3VP2A 1QMFA 4JXSA 4X6TA 3PTEA 1JVJA 3DTIA 3T1RA 4S2NA 4R6LA 3CPTB 4K0WA 2ZQAA 4JF5A 4P6BA 2LB9A 2PBDP 3FWLA 3ZNYA 3HUNA 4JF4A 4EQ1A 2YKHA 1MWTA 1KDSA 4ID4A 3T1XA 2ZMAA 4BJPA 3R4KA 5GHZA 3FV7A 4CLCD 1M6KA 1VEUB 5DF9A 1XGIA 3ULFA 2PR5A 5FDSA 1GHIA 2HP5A 4N92A 4OLDA 3IWIA 4LRXC 3HLDA 1W7FA 5M1AA 2X02A 3V3SA 4LENA 3T4LA 2ZM2A 4GD8A 3N8SA 3EQUA 4RX3A 3UDIA 1MWSA 3OBFA 5A8BA 1DRMA 4EU0A 2P04A 2R9WA 2WGVA 5DTTA 1YLJA 2J80A 3N4IA 2YKFA 5DFXA 3HL9A 1L0GA 1NLYA 1IYSA 1MKMA 4DE3A 2XA7M 2OOLA 4EBNA 3VOYA 3SOIA 3VE4A 1J9MA 3AGDA 3DWKA 4I3IA 1G68A 4OP8A 1K54A 1YKDA 4FD8A 3PBTA 3NIAA 3H82B 1F98A 3SS3A 4QWOA 4II7A 3V39A 4KUOA 4X1LA 2PDRA 3ZGAB 4G3KA 1FR1A 3F1OB 3IF6A 5CHJA 3MFXA 2W3HA 3L7HA 3T4JA 3KX0X 3UE1A 4XUZA 3QP8A 1CQAA 4EEUA 5GHXA 4HI4A 3D72A 5EE8A 3LR5A 5FAPA 2Y59A 3FKWA 3LO7A 3OLOA 3UB9A 4KZ5A 2QWSA 2W3FA 3NDGA 4FUWA 3RFBA 3PHYA 1L0EA 5EECA 4DJ2A 1S4SA 1YSQA 4KENB 4S2PA 2ZQCA 4QU3A 5FQ9A 3FYZA 2Y2GA 1BULA 3S4XA 2HDSA 1MKIA 1H8ZA 1Y4OA 3LEZA 4WEKA 3HCYA 1PWGA 2HJ9C 4R3BA 1NLZA 1K38A 2XSSA 2O99A 3BFEA 3DAVA 2WKPA 2J9PA 2ZLYA 2ZJ9A 2P9VA 3E0YA 5J4EA 2B95A 4WF0A 4DE2A 4OOLA 2Z2LB 4QY5A 4EW7A 4DE1A 1JTDA 3Q81A 1PW8A 1XFNA 4KG5A 4CPKA 3VE3A 2EWWA 3W4QA 3ITAA 1FSYA 1FSWA 5CGXA 3FPWA 3Q1FA 4BD1A 1P0ZA 2Y2JA 1I2WA 5HL1A 5AVEA 5C5KA 3V5MA 3IBJA 2OSUA 3NOUC 4HP9A 1IELA 3MQ0A 2XQZA 3E4PA 3SH7A 4YFMA 3DTMA 3IHAA 5L09A 3CITA 2V1BA 5EV0A 4MDZA 5KMWA 4K08A 3MXSA 1ESUA 2V0WA 3IS2A 2R9XA 2DRWA 2WKQA 3MKEA 1E25A 1ZTUA 4DDSA 2VK3A 1Z09A 3MZEA 3LUQA 4OQ0A 3NULA 3HJIA 3N8RA 5L8MA 2WZZA 2ZC6B 3DTEA 3U2AA 3MQOA 4N9LA 4OQHA 2UV0E 3S1YA 1LI9A 3VOZA 4Y13A 3O87A 3WRTA 1MBLA 4F3LA 5HPFA 3P01A 4U0TA 1ES3A 3EEHA 1LHYA 4GB7A 2W3EA 3LIEA 5F1FA 1ESIA 1K56D 2Y2MA 5IHVA 5M19A 2J3TC 2W1RA 3LGOA 1VETA 3P09A 3LIFA 5HARA 4DJ3A 2EX9A 3CJMA 5KSCA 4NXEA 2VGKA 3BEBA 2W3DA 3C7VA 3DW0A 3BFGA 2INWA 3IXDA 1LSWA 1ODVA 1MY8A 3DWZA 2WK0A 2M7UA 2QMIA 4R4SA 1NJ4A 3WS0A 5TBMA 5JYPA 4LV0A 3OPHA 3WS5A 1JWVA 3E4OA 4JLFA 3T4TA 5I94A 3IF6B 3QP2A 3D4FA 2Z2MB 4NXFA 1Y28A 1O7EA 5CERA 5F69A 1X0OA 1PRQA 2FH5A 3VV4A 4JF6A 1JWPA 3S7NA 3W4OA 2IA2A 4O01A 1KVLA 1IYOA 5HD3A 5FQMA 3GTCA 2OAP1 2A49A 4OONA 2ZOIA 5AQ7A 5HL6A 3IXGA 2L0WA 4GDBA 4FSFA 3NHQA 1FCMA 3K3CA 4U3TA 4GLQA 1XJ6A 3NECA 2A24B 2O9CA 2I72A 4LCLA 3W8KA 4GNUA 3RXWA 4HEFA 4X68A 4QPRA 3BECA 1S4RA 5DVAA 3QP1A 5AQAA 3H9WA 2WKRA 4NXGA 1OTEA 4FH4A 5F5YA 1BSGA 2P9VB 4MBHA 4LV2A 2K2NA 5TGFA 3UMEA 3M6BA 3MZDA 3HUOA 5IS1A 3ZG5A 1HVBA 1D7EA 2OAQ1 5EUAA 4HIAA 1WYCA 2GZAA 3GDIA 5G18A 5L07A 4KZ9A 2Z6CA 4PKYA 3ZG9B 1YLYA 2WKIA 2VKSA 3PBQA 3SW1A 4L0LA 1XFQA 3ZNTA 2VGLS 4Y0UA 3TRCA 1K25A 1CEFA 3T4SA 1FQGA 2PU2A 3IS2B 3BY8A 5DF8A 1Q2QA 4EERA 5CXWA 4DF6A 3VFHA 1DJAA 2FFFB 1T19A 2XFTA 2WKHA 2ZM0A 3VMAA 2W1TB 4OPRA 1E4DA 1XJ3A 4HBUA 2ZQ8A 4E3LA 3BFFA 3KSIA 4IBRA 3LR3A 1LL5A 2JKTM 2P08A 3NJAA 2PD7A 5K5BA 4X56A 3OC2A 3ZVTA 1KGEA 1Z6FA 3EGDC 5A93A 1PYYA 3PR6A 5KSHA 1K57C 4QY6A 1SHVA 4R1GA 4F3LB 3UB6A 3NY4A 1SKFA 2GX5A 2I9VA 5FAQA 4QJGA 3LYXA 3MR0A 5TR7A 2JBFA 4IVIA 2DCFA 3CUEC 1VETB 1UWPX 2XGNA 4UA6A 2V8FA 3UB5P 4Y5FA 2WZXA 4KG2A 2V9AA 5EPHA 5EVIC 3PBOA 3DBAA 4R38A 5DTKA 3N7WA 2QHKA 1NXYA 4O0PA 1SDEA 2Y2PA 2WYXA 3UE0A 1JWZA 3A3DA 1KDWA 2EX6A 2O9BA 2Y79A 5FA7A 5HPIA 1STZA 5E43A 2HV1A 3UNWA 2VGJA 3V3RA 5TBMB 5FASA 2G2UA 2VGLM 3ISGA 3LY4A 2WAFA 3CMZA 2XA7S 3QNCA 3UB8A 4WL9A 4EV4A 1JTGA 4WZ5C 3KYEA 5HZHA 4LCMA 3S7OA 3MFDA 5A91A 2XROA 5CGSA 1F5MA 5HSQA 3PAGA 3A0VA 3L9KA 1XKZA 1ES4A 4N1XA 4KQOA 5FSRA 4GJ4A 3D3OA 4KQDA 4FTXA 4MN5A 5CECA 4UA7A 3ZG8B 1YMXA 4JPMA 1F9IA 3MJQA 5E2HA 1K55C 1G28A 3T4OA 3DTKA 2JKFA 4LGWA 4P0MA 1BT5A 4IBXA 4D2OA 2H0TA 3IWQA 4HH2A 2HPBA 4NXBA 5KZHA 3WS1A 5EVIA 1NYYA 4HOIA 5MC7A 1CEGA 4RYEA 2H10A 4LRYC 2Y55A 5GLBA 1ACFA 4Y17A 1D1JA 3ZDJA 3AGEA 3K3DA 4O8GA 1F2KA 2E8IA 3WRZA 2ACGA 4HBTA 5HX9A 1NZUA 3CHWP 2ZC5B 5GL9A 2A3UA 2NUTC 1MWUA 4GOGA 3LIDA 4HY8A 4ME4A 3SS5A 3F1NA 4JGRA 4AFIA 5HD5A 5HWVA 4DRTA 3AGFA 2JKTI 1S6RA 3GVBA 5AQBA 2OWHA 4BBTA 1OMEA 4WEJA 3JVVA 2ZQ7A 1K6SA 4S2JA 4JXWA 3W4PA 4PM5A 3MBZA 3G2ZA 3UPPA 2XRNA 5AQ9A 1EI5A 1MXOA 1T1AA 2PU4A 3U4LP 5FQQA 3IF5A 3LIBA 5TFQA 1EROA 5CTMA 2QKPA 2K31A 1KE4A 2ZL1A 2D02A 1KGFA 2HF6A 1TDGA 2KOIA 1P97A 1M40A 3IBRA 4OLGA 1P9RA 4Z9QA 1C3BA 2NUPC 1I2SA 3KSFA 1YLPA 1S1YA 5L10A 2A24A 1EWZA 3ZFZA 1HD8A 5EOOA 3VOLA 5A90A 4GS9A 3OCLA 4IUKA 1TDLA 2H0YA 4HQAA 1PFLA 4DE0A 3ZG7B 2Y2LA 4BBUA 4WMCA 3IH9A 4IVKA 4JXVA 1MPLA 2GNXA 3OPPA 3OOVA 4DN0A 1U60A 5KIZA 1ZKJA 3EEAA 3T4QA 3TW8A 1YPRA 4Y15A 4I39A 4UEYA 2ZC4B 3TOIA 4DXCA 3ITBA 4UAAA 2EX8A 5LBRA 2PD8A 1L0FA 4DDYA 1TS6A 5HDSA 3GR2A 3CLOA 1YLZA 4MBKA 4HH3A 2FZ0A 4Y7PA 3PBSA 1OT6A 1PWDA 3IX4A 2P7JA 3VP1A 2VX8A 4X1MA 1QMEA 1H3QA 3QP4A 3UMDA 3JPUA 2QJ7A 3S7PA 1OTAA 2ZQ9A 3UE6A 2JCHA 1GSXA 1ALQA 1H0MA 3ZVWA 3C4PA 4EUZA 4KUKA 3C38A 5M18A 2W1TA 3GV9A 2XD1A 2XD5A 5GLAA 2L1MA 1MZUA 1H5XA 4ETZA 1K4EA 3QP6A 3BFCA 2PYRA 5EVIB 4LFUA 5FI2A 1CI9A 2RL3A 1OTDA 3E4QA 5CX7A 1DY6A 5BOHA 2QYBA 1E3UA 1K6RA 3CAXA 4ZJ3A 2DMWA 2Y2HA 3SZTA 1LI0A 4BMWA 4PKYG 1PZPA 4Y2FA 1XP4A 5F68A 3N8LA 4Z1WA 3RXXA 3C30A 1GCEA 1GHPA 4X53A 1T18A 4U0XA 3ZHHA 2R78A 4HP4A 5DKKA 5CRFA 3VP4A 4JBFA 2Y91A 1SZVA 3F1NB 2FFYA 3C8CA 1IYPA 2XDMA 4ZJ2A 2QZ6A 4KZAA 3UN7A 4BENA 1V9ZA 1A0KA 2ZOHA 3MF0A 1DP6A 3G34A 4JXGA 4EUVA 4QHCA 3BJNA 3O5YA 3MQQA 1BLCA 2ZC3B 1XXMA 5E2EA 5EOEA 4GW9A 1UWNX 3A3EA 4BBVA 1W63M 2V2FF 3GRJA 3WS4A 3ICYA 5EM0A 4KZ8A 4E3KA 3PYPA 3G35A 2ZL1B 4NKPA 3PBRA 3OCNA 3UO9A 1LSXA 4D60A 2V1ZA 3T50A 4C3QA 3IT9A 1S1ZA 4Q0JA 2GJ3A 3FPVA 1DP8A 1XJ2A 1KVMA 2IWCA 1TS0A 4KZBA 3ZG0A 2ZMFA 3KO6A 1W5DA 4WZ4A 4GCZA 2W3GA 3G6OA 1D06A 3Q82A 3MKFA 4R23A 1W8YA 1LT0A 2EX2A 4B4ZA 2XEPA 5EVID 1KE0A 4E6XA 1K0KA 1TS8A 3IXHA 4K0XA 2HZ5A 1L0DA 4IHQA 2VLGA 2KX6A 4E3OA 3BY9A 3NBLA 4LRZE 3KYQA 4S2MA 3TSGA 4MBFA 4GS9B 2QJ5A 2ZC7A 1V9YA 4A5RA 1G6AA 4EQIA 3RH8B 3IX3A 5F6AA 2ZM8A 4HESA 1NRJA 4EBLA 4H6JA 2HP9A 4RX2A 4EXOA 3B33A 4GDNA 4OPYA 2GDNA 3KYZA 4OPQA 1GA9A 4S2LA 5GLCA 3P98A 1LL9A 1IKIA 1AWIA 5E2FA 4PPRA 3T4KA 3BWLA 1CI8A 1ES2A 1BYWA 3H7WB 4RVAA 1SCWA 2Q9NA 4X69A 4I3JA 5FATA 3HLFA 1YLTA 3RTYA 4DKIA 5FQKA 1ZC2A 2PAVP 3EOIA 3LFVA 1PWCA 5HAIA 3BQAA 1OJ5A 1CF0A 4S2KA 5FQIA 1IYQA 2EFUA 1CK3A 5DJUA 3TE8A 4JKTA 5D3OA 5EVEA 3BQ8A 1HLUP 1YLWA 4IEDA 3WWXA 3WS2A 2VEAA 3G31A 5CEBA 2XK1A 3JYIA 3MMHA 1SKOA 1PNEA 5FL3A 2HDUA 1N9BA 4QD4A 4L9EA 5CHMA 3LCEA 5J7EA 1YQSA 3BLMA 3F1PA 4PHTA 3IH8A 3A3IA 3OPRA 3LI9A 3OPLA 2JE5A 4HJ3A 3SH8A 1DJCA 2Y2QA 4BWIA 1PI5A 1IKGA 3LR4A 4I3AA 1VHMA 4Q0IA 5DF7A 1W63Q 4MNRA 1XA1A 1FOFA 1Y54A 2VV6A 4WMCD 4BQMA 4NEED 3W2ZA 1BLHA 2X01A 3ZYTA 5F83A 1WE4A 1NZOA 2AVXA 1TD5A 1TS7A 1LSVA 4E3JA 2LB5A 4E04A 3EQVA 4B4XA 4PMAA 4HHDA 2EA9A 2VJWA 3D9YA 3ZQ5A 2J8YA 1VQQA 2E8JA 2JKRM 3Q07A 2XH9A 1PW1A 2JN7A 4NK3A 4WM9A 3M2JA 4LV1A 2Y4AA 3CI6A 1FCNA 5G4ZA 2HGVA 2XF3A 4OPZA 4R0QA 1H8YA 5J8XA 3UPOA 2Q9MA 3UY6A 4OOYA 1VB6A 3VFFA 1S67L 4ETXA 1LLBA 1N9NA 5IT5A 2PRFA 3BLSA 5CHUA 4R4RA 1ONGA 4N1HA 4R70A 4XT2A 1K57A 4OH0A 1G5UA 4GD6A 5I5LA 1EW0A 2WUQA 3G4PA 4Y0TA 3FKVA 1E3UD 3CUEA 4LPZA 1BZAA 1K54C 2G2WA 3UE3A 4WLAA 2OV5A 2HJEA 5L2FA 1P9WA 4UQIM 3Q7ZA 1YM1A 2KDKA 1RGZA 3IF6C 4R3JA 4H6JB 3TJZC 2Y2NA 4ESPA 2C5WB 4B93A 3I7JA 3OZHA 4R3AA 3SS4A 4CLCE 5FEGA 4N9KA 2J3WA 4B9OA 1NWZA 3G2YA 4CQHA 1DJBA 4WZ5A 1OJGA 3UPNA 2WGIA 3G30A 3VP3A 1NY0A 1IEMA 5TJJA 4F94A 4FOFA 5JYOA 4YINA 4WELA 2P74A 4M3KA 2HDQA 5CEDA 4MLLA 1UGUA 2ZQDA 1IOUA 3CG5A 4OP5A 4Y0OA 1JNUA 5FQJA 4UA9A 4BD0A 1BTLA 1FR6A 1L3LA 2WKEA 5HAQA 4HJ4A 1K55A 3BFDA 4S2IA 2V1AA 5HFOA 4BL2A 5CGWA 3C4OA 4WYYA 1OT9A 1J3WA 1SKOB 3HLEA 1AXBA 1OTBA 4WUJA 4PM9A 4OVDA 3F1PB 3HREA 3HVFA 5GHYA 3A0RA 2O0YA 2J3TD 5FEFA 3NI9A 2PYPA 4E3MA 4WN5A 2EXAA 3RJUA 4PAUA 2JKRI 1S66L 4E6WA 4XXRA 1T1BA 1DP9A 2HP6A 4Q8IA 2JKGA 2XFSA 4ZJ1A 3T1QB 3HUMA 2PR6A 2UWXA 3VSLA 1FIKA 2JC7A 3NC8A 4KG6A 3VSKA 4KZ4A 2J7VA 1MWRA 1YSPA 3FC7A 4KZ6A 5DJTA 4E3IA 3HLBA 4ARZA 1YT4A 4OQGA 1ZG4A 2W27A 1XGJA 3TG9A 4PM6A 4ZRRA 1NRFA 4CLCC 3Q7VA 3B3XA 2V8CA 2G7UA 4C75A 2Z6DA 2OLVA 1TF1A 4GN2A 4L9FA 5CTNA 3T1SA 4DMZA 2M7VA 4GHIA 3MZFA 1IFQA 1OPXA 3H7WA 1L2SA 4GZBA 3B47A 3GQZA 2V0UA 4JGQA 1VM1A 1WA9A 4XT2B 1TVFA 2EFXA 1PI4A 1GA0A 2Y2IA 3GSGA 4OQIA 2HDRA 2RCXA 4DXBA 1G6OA 3IWOA 3MXRA 3NOTC 5GLDA 4ZDXA 2BTFP 3NOPC 4I38A 4XUXA 1ZHHB 5A92A 4RQ9A 4BLMA 1GHMA 5HWTA 4RA7A 3VP0A 3UDXA 5HW3A 2WAEA 2XLNA 5J3WA 1TEMA 5G4YA 4KQRA 1LL8A 2DNSA 4FH2A 5AJGA 2C6WB 1KE3A 2PT7A 2Y8HA 5AVFA 2JHEA 4MN6A 1HTZA 3UB7A 3C5AA 2XR0A 4QB8A 4P87A 3S7QA 4KQQA 3M6HA 4FCFA 3B42A 4CLCA 3MSHA 3A3JA 4PM7A 2B18A 2IWDA 3BM6A 3PAEA 2BG1A 1K4FA 3M2KA 3NDEA 4NG2A 3V67A 4OOMA 4UHUA 3MXQA 2IWBA 4PM8A 2O9AA 4X55A 5DFYA 4M4XA 1WYBA 1CJFA 2VV7A 5F82A 3E98A 4P6ZS 1MC0A 1ONHA 4CJNA 3R7WA 1KOUA 4ZTKA 2H5SA 1GSWA 4X25A 4OKPA 5DKLA 5HWWA 1XPBA 1I5QA 4NETA 3QP5A 4LV3A 2WGWA 2Y2OA 4IUHA 4KZ7A 1N4OA 3KSGA 5FAOA 1YAXA 4JGOA 3LI8A 1XJ4A 3HLWA 4H8RA 2EWVA 4P85A 3BYDA 1BUEA 3GECA 3A3FA 1ZG6A 5DTSA 2VZWA 3CPTA 1Q2PA 3ZCZA 4HNBA 1KGGA 3GMWA 2CC1A 5EVLA 4MEZA 3CWFA 3E2LA 5HDCA 1O07A 2V20A 2Q0OA 2BLSA 2Y2KA 3EGXC 2ZBBA 3NCKA 1ES5A 2B5RA 4K91A 1OTIA 5E2GA 4MMNA 1ERMA 3FG8A 2X71A 4EWFA 3CZDA 3A0SA 3IHBA 3LY3A 1VEUA 4ARZB 2B02A 3QHYA 4G3VA 1XA7A 1SDNA 4EBPA 3O3VA 3Q7VB 1W8QA 3N6IA 3HLGA 3HLCA 5F1GA 1H8MA 4KZ3A 3LICA 4P6ZM 4B88A 3JVUA 1RCJA 4S2OA 3E2KA 1YMSA 2EXBA 4E3NA 3PXPA 4GHIB 4ZAMA 4YWZA 3O86A 3HBRA 3K2NA 1NYMA 3IX8A 4Y3IA 4C6YA 2MJ6A 4LLOB 1GSVA 1FCOA 4ZBEA 3O88A 1PIOA 2M1CA 5FDHA 3MS6A 2QPNA 1PZOA 4Q0HA 3SH9A 4EETB 3PBNA 4G3WA 2L4RA 4WBGA 4EESA 2J9OA 2PHYA 3H82A 2A2LA 3T12B 4I5SA 3G32A 2VA0A 5EFWA 3LR0A 2OWJA 1BLSA 4EEPA 3F1OA 3QNBA 3FZCA 1ERQA 4S2NC 4HJ6A 3C7UA 5EM1A 3S22A 1RP5A 1T1CA 3BRMA 4UQIS 4CLCB 2ZD8A 2K7SA 5HDDA 1BLPA 2OLUA 3EWKA 3P7NA 4JGPA 1W79A 5FI6A 3UDFA 3C2WA 1HZOA 1XX2A 4L9GA 1S0WA 4MCWA 5U47A 3IXBA 4BL3A 3LIAA 4MN7A 1RGYA 4GKUA 5FI7A 2CMNA 3IQAA 3HJKA 1N9LA 4O7DA 2BASA 2W0NA 5HAPA 2D01A 3R7WB 2PBYA 1K56A 4YNRA 1N9OA 3V50A 2H28A 2WADA 3BW6A 2VV8A 3KSHA 5IU1A 4IJGA 1FILA 2ZMVA 4YOFA 2KLIA
chains in the Genus database with same CATH topology
3A0RA 4BMWA 4PKYG 2O0YA 2J3TD 2K2NA 4Y2FA 3UMEA 2PYPA 5F68A 4WN5A 5IS1A 4Z1WA 1D7EA 3C30A 2OAQ1 4PAUA 4HIAA 2GZAA 2JKRI 3GDIA 4R6LA 1S66L 1T18A 2Z6CA 2R78A 2LB9A 4HP4A 5DKKA 4PKYA 2VKSA 3F1NB 1T1BA 3PBQA 1DP9A 3C8CA 3SW1A 4L0LA 1XFQA 2VGLS 3TRCA 2PR6A 4EQ1A 1V9ZA 2YKHA 3T4SA 2ZOHA 3MF0A 1DP6A 4EUVA 4BJPA 3BJNA 3IS2B 3MQQA 3O5YA 3BY8A 3R4KA 4EERA 3FC7A 1YSPA 4GW9A 1UWNX 5DJTA 4CLCD 1T19A 4ARZA 2W1TB 4BBVA 1W63M 5DF9A 1XJ3A 2W27A 3ULFA 2PR5A 4ZRRA 3ICYA 4CLCC 3KSIA 4LRXC 3LR3A 3PYPA 2P08A 2G7UA 2JKTM 3NJAA 2Z6DA 4NKPA 3PBRA 2PD7A 1TF1A 4L9FA 3OCNA 1LSXA 4DMZA 2M7VA 5K5BA 3OC2A 4GHIA 3T50A 3EGDC 1IFQA 1OPXA 3H7WA 3PR6A 3T4LA 5KSHA 1S1ZA 4Q0JA 3B47A 2GJ3A 3FPVA 1DP8A 3EQUA 1XJ2A 2V0UA 4F3LB 3UB6A 1TS0A 4JGQA 2GX5A 2I9VA 2ZMFA 3KO6A 3OBFA 5A8BA 3LYXA 3MR0A 1DRMA 1WA9A 4GCZA 2P04A 4XT2B 2W3GA 3G6OA 4EU0A 2J80A 1D06A 3CUEC 1LT0A 2YKFA 5DFXA 1TS8A 1UWPX 1NLYA 4IHQA 2VLGA 1MKMA 1G6OA 2XA7M 2KX6A 4Y5FA 3NOTC 2OOLA 3BY9A 4LRZE 2V9AA 3KYQA 3NOPC 4I38A 3PBOA 3DBAA 4R38A 4GS9B 1ZHHB 3VE4A 2QHKA 4O0PA 4RQ9A 4I3IA 2QJ5A 1V9YA 1YKDA 5HWTA 2O9BA 3PBTA 3H82B 2Y79A 5HPIA 1F98A 1STZA 3RH8B 2HV1A 5F6AA 4II7A 1NRJA 4H6JA 5J3WA 4KUOA 4EXOA 5TBMB 2VGLM 5G4YA 3B33A 1LL8A 2PDRA 5AJGA 3KYZA 4G3KA 3F1OB 2PT7A 2Y8HA 3MFXA 2W3HA 2XA7S 3T4JA 3KX0X 5AVFA 2JHEA 4MN6A 3UB8A 4WL9A 3UB7A 4EEUA 5HZHA 4HI4A 3D72A 3LR5A 3S7QA 3S7OA 2XROA 3B42A 4CLCA 3T4KA 3BWLA 1F5MA 5HSQA 1BYWA 2B18A 3H7WB 3A0VA 3OLOA 3UB9A 3V67A 4I3JA 4OOMA 4KQOA 2QWSA 2W3FA 3RTYA 3MXQA 4GJ4A 3D3OA 4KQDA 3RFBA 2O9AA 3PHYA 4MN5A 5DFYA 3EOIA 3LFVA 4DJ2A 3BQAA 1OJ5A 1S4SA 1YSQA 4M4XA 1F9IA 3MJQA 5DJUA 1G28A 2VV7A 3T4OA 3TE8A 3E98A 4P6ZS 1MC0A 3BQ8A 3R7WA 1KOUA 4WEKA 1GSWA 3HCYA 2HJ9C 4HH2A 2VEAA 4NXBA 5DKLA 5HWWA 4HOIA 3MMHA 5MC7A 1NLZA 2XSSA 4LRYC 2O99A 5FL3A 4L9EA 2WKPA 5J7EA 3F1PA 4PHTA 3E0YA 5J4EA 4IUHA 3LI9A 4HJ3A 4WF0A 4OOLA 3KSGA 4EW7A 3K3DA 4O8GA 1YAXA 4JGOA 3LI8A 4BWIA 1XJ4A 2EWVA 1XFNA 3LR4A 3VE3A 3GECA 4I3AA 2EWWA 1VHMA 2VZWA 4Q0IA 3FPWA 1P0ZA 1W63Q 2NUTC 4HNBA 3LIDA 2VV6A 4HY8A 4ME4A 5AVEA 5C5KA 3F1NA 4JGRA 4AFIA 3IBJA 4HP9A 3NOUC 4NEED 5HD5A 5HWVA 3W2ZA 2JKTI 3ZYTA 3CWFA 3MQ0A 5HDCA 2OWHA 3E4PA 4BBTA 3EGXC 3CITA 2ZBBA 2V1BA 4WEJA 1TD5A 4MDZA 4K08A 1OTIA 1TS7A 1LSVA 4MMNA 3JVVA 3FG8A 2V0WA 3IS2A 2LB5A 4E04A 3EQVA 3A0SA 2WKQA 2EA9A 4HHDA 1ZTUA 2VJWA 4ARZB 2B02A 3ZQ5A 3LUQA 2XRNA 2JKRM 1T1AA 4G3VA 3HJIA 5L8MA 2JN7A 3LIBA 2QKPA 3U2AA 2K31A 3CI6A 3MQOA 5G4ZA 2HGVA 1H8MA 4P6ZM 3LICA 3JVUA 2D02A 2HF6A 2KOIA 3PXPA 4GHIB 1P97A 3IBRA 1VB6A 4YWZA 1S67L 4F3LA 4ETXA 1N9NA 5HPFA 5IT5A 3P01A 1P9RA 3EEHA 3K2NA 2W3EA 3LIEA 4Y3IA 4R70A 4XT2A 2NUPC 2J3TC 1EW0A 2W1RA 5I5LA 2MJ6A 4LLOB 3KSFA 1GSVA 3LIFA 1S1YA 4DJ3A 2A24A 3CUEA 4LPZA 2M1CA 4NXEA 3VOLA 3UE3A 2W3DA 4GS9A 4Q0HA 4WLAA 4EETB 2HJEA 1P9WA 3OCLA 3PBNA 4G3WA 4IUKA 4UQIM 2L4RA 4EESA 2INWA 1LSWA 4HQAA 2KDKA 2PHYA 3H82A 2A2LA 1ODVA 4I5SA 4BBUA 2M7UA 2VA0A 5EFWA 4H6JB 5TBMA 3LR0A 3TJZC 2GNXA 2OWJA 3OOVA 4DN0A 3E4OA 4EEPA 3F1OA 3T4TA 5KIZA 4B93A 3EEAA 3T4QA 3TW8A 4R3AA 4I39A 4UEYA 4NXFA 4CLCE 1Y28A 4HJ6A 5LBRA 2PD8A 2J3WA 4B9OA 5F69A 1T1CA 1X0OA 1NWZA 4UQIS 2FH5A 3VV4A 4CLCB 2K7SA 5HDDA 4CQHA 1TS6A 5HDSA 3EWKA 1OJGA 3S7NA 3P7NA 3CLOA 2IA2A 4JGPA 4O01A 4HH3A 5HD3A 5TJJA 2FZ0A 2OAP1 3PBSA 3C2WA 2ZOIA 4FOFA 4L9GA 4MCWA 1OT6A 5HL6A 2P7JA 4WELA 2L0WA 3LIAA 4MN7A 2VX8A 4FSFA 3NHQA 1H3QA 3UMDA 1UGUA 3K3CA 2QJ7A 4GLQA 3S7PA 1IOUA 1OTAA 3UE6A 1GSXA 1JNUA 1XJ6A 2A24B 2O9CA 2CMNA 3HJKA 1N9LA 3C38A 4KUKA 2BASA 2W1TA 2W0NA 2D01A 4HJ4A 3R7WB 2L1MA 1MZUA 4QPRA 1S4RA 4YNRA 1N9OA 4ETZA 2V1AA 3H9WA 2H28A 3BW6A 5IU1A 2VV8A 2PYRA 2WKRA 3KSHA 4NXGA 1OTEA 4IJGA 1OT9A 5F5YA 3E4QA 1OTDA 5CX7A 2QYBA 1OTBA 3CAXA 4WUJA 2ZMVA 4YOFA 3F1PB 2DMWA 2KLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUH A;  4Y5F A;  3NOT C;  2OOL A;  4LRZ E;  3KSG A;  2O0Y A;  4O8G A;  2K2N A;  4BWI A;  3NOP C;  2W3D A;  4Q0H A;  3DBA A;  4Y2F A;  4O0P A;  4RQ9 A;  4G3W A;  4IUK A;  4Z1W A;  1VHM A;  1YKD A;  2O9B A;  2VZW A;  4Q0I A;  2Y79 A;  5HPI A;  4PAU A;  1STZ A;  4R6L A;  2M7U A;  2LB9 A;  4ME4 A;  5C5K A;  3OOV A;  2VKS A;  3IBJ A;  3NOU C;  4DN0 A;  3W2Z A;  5AJG A;  4G3K A;  3MQ0 A;  2Y8H A;  3EEA A;  3TRC A;  2W3H A;  3CIT A;  1TD5 A;  4MDZ A;  5LBR A;  3MF0 A;  4MMN A;  4EUV A;  3S7Q A;  3S7O A;  3BJN A;  2XRO A;  3O5Y A;  2LB5 A;  3VV4 A;  4E04 A;  3R4K A;  4CQH A;  1F5M A;  5HSQ A;  1YSP A;  4GW9 A;  1ZTU A;  2VJW A;  2B18 A;  3S7N A;  2IA2 A;  2W1T B;  4O01 A;  3ZQ5 A;  2XRN A;  5TJJ A;  4G3V A;  3C2W A;  4FOF A;  4MCW A;  5HL6 A;  5L8M A;  2W3F A;  4ZRR A;  4MN7 A;  3D3O A;  3KSI A;  3RFB A;  2O9A A;  3NHQ A;  2K31 A;  3CI6 A;  4LRX C;  5DFY A;  3LFV A;  2G7U A;  2HGV A;  3S7P A;  4GLQ A;  1TF1 A;  1YSQ A;  4DMZ A;  2M7V A;  5K5B A;  2O9C A;  2KOI A;  3E98 A;  1MC0 A;  3IBR A;  4Q0J A;  4ETX A;  5HPF A;  2W1T A;  4QPR A;  3K2N A;  3HCY A;  4YNR A;  2W3E A;  2GX5 A;  4ETZ A;  2ZMF A;  4Y3I A;  3KO6 A;  2VEA A;  3OBF A;  4R70 A;  4EU0 A;  2W3G A;  3G6O A;  3KSH A;  3MMH A;  4IJG A;  5I5L A;  2W1R A;  2XSS A;  4LRY C;  2O99 A;  3KSF A;  5DFX A;  2QYB A;  4YOF A;  1MKM A;  3E0Y A;  2KLI A; 
#chains in the Genus database with same CATH topology
 2WGW B;  3LEQ A;  3VP2 A;  1QMF A;  4JXS A;  4X6T A;  3PTE A;  1JVJ A;  3DTI A;  3T1R A;  4S2N A;  4R6L A;  3CPT B;  4K0W A;  2ZQA A;  4JF5 A;  4P6B A;  2LB9 A;  2PBD P;  3FWL A;  3ZNY A;  3HUN A;  4JF4 A;  4EQ1 A;  2YKH A;  1MWT A;  1KDS A;  4ID4 A;  3T1X A;  2ZMA A;  4BJP A;  3R4K A;  5GHZ A;  3FV7 A;  4CLC D;  1M6K A;  1VEU B;  5DF9 A;  1XGI A;  3ULF A;  2PR5 A;  5FDS A;  1GHI A;  2HP5 A;  4N92 A;  4OLD A;  3IWI A;  4LRX C;  3HLD A;  1W7F A;  5M1A A;  2X02 A;  3V3S A;  4LEN A;  3T4L A;  2ZM2 A;  4GD8 A;  3N8S A;  3EQU A;  4RX3 A;  3UDI A;  1MWS A;  3OBF A;  5A8B A;  1DRM A;  4EU0 A;  2P04 A;  2R9W A;  2WGV A;  5DTT A;  1YLJ A;  2J80 A;  3N4I A;  2YKF A;  5DFX A;  3HL9 A;  1L0G A;  1NLY A;  1IYS A;  1MKM A;  4DE3 A;  2XA7 M;  2OOL A;  4EBN A;  3VOY A;  3SOI A;  3VE4 A;  1J9M A;  3AGD A;  3DWK A;  4I3I A;  1G68 A;  4OP8 A;  1K54 A;  1YKD A;  4FD8 A;  3PBT A;  3NIA A;  3H82 B;  1F98 A;  3SS3 A;  4QWO A;  4II7 A;  3V39 A;  4KUO A;  4X1L A;  2PDR A;  3ZGA B;  4G3K A;  1FR1 A;  3F1O B;  3IF6 A;  5CHJ A;  3MFX A;  2W3H A;  3L7H A;  3T4J A;  3KX0 X;  3UE1 A;  4XUZ A;  3QP8 A;  1CQA A;  4EEU A;  5GHX A;  4HI4 A;  3D72 A;  5EE8 A;  3LR5 A;  5FAP A;  2Y59 A;  3FKW A;  3LO7 A;  3OLO A;  3UB9 A;  4KZ5 A;  2QWS A;  2W3F A;  3NDG A;  4FUW A;  3RFB A;  3PHY A;  1L0E A;  5EEC A;  4DJ2 A;  1S4S A;  1YSQ A;  4KEN B;  4S2P A;  2ZQC A;  4QU3 A;  5FQ9 A;  3FYZ A;  2Y2G A;  1BUL A;  3S4X A;  2HDS A;  1MKI A;  1H8Z A;  1Y4O A;  3LEZ A;  4WEK A;  3HCY A;  1PWG A;  2HJ9 C;  4R3B A;  1NLZ A;  1K38 A;  2XSS A;  2O99 A;  3BFE A;  3DAV A;  2WKP A;  2J9P A;  2ZLY A;  2ZJ9 A;  2P9V A;  3E0Y A;  5J4E A;  2B95 A;  4WF0 A;  4DE2 A;  4OOL A;  2Z2L B;  4QY5 A;  4EW7 A;  4DE1 A;  1JTD A;  3Q81 A;  1PW8 A;  1XFN A;  4KG5 A;  4CPK A;  3VE3 A;  2EWW A;  3W4Q A;  3ITA A;  1FSY A;  1FSW A;  5CGX A;  3FPW A;  3Q1F A;  4BD1 A;  1P0Z A;  2Y2J A;  1I2W A;  5HL1 A;  5AVE A;  5C5K A;  3V5M A;  3IBJ A;  2OSU A;  3NOU C;  4HP9 A;  1IEL A;  3MQ0 A;  2XQZ A;  3E4P A;  3SH7 A;  4YFM A;  3DTM A;  3IHA A;  5L09 A;  3CIT A;  2V1B A;  5EV0 A;  4MDZ A;  5KMW A;  4K08 A;  3MXS A;  1ESU A;  2V0W A;  3IS2 A;  2R9X A;  2DRW A;  2WKQ A;  3MKE A;  1E25 A;  1ZTU A;  4DDS A;  2VK3 A;  1Z09 A;  3MZE A;  3LUQ A;  4OQ0 A;  3NUL A;  3HJI A;  3N8R A;  5L8M A;  2WZZ A;  2ZC6 B;  3DTE A;  3U2A A;  3MQO A;  4N9L A;  4OQH A;  2UV0 E;  3S1Y A;  1LI9 A;  3VOZ A;  4Y13 A;  3O87 A;  3WRT A;  1MBL A;  4F3L A;  5HPF A;  3P01 A;  4U0T A;  1ES3 A;  3EEH A;  1LHY A;  4GB7 A;  2W3E A;  3LIE A;  5F1F A;  1ESI A;  1K56 D;  2Y2M A;  5IHV A;  5M19 A;  2J3T C;  2W1R A;  3LGO A;  1VET A;  3P09 A;  3LIF A;  5HAR A;  4DJ3 A;  2EX9 A;  3CJM A;  5KSC A;  4NXE A;  2VGK A;  3BEB A;  2W3D A;  3C7V A;  3DW0 A;  3BFG A;  2INW A;  3IXD A;  1LSW A;  1ODV A;  1MY8 A;  3DWZ A;  2WK0 A;  2M7U A;  2QMI A;  4R4S A;  1NJ4 A;  3WS0 A;  5TBM A;  5JYP A;  4LV0 A;  3OPH A;  3WS5 A;  1JWV A;  3E4O A;  4JLF A;  3T4T A;  5I94 A;  3IF6 B;  3QP2 A;  3D4F A;  2Z2M B;  4NXF A;  1Y28 A;  1O7E A;  5CER A;  5F69 A;  1X0O A;  1PRQ A;  2FH5 A;  3VV4 A;  4JF6 A;  1JWP A;  3S7N A;  3W4O A;  2IA2 A;  4O01 A;  1KVL A;  1IYO A;  5HD3 A;  5FQM A;  3GTC A;  2OAP 1;  2A49 A;  4OON A;  2ZOI A;  5AQ7 A;  5HL6 A;  3IXG A;  2L0W A;  4GDB A;  4FSF A;  3NHQ A;  1FCM A;  3K3C A;  4U3T A;  4GLQ A;  1XJ6 A;  3NEC A;  2A24 B;  2O9C A;  2I72 A;  4LCL A;  3W8K A;  4GNU A;  3RXW A;  4HEF A;  4X68 A;  4QPR A;  3BEC A;  1S4R A;  5DVA A;  3QP1 A;  5AQA A;  3H9W A;  2WKR A;  4NXG A;  1OTE A;  4FH4 A;  5F5Y A;  1BSG A;  2P9V B;  4MBH A;  4LV2 A;  2K2N A;  5TGF A;  3UME A;  3M6B A;  3MZD A;  3HUO A;  5IS1 A;  3ZG5 A;  1HVB A;  1D7E A;  2OAQ 1;  5EUA A;  4HIA A;  1WYC A;  2GZA A;  3GDI A;  5G18 A;  5L07 A;  4KZ9 A;  2Z6C A;  4PKY A;  3ZG9 B;  1YLY A;  2WKI A;  2VKS A;  3PBQ A;  3SW1 A;  4L0L A;  1XFQ A;  3ZNT A;  2VGL S;  4Y0U A;  3TRC A;  1K25 A;  1CEF A;  3T4S A;  1FQG A;  2PU2 A;  3IS2 B;  3BY8 A;  5DF8 A;  1Q2Q A;  4EER A;  5CXW A;  4DF6 A;  3VFH A;  1DJA A;  2FFF B;  1T19 A;  2XFT A;  2WKH A;  2ZM0 A;  3VMA A;  2W1T B;  4OPR A;  1E4D A;  1XJ3 A;  4HBU A;  2ZQ8 A;  4E3L A;  3BFF A;  3KSI A;  4IBR A;  3LR3 A;  1LL5 A;  2JKT M;  2P08 A;  3NJA A;  2PD7 A;  5K5B A;  4X56 A;  3OC2 A;  3ZVT A;  1KGE A;  1Z6F A;  3EGD C;  5A93 A;  1PYY A;  3PR6 A;  5KSH A;  1K57 C;  4QY6 A;  1SHV A;  4R1G A;  4F3L B;  3UB6 A;  3NY4 A;  1SKF A;  2GX5 A;  2I9V A;  5FAQ A;  4QJG A;  3LYX A;  3MR0 A;  5TR7 A;  2JBF A;  4IVI A;  2DCF A;  3CUE C;  1VET B;  1UWP X;  2XGN A;  4UA6 A;  2V8F A;  3UB5 P;  4Y5F A;  2WZX A;  4KG2 A;  2V9A A;  5EPH A;  5EVI C;  3PBO A;  3DBA A;  4R38 A;  5DTK A;  3N7W A;  2QHK A;  1NXY A;  4O0P A;  1SDE A;  2Y2P A;  2WYX A;  3UE0 A;  1JWZ A;  3A3D A;  1KDW A;  2EX6 A;  2O9B A;  2Y79 A;  5FA7 A;  5HPI A;  1STZ A;  5E43 A;  2HV1 A;  3UNW A;  2VGJ A;  3V3R A;  5TBM B;  5FAS A;  2G2U A;  2VGL M;  3ISG A;  3LY4 A;  2WAF A;  3CMZ A;  2XA7 S;  3QNC A;  3UB8 A;  4WL9 A;  4EV4 A;  1JTG A;  4WZ5 C;  3KYE A;  5HZH A;  4LCM A;  3S7O A;  3MFD A;  5A91 A;  2XRO A;  5CGS A;  1F5M A;  5HSQ A;  3PAG A;  3A0V A;  3L9K A;  1XKZ A;  1ES4 A;  4N1X A;  4KQO A;  5FSR A;  4GJ4 A;  3D3O A;  4KQD A;  4FTX A;  4MN5 A;  5CEC A;  4UA7 A;  3ZG8 B;  1YMX A;  4JPM A;  1F9I A;  3MJQ A;  5E2H A;  1K55 C;  1G28 A;  3T4O A;  3DTK A;  2JKF A;  4LGW A;  4P0M A;  1BT5 A;  4IBX A;  4D2O A;  2H0T A;  3IWQ A;  4HH2 A;  2HPB A;  4NXB A;  5KZH A;  3WS1 A;  5EVI A;  1NYY A;  4HOI A;  5MC7 A;  1CEG A;  4RYE A;  2H10 A;  4LRY C;  2Y55 A;  5GLB A;  1ACF A;  4Y17 A;  1D1J A;  3ZDJ A;  3AGE A;  3K3D A;  4O8G A;  1F2K A;  2E8I A;  3WRZ A;  2ACG A;  4HBT A;  5HX9 A;  1NZU A;  3CHW P;  2ZC5 B;  5GL9 A;  2A3U A;  2NUT C;  1MWU A;  4GOG A;  3LID A;  4HY8 A;  4ME4 A;  3SS5 A;  3F1N A;  4JGR A;  4AFI A;  5HD5 A;  5HWV A;  4DRT A;  3AGF A;  2JKT I;  1S6R A;  3GVB A;  5AQB A;  2OWH A;  4BBT A;  1OME A;  4WEJ A;  3JVV A;  2ZQ7 A;  1K6S A;  4S2J A;  4JXW A;  3W4P A;  4PM5 A;  3MBZ A;  3G2Z A;  3UPP A;  2XRN A;  5AQ9 A;  1EI5 A;  1MXO A;  1T1A A;  2PU4 A;  3U4L P;  5FQQ A;  3IF5 A;  3LIB A;  5TFQ A;  1ERO A;  5CTM A;  2QKP A;  2K31 A;  1KE4 A;  2ZL1 A;  2D02 A;  1KGF A;  2HF6 A;  1TDG A;  2KOI A;  1P97 A;  1M40 A;  3IBR A;  4OLG A;  1P9R A;  4Z9Q A;  1C3B A;  2NUP C;  1I2S A;  3KSF A;  1YLP A;  1S1Y A;  5L10 A;  2A24 A;  1EWZ A;  3ZFZ A;  1HD8 A;  5EOO A;  3VOL A;  5A90 A;  4GS9 A;  3OCL A;  4IUK A;  1TDL A;  2H0Y A;  4HQA A;  1PFL A;  4DE0 A;  3ZG7 B;  2Y2L A;  4BBU A;  4WMC A;  3IH9 A;  4IVK A;  4JXV A;  1MPL A;  2GNX A;  3OPP A;  3OOV A;  4DN0 A;  1U60 A;  5KIZ A;  1ZKJ A;  3EEA A;  3T4Q A;  3TW8 A;  1YPR A;  4Y15 A;  4I39 A;  4UEY A;  2ZC4 B;  3TOI A;  4DXC A;  3ITB A;  4UAA A;  2EX8 A;  5LBR A;  2PD8 A;  1L0F A;  4DDY A;  1TS6 A;  5HDS A;  3GR2 A;  3CLO A;  1YLZ A;  4MBK A;  4HH3 A;  2FZ0 A;  4Y7P A;  3PBS A;  1OT6 A;  1PWD A;  3IX4 A;  2P7J A;  3VP1 A;  2VX8 A;  4X1M A;  1QME A;  1H3Q A;  3QP4 A;  3UMD A;  3JPU A;  2QJ7 A;  3S7P A;  1OTA A;  2ZQ9 A;  3UE6 A;  2JCH A;  1GSX A;  1ALQ A;  1H0M A;  3ZVW A;  3C4P A;  4EUZ A;  4KUK A;  3C38 A;  5M18 A;  2W1T A;  3GV9 A;  2XD1 A;  2XD5 A;  5GLA A;  2L1M A;  1MZU A;  1H5X A;  4ETZ A;  1K4E A;  3QP6 A;  3BFC A;  2PYR A;  5EVI B;  4LFU A;  5FI2 A;  1CI9 A;  2RL3 A;  1OTD A;  3E4Q A;  5CX7 A;  1DY6 A;  5BOH A;  2QYB A;  1E3U A;  1K6R A;  3CAX A;  4ZJ3 A;  2DMW A;  2Y2H A;  3SZT A;  1LI0 A;  4BMW A;  4PKY G;  1PZP A;  4Y2F A;  1XP4 A;  5F68 A;  3N8L A;  4Z1W A;  3RXX A;  3C30 A;  1GCE A;  1GHP A;  4X53 A;  1T18 A;  4U0X A;  3ZHH A;  2R78 A;  4HP4 A;  5DKK A;  5CRF A;  3VP4 A;  4JBF A;  2Y91 A;  1SZV A;  3F1N B;  2FFY A;  3C8C A;  1IYP A;  2XDM A;  4ZJ2 A;  2QZ6 A;  4KZA A;  3UN7 A;  4BEN A;  1V9Z A;  1A0K A;  2ZOH A;  3MF0 A;  1DP6 A;  3G34 A;  4JXG A;  4EUV A;  4QHC A;  3BJN A;  3O5Y A;  3MQQ A;  1BLC A;  2ZC3 B;  1XXM A;  5E2E A;  5EOE A;  4GW9 A;  1UWN X;  3A3E A;  4BBV A;  1W63 M;  2V2F F;  3GRJ A;  3WS4 A;  3ICY A;  5EM0 A;  4KZ8 A;  4E3K A;  3PYP A;  3G35 A;  2ZL1 B;  4NKP A;  3PBR A;  3OCN A;  3UO9 A;  1LSX A;  4D60 A;  2V1Z A;  3T50 A;  4C3Q A;  3IT9 A;  1S1Z A;  4Q0J A;  2GJ3 A;  3FPV A;  1DP8 A;  1XJ2 A;  1KVM A;  2IWC A;  1TS0 A;  4KZB A;  3ZG0 A;  2ZMF A;  3KO6 A;  1W5D A;  4WZ4 A;  4GCZ A;  2W3G A;  3G6O A;  1D06 A;  3Q82 A;  3MKF A;  4R23 A;  1W8Y A;  1LT0 A;  2EX2 A;  4B4Z A;  2XEP A;  5EVI D;  1KE0 A;  4E6X A;  1K0K A;  1TS8 A;  3IXH A;  4K0X A;  2HZ5 A;  1L0D A;  4IHQ A;  2VLG A;  2KX6 A;  4E3O A;  3BY9 A;  3NBL A;  4LRZ E;  3KYQ A;  4S2M A;  3TSG A;  4MBF A;  4GS9 B;  2QJ5 A;  2ZC7 A;  1V9Y A;  4A5R A;  1G6A A;  4EQI A;  3RH8 B;  3IX3 A;  5F6A A;  2ZM8 A;  4HES A;  1NRJ A;  4EBL A;  4H6J A;  2HP9 A;  4RX2 A;  4EXO A;  3B33 A;  4GDN A;  4OPY A;  2GDN A;  3KYZ A;  4OPQ A;  1GA9 A;  4S2L A;  5GLC A;  3P98 A;  1LL9 A;  1IKI A;  1AWI A;  5E2F A;  4PPR A;  3T4K A;  3BWL A;  1CI8 A;  1ES2 A;  1BYW A;  3H7W B;  4RVA A;  1SCW A;  2Q9N A;  4X69 A;  4I3J A;  5FAT A;  3HLF A;  1YLT A;  3RTY A;  4DKI A;  5FQK A;  1ZC2 A;  2PAV P;  3EOI A;  3LFV A;  1PWC A;  5HAI A;  3BQA A;  1OJ5 A;  1CF0 A;  4S2K A;  5FQI A;  1IYQ A;  2EFU A;  1CK3 A;  5DJU A;  3TE8 A;  4JKT A;  5D3O A;  5EVE A;  3BQ8 A;  1HLU P;  1YLW A;  4IED A;  3WWX A;  3WS2 A;  2VEA A;  3G31 A;  5CEB A;  2XK1 A;  3JYI A;  3MMH A;  1SKO A;  1PNE A;  5FL3 A;  2HDU A;  1N9B A;  4QD4 A;  4L9E A;  5CHM A;  3LCE A;  5J7E A;  1YQS A;  3BLM A;  3F1P A;  4PHT A;  3IH8 A;  3A3I A;  3OPR A;  3LI9 A;  3OPL A;  2JE5 A;  4HJ3 A;  3SH8 A;  1DJC A;  2Y2Q A;  4BWI A;  1PI5 A;  1IKG A;  3LR4 A;  4I3A A;  1VHM A;  4Q0I A;  5DF7 A;  1W63 Q;  4MNR A;  1XA1 A;  1FOF A;  1Y54 A;  2VV6 A;  4WMC D;  4BQM A;  4NEE D;  3W2Z A;  1BLH A;  2X01 A;  3ZYT A;  5F83 A;  1WE4 A;  1NZO A;  2AVX A;  1TD5 A;  1TS7 A;  1LSV A;  4E3J A;  2LB5 A;  4E04 A;  3EQV A;  4B4X A;  4PMA A;  4HHD A;  2EA9 A;  2VJW A;  3D9Y A;  3ZQ5 A;  2J8Y A;  1VQQ A;  2E8J A;  2JKR M;  3Q07 A;  2XH9 A;  1PW1 A;  2JN7 A;  4NK3 A;  4WM9 A;  3M2J A;  4LV1 A;  2Y4A A;  3CI6 A;  1FCN A;  5G4Z A;  2HGV A;  2XF3 A;  4OPZ A;  4R0Q A;  1H8Y A;  5J8X A;  3UPO A;  2Q9M A;  3UY6 A;  4OOY A;  1VB6 A;  3VFF A;  1S67 L;  4ETX A;  1LLB A;  1N9N A;  5IT5 A;  2PRF A;  3BLS A;  5CHU A;  4R4R A;  1ONG A;  4N1H A;  4R70 A;  4XT2 A;  1K57 A;  4OH0 A;  1G5U A;  4GD6 A;  5I5L A;  1EW0 A;  2WUQ A;  3G4P A;  4Y0T A;  3FKV A;  1E3U D;  3CUE A;  4LPZ A;  1BZA A;  1K54 C;  2G2W A;  3UE3 A;  4WLA A;  2OV5 A;  2HJE A;  5L2F A;  1P9W A;  4UQI M;  3Q7Z A;  1YM1 A;  2KDK A;  1RGZ A;  3IF6 C;  4R3J A;  4H6J B;  3TJZ C;  2Y2N A;  4ESP A;  2C5W B;  4B93 A;  3I7J A;  3OZH A;  4R3A A;  3SS4 A;  4CLC E;  5FEG A;  4N9K A;  2J3W A;  4B9O A;  1NWZ A;  3G2Y A;  4CQH A;  1DJB A;  4WZ5 A;  1OJG A;  3UPN A;  2WGI A;  3G30 A;  3VP3 A;  1NY0 A;  1IEM A;  5TJJ A;  4F94 A;  4FOF A;  5JYO A;  4YIN A;  4WEL A;  2P74 A;  4M3K A;  2HDQ A;  5CED A;  4MLL A;  1UGU A;  2ZQD A;  1IOU A;  3CG5 A;  4OP5 A;  4Y0O A;  1JNU A;  5FQJ A;  4UA9 A;  4BD0 A;  1BTL A;  1FR6 A;  1L3L A;  2WKE A;  5HAQ A;  4HJ4 A;  1K55 A;  3BFD A;  4S2I A;  2V1A A;  5HFO A;  4BL2 A;  5CGW A;  3C4O A;  4WYY A;  1OT9 A;  1J3W A;  1SKO B;  3HLE A;  1AXB A;  1OTB A;  4WUJ A;  4PM9 A;  4OVD A;  3F1P B;  3HRE A;  3HVF A;  5GHY A;  3A0R A;  2O0Y A;  2J3T D;  5FEF A;  3NI9 A;  2PYP A;  4E3M A;  4WN5 A;  2EXA A;  3RJU A;  4PAU A;  2JKR I;  1S66 L;  4E6W A;  4XXR A;  1T1B A;  1DP9 A;  2HP6 A;  4Q8I A;  2JKG A;  2XFS A;  4ZJ1 A;  3T1Q B;  3HUM A;  2PR6 A;  2UWX A;  3VSL A;  1FIK A;  2JC7 A;  3NC8 A;  4KG6 A;  3VSK A;  4KZ4 A;  2J7V A;  1MWR A;  1YSP A;  3FC7 A;  4KZ6 A;  5DJT A;  4E3I A;  3HLB A;  4ARZ A;  1YT4 A;  4OQG A;  1ZG4 A;  2W27 A;  1XGJ A;  3TG9 A;  4PM6 A;  4ZRR A;  1NRF A;  4CLC C;  3Q7V A;  3B3X A;  2V8C A;  2G7U A;  4C75 A;  2Z6D A;  2OLV A;  1TF1 A;  4GN2 A;  4L9F A;  5CTN A;  3T1S A;  4DMZ A;  2M7V A;  4GHI A;  3MZF A;  1IFQ A;  1OPX A;  3H7W A;  1L2S A;  4GZB A;  3B47 A;  3GQZ A;  2V0U A;  4JGQ A;  1VM1 A;  1WA9 A;  4XT2 B;  1TVF A;  2EFX A;  1PI4 A;  1GA0 A;  2Y2I A;  3GSG A;  4OQI A;  2HDR A;  2RCX A;  4DXB A;  1G6O A;  3IWO A;  3MXR A;  3NOT C;  5GLD A;  4ZDX A;  2BTF P;  3NOP C;  4I38 A;  4XUX A;  1ZHH B;  5A92 A;  4RQ9 A;  4BLM A;  1GHM A;  5HWT A;  4RA7 A;  3VP0 A;  3UDX A;  5HW3 A;  2WAE A;  2XLN A;  5J3W A;  1TEM A;  5G4Y A;  4KQR A;  1LL8 A;  2DNS A;  4FH2 A;  5AJG A;  2C6W B;  1KE3 A;  2PT7 A;  2Y8H A;  5AVF A;  2JHE A;  4MN6 A;  1HTZ A;  3UB7 A;  3C5A A;  2XR0 A;  4QB8 A;  4P87 A;  3S7Q A;  4KQQ A;  3M6H A;  4FCF A;  3B42 A;  4CLC A;  3MSH A;  3A3J A;  4PM7 A;  2B18 A;  2IWD A;  3BM6 A;  3PAE A;  2BG1 A;  1K4F A;  3M2K A;  3NDE A;  4NG2 A;  3V67 A;  4OOM A;  4UHU A;  3MXQ A;  2IWB A;  4PM8 A;  2O9A A;  4X55 A;  5DFY A;  4M4X A;  1WYB A;  1CJF A;  2VV7 A;  5F82 A;  3E98 A;  4P6Z S;  1MC0 A;  1ONH A;  4CJN A;  3R7W A;  1KOU A;  4ZTK A;  2H5S A;  1GSW A;  4X25 A;  4OKP A;  5DKL A;  5HWW A;  1XPB A;  1I5Q A;  4NET A;  3QP5 A;  4LV3 A;  2WGW A;  2Y2O A;  4IUH A;  4KZ7 A;  1N4O A;  3KSG A;  5FAO A;  1YAX A;  4JGO A;  3LI8 A;  1XJ4 A;  3HLW A;  4H8R A;  2EWV A;  4P85 A;  3BYD A;  1BUE A;  3GEC A;  3A3F A;  1ZG6 A;  5DTS A;  2VZW A;  3CPT A;  1Q2P A;  3ZCZ A;  4HNB A;  1KGG A;  3GMW A;  2CC1 A;  5EVL A;  4MEZ A;  3CWF A;  3E2L A;  5HDC A;  1O07 A;  2V20 A;  2Q0O A;  2BLS A;  2Y2K A;  3EGX C;  2ZBB A;  3NCK A;  1ES5 A;  2B5R A;  4K91 A;  1OTI A;  5E2G A;  4MMN A;  1ERM A;  3FG8 A;  2X71 A;  4EWF A;  3CZD A;  3A0S A;  3IHB A;  3LY3 A;  1VEU A;  4ARZ B;  2B02 A;  3QHY A;  4G3V A;  1XA7 A;  1SDN A;  4EBP A;  3O3V A;  3Q7V B;  1W8Q A;  3N6I A;  3HLG A;  3HLC A;  5F1G A;  1H8M A;  4KZ3 A;  3LIC A;  4P6Z M;  4B88 A;  3JVU A;  1RCJ A;  4S2O A;  3E2K A;  1YMS A;  2EXB A;  4E3N A;  3PXP A;  4GHI B;  4ZAM A;  4YWZ A;  3O86 A;  3HBR A;  3K2N A;  1NYM A;  3IX8 A;  4Y3I A;  4C6Y A;  2MJ6 A;  4LLO B;  1GSV A;  1FCO A;  4ZBE A;  3O88 A;  1PIO A;  2M1C A;  5FDH A;  3MS6 A;  2QPN A;  1PZO A;  4Q0H A;  3SH9 A;  4EET B;  3PBN A;  4G3W A;  2L4R A;  4WBG A;  4EES A;  2J9O A;  2PHY A;  3H82 A;  2A2L A;  3T12 B;  4I5S A;  3G32 A;  2VA0 A;  5EFW A;  3LR0 A;  2OWJ A;  1BLS A;  4EEP A;  3F1O A;  3QNB A;  3FZC A;  1ERQ A;  4S2N C;  4HJ6 A;  3C7U A;  5EM1 A;  3S22 A;  1RP5 A;  1T1C A;  3BRM A;  4UQI S;  4CLC B;  2ZD8 A;  2K7S A;  5HDD A;  1BLP A;  2OLU A;  3EWK A;  3P7N A;  4JGP A;  1W79 A;  5FI6 A;  3UDF A;  3C2W A;  1HZO A;  1XX2 A;  4L9G A;  1S0W A;  4MCW A;  5U47 A;  3IXB A;  4BL3 A;  3LIA A;  4MN7 A;  1RGY A;  4GKU A;  5FI7 A;  2CMN A;  3IQA A;  3HJK A;  1N9L A;  4O7D A;  2BAS A;  2W0N A;  5HAP A;  2D01 A;  3R7W B;  2PBY A;  1K56 A;  4YNR A;  1N9O A;  3V50 A;  2H28 A;  2WAD A;  3BW6 A;  2VV8 A;  3KSH A;  5IU1 A;  4IJG A;  1FIL A;  2ZMV A;  4YOF A;  2KLI A; 
#chains in the Genus database with same CATH homology
 3A0R A;  4BMW A;  4PKY G;  2O0Y A;  2J3T D;  2K2N A;  4Y2F A;  3UME A;  2PYP A;  5F68 A;  4WN5 A;  5IS1 A;  4Z1W A;  1D7E A;  3C30 A;  2OAQ 1;  4PAU A;  4HIA A;  2GZA A;  2JKR I;  3GDI A;  4R6L A;  1S66 L;  1T18 A;  2Z6C A;  2R78 A;  2LB9 A;  4HP4 A;  5DKK A;  4PKY A;  2VKS A;  3F1N B;  1T1B A;  3PBQ A;  1DP9 A;  3C8C A;  3SW1 A;  4L0L A;  1XFQ A;  2VGL S;  3TRC A;  2PR6 A;  4EQ1 A;  1V9Z A;  2YKH A;  3T4S A;  2ZOH A;  3MF0 A;  1DP6 A;  4EUV A;  4BJP A;  3BJN A;  3IS2 B;  3MQQ A;  3O5Y A;  3BY8 A;  3R4K A;  4EER A;  3FC7 A;  1YSP A;  4GW9 A;  1UWN X;  5DJT A;  4CLC D;  1T19 A;  4ARZ A;  2W1T B;  4BBV A;  1W63 M;  5DF9 A;  1XJ3 A;  2W27 A;  3ULF A;  2PR5 A;  4ZRR A;  3ICY A;  4CLC C;  3KSI A;  4LRX C;  3LR3 A;  3PYP A;  2P08 A;  2G7U A;  2JKT M;  3NJA A;  2Z6D A;  4NKP A;  3PBR A;  2PD7 A;  1TF1 A;  4L9F A;  3OCN A;  1LSX A;  4DMZ A;  2M7V A;  5K5B A;  3OC2 A;  4GHI A;  3T50 A;  3EGD C;  1IFQ A;  1OPX A;  3H7W A;  3PR6 A;  3T4L A;  5KSH A;  1S1Z A;  4Q0J A;  3B47 A;  2GJ3 A;  3FPV A;  1DP8 A;  3EQU A;  1XJ2 A;  2V0U A;  4F3L B;  3UB6 A;  1TS0 A;  4JGQ A;  2GX5 A;  2I9V A;  2ZMF A;  3KO6 A;  3OBF A;  5A8B A;  3LYX A;  3MR0 A;  1DRM A;  1WA9 A;  4GCZ A;  2P04 A;  4XT2 B;  2W3G A;  3G6O A;  4EU0 A;  2J80 A;  1D06 A;  3CUE C;  1LT0 A;  2YKF A;  5DFX A;  1TS8 A;  1UWP X;  1NLY A;  4IHQ A;  2VLG A;  1MKM A;  1G6O A;  2XA7 M;  2KX6 A;  4Y5F A;  3NOT C;  2OOL A;  3BY9 A;  4LRZ E;  2V9A A;  3KYQ A;  3NOP C;  4I38 A;  3PBO A;  3DBA A;  4R38 A;  4GS9 B;  1ZHH B;  3VE4 A;  2QHK A;  4O0P A;  4RQ9 A;  4I3I A;  2QJ5 A;  1V9Y A;  1YKD A;  5HWT A;  2O9B A;  3PBT A;  3H82 B;  2Y79 A;  5HPI A;  1F98 A;  1STZ A;  3RH8 B;  2HV1 A;  5F6A A;  4II7 A;  1NRJ A;  4H6J A;  5J3W A;  4KUO A;  4EXO A;  5TBM B;  2VGL M;  5G4Y A;  3B33 A;  1LL8 A;  2PDR A;  5AJG A;  3KYZ A;  4G3K A;  3F1O B;  2PT7 A;  2Y8H A;  3MFX A;  2W3H A;  2XA7 S;  3T4J A;  3KX0 X;  5AVF A;  2JHE A;  4MN6 A;  3UB8 A;  4WL9 A;  3UB7 A;  4EEU A;  5HZH A;  4HI4 A;  3D72 A;  3LR5 A;  3S7Q A;  3S7O A;  2XRO A;  3B42 A;  4CLC A;  3T4K A;  3BWL A;  1F5M A;  5HSQ A;  1BYW A;  2B18 A;  3H7W B;  3A0V A;  3OLO A;  3UB9 A;  3V67 A;  4I3J A;  4OOM A;  4KQO A;  2QWS A;  2W3F A;  3RTY A;  3MXQ A;  4GJ4 A;  3D3O A;  4KQD A;  3RFB A;  2O9A A;  3PHY A;  4MN5 A;  5DFY A;  3EOI A;  3LFV A;  4DJ2 A;  3BQA A;  1OJ5 A;  1S4S A;  1YSQ A;  4M4X A;  1F9I A;  3MJQ A;  5DJU A;  1G28 A;  2VV7 A;  3T4O A;  3TE8 A;  3E98 A;  4P6Z S;  1MC0 A;  3BQ8 A;  3R7W A;  1KOU A;  4WEK A;  1GSW A;  3HCY A;  2HJ9 C;  4HH2 A;  2VEA A;  4NXB A;  5DKL A;  5HWW A;  4HOI A;  3MMH A;  5MC7 A;  1NLZ A;  2XSS A;  4LRY C;  2O99 A;  5FL3 A;  4L9E A;  2WKP A;  5J7E A;  3F1P A;  4PHT A;  3E0Y A;  5J4E A;  4IUH A;  3LI9 A;  4HJ3 A;  4WF0 A;  4OOL A;  3KSG A;  4EW7 A;  3K3D A;  4O8G A;  1YAX A;  4JGO A;  3LI8 A;  4BWI A;  1XJ4 A;  2EWV A;  1XFN A;  3LR4 A;  3VE3 A;  3GEC A;  4I3A A;  2EWW A;  1VHM A;  2VZW A;  4Q0I A;  3FPW A;  1P0Z A;  1W63 Q;  2NUT C;  4HNB A;  3LID A;  2VV6 A;  4HY8 A;  4ME4 A;  5AVE A;  5C5K A;  3F1N A;  4JGR A;  4AFI A;  3IBJ A;  4HP9 A;  3NOU C;  4NEE D;  5HD5 A;  5HWV A;  3W2Z A;  2JKT I;  3ZYT A;  3CWF A;  3MQ0 A;  5HDC A;  2OWH A;  3E4P A;  4BBT A;  3EGX C;  3CIT A;  2ZBB A;  2V1B A;  4WEJ A;  1TD5 A;  4MDZ A;  4K08 A;  1OTI A;  1TS7 A;  1LSV A;  4MMN A;  3JVV A;  3FG8 A;  2V0W A;  3IS2 A;  2LB5 A;  4E04 A;  3EQV A;  3A0S A;  2WKQ A;  2EA9 A;  4HHD A;  1ZTU A;  2VJW A;  4ARZ B;  2B02 A;  3ZQ5 A;  3LUQ A;  2XRN A;  2JKR M;  1T1A A;  4G3V A;  3HJI A;  5L8M A;  2JN7 A;  3LIB A;  2QKP A;  3U2A A;  2K31 A;  3CI6 A;  3MQO A;  5G4Z A;  2HGV A;  1H8M A;  4P6Z M;  3LIC A;  3JVU A;  2D02 A;  2HF6 A;  2KOI A;  3PXP A;  4GHI B;  1P97 A;  3IBR A;  1VB6 A;  4YWZ A;  1S67 L;  4F3L A;  4ETX A;  1N9N A;  5HPF A;  5IT5 A;  3P01 A;  1P9R A;  3EEH A;  3K2N A;  2W3E A;  3LIE A;  4Y3I A;  4R70 A;  4XT2 A;  2NUP C;  2J3T C;  1EW0 A;  2W1R A;  5I5L A;  2MJ6 A;  4LLO B;  3KSF A;  1GSV A;  3LIF A;  1S1Y A;  4DJ3 A;  2A24 A;  3CUE A;  4LPZ A;  2M1C A;  4NXE A;  3VOL A;  3UE3 A;  2W3D A;  4GS9 A;  4Q0H A;  4WLA A;  4EET B;  2HJE A;  1P9W A;  3OCL A;  3PBN A;  4G3W A;  4IUK A;  4UQI M;  2L4R A;  4EES A;  2INW A;  1LSW A;  4HQA A;  2KDK A;  2PHY A;  3H82 A;  2A2L A;  1ODV A;  4I5S A;  4BBU A;  2M7U A;  2VA0 A;  5EFW A;  4H6J B;  5TBM A;  3LR0 A;  3TJZ C;  2GNX A;  2OWJ A;  3OOV A;  4DN0 A;  3E4O A;  4EEP A;  3F1O A;  3T4T A;  5KIZ A;  4B93 A;  3EEA A;  3T4Q A;  3TW8 A;  4R3A A;  4I39 A;  4UEY A;  4NXF A;  4CLC E;  1Y28 A;  4HJ6 A;  5LBR A;  2PD8 A;  2J3W A;  4B9O A;  5F69 A;  1T1C A;  1X0O A;  1NWZ A;  4UQI S;  2FH5 A;  3VV4 A;  4CLC B;  2K7S A;  5HDD A;  4CQH A;  1TS6 A;  5HDS A;  3EWK A;  1OJG A;  3S7N A;  3P7N A;  3CLO A;  2IA2 A;  4JGP A;  4O01 A;  4HH3 A;  5HD3 A;  5TJJ A;  2FZ0 A;  2OAP 1;  3PBS A;  3C2W A;  2ZOI A;  4FOF A;  4L9G A;  4MCW A;  1OT6 A;  5HL6 A;  2P7J A;  4WEL A;  2L0W A;  3LIA A;  4MN7 A;  2VX8 A;  4FSF A;  3NHQ A;  1H3Q A;  3UMD A;  1UGU A;  3K3C A;  2QJ7 A;  4GLQ A;  3S7P A;  1IOU A;  1OTA A;  3UE6 A;  1GSX A;  1JNU A;  1XJ6 A;  2A24 B;  2O9C A;  2CMN A;  3HJK A;  1N9L A;  3C38 A;  4KUK A;  2BAS A;  2W1T A;  2W0N A;  2D01 A;  4HJ4 A;  3R7W B;  2L1M A;  1MZU A;  4QPR A;  1S4R A;  4YNR A;  1N9O A;  4ETZ A;  2V1A A;  3H9W A;  2H28 A;  3BW6 A;  5IU1 A;  2VV8 A;  2PYR A;  2WKR A;  3KSH A;  4NXG A;  1OTE A;  4IJG A;  1OT9 A;  5F5Y A;  3E4Q A;  1OTD A;  5CX7 A;  2QYB A;  1OTB A;  3CAX A;  4WUJ A;  2ZMV A;  4YOF A;  3F1P B;  2DMW A;  2KLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...