4G3KA

Crystal structure of a. aeolicus nlh1 gaf domain in an inactive state
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
170
structure length
155
Chain Sequence
DLKVEIETLYEVSKILSSSLNLETTVPYIFRLLKKLMGFERLTLTIYDPSTDQIVVRATSSGKFPKEGFKKGEGITGKVWKHGVPIVIPDISQKKIAFIAVPIKSGGKVIGVLSADKEINEKDSLDEYTRFLSMIATLIANSFSLERKVQAERKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator nlh1
publication title Structural mechanism of GAF-regulated delta(54) activators from Aquifex aeolicus
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transcription regulator
total genus 39
structure length 155
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4g3kA00
3HCYA 5L8MA 3MMHA 3E98A 3ZQ5A 2W1TB 5TJJA 5DFYA 1YSPA 2LB9A 2O99A 4YNRA 4LRYC 1YKDA 4ETXA 4DMZA 4E04A 2W3FA 4EUVA 2VEAA 2W1TA 2B18A 3LFVA 2K2NA 5HPIA 3KSGA 4Y5FA 1F5MA 2O9BA 4G3WA 2GX5A 2M7VA 4ETZA 2XROA 2O9CA 3KSHA 3TRCA 5HL6A 3C2WA 3NOUC 4G3KA 3DBAA 2IA2A 2W3EA 1ZTUA 2ZMFA 3NOTC 4Q0IA 5AJGA 5HSQA 3MF0A 3E0YA 4IUKA 3EEAA 4MN7A 2Y8HA 2W3GA 2OOLA 4IJGA 4MCWA 3D3OA 3O5YA 2XRNA 1YSQA 2LB5A 2VZWA 5I5LA 1TF1A 2KLIA 5DFXA 2VKSA 1MC0A 5HPFA 4O01A 3NHQA 4YOFA 3CITA 4Y2FA 2XSSA 4ME4A 3W2ZA 3KSIA 5LBRA 3IBRA 3NOPC 4ZRRA 4O0PA 2M7UA 3KO6A 2Y79A 1MKMA 4Y3IA 2O9AA 2VJWA 4RQ9A 3S7OA 3G6OA 3OBFA 3K2NA 1STZA 1TD5A 4PAUA 4IUHA 3RFBA 4GW9A 4Q0HA 4G3VA 5C5KA 3S7NA 2W1RA 4EU0A 3KSFA 3S7QA 2W3HA 3VV4A 3CI6A 4FOFA 4QPRA 2W3DA 4R70A 4MMNA 4CQHA 4O8GA 2QYBA 4Q0JA 2G7UA 2KOIA 4BWIA 2HGVA 3OOVA 3MQ0A 4Z1WA 1VHMA 4LRZE 4R6LA 3IBJA 4GLQA 4DN0A 3R4KA 3BJNA 3S7PA 5K5BA 4MDZA 2K31A 4LRXC 2O0YA
chains in the Genus database with same CATH superfamily
3BFDA 3GTCA 4PM9A 3MMHA 5HAQA 3OPLA 3HLEA 3UE3A 4NKPA 4FD8A 2Q9MA 3H82A 4MN6A 1H8MA 2VV8A 1FCNA 2PBDP 5GLBA 2FFYA 1V9YA 4JGPA 4L9FA 5F82A 3P7NA 3T4QA 2PAVP 4EQIA 4Y5FA 2FZ0A 4MNRA 4EW7A 1H8ZA 5FSRA 2YKHA 1O07A 4B4ZA 4NXGA 4QHCA 2H0YA 1K6SA 3GR2A 4ARZB 1OJ5A 4B9OA 4WMCD 2XGNA 3UN7A 2W3GA 4IJGA 3IXDA 1W5DA 3IS2B 1Q2PA 5I94A 3W4PA 1KE4A 4KQRA 2B02A 3HUNA 4WBGA 4R3BA 1I5QA 3BFFA 3F1PB 3I7JA 1S67L 1FCOA 5M1AA 5LBRA 2Y2JA 3GECA 1G68A 3HUOA 4JF4A 3UB7A 4H8RA 1L0EA 5IU1A 4N1XA 4WYYA 4BL2A 2Y2PA 3IF5A 3QNCA 4X55A 3TE8A 2WAFA 1XP4A 5CEBA 4PM7A 1GSWA 4QJGA 3KX0X 5EECA 4JPMA 5DTTA 1D1JA 3UNWA 3CI6A 3VOLA 2DRWA 2P74A 1NWZA 4XT2B 4WL9A 1AWIA 2VA0A 3BRMA 3E2LA 5CXWA 1XA7A 2ZC3B 2A24B 3IBJA 1YPRA 3IF6C 5A92A 4JGRA 3LO7A 2NUTC 1H5XA 3HCYA 1MWSA 2EXBA 1Y54A 2XK1A 4KZ9A 1SKOB 1MKIA 2I9VA 3FC7A 1K4EA 1T1AA 1OJGA 3MJQA 4KZAA 1DP6A 4N1HA 3G30A 3KYEA 2BTFP 3A3EA 3OZHA 3OCLA 1ZKJA 3BFEA 3FZCA 3ZVWA 1DP9A 2VX8A 4EBPA 4BBVA 2Z6DA 2V1BA 4HJ4A 3E4OA 1NLZA 1SHVA 4BD0A 3PBNA 3EEAA 2EFUA 3SW1A 2HF6A 3VSKA 5EFWA 2VZWA 4FCFA 2J80A 4GDNA 2PR6A 4GNUA 3NHQA 4EV4A 5DF7A 1IKIA 3SS4A 4U0TA 4GD8A 1G5UA 3S7OA 1ONGA 4JXSA 2JN7A 5EPHA 4LCMA 1KGFA 4DXCA 4Q0HA 3VP4A 5FAPA 3WS5A 2W3HA 3VP0A 3VV4A 2J3TC 4CLCC 1PW8A 2ZM0A 2ZQ8A 4QPRA 1DJCA 3BY9A 4MMNA 1PNEA 3ZHHA 3MQ0A 2H10A 3H9WA 4LRZE 3WS2A 4KUKA 1WYCA 3PBTA 2L4RA 4OONA 2WKQA 3IXGA 2PT7A 2P08A 3IF6A 4X53A 3E98A 4HBUA 1UWNX 1OTBA 1XX2A 3VE3A 4L0LA 4HIAA 4DE1A 3ZG9B 4KQOA 3NECA 3GV9A 5HD5A 3UB6A 4IBRA 3VP1A 4E3NA 1NRJA 5GLCA 3LR3A 1K56D 3A3DA 5HD3A 3MQQA 4IUKA 5FDHA 4KENB 4NXFA 4FSFA 5J4EA 2V1ZA 2G2WA 4ZJ3A 2DCFA 5DFXA 5HDDA 2Q9NA 3AGFA 4WN5A 4Q8IA 4K91A 3NOPC 2M7UA 4NK3A 1QMFA 4U0XA 3V5MA 2Y79A 1ZHHB 2O9AA 4IVKA 1JVJA 3N7WA 4R0QA 1STZA 4RVAA 1FILA 3LI9A 3T12B 3MZDA 4XT2A 3QP5A 1JTGA 2ACGA 1IYQA 3CPTB 4N9KA 2VGJA 5CHJA 2Z2LB 5FAQA 1TS6A 1BLCA 2Z2MB 1OT6A 4BWIA 1L3LA 2JKRM 3F1NA 4Z1WA 5TBMB 1LSXA 4X6TA 3R7WA 3D4FA 3OPPA 5DTKA 4OH0A 4BBUA 5A90A 3L9KA 3T4TA 5L8MA 3BFGA 2WGIA 3B42A 2IWCA 2P04A 3LR5A 2ZMAA 2PD7A 2ZLYA 4S2PA 3LFVA 1LL9A 3IX3A 3DAVA 3BECA 1PZPA 4S2NC 2GX5A 4ETZA 1BLSA 3VSLA 5GLDA 2Y2MA 4XUXA 3EGXC 3MR0A 2IA2A 3UDFA 4KZ3A 2VV7A 1AXBA 2Y8HA 3HLWA 3NDGA 5FQIA 4OP5A 3ITBA 2WGWA 3UPPA 2VKSA 1MC0A 3BY8A 3QNBA 3IX8A 4X69A 4Y17A 4WELA 3ZG7B 5DF8A 1IEMA 1K25A 2KX6A 5L07A 4OLGA 3KYZA 3C4OA 4KZ6A 2VGKA 2Q0OA 5HAIA 1TEMA 2ZQ9A 2L0WA 3MS6A 2K7SA 3MXQA 5EVIC 4S2JA 4OPRA 5F1GA 4HP4A 1GCEA 1UGUA 1VHMA 3HVFA 4R23A 4L9EA 4RYEA 1T1BA 5IS1A 1FCMA 3G2YA 4JF5A 3Q7ZA 3N4IA 5HL1A 4LRXC 4QD4A 2O0YA 3UO9A 1RP5A 3BFCA 1YLTA 1NY0A 2WZZA 3BQ8A 4LV2A 3MFDA 5J3WA 4OQ0A 3TJZC 1LI9A 2W0NA 1W79A 3F1OA 1FOFA 1K54C 1Z6FA 4OOLA 3PBQA 2V8FA 5CX7A 1NZOA 5AQAA 2R78A 2V0WA 1EI5A 1XFNA 2XROA 4A5RA 5DKLA 1YMXA 1CJFA 2OAP1 4QB8A 2ZMVA 2RL3A 3LICA 1ZTUA 3PAEA 2WGVA 5HSQA 3GSGA 1NXYA 4S2MA 3DWKA 4WMCA 4BMWA 4P87A 3JPUA 4CLCE 1ES2A 3FPVA 1IKGA 5FI6A 4N9LA 4Y2FA 2Y2HA 5AQ9A 1E25A 3IBRA 4IBXA 4S2KA 4E3IA 1P9WA 2VJWA 2ZC5B 5HDCA 2J8YA 2ZC4B 4IUHA 3HLBA 4EERA 4ID4A 2ZL1A 1BLHA 3LCEA 3CUEA 1L0DA 3QP6A 4KZ7A 3PXPA 2X02A 3DW0A 2HGVA 2WZXA 5EVIA 3IHAA 4HJ3A 4JGOA 1OTAA 1P97A 2WKPA 3ZVTA 4GB7A 2Y2OA 2KDKA 4LV0A 2EWVA 3IX4A 4C75A 3CAXA 1L0GA 4UA9A 3LR4A 4YNRA 1KE3A 2MJ6A 4EUVA 2B95A 3N8RA 4P6ZS 2QJ5A 3G4PA 2ZOHA 5FQQA 4OOYA 1ERMA 3OPHA 1DY6A 4H6JA 3EEHA 5FASA 2QPNA 2DNSA 3UE6A 3KSHA 4II7A 3NI9A 3DBAA 1LSVA 2ZMFA 3H7WA 3IH9A 3T1RA 1RCJA 4AFIA 1SKFA 4HBTA 4MCWA 1D06A 4PM5A 4EWFA 1G28A 2BASA 1XA1A 3Q7VA 3Q81A 1VETA 3KSIA 1ERQA 4LPZA 3MQOA 3S4XA 3QP8A 1M6KA 4HP9A 2EX9A 3MSHA 4R3AA 1OPXA 3MBZA 4WF0A 3DTKA 3S7NA 3E4PA 4WEKA 3S7QA 3D72A 2A2LA 1HZOA 5D3OA 3HUMA 4R4RA 5J8XA 2OSUA 4L9GA 2W3DA 5EOOA 5U47A 3NY4A 2XFSA 3P98A 5HWVA 4GDBA 3IT9A 3EOIA 4MDZA 2NUPC 5E2EA 1EW0A 1RGYA 1S6RA 1W63M 2H28A 1CEGA 1N9LA 1YSPA 4I5SA 2R9WA 1I2WA 3QP1A 4IVIA 3UDIA 4WZ5A 1P0ZA 2WKRA 5HPIA 1OT9A 3N6IA 5FQKA 2O9CA 3NULA 1CF0A 2XA7M 1YQSA 1DJAA 4G3KA 3Q1FA 3O88A 1VEUA 3MKFA 3UY6A 1BYWA 1PYYA 4E3KA 2HDQA 3PYPA 4DDYA 5J7EA 3Q07A 1IFQA 3PBOA 5FQ9A 4WZ4A 2GZAA 3IQAA 2XRNA 1LHYA 1TF1A 3LIBA 5GLAA 1YAXA 4PPRA 4MBHA 3LR0A 4YINA 1M40A 3ZDJA 2HDRA 2X71A 3LI8A 3KYQA 1GHPA 1TDLA 2P9VB 5GL9A 5HWWA 3G34A 1TD5A 4LV3A 2JKTI 3TOIA 1Y28A 2OAQ1 4GW9A 1ZC2A 3EQUA 4EU0A 2PR5A 3HL9A 5F5YA 2QWSA 4OKPA 3HLFA 2G7UA 2EX8A 2BG1A 5FI7A 4E6XA 4GLQA 1H3QA 4QWOA 3ISGA 5BOHA 4Y15A 3JVVA 3TW8A 5K5BA 1FR6A 1VM1A 1LL5A 1N9BA 2ZC6B 4KG2A 3UB9A 5E2FA 1U60A 3PBSA 3JYIA 4D60A 2XD1A 2OLUA 4BBTA 3C38A 2BLSA 4BL3A 1S0WA 5F68A 3UMEA 1XJ3A 1N9OA 2IWBA 1D7EA 4KG5A 3LYXA 1G6AA 3FKVA 3NOUC 2A49A 4MBFA 3IXHA 4Y13A 5JYOA 4GN2A 1OTDA 1MWRA 3B33A 3U4LP 5M19A 5CHMA 3D3OA 3O5YA 2RCXA 1YSQA 2LB5A 1JTDA 2XLNA 4ARZA 3MZEA 4O01A 4S2IA 4PKYG 1LI0A 3P09A 3BEBA 3IS2A 4WEJA 3LEQA 2Y4AA 3LIFA 3OLOA 4P0MA 3DTIA 3F1PA 4I39A 4F3LB 1W8QA 1OTIA 4PAUA 2WKEA 1ONHA 3PR6A 2GJ3A 4LGWA 1PRQA 1SZVA 3S22A 3IWOA 3VE4A 1KDWA 1WA9A 4DDSA 4GS9B 1KGEA 4E3JA 1MWTA 5HFOA 2HP9A 2XA7S 4KUOA 1IELA 4OQIA 3BM6A 2WYXA 2W27A 3G31A 3G2ZA 4OPYA 1K4FA 2K31A 4HHDA 5DJTA 5GHXA 1ESUA 2A24A 3BWLA 2W1TB 4GHIB 5L2FA 2ZD8A 3QP2A 2XFTA 2VLGA 3VFHA 2LB9A 1YKDA 5E43A 4EQ1A 2W3FA 3A0RA 3M6HA 2ZBBA 4I3IA 1GHIA 2B18A 1KVMA 1YM1A 1SKOA 5CTMA 5F69A 1H0MA 3C4PA 1GSXA 5CRFA 4E3MA 3NBLA 2HDSA 4CJNA 2EFXA 4DE0A 5A93A 1FR1A 3VOZA 4JXWA 2W3EA 5KSHA 3NOTC 2XEPA 1GA9A 4Q0IA 3SH8A 3E0YA 3K3CA 2H0TA 3HREA 5KZHA 2J3WA 1K38A 4OVDA 1DJBA 3CHWP 5I5LA 3M6BA 2XF3A 3SS5A 5TR7A 2PBYA 2QJ7A 3GQZA 4UEYA 2CC1A 3GMWA 1ES3A 4EETB 4P85A 3SOIA 5FA7A 4ESPA 1NRFA 5FL3A 4UA6A 5HX9A 2W1RA 1CQAA 4P6ZM 1K57A 3JVUA 5DJUA 2EX6A 3LY3A 4GCZA 1JWVA 4OPQA 3IXBA 2Y2QA 4DN0A 1NJ4A 2HJ9C 4NXBA 4ZAMA 3IWQA 3A3IA 2V2FF 2Y55A 3CUEC 3C5AA 1BULA 3VOYA 5L09A 1JWPA 1VQQA 2J9OA 1S1ZA 5KMWA 2O99A 2OLVA 4ETXA 2ZQCA 3T1XA 3TG9A 5CERA 4XUZA 3M2JA 3C30A 4JXGA 3LY4A 3KSGA 2J9PA 1LL8A 1BSGA 1LSWA 2C6WB 5DKKA 2Y2NA 1XJ6A 1ES5A 1MBLA 4HH2A 3T4JA 2VGLM 2PD8A 5HL6A 5KIZA 2PRFA 4DKIA 5AVFA 3E4QA 4JLFA 3EWKA 5FATA 1OMEA 4MN7A 4C3QA 3T1QB 2VK3A 2OOLA 1YMSA 3MZFA 2Z6CA 2JKGA 5FQMA 4U3TA 1KGGA 5IT5A 4QU3A 4PMAA 2J3TD 4CLCD 3GDIA 4LLOB 3NC8A 1JNUA 3NIAA 3WWXA 2Y91A 4RA7A 2QMIA 1T18A 3W4QA 2WAEA 1Y4OA 2WKIA 1XJ2A 3CG5A 1O7EA 1Q2QA 3MXSA 2R9XA 1GHMA 4K0XA 4DE3A 1XFQA 4R1GA 1FQGA 2QZ6A 2XD5A 3SH7A 4GKUA 3PBRA 5GHZA 1XPBA 2OWJA 2QYBA 2V20A 3CPTA 2QKPA 1IOUA 4R6LA 3NDEA 3NJAA 2I72A 4MN5A 2EWWA 1S66L 2GDNA 1E3UD 1NYYA 5TBMA 2JKTM 1HLUP 2PU2A 1C3BA 5EVLA 1F9IA 4KZ8A 5JYPA 4RX2A 3O87A 3MKEA 4Y0TA 1YLPA 2V1AA 4X56A 5AQ7A 2ZM2A 3RH8B 1MPLA 2FFFB 3A0SA 3O3VA 3T4KA 3T50A 3UPOA 4WZ5C 2J7VA 3O86A 2Y59A 1KVLA 2WADA 3C7VA 5F1FA 2CMNA 3VP3A 5HPFA 2AVXA 1BTLA 3RXWA 4I3JA 3W2ZA 1S4SA 4JGQA 1IYPA 1F98A 3T4LA 1MXOA 5FQJA 3DTEA 1BUEA 3V3SA 4NG2A 3LIDA 4X68A 1FSYA 3ULFA 4KQQA 4S2LA 3ZNTA 4CPKA 1ZG4A 3AGEA 3KSFA 3LUQA 3WS0A 3SH9A 1LT0A 3ZG8B 4X1MA 2ZQ7A 4X1LA 3DWZA 3IF6B 4E3OA 4OLDA 2VGLS 2INWA 3UB5P 3A3JA 3NCKA 2A3UA 4I3AA 3ZQ5A 3QHYA 1GA0A 1PW1A 2Y2GA 4GD6A 3WRTA 4EUZA 1W8YA 3UMDA 4G3WA 4O7DA 1IYSA 4FUWA 2XH9A 3OC2A 1I2SA 3QP4A 5G4ZA 2VV6A 2EA9A 4KZ5A 5EV0A 2DMWA 4YFMA 3MF0A 4EESA 1P9RA 5HW3A 4R38A 1EROA 2GNXA 3A3FA 3HJIA 4JXVA 3VMAA 2XSSA 4BENA 4ME4A 4O0PA 2ZC7A 1NYMA 3KO6A 5IHVA 5EVID 4NEED 4RQ9A 1BT5A 1K56A 1FIKA 3RFBA 4G3VA 2HP6A 1XGJA 3FYZA 3ZGAB 3F1NB 4CLCB 1ZG6A 3R7WB 2WK0A 2XDMA 1MWUA 3MXRA 1UWPX 1YLYA 4JF6A 1TS0A 1L0FA 3EGDC 5M18A 4ZJ2A 4WUJA 2D01A 1PI5A 2C5WB 2PYRA 1L2SA 1YT4A 5TJJA 5DVAA 5EUAA 3ZG0A 2L1MA 1GSVA 4DMZA 5TFQA 4E04A 5CHUA 3W4OA 4HJ6A 2Y2KA 2JCHA 5KSCA 5FI2A 3T1SA 5A91A 4BQMA 3FG8A 4KQDA 1IYOA 1F5MA 3C7UA 4MBKA 4JKTA 3K3DA 2EX2A 4OOMA 4B93A 5L10A 2M1CA 2WGWB 4HNBA 4OPZA 5AJGA 4GJ4A 1KE0A 4Y0UA 1ES4A 5MC7A 3S1YA 3LGOA 2V9AA 4HH3A 4EBLA 3UE0A 4P6BA 4GZBA 5HWTA 5HARA 4EEUA 1T1CA 1XJ4A 3Q82A 4YOFA 3BLMA 5EM1A 1NZUA 4B88A 5A8BA 4ZRRA 5DTSA 3DTMA 3UB8A 2EXAA 1XGIA 3OBFA 2JBFA 3B3XA 1TS8A 3LIEA 4ZJ1A 2OWHA 1PWGA 3V67A 1YLWA 2G2UA 5C5KA 2V0UA 4XXRA 4HY8A 1X0OA 1SDEA 5EVEA 4O8GA 4Q0JA 3RTYA 2Y2IA 3OOVA 3LEZA 1TDGA 4DRTA 5FEGA 1WYBA 4UQIM 3UPNA 1J9MA 3G35A 3BJNA 3MFXA 3WS1A 1K57C 1A0KA 3V39A 3F1OB 4Y0OA 4ZTKA 1K55C 3VFFA 4YWZA 5TGFA 3PHYA 1HVBA 3G32A 4K0WA 4JBFA 3V50A 4EXOA 4F94A 1J3WA 2H5SA 3FV7A 2P7JA 1ODVA 4UHUA 2K2NA 1EWZA 4N92A 5CGWA 4IHQA 2ZQDA 1HD8A 5EOEA 4HESA 3LIAA 1HTZA 3GVBA 3D9YA 4HI4A 1QMEA 4NETA 3BQAA 3WRZA 2UWXA 4PKYA 1N9NA 3A0VA 1WE4A 3ZG5A 5E2GA 1T19A 4I38A 3GRJA 3BYDA 3PTEA 4GOGA 4WM9A 1G6OA 1BZAA 2PDRA 4Y3IA 1MY8A 5EM0A 1CK3A 4CLCA 4DXBA 2FH5A 4KZBA 2ZL1B 1PZOA 1CI8A 2HPBA 3ITAA 5GHYA 2HZ5A 4ZDXA 1XKZA 3E2KA 5EVIB 2P9VA 4CQHA 2KOIA 1KOUA 1N4OA 1OTEA 2YKFA 2ZJ9A 4KG6A 2HP5A 3WS4A 3R4KA 4B4XA 3TSGA 4PM8A 3HLCA 1E3UA 4BJPA 3W8KA 4PHTA 3IH8A 3FWLA 4MEZA 5F6AA 2E8JA 3ZYTA 5DFYA 2JE5A 3CZDA 1SCWA 3SZTA 4KZ4A 4LRYC 3CLOA 4DJ2A 2JC7A 4H6JB 1KDSA 2VEAA 3N8LA 1FSWA 1K55A 3P01A 3T4SA 4M3KA 4EEPA 2QHKA 2Y2LA 4OQGA 4Z9QA 3CJMA 1W63Q 2PHYA 3H82B 3ICYA 4LFUA 1PIOA 1F2KA 3H7WB 3IWIA 4OP8A 2O9BA 2IWDA 4R3JA 2M7VA 4HQAA 4IEDA 1CEFA 1ACFA 4DF6A 3M2KA 3OCNA 4LV1A 1H8YA 3ZCZA 1S4RA 5CECA 3SS3A 2D02A 4E3LA 3Q7VB 5EE8A 1XXMA 1VETB 5AVEA 3RXXA 4UAAA 3HBRA 4PM6A 5CEDA 3U2AA 2UV0E 3CITA 1PWDA 4UQIS 4WLAA 4K08A 1MKMA 1PI4A 3G6OA 3K2NA 4X25A 3AGDA 3OPRA 1LLBA 1YLZA 3C8CA 1SDNA 4DJ3A 2WKHA 3PAGA 2XQZA 4F3LA 5CTNA 5CGXA 1ESIA 4BD1A 4R70A 3T4OA 3B47A 2HV1A 5CGSA 2PU4A 4GS9A 3S7PA 3BW6A 1W7FA 3L7HA 1K0KA 3HLDA 4RX3A 1JWZA 5G4YA 4R4SA 3HJKA 5HZHA 4S2NA 4LENA 1PFLA 2JKFA 3HLGA 4E6WA 3FPWA 2E8IA 1VB6A 1V9ZA 2B5RA 4QY6A 2W1TA 4GHIA 2ZQAA 3FKWA 3VP2A 5AQBA 3IHBA 1VEUB 2X01A 4FH2A 3CMZA 4S2OA 1YLJA 5HAPA 1MZUA 3TRCA 1K6RA 3C2WA 1E4DA 1NLYA 4LCLA 5HDSA 4DE2A 3ZNYA 2WUQA 4M4XA 2V8CA 5FEFA 4Y7PA 1TS7A 2KLIA 4HOIA 4MLLA 1CI9A 2JKRI 5G18A 4OQHA 3ZFZA 1BLPA 4BLMA 3CWFA 2ZM8A 3V3RA 1DP8A 4QY5A 5FDSA 4ZBEA 3EQVA 4NXEA 5F83A 4FH4A 4HEFA 1TVFA 5DF9A 4EBNA 4UA7A 2HJEA 3UDXA 4FTXA 3UE1A 1ALQA 2JHEA 1RGZA 2XR0A 2OV5A 4FOFA 2HDUA 3RJUA 3BLSA 1S1YA 4D2OA 2ZOIA 3N8SA 2PYPA 1PWCA 1DRMA 1Z09A 5E2HA 4C6YA 1K54A 5FAOA
chains in the Genus database with same CATH topology
3MMHA 5DJTA 2A24A 3UE3A 3BWLA 2W1TB 4GHIB 5TJJA 3BQ8A 4NKPA 2VLGA 3H82A 4MN6A 2LB9A 1H8MA 2L1MA 2VV8A 1GSVA 1YKDA 5J3WA 3TJZC 4DMZA 4E04A 4EQ1A 2W0NA 2W3FA 3A0RA 4HJ6A 2ZBBA 1V9YA 3F1OA 4I3IA 4JGPA 4L9FA 2B18A 4OOLA 3FG8A 3P7NA 3PBQA 3T4QA 4KQDA 4Y5FA 5CX7A 1F5MA 5F69A 1GSXA 2R78A 2FZ0A 2V0WA 4EW7A 1XFNA 2XROA 5DKLA 3K3DA 2YKHA 4OOMA 2OAP1 4NXGA 4B93A 2ZMVA 3LICA 2M1CA 2W3EA 4HNBA 1ZTUA 5KSHA 3NOTC 4Q0IA 5AJGA 4GJ4A 4ARZB 3E0YA 3K3CA 5HSQA 1OJ5A 4B9OA 5MC7A 4BMWA 2J3WA 2W3GA 4IJGA 3IS2B 4CLCE 2V9AA 3FPVA 4HH3A 5I5LA 2B02A 5HWTA 4EEUA 1T1CA 1XJ4A 3F1PB 4YOFA 1S67L 4Y2FA 2QJ7A 4UEYA 5LBRA 3GECA 3IBRA 5A8BA 4ZRRA 1P9WA 2VJWA 4EETB 3UB8A 3OBFA 3UB7A 1TS8A 5HDCA 5IU1A 4IUHA 5FL3A 3LIEA 2OWHA 3V67A 4EERA 5C5KA 2W1RA 3TE8A 1GSWA 2V0UA 3KX0X 4HY8A 3VOLA 3CI6A 3CUEA 4P6ZM 1X0OA 1NWZA 3PXPA 4WL9A 4XT2B 4O8GA 3JVUA 4Q0JA 2VA0A 2HGVA 3RTYA 5DJUA 3OOVA 4HJ3A 4GCZA 4JGOA 1OTAA 2A24B 3IBJA 1P97A 2WKPA 4DN0A 4UQIM 4JGRA 2HJ9C 2KDKA 4NXBA 2NUTC 3BJNA 2EWVA 3CUEC 3MFXA 3HCYA 3CAXA 3F1OB 1S1ZA 3LR4A 4YWZA 2O99A 2I9VA 3PHYA 4YNRA 4ETXA 3FC7A 2MJ6A 4EXOA 1T1AA 1OJGA 3MJQA 4EUVA 2P7JA 3C30A 1DP6A 1ODVA 4P6ZS 2QJ5A 2K2NA 3KSGA 2ZOHA 3OCLA 1LL8A 4IHQA 1LSWA 5DKKA 1XJ6A 4H6JA 3EEHA 1DP9A 2VX8A 4HH2A 3T4JA 3UE6A 3KSHA 4BBVA 4II7A 2VGLM 2PD8A 2Z6DA 5HL6A 5KIZA 3LIAA 2V1BA 5AVFA 3DBAA 4HJ4A 3E4OA 1LSVA 2ZMFA 3H7WA 1NLZA 3E4QA 4HI4A 3EWKA 3BQAA 3PBNA 4AFIA 3EEAA 4MN7A 4PKYA 2OOLA 4MCWA 2HF6A 1N9NA 3SW1A 3A0VA 1D06A 5EFWA 2Z6CA 2VZWA 1G28A 2BASA 2J80A 2PR6A 1T19A 4I38A 3NHQA 5IT5A 3KSIA 1G6OA 4LPZA 3MQOA 2PDRA 4Y3IA 2J3TD 4CLCD 3S7OA 3GDIA 4LLOB 2JN7A 4CLCA 1JNUA 4HP9A 2FH5A 1T18A 4R3AA 1OPXA 4Q0HA 1XJ2A 4WF0A 3S7NA 3E4PA 4WEKA 3S7QA 2W3HA 3D72A 2A2LA 1XFQA 3VV4A 2J3TC 4CLCC 4L9GA 4QPRA 2W3DA 3BY9A 4MMNA 4CQHA 3PBRA 2OWJA 2QYBA 2YKFA 1KOUA 1OTEA 2KOIA 2QKPA 1IOUA 3MQ0A 3H9WA 4LRZE 4R6LA 3NJAA 4KUKA 4MN5A 3R4KA 2EWWA 5HWVA 1S66L 3PBTA 3EOIA 2L4RA 2WKQA 4MDZA 2PT7A 4BJPA 2NUPC 2P08A 4PHTA 5F6AA 1EW0A 5TBMA 3E98A 2JKTM 3ZYTA 1UWNX 1OTBA 5DFYA 1W63M 2H28A 1N9LA 1YSPA 3VE3A 4I5SA 4L0LA 4HIAA 3CLOA 4LRYC 4DJ2A 1F9IA 4H6JB 2VEAA 3T4SA 3P01A 1P0ZA 4KQOA 4EEPA 2WKRA 2QHKA 5HPIA 2V1AA 3UB6A 5HD5A 1OT9A 1W63Q 2PHYA 3H82B 3ICYA 3H7WB 2O9BA 2M7VA 4HQAA 3RH8B 2O9CA 1NRJA 3A0SA 3T4KA 2XA7M 3T50A 3OCNA 3LR3A 4G3KA 1BYWA 5HD3A 1S4RA 3MQQA 4IUKA 2D02A 3PYPA 5J7EA 4NXFA 1IFQA 3PBOA 4FSFA 2CMNA 5AVEA 5J4EA 2GZAA 2XRNA 1TF1A 3LIBA 1YAXA 5DFXA 5HDDA 3U2AA 5HPFA 3LR0A 4WN5A 3CITA 4UQIS 4I3JA 3W2ZA 1S4SA 4WLAA 3NOPC 2M7UA 4K08A 2Y79A 1ZHHB 1MKMA 2O9AA 3LI8A 3KYQA 4JGQA 1F98A 3T4LA 3G6OA 3K2NA 5HWWA 1STZA 1TD5A 3LI9A 2JKTI 3LIDA 1Y28A 2OAQ1 4GW9A 4XT2A 3ULFA 3C8CA 3EQUA 4EU0A 4DJ3A 2PR5A 3KSFA 3LUQA 4F3LA 5F5YA 2QWSA 4R70A 1LT0A 1TS6A 3T4OA 3B47A 1OT6A 2G7UA 4BWIA 2JKRM 3F1NA 4Z1WA 5TBMB 2HV1A 4GLQA 1H3QA 1LSXA 2VGLS 3R7WA 2INWA 4GS9A 3S7PA 3JVVA 3TW8A 3BW6A 5K5BA 4BBUA 3T4TA 5L8MA 4I3AA 5G4YA 3ZQ5A 3B42A 3UB9A 3HJKA 2P04A 3LR5A 5HZHA 3PBSA 2PD7A 2O0YA 3FPWA 1VB6A 1V9ZA 2W1TA 4GHIA 3LFVA 4BBTA 3C38A 3UMDA 5F68A 4G3WA 3UMEA 2GX5A 1XJ3A 4ETZA 1N9OA 1D7EA 1MZUA 3LYXA 3OC2A 3TRCA 3EGXC 3C2WA 3NOUC 5G4ZA 1NLYA 2VV6A 3MR0A 2EA9A 2DMWA 2IA2A 5HDSA 3MF0A 1OTDA 4EESA 3B33A 1P9RA 4M4XA 2VV7A 2Y8HA 4R38A 2GNXA 3D3OA 3O5YA 1TS7A 1YSQA 2LB5A 2KLIA 4HOIA 3HJIA 2VKSA 1MC0A 4ARZA 4O01A 2JKRI 3BY8A 2XSSA 4PKYG 4ME4A 3CWFA 3IS2A 4WEJA 4O0PA 4WELA 3KO6A 3OLOA 1DP8A 3LIFA 4NEED 4RQ9A 2KX6A 3F1PA 4I39A 4F3LB 3EQVA 1OTIA 4NXEA 4PAUA 3KYZA 3RFBA 3PR6A 2GJ3A 5DF9A 4G3VA 2HJEA 2L0WA 2K7SA 2JHEA 3F1NB 4CLCB 3MXQA 3R7WB 3VE4A 4FOFA 1WA9A 1UWPX 4GS9B 4HP4A 1S1YA 1VHMA 1UGUA 2ZOIA 4L9EA 1T1BA 1TS0A 5IS1A 2XA7S 4KUOA 2PYPA 3EGDC 2W27A 4WUJA 1DRMA 2D01A 2K31A 4HHDA 4LRXC 2PYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCY A;  5L8M A;  3MMH A;  3E98 A;  3ZQ5 A;  2W1T B;  5TJJ A;  5DFY A;  1YSP A;  2LB9 A;  2O99 A;  4YNR A;  4LRY C;  1YKD A;  4ETX A;  4DMZ A;  4E04 A;  2W3F A;  4EUV A;  2VEA A;  2W1T A;  2B18 A;  3LFV A;  2K2N A;  5HPI A;  3KSG A;  4Y5F A;  1F5M A;  2O9B A;  4G3W A;  2GX5 A;  2M7V A;  4ETZ A;  2XRO A;  2O9C A;  3KSH A;  3TRC A;  5HL6 A;  3C2W A;  3NOU C;  4G3K A;  3DBA A;  2IA2 A;  2W3E A;  1ZTU A;  2ZMF A;  3NOT C;  4Q0I A;  5AJG A;  5HSQ A;  3MF0 A;  3E0Y A;  4IUK A;  3EEA A;  4MN7 A;  2Y8H A;  2W3G A;  2OOL A;  4IJG A;  4MCW A;  3D3O A;  3O5Y A;  2XRN A;  1YSQ A;  2LB5 A;  2VZW A;  5I5L A;  1TF1 A;  2KLI A;  5DFX A;  2VKS A;  1MC0 A;  5HPF A;  4O01 A;  3NHQ A;  4YOF A;  3CIT A;  4Y2F A;  2XSS A;  4ME4 A;  3W2Z A;  3KSI A;  5LBR A;  3IBR A;  3NOP C;  4ZRR A;  4O0P A;  2M7U A;  3KO6 A;  2Y79 A;  1MKM A;  4Y3I A;  2O9A A;  2VJW A;  4RQ9 A;  3S7O A;  3G6O A;  3OBF A;  3K2N A;  1STZ A;  1TD5 A;  4PAU A;  4IUH A;  3RFB A;  4GW9 A;  4Q0H A;  4G3V A;  5C5K A;  3S7N A;  2W1R A;  4EU0 A;  3KSF A;  3S7Q A;  2W3H A;  3VV4 A;  3CI6 A;  4FOF A;  4QPR A;  2W3D A;  4R70 A;  4MMN A;  4CQH A;  4O8G A;  2QYB A;  4Q0J A;  2G7U A;  2KOI A;  4BWI A;  2HGV A;  3OOV A;  3MQ0 A;  4Z1W A;  1VHM A;  4LRZ E;  4R6L A;  3IBJ A;  4GLQ A;  4DN0 A;  3R4K A;  3BJN A;  3S7P A;  5K5B A;  4MDZ A;  2K31 A;  4LRX C;  2O0Y A; 
#chains in the Genus database with same CATH topology
 3BFD A;  3GTC A;  4PM9 A;  3MMH A;  5HAQ A;  3OPL A;  3HLE A;  3UE3 A;  4NKP A;  4FD8 A;  2Q9M A;  3H82 A;  4MN6 A;  1H8M A;  2VV8 A;  1FCN A;  2PBD P;  5GLB A;  2FFY A;  1V9Y A;  4JGP A;  4L9F A;  5F82 A;  3P7N A;  3T4Q A;  2PAV P;  4EQI A;  4Y5F A;  2FZ0 A;  4MNR A;  4EW7 A;  1H8Z A;  5FSR A;  2YKH A;  1O07 A;  4B4Z A;  4NXG A;  4QHC A;  2H0Y A;  1K6S A;  3GR2 A;  4ARZ B;  1OJ5 A;  4B9O A;  4WMC D;  2XGN A;  3UN7 A;  2W3G A;  4IJG A;  3IXD A;  1W5D A;  3IS2 B;  1Q2P A;  5I94 A;  3W4P A;  1KE4 A;  4KQR A;  2B02 A;  3HUN A;  4WBG A;  4R3B A;  1I5Q A;  3BFF A;  3F1P B;  3I7J A;  1S67 L;  1FCO A;  5M1A A;  5LBR A;  2Y2J A;  3GEC A;  1G68 A;  3HUO A;  4JF4 A;  3UB7 A;  4H8R A;  1L0E A;  5IU1 A;  4N1X A;  4WYY A;  4BL2 A;  2Y2P A;  3IF5 A;  3QNC A;  4X55 A;  3TE8 A;  2WAF A;  1XP4 A;  5CEB A;  4PM7 A;  1GSW A;  4QJG A;  3KX0 X;  5EEC A;  4JPM A;  5DTT A;  1D1J A;  3UNW A;  3CI6 A;  3VOL A;  2DRW A;  2P74 A;  1NWZ A;  4XT2 B;  4WL9 A;  1AWI A;  2VA0 A;  3BRM A;  3E2L A;  5CXW A;  1XA7 A;  2ZC3 B;  2A24 B;  3IBJ A;  1YPR A;  3IF6 C;  5A92 A;  4JGR A;  3LO7 A;  2NUT C;  1H5X A;  3HCY A;  1MWS A;  2EXB A;  1Y54 A;  2XK1 A;  4KZ9 A;  1SKO B;  1MKI A;  2I9V A;  3FC7 A;  1K4E A;  1T1A A;  1OJG A;  3MJQ A;  4KZA A;  1DP6 A;  4N1H A;  3G30 A;  3KYE A;  2BTF P;  3A3E A;  3OZH A;  3OCL A;  1ZKJ A;  3BFE A;  3FZC A;  3ZVW A;  1DP9 A;  2VX8 A;  4EBP A;  4BBV A;  2Z6D A;  2V1B A;  4HJ4 A;  3E4O A;  1NLZ A;  1SHV A;  4BD0 A;  3PBN A;  3EEA A;  2EFU A;  3SW1 A;  2HF6 A;  3VSK A;  5EFW A;  2VZW A;  4FCF A;  2J80 A;  4GDN A;  2PR6 A;  4GNU A;  3NHQ A;  4EV4 A;  5DF7 A;  1IKI A;  3SS4 A;  4U0T A;  4GD8 A;  1G5U A;  3S7O A;  1ONG A;  4JXS A;  2JN7 A;  5EPH A;  4LCM A;  1KGF A;  4DXC A;  4Q0H A;  3VP4 A;  5FAP A;  3WS5 A;  2W3H A;  3VP0 A;  3VV4 A;  2J3T C;  4CLC C;  1PW8 A;  2ZM0 A;  2ZQ8 A;  4QPR A;  1DJC A;  3BY9 A;  4MMN A;  1PNE A;  3ZHH A;  3MQ0 A;  2H10 A;  3H9W A;  4LRZ E;  3WS2 A;  4KUK A;  1WYC A;  3PBT A;  2L4R A;  4OON A;  2WKQ A;  3IXG A;  2PT7 A;  2P08 A;  3IF6 A;  4X53 A;  3E98 A;  4HBU A;  1UWN X;  1OTB A;  1XX2 A;  3VE3 A;  4L0L A;  4HIA A;  4DE1 A;  3ZG9 B;  4KQO A;  3NEC A;  3GV9 A;  5HD5 A;  3UB6 A;  4IBR A;  3VP1 A;  4E3N A;  1NRJ A;  5GLC A;  3LR3 A;  1K56 D;  3A3D A;  5HD3 A;  3MQQ A;  4IUK A;  5FDH A;  4KEN B;  4NXF A;  4FSF A;  5J4E A;  2V1Z A;  2G2W A;  4ZJ3 A;  2DCF A;  5DFX A;  5HDD A;  2Q9N A;  3AGF A;  4WN5 A;  4Q8I A;  4K91 A;  3NOP C;  2M7U A;  4NK3 A;  1QMF A;  4U0X A;  3V5M A;  2Y79 A;  1ZHH B;  2O9A A;  4IVK A;  1JVJ A;  3N7W A;  4R0Q A;  1STZ A;  4RVA A;  1FIL A;  3LI9 A;  3T12 B;  3MZD A;  4XT2 A;  3QP5 A;  1JTG A;  2ACG A;  1IYQ A;  3CPT B;  4N9K A;  2VGJ A;  5CHJ A;  2Z2L B;  5FAQ A;  1TS6 A;  1BLC A;  2Z2M B;  1OT6 A;  4BWI A;  1L3L A;  2JKR M;  3F1N A;  4Z1W A;  5TBM B;  1LSX A;  4X6T A;  3R7W A;  3D4F A;  3OPP A;  5DTK A;  4OH0 A;  4BBU A;  5A90 A;  3L9K A;  3T4T A;  5L8M A;  3BFG A;  2WGI A;  3B42 A;  2IWC A;  2P04 A;  3LR5 A;  2ZMA A;  2PD7 A;  2ZLY A;  4S2P A;  3LFV A;  1LL9 A;  3IX3 A;  3DAV A;  3BEC A;  1PZP A;  4S2N C;  2GX5 A;  4ETZ A;  1BLS A;  3VSL A;  5GLD A;  2Y2M A;  4XUX A;  3EGX C;  3MR0 A;  2IA2 A;  3UDF A;  4KZ3 A;  2VV7 A;  1AXB A;  2Y8H A;  3HLW A;  3NDG A;  5FQI A;  4OP5 A;  3ITB A;  2WGW A;  3UPP A;  2VKS A;  1MC0 A;  3BY8 A;  3QNB A;  3IX8 A;  4X69 A;  4Y17 A;  4WEL A;  3ZG7 B;  5DF8 A;  1IEM A;  1K25 A;  2KX6 A;  5L07 A;  4OLG A;  3KYZ A;  3C4O A;  4KZ6 A;  2VGK A;  2Q0O A;  5HAI A;  1TEM A;  2ZQ9 A;  2L0W A;  3MS6 A;  2K7S A;  3MXQ A;  5EVI C;  4S2J A;  4OPR A;  5F1G A;  4HP4 A;  1GCE A;  1UGU A;  1VHM A;  3HVF A;  4R23 A;  4L9E A;  4RYE A;  1T1B A;  5IS1 A;  1FCM A;  3G2Y A;  4JF5 A;  3Q7Z A;  3N4I A;  5HL1 A;  4LRX C;  4QD4 A;  2O0Y A;  3UO9 A;  1RP5 A;  3BFC A;  1YLT A;  1NY0 A;  2WZZ A;  3BQ8 A;  4LV2 A;  3MFD A;  5J3W A;  4OQ0 A;  3TJZ C;  1LI9 A;  2W0N A;  1W79 A;  3F1O A;  1FOF A;  1K54 C;  1Z6F A;  4OOL A;  3PBQ A;  2V8F A;  5CX7 A;  1NZO A;  5AQA A;  2R78 A;  2V0W A;  1EI5 A;  1XFN A;  2XRO A;  4A5R A;  5DKL A;  1YMX A;  1CJF A;  2OAP 1;  4QB8 A;  2ZMV A;  2RL3 A;  3LIC A;  1ZTU A;  3PAE A;  2WGV A;  5HSQ A;  3GSG A;  1NXY A;  4S2M A;  3DWK A;  4WMC A;  4BMW A;  4P87 A;  3JPU A;  4CLC E;  1ES2 A;  3FPV A;  1IKG A;  5FI6 A;  4N9L A;  4Y2F A;  2Y2H A;  5AQ9 A;  1E25 A;  3IBR A;  4IBX A;  4S2K A;  4E3I A;  1P9W A;  2VJW A;  2ZC5 B;  5HDC A;  2J8Y A;  2ZC4 B;  4IUH A;  3HLB A;  4EER A;  4ID4 A;  2ZL1 A;  1BLH A;  3LCE A;  3CUE A;  1L0D A;  3QP6 A;  4KZ7 A;  3PXP A;  2X02 A;  3DW0 A;  2HGV A;  2WZX A;  5EVI A;  3IHA A;  4HJ3 A;  4JGO A;  1OTA A;  1P97 A;  2WKP A;  3ZVT A;  4GB7 A;  2Y2O A;  2KDK A;  4LV0 A;  2EWV A;  3IX4 A;  4C75 A;  3CAX A;  1L0G A;  4UA9 A;  3LR4 A;  4YNR A;  1KE3 A;  2MJ6 A;  4EUV A;  2B95 A;  3N8R A;  4P6Z S;  2QJ5 A;  3G4P A;  2ZOH A;  5FQQ A;  4OOY A;  1ERM A;  3OPH A;  1DY6 A;  4H6J A;  3EEH A;  5FAS A;  2QPN A;  2DNS A;  3UE6 A;  3KSH A;  4II7 A;  3NI9 A;  3DBA A;  1LSV A;  2ZMF A;  3H7W A;  3IH9 A;  3T1R A;  1RCJ A;  4AFI A;  1SKF A;  4HBT A;  4MCW A;  1D06 A;  4PM5 A;  4EWF A;  1G28 A;  2BAS A;  1XA1 A;  3Q7V A;  3Q81 A;  1VET A;  3KSI A;  1ERQ A;  4LPZ A;  3MQO A;  3S4X A;  3QP8 A;  1M6K A;  4HP9 A;  2EX9 A;  3MSH A;  4R3A A;  1OPX A;  3MBZ A;  4WF0 A;  3DTK A;  3S7N A;  3E4P A;  4WEK A;  3S7Q A;  3D72 A;  2A2L A;  1HZO A;  5D3O A;  3HUM A;  4R4R A;  5J8X A;  2OSU A;  4L9G A;  2W3D A;  5EOO A;  5U47 A;  3NY4 A;  2XFS A;  3P98 A;  5HWV A;  4GDB A;  3IT9 A;  3EOI A;  4MDZ A;  2NUP C;  5E2E A;  1EW0 A;  1RGY A;  1S6R A;  1W63 M;  2H28 A;  1CEG A;  1N9L A;  1YSP A;  4I5S A;  2R9W A;  1I2W A;  3QP1 A;  4IVI A;  3UDI A;  4WZ5 A;  1P0Z A;  2WKR A;  5HPI A;  1OT9 A;  3N6I A;  5FQK A;  2O9C A;  3NUL A;  1CF0 A;  2XA7 M;  1YQS A;  1DJA A;  4G3K A;  3Q1F A;  3O88 A;  1VEU A;  3MKF A;  3UY6 A;  1BYW A;  1PYY A;  4E3K A;  2HDQ A;  3PYP A;  4DDY A;  5J7E A;  3Q07 A;  1IFQ A;  3PBO A;  5FQ9 A;  4WZ4 A;  2GZA A;  3IQA A;  2XRN A;  1LHY A;  1TF1 A;  3LIB A;  5GLA A;  1YAX A;  4PPR A;  4MBH A;  3LR0 A;  4YIN A;  1M40 A;  3ZDJ A;  2HDR A;  2X71 A;  3LI8 A;  3KYQ A;  1GHP A;  1TDL A;  2P9V B;  5GL9 A;  5HWW A;  3G34 A;  1TD5 A;  4LV3 A;  2JKT I;  3TOI A;  1Y28 A;  2OAQ 1;  4GW9 A;  1ZC2 A;  3EQU A;  4EU0 A;  2PR5 A;  3HL9 A;  5F5Y A;  2QWS A;  4OKP A;  3HLF A;  2G7U A;  2EX8 A;  2BG1 A;  5FI7 A;  4E6X A;  4GLQ A;  1H3Q A;  4QWO A;  3ISG A;  5BOH A;  4Y15 A;  3JVV A;  3TW8 A;  5K5B A;  1FR6 A;  1VM1 A;  1LL5 A;  1N9B A;  2ZC6 B;  4KG2 A;  3UB9 A;  5E2F A;  1U60 A;  3PBS A;  3JYI A;  4D60 A;  2XD1 A;  2OLU A;  4BBT A;  3C38 A;  2BLS A;  4BL3 A;  1S0W A;  5F68 A;  3UME A;  1XJ3 A;  1N9O A;  2IWB A;  1D7E A;  4KG5 A;  3LYX A;  1G6A A;  3FKV A;  3NOU C;  2A49 A;  4MBF A;  3IXH A;  4Y13 A;  5JYO A;  4GN2 A;  1OTD A;  1MWR A;  3B33 A;  3U4L P;  5M19 A;  5CHM A;  3D3O A;  3O5Y A;  2RCX A;  1YSQ A;  2LB5 A;  1JTD A;  2XLN A;  4ARZ A;  3MZE A;  4O01 A;  4S2I A;  4PKY G;  1LI0 A;  3P09 A;  3BEB A;  3IS2 A;  4WEJ A;  3LEQ A;  2Y4A A;  3LIF A;  3OLO A;  4P0M A;  3DTI A;  3F1P A;  4I39 A;  4F3L B;  1W8Q A;  1OTI A;  4PAU A;  2WKE A;  1ONH A;  3PR6 A;  2GJ3 A;  4LGW A;  1PRQ A;  1SZV A;  3S22 A;  3IWO A;  3VE4 A;  1KDW A;  1WA9 A;  4DDS A;  4GS9 B;  1KGE A;  4E3J A;  1MWT A;  5HFO A;  2HP9 A;  2XA7 S;  4KUO A;  1IEL A;  4OQI A;  3BM6 A;  2WYX A;  2W27 A;  3G31 A;  3G2Z A;  4OPY A;  1K4F A;  2K31 A;  4HHD A;  5DJT A;  5GHX A;  1ESU A;  2A24 A;  3BWL A;  2W1T B;  4GHI B;  5L2F A;  2ZD8 A;  3QP2 A;  2XFT A;  2VLG A;  3VFH A;  2LB9 A;  1YKD A;  5E43 A;  4EQ1 A;  2W3F A;  3A0R A;  3M6H A;  2ZBB A;  4I3I A;  1GHI A;  2B18 A;  1KVM A;  1YM1 A;  1SKO A;  5CTM A;  5F69 A;  1H0M A;  3C4P A;  1GSX A;  5CRF A;  4E3M A;  3NBL A;  2HDS A;  4CJN A;  2EFX A;  4DE0 A;  5A93 A;  1FR1 A;  3VOZ A;  4JXW A;  2W3E A;  5KSH A;  3NOT C;  2XEP A;  1GA9 A;  4Q0I A;  3SH8 A;  3E0Y A;  3K3C A;  2H0T A;  3HRE A;  5KZH A;  2J3W A;  1K38 A;  4OVD A;  1DJB A;  3CHW P;  5I5L A;  3M6B A;  2XF3 A;  3SS5 A;  5TR7 A;  2PBY A;  2QJ7 A;  3GQZ A;  4UEY A;  2CC1 A;  3GMW A;  1ES3 A;  4EET B;  4P85 A;  3SOI A;  5FA7 A;  4ESP A;  1NRF A;  5FL3 A;  4UA6 A;  5HX9 A;  2W1R A;  1CQA A;  4P6Z M;  1K57 A;  3JVU A;  5DJU A;  2EX6 A;  3LY3 A;  4GCZ A;  1JWV A;  4OPQ A;  3IXB A;  2Y2Q A;  4DN0 A;  1NJ4 A;  2HJ9 C;  4NXB A;  4ZAM A;  3IWQ A;  3A3I A;  2V2F F;  2Y55 A;  3CUE C;  3C5A A;  1BUL A;  3VOY A;  5L09 A;  1JWP A;  1VQQ A;  2J9O A;  1S1Z A;  5KMW A;  2O99 A;  2OLV A;  4ETX A;  2ZQC A;  3T1X A;  3TG9 A;  5CER A;  4XUZ A;  3M2J A;  3C30 A;  4JXG A;  3LY4 A;  3KSG A;  2J9P A;  1LL8 A;  1BSG A;  1LSW A;  2C6W B;  5DKK A;  2Y2N A;  1XJ6 A;  1ES5 A;  1MBL A;  4HH2 A;  3T4J A;  2VGL M;  2PD8 A;  5HL6 A;  5KIZ A;  2PRF A;  4DKI A;  5AVF A;  3E4Q A;  4JLF A;  3EWK A;  5FAT A;  1OME A;  4MN7 A;  4C3Q A;  3T1Q B;  2VK3 A;  2OOL A;  1YMS A;  3MZF A;  2Z6C A;  2JKG A;  5FQM A;  4U3T A;  1KGG A;  5IT5 A;  4QU3 A;  4PMA A;  2J3T D;  4CLC D;  3GDI A;  4LLO B;  3NC8 A;  1JNU A;  3NIA A;  3WWX A;  2Y91 A;  4RA7 A;  2QMI A;  1T18 A;  3W4Q A;  2WAE A;  1Y4O A;  2WKI A;  1XJ2 A;  3CG5 A;  1O7E A;  1Q2Q A;  3MXS A;  2R9X A;  1GHM A;  4K0X A;  4DE3 A;  1XFQ A;  4R1G A;  1FQG A;  2QZ6 A;  2XD5 A;  3SH7 A;  4GKU A;  3PBR A;  5GHZ A;  1XPB A;  2OWJ A;  2QYB A;  2V20 A;  3CPT A;  2QKP A;  1IOU A;  4R6L A;  3NDE A;  3NJA A;  2I72 A;  4MN5 A;  2EWW A;  1S66 L;  2GDN A;  1E3U D;  1NYY A;  5TBM A;  2JKT M;  1HLU P;  2PU2 A;  1C3B A;  5EVL A;  1F9I A;  4KZ8 A;  5JYP A;  4RX2 A;  3O87 A;  3MKE A;  4Y0T A;  1YLP A;  2V1A A;  4X56 A;  5AQ7 A;  2ZM2 A;  3RH8 B;  1MPL A;  2FFF B;  3A0S A;  3O3V A;  3T4K A;  3T50 A;  3UPO A;  4WZ5 C;  2J7V A;  3O86 A;  2Y59 A;  1KVL A;  2WAD A;  3C7V A;  5F1F A;  2CMN A;  3VP3 A;  5HPF A;  2AVX A;  1BTL A;  3RXW A;  4I3J A;  3W2Z A;  1S4S A;  4JGQ A;  1IYP A;  1F98 A;  3T4L A;  1MXO A;  5FQJ A;  3DTE A;  1BUE A;  3V3S A;  4NG2 A;  3LID A;  4X68 A;  1FSY A;  3ULF A;  4KQQ A;  4S2L A;  3ZNT A;  4CPK A;  1ZG4 A;  3AGE A;  3KSF A;  3LUQ A;  3WS0 A;  3SH9 A;  1LT0 A;  3ZG8 B;  4X1M A;  2ZQ7 A;  4X1L A;  3DWZ A;  3IF6 B;  4E3O A;  4OLD A;  2VGL S;  2INW A;  3UB5 P;  3A3J A;  3NCK A;  2A3U A;  4I3A A;  3ZQ5 A;  3QHY A;  1GA0 A;  1PW1 A;  2Y2G A;  4GD6 A;  3WRT A;  4EUZ A;  1W8Y A;  3UMD A;  4G3W A;  4O7D A;  1IYS A;  4FUW A;  2XH9 A;  3OC2 A;  1I2S A;  3QP4 A;  5G4Z A;  2VV6 A;  2EA9 A;  4KZ5 A;  5EV0 A;  2DMW A;  4YFM A;  3MF0 A;  4EES A;  1P9R A;  5HW3 A;  4R38 A;  1ERO A;  2GNX A;  3A3F A;  3HJI A;  4JXV A;  3VMA A;  2XSS A;  4BEN A;  4ME4 A;  4O0P A;  2ZC7 A;  1NYM A;  3KO6 A;  5IHV A;  5EVI D;  4NEE D;  4RQ9 A;  1BT5 A;  1K56 A;  1FIK A;  3RFB A;  4G3V A;  2HP6 A;  1XGJ A;  3FYZ A;  3ZGA B;  3F1N B;  4CLC B;  1ZG6 A;  3R7W B;  2WK0 A;  2XDM A;  1MWU A;  3MXR A;  1UWP X;  1YLY A;  4JF6 A;  1TS0 A;  1L0F A;  3EGD C;  5M18 A;  4ZJ2 A;  4WUJ A;  2D01 A;  1PI5 A;  2C5W B;  2PYR A;  1L2S A;  1YT4 A;  5TJJ A;  5DVA A;  5EUA A;  3ZG0 A;  2L1M A;  1GSV A;  4DMZ A;  5TFQ A;  4E04 A;  5CHU A;  3W4O A;  4HJ6 A;  2Y2K A;  2JCH A;  5KSC A;  5FI2 A;  3T1S A;  5A91 A;  4BQM A;  3FG8 A;  4KQD A;  1IYO A;  1F5M A;  3C7U A;  4MBK A;  4JKT A;  3K3D A;  2EX2 A;  4OOM A;  4B93 A;  5L10 A;  2M1C A;  2WGW B;  4HNB A;  4OPZ A;  5AJG A;  4GJ4 A;  1KE0 A;  4Y0U A;  1ES4 A;  5MC7 A;  3S1Y A;  3LGO A;  2V9A A;  4HH3 A;  4EBL A;  3UE0 A;  4P6B A;  4GZB A;  5HWT A;  5HAR A;  4EEU A;  1T1C A;  1XJ4 A;  3Q82 A;  4YOF A;  3BLM A;  5EM1 A;  1NZU A;  4B88 A;  5A8B A;  4ZRR A;  5DTS A;  3DTM A;  3UB8 A;  2EXA A;  1XGI A;  3OBF A;  2JBF A;  3B3X A;  1TS8 A;  3LIE A;  4ZJ1 A;  2OWH A;  1PWG A;  3V67 A;  1YLW A;  2G2U A;  5C5K A;  2V0U A;  4XXR A;  4HY8 A;  1X0O A;  1SDE A;  5EVE A;  4O8G A;  4Q0J A;  3RTY A;  2Y2I A;  3OOV A;  3LEZ A;  1TDG A;  4DRT A;  5FEG A;  1WYB A;  4UQI M;  3UPN A;  1J9M A;  3G35 A;  3BJN A;  3MFX A;  3WS1 A;  1K57 C;  1A0K A;  3V39 A;  3F1O B;  4Y0O A;  4ZTK A;  1K55 C;  3VFF A;  4YWZ A;  5TGF A;  3PHY A;  1HVB A;  3G32 A;  4K0W A;  4JBF A;  3V50 A;  4EXO A;  4F94 A;  1J3W A;  2H5S A;  3FV7 A;  2P7J A;  1ODV A;  4UHU A;  2K2N A;  1EWZ A;  4N92 A;  5CGW A;  4IHQ A;  2ZQD A;  1HD8 A;  5EOE A;  4HES A;  3LIA A;  1HTZ A;  3GVB A;  3D9Y A;  4HI4 A;  1QME A;  4NET A;  3BQA A;  3WRZ A;  2UWX A;  4PKY A;  1N9N A;  3A0V A;  1WE4 A;  3ZG5 A;  5E2G A;  1T19 A;  4I38 A;  3GRJ A;  3BYD A;  3PTE A;  4GOG A;  4WM9 A;  1G6O A;  1BZA A;  2PDR A;  4Y3I A;  1MY8 A;  5EM0 A;  1CK3 A;  4CLC A;  4DXB A;  2FH5 A;  4KZB A;  2ZL1 B;  1PZO A;  1CI8 A;  2HPB A;  3ITA A;  5GHY A;  2HZ5 A;  4ZDX A;  1XKZ A;  3E2K A;  5EVI B;  2P9V A;  4CQH A;  2KOI A;  1KOU A;  1N4O A;  1OTE A;  2YKF A;  2ZJ9 A;  4KG6 A;  2HP5 A;  3WS4 A;  3R4K A;  4B4X A;  3TSG A;  4PM8 A;  3HLC A;  1E3U A;  4BJP A;  3W8K A;  4PHT A;  3IH8 A;  3FWL A;  4MEZ A;  5F6A A;  2E8J A;  3ZYT A;  5DFY A;  2JE5 A;  3CZD A;  1SCW A;  3SZT A;  4KZ4 A;  4LRY C;  3CLO A;  4DJ2 A;  2JC7 A;  4H6J B;  1KDS A;  2VEA A;  3N8L A;  1FSW A;  1K55 A;  3P01 A;  3T4S A;  4M3K A;  4EEP A;  2QHK A;  2Y2L A;  4OQG A;  4Z9Q A;  3CJM A;  1W63 Q;  2PHY A;  3H82 B;  3ICY A;  4LFU A;  1PIO A;  1F2K A;  3H7W B;  3IWI A;  4OP8 A;  2O9B A;  2IWD A;  4R3J A;  2M7V A;  4HQA A;  4IED A;  1CEF A;  1ACF A;  4DF6 A;  3M2K A;  3OCN A;  4LV1 A;  1H8Y A;  3ZCZ A;  1S4R A;  5CEC A;  3SS3 A;  2D02 A;  4E3L A;  3Q7V B;  5EE8 A;  1XXM A;  1VET B;  5AVE A;  3RXX A;  4UAA A;  3HBR A;  4PM6 A;  5CED A;  3U2A A;  2UV0 E;  3CIT A;  1PWD A;  4UQI S;  4WLA A;  4K08 A;  1MKM A;  1PI4 A;  3G6O A;  3K2N A;  4X25 A;  3AGD A;  3OPR A;  1LLB A;  1YLZ A;  3C8C A;  1SDN A;  4DJ3 A;  2WKH A;  3PAG A;  2XQZ A;  4F3L A;  5CTN A;  5CGX A;  1ESI A;  4BD1 A;  4R70 A;  3T4O A;  3B47 A;  2HV1 A;  5CGS A;  2PU4 A;  4GS9 A;  3S7P A;  3BW6 A;  1W7F A;  3L7H A;  1K0K A;  3HLD A;  4RX3 A;  1JWZ A;  5G4Y A;  4R4S A;  3HJK A;  5HZH A;  4S2N A;  4LEN A;  1PFL A;  2JKF A;  3HLG A;  4E6W A;  3FPW A;  2E8I A;  1VB6 A;  1V9Z A;  2B5R A;  4QY6 A;  2W1T A;  4GHI A;  2ZQA A;  3FKW A;  3VP2 A;  5AQB A;  3IHB A;  1VEU B;  2X01 A;  4FH2 A;  3CMZ A;  4S2O A;  1YLJ A;  5HAP A;  1MZU A;  3TRC A;  1K6R A;  3C2W A;  1E4D A;  1NLY A;  4LCL A;  5HDS A;  4DE2 A;  3ZNY A;  2WUQ A;  4M4X A;  2V8C A;  5FEF A;  4Y7P A;  1TS7 A;  2KLI A;  4HOI A;  4MLL A;  1CI9 A;  2JKR I;  5G18 A;  4OQH A;  3ZFZ A;  1BLP A;  4BLM A;  3CWF A;  2ZM8 A;  3V3R A;  1DP8 A;  4QY5 A;  5FDS A;  4ZBE A;  3EQV A;  4NXE A;  5F83 A;  4FH4 A;  4HEF A;  1TVF A;  5DF9 A;  4EBN A;  4UA7 A;  2HJE A;  3UDX A;  4FTX A;  3UE1 A;  1ALQ A;  2JHE A;  1RGZ A;  2XR0 A;  2OV5 A;  4FOF A;  2HDU A;  3RJU A;  3BLS A;  1S1Y A;  4D2O A;  2ZOI A;  3N8S A;  2PYP A;  1PWC A;  1DRM A;  1Z09 A;  5E2H A;  4C6Y A;  1K54 A;  5FAO A; 
#chains in the Genus database with same CATH homology
 3MMH A;  5DJT A;  2A24 A;  3UE3 A;  3BWL A;  2W1T B;  4GHI B;  5TJJ A;  3BQ8 A;  4NKP A;  2VLG A;  3H82 A;  4MN6 A;  2LB9 A;  1H8M A;  2L1M A;  2VV8 A;  1GSV A;  1YKD A;  5J3W A;  3TJZ C;  4DMZ A;  4E04 A;  4EQ1 A;  2W0N A;  2W3F A;  3A0R A;  4HJ6 A;  2ZBB A;  1V9Y A;  3F1O A;  4I3I A;  4JGP A;  4L9F A;  2B18 A;  4OOL A;  3FG8 A;  3P7N A;  3PBQ A;  3T4Q A;  4KQD A;  4Y5F A;  5CX7 A;  1F5M A;  5F69 A;  1GSX A;  2R78 A;  2FZ0 A;  2V0W A;  4EW7 A;  1XFN A;  2XRO A;  5DKL A;  3K3D A;  2YKH A;  4OOM A;  2OAP 1;  4NXG A;  4B93 A;  2ZMV A;  3LIC A;  2M1C A;  2W3E A;  4HNB A;  1ZTU A;  5KSH A;  3NOT C;  4Q0I A;  5AJG A;  4GJ4 A;  4ARZ B;  3E0Y A;  3K3C A;  5HSQ A;  1OJ5 A;  4B9O A;  5MC7 A;  4BMW A;  2J3W A;  2W3G A;  4IJG A;  3IS2 B;  4CLC E;  2V9A A;  3FPV A;  4HH3 A;  5I5L A;  2B02 A;  5HWT A;  4EEU A;  1T1C A;  1XJ4 A;  3F1P B;  4YOF A;  1S67 L;  4Y2F A;  2QJ7 A;  4UEY A;  5LBR A;  3GEC A;  3IBR A;  5A8B A;  4ZRR A;  1P9W A;  2VJW A;  4EET B;  3UB8 A;  3OBF A;  3UB7 A;  1TS8 A;  5HDC A;  5IU1 A;  4IUH A;  5FL3 A;  3LIE A;  2OWH A;  3V67 A;  4EER A;  5C5K A;  2W1R A;  3TE8 A;  1GSW A;  2V0U A;  3KX0 X;  4HY8 A;  3VOL A;  3CI6 A;  3CUE A;  4P6Z M;  1X0O A;  1NWZ A;  3PXP A;  4WL9 A;  4XT2 B;  4O8G A;  3JVU A;  4Q0J A;  2VA0 A;  2HGV A;  3RTY A;  5DJU A;  3OOV A;  4HJ3 A;  4GCZ A;  4JGO A;  1OTA A;  2A24 B;  3IBJ A;  1P97 A;  2WKP A;  4DN0 A;  4UQI M;  4JGR A;  2HJ9 C;  2KDK A;  4NXB A;  2NUT C;  3BJN A;  2EWV A;  3CUE C;  3MFX A;  3HCY A;  3CAX A;  3F1O B;  1S1Z A;  3LR4 A;  4YWZ A;  2O99 A;  2I9V A;  3PHY A;  4YNR A;  4ETX A;  3FC7 A;  2MJ6 A;  4EXO A;  1T1A A;  1OJG A;  3MJQ A;  4EUV A;  2P7J A;  3C30 A;  1DP6 A;  1ODV A;  4P6Z S;  2QJ5 A;  2K2N A;  3KSG A;  2ZOH A;  3OCL A;  1LL8 A;  4IHQ A;  1LSW A;  5DKK A;  1XJ6 A;  4H6J A;  3EEH A;  1DP9 A;  2VX8 A;  4HH2 A;  3T4J A;  3UE6 A;  3KSH A;  4BBV A;  4II7 A;  2VGL M;  2PD8 A;  2Z6D A;  5HL6 A;  5KIZ A;  3LIA A;  2V1B A;  5AVF A;  3DBA A;  4HJ4 A;  3E4O A;  1LSV A;  2ZMF A;  3H7W A;  1NLZ A;  3E4Q A;  4HI4 A;  3EWK A;  3BQA A;  3PBN A;  4AFI A;  3EEA A;  4MN7 A;  4PKY A;  2OOL A;  4MCW A;  2HF6 A;  1N9N A;  3SW1 A;  3A0V A;  1D06 A;  5EFW A;  2Z6C A;  2VZW A;  1G28 A;  2BAS A;  2J80 A;  2PR6 A;  1T19 A;  4I38 A;  3NHQ A;  5IT5 A;  3KSI A;  1G6O A;  4LPZ A;  3MQO A;  2PDR A;  4Y3I A;  2J3T D;  4CLC D;  3S7O A;  3GDI A;  4LLO B;  2JN7 A;  4CLC A;  1JNU A;  4HP9 A;  2FH5 A;  1T18 A;  4R3A A;  1OPX A;  4Q0H A;  1XJ2 A;  4WF0 A;  3S7N A;  3E4P A;  4WEK A;  3S7Q A;  2W3H A;  3D72 A;  2A2L A;  1XFQ A;  3VV4 A;  2J3T C;  4CLC C;  4L9G A;  4QPR A;  2W3D A;  3BY9 A;  4MMN A;  4CQH A;  3PBR A;  2OWJ A;  2QYB A;  2YKF A;  1KOU A;  1OTE A;  2KOI A;  2QKP A;  1IOU A;  3MQ0 A;  3H9W A;  4LRZ E;  4R6L A;  3NJA A;  4KUK A;  4MN5 A;  3R4K A;  2EWW A;  5HWV A;  1S66 L;  3PBT A;  3EOI A;  2L4R A;  2WKQ A;  4MDZ A;  2PT7 A;  4BJP A;  2NUP C;  2P08 A;  4PHT A;  5F6A A;  1EW0 A;  5TBM A;  3E98 A;  2JKT M;  3ZYT A;  1UWN X;  1OTB A;  5DFY A;  1W63 M;  2H28 A;  1N9L A;  1YSP A;  3VE3 A;  4I5S A;  4L0L A;  4HIA A;  3CLO A;  4LRY C;  4DJ2 A;  1F9I A;  4H6J B;  2VEA A;  3T4S A;  3P01 A;  1P0Z A;  4KQO A;  4EEP A;  2WKR A;  2QHK A;  5HPI A;  2V1A A;  3UB6 A;  5HD5 A;  1OT9 A;  1W63 Q;  2PHY A;  3H82 B;  3ICY A;  3H7W B;  2O9B A;  2M7V A;  4HQA A;  3RH8 B;  2O9C A;  1NRJ A;  3A0S A;  3T4K A;  2XA7 M;  3T50 A;  3OCN A;  3LR3 A;  4G3K A;  1BYW A;  5HD3 A;  1S4R A;  3MQQ A;  4IUK A;  2D02 A;  3PYP A;  5J7E A;  4NXF A;  1IFQ A;  3PBO A;  4FSF A;  2CMN A;  5AVE A;  5J4E A;  2GZA A;  2XRN A;  1TF1 A;  3LIB A;  1YAX A;  5DFX A;  5HDD A;  3U2A A;  5HPF A;  3LR0 A;  4WN5 A;  3CIT A;  4UQI S;  4I3J A;  3W2Z A;  1S4S A;  4WLA A;  3NOP C;  2M7U A;  4K08 A;  2Y79 A;  1ZHH B;  1MKM A;  2O9A A;  3LI8 A;  3KYQ A;  4JGQ A;  1F98 A;  3T4L A;  3G6O A;  3K2N A;  5HWW A;  1STZ A;  1TD5 A;  3LI9 A;  2JKT I;  3LID A;  1Y28 A;  2OAQ 1;  4GW9 A;  4XT2 A;  3ULF A;  3C8C A;  3EQU A;  4EU0 A;  4DJ3 A;  2PR5 A;  3KSF A;  3LUQ A;  4F3L A;  5F5Y A;  2QWS A;  4R70 A;  1LT0 A;  1TS6 A;  3T4O A;  3B47 A;  1OT6 A;  2G7U A;  4BWI A;  2JKR M;  3F1N A;  4Z1W A;  5TBM B;  2HV1 A;  4GLQ A;  1H3Q A;  1LSX A;  2VGL S;  3R7W A;  2INW A;  4GS9 A;  3S7P A;  3JVV A;  3TW8 A;  3BW6 A;  5K5B A;  4BBU A;  3T4T A;  5L8M A;  4I3A A;  5G4Y A;  3ZQ5 A;  3B42 A;  3UB9 A;  3HJK A;  2P04 A;  3LR5 A;  5HZH A;  3PBS A;  2PD7 A;  2O0Y A;  3FPW A;  1VB6 A;  1V9Z A;  2W1T A;  4GHI A;  3LFV A;  4BBT A;  3C38 A;  3UMD A;  5F68 A;  4G3W A;  3UME A;  2GX5 A;  1XJ3 A;  4ETZ A;  1N9O A;  1D7E A;  1MZU A;  3LYX A;  3OC2 A;  3TRC A;  3EGX C;  3C2W A;  3NOU C;  5G4Z A;  1NLY A;  2VV6 A;  3MR0 A;  2EA9 A;  2DMW A;  2IA2 A;  5HDS A;  3MF0 A;  1OTD A;  4EES A;  3B33 A;  1P9R A;  4M4X A;  2VV7 A;  2Y8H A;  4R38 A;  2GNX A;  3D3O A;  3O5Y A;  1TS7 A;  1YSQ A;  2LB5 A;  2KLI A;  4HOI A;  3HJI A;  2VKS A;  1MC0 A;  4ARZ A;  4O01 A;  2JKR I;  3BY8 A;  2XSS A;  4PKY G;  4ME4 A;  3CWF A;  3IS2 A;  4WEJ A;  4O0P A;  4WEL A;  3KO6 A;  3OLO A;  1DP8 A;  3LIF A;  4NEE D;  4RQ9 A;  2KX6 A;  3F1P A;  4I39 A;  4F3L B;  3EQV A;  1OTI A;  4NXE A;  4PAU A;  3KYZ A;  3RFB A;  3PR6 A;  2GJ3 A;  5DF9 A;  4G3V A;  2HJE A;  2L0W A;  2K7S A;  2JHE A;  3F1N B;  4CLC B;  3MXQ A;  3R7W B;  3VE4 A;  4FOF A;  1WA9 A;  1UWP X;  4GS9 B;  4HP4 A;  1S1Y A;  1VHM A;  1UGU A;  2ZOI A;  4L9E A;  1T1B A;  1TS0 A;  5IS1 A;  2XA7 S;  4KUO A;  2PYP A;  3EGD C;  2W27 A;  4WUJ A;  1DRM A;  2D01 A;  2K31 A;  4HHD A;  4LRX C;  2PYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...