4G3KA

Crystal structure of a. aeolicus nlh1 gaf domain in an inactive state
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
170
structure length
155
Chain Sequence
b'DLKVEIETLYEVSKILSSSLNLETTVPYIFRLLKKLMGFERLTLTIYDPSTDQIVVRATSSGKFPKEGFKKGEGITGKVWKHGVPIVIPDISQKKIAFIAVPIKSGGKVIGVLSADKEINEKDSLDEYTRFLSMIATLIANSFSLERKVQAERKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator nlh1
molecule tags Transcription regulator
source organism Aquifex aeolicus
publication title Structural mechanism of GAF-regulated delta(54) activators from Aquifex aeolicus
pubmed doi rcsb
total genus 39
structure length 155
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4g3kA00
4R70A 2OOLA 2O0YA 3MMHA 3IBJA 5K5BA 3KO6A 2VKSA 3NOTC 4LRXC 2VJWA 4FOFA 4G3VA 3CITA 1TD5A 3LFVA 3NOPC 3S7NA 3KSFA 2XRNA 2O9CA 5DFXA 3IBRA 3KSHA 2O9BA 3EEAA 5C5KA 4EU0A 1TF1A 3O5YA 4QPRA 2VZWA 1F5MA 3HCYA 1VHMA 3S7QA 4O8GA 2KOIA 2W3HA 4CQHA 5HPIA 2QYBA 5TJJA 4BWIA 4Q0IA 4GW9A 5L8MA 4DN0A 4Z1WA 3C2WA 4DMZA 2W3FA 4R6LA 2W3EA 2O99A 3E98A 1MC0A 3D3OA 2ZMFA 4LRYC 4ZRRA 2K2NA 5HPFA 2W3GA 4E04A 4Q0JA 2GX5A 3MQ0A 4MCWA 4ME4A 1ZTUA 4O0PA 5HSQA 4IUKA 2W3DA 3DBAA 4LRZE 2B18A 4Y5FA 2O9AA 1YKDA 3OBFA 4G3KA 4EUVA 2LB5A 3RFBA 1YSPA 2XSSA 2Y8HA 4MDZA 4Y3IA 3S7PA 4Y2FA 2LB9A 5AJGA 3S7OA 1MKMA 4O01A 4PAUA 2IA2A 3BJNA 3K2NA 4Q0HA 2M7VA 3MF0A 3TRCA 1YSQA 3KSIA 3W2ZA 5HL6A 2K31A 3OOVA 3ZQ5A 2W1TA 4IJGA 2W1TB 4MMNA 4G3WA 5I5LA 4ETXA 2VEAA 4YOFA 4RQ9A 3KSGA 2HGVA 4YNRA 3E0YA 4IUHA 3NOUC 3R4KA 2W1RA 4ETZA 5DFYA 2Y79A 4MN7A 1STZA 3VV4A 2G7UA 2XROA 3CI6A 4GLQA 2KLIA 2M7UA 3G6OA 3NHQA 5LBRA
chains in the Genus database with same CATH superfamily
2HP9A 5A92A 4BD0A 4LENA 4R3JA 1S66L 1VEUB 1IEMA 3KSFA 3ZG7B 1JWPA 5DFXA 5M1AA 3E4OA 1GSVA 3CZDA 3IWOA 5FASA 1ALQA 1LL9A 3BFEA 1VM1A 3OPHA 4R38A 4OQHA 3LUQA 3T4TA 1BYWA 3KYEA 4CLCE 3T4LA 1MY8A 2HF6A 5HL1A 5HWVA 5FAOA 4OP8A 4N1HA 5F5YA 2FZ0A 4LRZE 1MPLA 5DF8A 5EPHA 4S2NA 4Y3IA 2WGVA 3IF5A 4O01A 2ZL1B 5F1GA 3L7HA 4S2LA 3JVVA 2Q9NA 1PW1A 3TRCA 2A24B 2PAVP 3HLFA 4WMCA 4WZ5C 3SZTA 5CHJA 1I5QA 4PKYG 2L4RA 4LLOB 4OLGA 3LICA 4ETXA 4YOFA 5GHZA 2WGIA 3KSGA 1VEUA 2J3TC 5AQBA 2WK0A 2QJ5A 2FFYA 1XP4A 1HVBA 4JF5A 4EERA 5AQ9A 3T1XA 4GDNA 3BFGA 1V9YA 4FH2A 4R70A 4LFUA 4OONA 4Z9QA 3IBJA 4R1GA 1ZHHB 2XD1A 4IEDA 4BBUA 4CLCB 1PWGA 2GZAA 2ZM0A 2GJ3A 1Q2PA 4KENB 3KSHA 4QB8A 1HD8A 2HZ5A 1OT6A 4LGWA 4LCMA 3O87A 4DDYA 4OQ0A 2KOIA 4S2JA 3C8CA 3QNCA 4MN5A 2V1BA 1N9BA 1OTIA 5L10A 3FPWA 5IT5A 5EM0A 4DN0A 1T1AA 4HQAA 5HW3A 2E8JA 3C7VA 3B3XA 4GZBA 5EVIC 1W8YA 5CERA 2E8IA 4F3LB 2A3UA 2BLSA 3W4OA 3BYDA 5FEGA 4X53A 1H8ZA 2XD5A 1W63Q 2Y4AA 3BRMA 3IWIA 2XK1A 3IS2B 2GDNA 4Y0TA 4E6WA 1IFQA 4PPRA 3ZCZA 5DTSA 2Q9MA 4EEPA 3IF6B 3RJUA 2PRFA 2Y91A 3P01A 3UB8A 3Q7VB 2JC7A 5KSCA 1ZC2A 4KZ8A 2Y55A 3FG8A 1K25A 1PIOA 1NLYA 4FSFA 3R4KA 4Q8IA 2V1AA 3ZHHA 4MEZA 2FFFB 3TOIA 4C75A 4S2OA 3M2KA 4OKPA 4F3LA 3PBRA 3SS5A 5EOEA 2PD8A 4NK3A 3ZG9B 3I7JA 3H9WA 5FI6A 2VJWA 3VP3A 3MXSA 1ACFA 2JBFA 2NUPC 1MZUA 2WUQA 2XQZA 2EWWA 4X69A 2VA0A 3C7UA 2WKEA 4EW7A 3IX4A 2IWBA 3LIAA 2ZJ9A 1S4RA 1ZG4A 4B4XA 2W3HA 2EA9A 3DTMA 4GN2A 5EECA 3MBZA 5L8MA 1V9ZA 1PI4A 3V39A 4KZ4A 3GR2A 4ZRRA 5HPFA 3BQ8A 2EX9A 1TS8A 4P6ZM 5GHYA 2OLVA 1YLYA 4DKIA 3BECA 3IWQA 3FC7A 4P87A 2HPBA 5DTKA 1VB6A 2LB5A 3BW6A 2XSSA 4PM8A 1KGGA 4Y2FA 3NC8A 3OCLA 1HTZA 4K91A 5FSRA 5CGXA 4EWFA 4GHIB 4JF4A 1XX2A 1FR1A 3HVFA 4Y15A 1KGEA 3NCKA 1OJGA 5DF9A 4WMCD 1MWRA 3F1OA 3ZG5A 3HJKA 4ETZA 2H5SA 3VP0A 4EEUA 1AWIA 2XEPA 1BTLA 3UDXA 3MMHA 2JKRM 1TEMA 3ZFZA 2K7SA 5FQJA 5EVID 4HBUA 3NOPC 4NXBA 2DNSA 2O9CA 2ZC6B 4HNBA 1WYBA 5GL9A 2Y2GA 4WBGA 5J4EA 5CHMA 5TBMB 2PR6A 2XDMA 4CQHA 2QYBA 3CLOA 4PM7A 2HV1A 4OPQA 1DP6A 1LSVA 1WE4A 3DTKA 4JGPA 5FDSA 2VV6A 4H6JA 1OTAA 3D72A 1GA9A 3VFFA 2W3GA 2V0UA 5EV0A 3CUEC 1RGZA 3U2AA 3KYQA 3MQ0A 1TS7A 3IX3A 1CQAA 3UE0A 5JYPA 3UN7A 5DVAA 4EUVA 3BY9A 4N9KA 4E3NA 5CEBA 2A2LA 4HOIA 1PWCA 4NXEA 3K2NA 3TG9A 4DE0A 2HDUA 2M7VA 1YSQA 1F2KA 4OLDA 4IJGA 1T19A 2WYXA 3CMZA 2ZMAA 3A3JA 1OTDA 4IUHA 4X68A 4WL9A 3BQAA 1WA9A 3HJIA 1MBLA 1DJBA 2BTFP 1FCNA 4KQQA 4IBXA 3SS3A 1Z6FA 2PR5A 3H82A 2YKHA 4HJ3A 2A24A 3B47A 2VX8A 4XT2B 3LCEA 4HJ4A 3ZYTA 4F94A 2BG1A 3OC2A 1GA0A 3IHBA 2WKIA 3MR0A 2VKSA 3NOTC 1S4SA 4N9LA 1OJ5A 3O88A 1G5UA 2VGLM 4IVIA 3IBRA 2EWVA 5EFWA 3V3RA 4EU0A 1JTDA 2VV8A 3Q81A 5HD5A 3VSLA 5J3WA 3FPVA 3HREA 2QKPA 4E3IA 1SCWA 3G31A 1TS6A 1U60A 5DTTA 5FAQA 4JPMA 2EFXA 3D3OA 3LY4A 2J8YA 4BBTA 5KSHA 4GOGA 4O0PA 2XFTA 3BY8A 2WGWA 4P6ZS 3HUNA 2J80A 3ZG0A 2O9AA 4X1LA 2FH5A 3DW0A 2IA2A 3TJZC 4IVKA 3UE6A 1BLPA 5L07A 3D9YA 3OPLA 2Y2MA 4PM9A 4PHTA 2EXAA 1ODVA 1KE3A 3OOVA 2X02A 2OAQ1 2WKRA 3IXBA 2ZQ8A 4GS9A 4ZJ2A 1EI5A 3S1YA 4HJ6A 3NOUC 4CLCC 3F1NA 1LI0A 3LIDA 3MQQA 4OOYA 5EE8A 3ITBA 3QP6A 4ARZA 4XUXA 5U47A 2XH9A 4K0WA 3VE4A 3BEBA 5F82A 2JKTI 3CJMA 4GCZA 3QHYA 1ESIA 3SOIA 2VV7A 4ZJ3A 3ZGAB 2JKRI 2PD7A 4UA6A 4JXGA 2P9VB 3T4QA 1NWZA 4NKPA 4LV2A 5HDDA 2A49A 4JGQA 1F5MA 1E3UD 4S2MA 2QHKA 4HP9A 2HDSA 3EQVA 3F1PA 5TR7A 4Z1WA 2W3FA 5FQ9A 4E3OA 2ZMFA 4LRYC 2IWCA 5EOOA 1GHIA 3K3DA 4R0QA 2I9VA 4ME4A 4JGOA 1ZTUA 3QP4A 4OP5A 5BOHA 1D06A 1J9MA 3GQZA 2PYPA 4KUOA 5G18A 4AFIA 4ZDXA 3RFBA 4RA7A 2PYRA 1Y54A 4MBHA 3S7OA 3VP2A 3T4JA 3Q07A 2L1MA 3DWKA 4M4XA 2RL3A 2XFSA 4HH3A 2XA7S 5TGFA 5F1FA 2HP6A 1EW0A 5M19A 1YMSA 1ONHA 4KZ5A 1M40A 1K55C 1A0KA 2VK3A 3ZNYA 2QJ7A 3H82B 2KLIA 2Y2NA 1M6KA 5DJTA 1K4FA 5HAQA 1KOUA 3N4IA 4GHIA 3MSHA 3UPPA 1K0KA 5HAPA 3G2ZA 4L0LA 3WS4A 3NULA 3S7NA 3UPNA 4B88A 3QP2A 5A91A 4FD8A 4MBKA 3IXDA 1K38A 1FIKA 1K54C 1LSXA 3SH9A 4QPRA 1OT9A 4RVAA 4NG2A 3NI9A 4HH2A 2EXBA 2XLNA 3H7WA 4L9EA 2Y2QA 1JNUA 4ZTKA 5TJJA 3T1SA 1NYYA 1AXBA 5EM1A 3WS0A 3UDIA 3IS2A 4CJNA 3PAEA 3EGDC 2ZC4B 1MKIA 3T4SA 4E04A 1NZUA 1K55A 5AVEA 3MKEA 3DWZA 5FI7A 3IQAA 5HSQA 1FSWA 1MXOA 1ZG6A 3OZHA 3SS4A 2Z6CA 3A3DA 1YLJA 1CI9A 1TDLA 3M2JA 5FQMA 4NETA 4PM5A 3EQUA 4YWZA 4BL2A 1KE0A 3IXGA 3FWLA 5DKKA 5I5LA 3JPUA 3PBOA 2V20A 3EEHA 4QWOA 4YINA 2W27A 2HJ9C 2G7UA 1XJ4A 3G6OA 4NEED 3ZDJA 1OTEA 1RCJA 2M1CA 3H7WB 2VGKA 3G4PA 5KIZA 1G6AA 5HWTA 4C6YA 3HLGA 2X71A 3LO7A 4UA9A 3W8KA 1XKZA 4DE1A 3V3SA 5A93A 3HCYA 1ONGA 5D3OA 4UEYA 3SH7A 3PBQA 1IYPA 4QHCA 4BWIA 4WN5A 1DJAA 3VFHA 4S2PA 2AVXA 4MBFA 4B93A 4H8RA 1MC0A 4S2IA 4LV3A 4OVDA 2V8FA 4Q0JA 1J3WA 3UB9A 1SDNA 3JVUA 2B95A 3TW8A 4QY5A 4ZBEA 4KG2A 2W3DA 2W0NA 4B9OA 4GJ4A 2QWSA 2Y8HA 4L9GA 4DXCA 1FILA 2ZQDA 4UA7A 3N8RA 1L3LA 3WRZA 3S4XA 4JBFA 1NYMA 3C30A 1FCMA 4CLCA 1T1BA 2B5RA 4KZ9A 3ZG8B 5AQAA 2HDQA 2Y2LA 1NY0A 5AVFA 4N92A 4BENA 4LCLA 1K56A 2ZC5B 4X1MA 1IYOA 4IBRA 3TE8A 2H28A 1TF1A 1GHPA 1TVFA 1SZVA 2Z2MB 2O0YA 5G4YA 4UQIM 2Y2JA 2ZOIA 1OPXA 2JHEA 4KQDA 4MN6A 3CITA 2VLGA 1BLCA 4Y0UA 2X01A 5J8XA 3WS2A 3GV9A 3GRJA 3ICYA 5F68A 4IHQA 4X56A 2PBYA 3PXPA 2VGLS 4NXGA 3N8LA 3O5YA 4LV1A 2BASA 1K56D 5CTMA 3GVBA 2PU4A 1TDGA 3CPTB 2NUTC 4GW9A 4DMZA 4R6LA 2ZM2A 1CI8A 3PBTA 3MXQA 2Q0OA 2OWJA 1BUEA 2P04A 4ZJ1A 2DMWA 2XR0A 4FUWA 3T50A 2B18A 4WZ4A 4HP4A 3C4PA 3OBFA 4G3KA 3PYPA 4BQMA 3PBSA 3CAXA 3IXHA 3LYXA 1E3UA 3IHAA 1XJ6A 3GTCA 3S7PA 1Z09A 3BJNA 3RTYA 5E43A 1GSWA 1FCOA 2D01A 5M18A 4DRTA 1XFQA 2Y2HA 5TBMA 5FL3A 1CEFA 1L0DA 4GS9B 3SH8A 5HFOA 5GLDA 1G6OA 1KVMA 4UHUA 1UGUA 1FSYA 3R7WA 2JKGA 3R7WB 4S2KA 2DRWA 5A90A 2Y2KA 4R4SA 2QMIA 5KZHA 4I5SA 3W4QA 4EV4A 4EQ1A 5L09A 3HBRA 4U0XA 2IWDA 1KE4A 1L0EA 4LRXC 1S1ZA 3HLBA 3UNWA 5G4ZA 1I2WA 3E4PA 4RYEA 1CK3A 1TD5A 4WZ5A 3P7NA 3NY4A 1JWVA 4L9FA 2J9PA 4OQGA 5GLBA 1NRFA 2OV5A 3VOZA 1IYSA 4EBNA 2B02A 5E2FA 3LIEA 1VQQA 1PW8A 4D2OA 1GHMA 1H8YA 3CHWP 4O8GA 5TFQA 3RXXA 3WS5A 2P74A 3GMWA 3LY3A 1PZOA 1L2SA 4WYYA 4DE2A 3ZVWA 1YMXA 4K08A 1YM1A 5FQKA 3T12B 1CJFA 5I94A 2GX5A 1KVLA 1HLUP 2P08A 2HP5A 4K0XA 3BLSA 5FQQA 5CHUA 4BD1A 1MWSA 1KDWA 3N6IA 1P9WA 3DAVA 4XUZA 2QPNA 3NBLA 1YLTA 5AJGA 1K4EA 4GNUA 3PTEA 3O86A 1S67L 2RCXA 3KSIA 3MZFA 2ZD8A 1MWTA 2ZM8A 1X0OA 3UB6A 2HGVA 2G2WA 3VE3A 2HDRA 1JWZA 3G2YA 3WS1A 1QMFA 2R78A 1UWPX 2JCHA 3PHYA 3GECA 1RP5A 1W7FA 1Q2QA 4KZBA 2V8CA 4JKTA 3T4OA 1W79A 1NLZA 4JXVA 1XJ3A 4UQIS 4Y0OA 3ULFA 2V1ZA 4E3MA 4DDSA 3FYZA 1BSGA 4R3AA 4WLAA 3WRTA 2ZOHA 5HDSA 1IELA 3HUMA 4FTXA 4E3LA 1DRMA 3SW1A 1IOUA 3V5MA 2XGNA 4KQOA 4QD4A 1DP9A 4FH4A 3LIFA 4P85A 1P0ZA 1PYYA 2JKTM 1JVJA 1F98A 5E2EA 4B4ZA 3RXWA 4EETB 1YSPA 3LGOA 4OPYA 3Q1FA 1OMEA 3VSKA 1NJ4A 4JXSA 4Y17A 5IS1A 1D7EA 2WAFA 4WELA 2PU2A 1K54A 3ZQ5A 4BBVA 1L0GA 4G3WA 3HLWA 1NRJA 3VMAA 4DXBA 5F69A 5AQ7A 3KX0X 3VP1A 4MNRA 1XA1A 4WEJA 5JYOA 2XROA 1KGFA 1PWDA 3M6BA 2M7UA 1SKOB 5F6AA 2OOLA 1FR6A 5IU1A 2EX6A 5HARA 5CEDA 2CC1A 3OPRA 4OOLA 5DJUA 2Y59A 1LL5A 3MS6A 2XRNA 3HLDA 3T1QB 3EEAA 4D60A 3P98A 3WWXA 3RH8B 2VZWA 3BFFA 4Y13A 1CEGA 4P6BA 5FEFA 5EVLA 3B42A 1L0FA 2L0WA 3EGXC 3C2WA 2WKQA 2VGJA 1LT0A 3CUEA 1BULA 2G2UA 2ZLYA 3NECA 2OSUA 3MZEA 5FATA 2UV0E 1T1CA 1F9IA 5CECA 4A5RA 1EWZA 3LR4A 4GB7A 1PNEA 1YLWA 3O3VA 2ZQAA 1MKMA 1S1YA 4ARZB 4PM6A 4GKUA 1G68A 1K6RA 2WKPA 2Z6DA 1O07A 5DF7A 5E2GA 4UAAA 5CGWA 1BT5A 1W63M 2W1TA 1SHVA 3PR6A 3LEZA 5HDCA 3Q7VA 4M3KA 5EVIA 4RX3A 4NXFA 3VP4A 3VOLA 3BFDA 4DJ2A 1H0MA 4O7DA 4WUJA 3ISGA 3DTEA 5HAIA 4I39A 2Y79A 4II7A 1FQGA 3VV4A 1PRQA 1P97A 3UDFA 4BLMA 3NHQA 4QY6A 3V67A 4I3IA 3GSGA 2HJEA 2H10A 3IH8A 2XF3A 2J3TD 5E2HA 2GNXA 4ESPA 5J7EA 3MFXA 4MLLA 2WAEA 2INWA 3F1OB 3NDGA 5FA7A 4EQIA 4JF6A 3LR0A 1ERQA 1T18A 5EUAA 1ZKJA 1S6RA 4R4RA 4KZ7A 4PKYA 5CGSA 2P9VA 3E98A 4CPKA 4HHDA 3LEQA 1LL8A 2K2NA 4EUZA 4S2NC 4X6TA 1N9LA 5HX9A 3T1RA 3NJAA 4MCWA 3W4PA 2Z2LB 3OPPA 1OTBA 4XXRA 3OCNA 2J7VA 2QZ6A 2V0WA 2ZC3B 2J3WA 3F1PB 1YKDA 4DE3A 3GDIA 4C3QA 3A3EA 1YQSA 3N7WA 1BLHA 4EXOA 4QU3A 4HI4A 3QNBA 2UWXA 3L9KA 4QJGA 3HLCA 2ZQCA 4RX2A 3MF0A 4KG6A 3FKVA 5FDHA 2JKFA 4KZAA 1DP8A 2VEAA 2ACGA 4WEKA 4DJ3A 1ES5A 3C38A 3BM6A 1Y28A 4EBPA 4EESA 2ZQ9A 2W1RA 1LSWA 3LR3A 4MN7A 1SKFA 4U0TA 3CI6A 1ERMA 1SDEA 1PZPA 1N4OA 1TS0A 1SKOA 3S22A 1PFLA 4KG5A 5K5BA 2OWHA 1IKGA 5GLAA 1VETA 1G28A 5FQIA 4U3TA 2H0TA 4FCFA 4GD8A 2D02A 4R23A 3AGEA 3C4OA 4WM9A 1DJCA 1P9RA 3MXRA 5CX7A 5HPIA 1I2SA 1ES4A 4R3BA 3EOIA 1D1JA 3IX8A 1XPBA 3IH9A 1K6SA 5HZHA 1LLBA 4GDBA 1YPRA 2H0YA 4GD6A 2Y2PA 1EROA 3CWFA 3ITAA 1KDSA 3JYIA 4OH0A 4E3JA 3B33A 4IUKA 1H3QA 3NDEA 1XGJA 1NXYA 1BLSA 2OLUA 4I3AA 5L2FA 1XJ2A 3MZDA 3MKFA 2ZBBA 2ZQ7A 1H5XA 1IYQA 1BZAA 4Q0HA 1E4DA 3IF6A 5GHXA 1S0WA 3Q82A 3T4KA 2W1TB 4MMNA 3CG5A 2WKHA 4JLFA 1N9OA 1WYCA 3UO9A 3BWLA 4Y7PA 3N8SA 4HESA 2ZC7A 2C5WB 2PT7A 3KYZA 4KUKA 2Y2OA 5DFYA 1STZA 3A0SA 5EVEA 2Y2IA 2KDKA 1GCEA 4HBTA 2EX2A 4N1XA 1GSXA 4FOFA 4G3VA 3FV7A 5IHVA 3OLOA 4H6JB 1K57A 2CMNA 3UB7A 1E25A 1LHYA 4YFMA 1W5DA 3DTIA 3Q7ZA 4KZ3A 2EX8A 2PBDP 3G32A 5CTNA 2OAP1 3S7QA 3IT9A 2C6WB 2I72A 2EFUA 1Y4OA 3G35A 1YT4A 4HIAA 2JE5A 3UMDA 4JGRA 2W3EA 1LI9A 1DY6A 1XFNA 3C5AA 5HWWA 3UE3A 3HL9A 5MC7A 4X55A 2R9XA 3MQOA 4Y5FA 3UPOA 2V9AA 1HZOA 3QP8A 1FOFA 4MDZA 1YLZA 4WF0A 2LB9A 2ZL1A 4HY8A 4KQRA 2PHYA 4PAUA 4E3KA 4BMWA 1N9NA 2V2FF 3W2ZA 3UE1A 5HL6A 4OOMA 5FAPA 3FKWA 4RQ9A 4YNRA 3E0YA 3P09A 4X25A 5GLCA 4HEFA 1MWUA 4OPRA 1H8MA 1QMEA 1IKIA 3K3CA 4LPZA 4EBLA 2WGWB 2KX6A 5DKLA 3KO6A 4P0MA 4JXWA 5EVIB 3CPTA 2DCFA 5KMWA 3A0VA 3LFVA 5CRFA 3E2LA 3IF6C 3G34A 1ES2A 1XA7A 2O9BA 1ESUA 3BFCA 3E4QA 5C5KA 5A8BA 3A3IA 3AGFA 3A0RA 4BL3A 1VHMA 3E2KA 1UWNX 3PBNA 5CXWA 1NZOA 4I38A 3BLMA 3D4FA 3LR5A 4Q0IA 3QP5A 4OQIA 3F1NB 1JTGA 3AGDA 3A3FA 2O99A 3M6HA 2R9WA 3G30A 4BJPA 2ZMVA 1YLPA 3V50A 3UB5P 3VOYA 2WADA 4I3JA 5F83A 4LV0A 1O7EA 4ZAMA 3HUOA 5HD3A 3DBAA 1XGIA 1PI5A 1CF0A 3NIAA 4DF6A 2YKFA 1W8QA 5FI2A 3MFDA 3TSGA 1C3BA 1XXMA 4E6XA 2WZXA 1ES3A 2PDRA 3ZVTA 4OPZA 1RGYA 3EWKA 4PMAA 3MJQA 2K31A 3PAGA 1YAXA 2WZZA 2J9OA 3LI8A 1VETB 3ZNTA 3QP1A 4ID4A 2XA7M 2P7JA 3UMEA 3LI9A 3LIBA 4CLCD 2JN7A 4KZ6A 3U4LP 3UY6A 1K57C 3HLEA 3FZCA 4XT2A 4GLQA 2MJ6A 5LBRA
chains in the Genus database with same CATH topology
4HJ4A 3ZYTA 2O0YA 3OC2A 3V67A 4I3IA 5G4YA 2HJEA 3MR0A 2VKSA 2J3TD 3NOTC 4UQIM 1S66L 2GNXA 1S4SA 2ZOIA 1OPXA 2JHEA 4KQDA 4MN6A 3CITA 5J7EA 2VLGA 3MFXA 1OJ5A 3KSFA 2INWA 2VGLM 3F1OB 5DFXA 3IBRA 3E4OA 3ICYA 5F68A 2EWVA 4IHQA 5EFWA 1GSVA 4NXGA 3PXPA 2VGLS 4EU0A 3O5YA 2VV8A 2BASA 3LR0A 5HD5A 5J3WA 3FPVA 2QKPA 1T18A 4R38A 1TS6A 3LUQA 4PKYA 4GW9A 2NUTC 3T4TA 1BYWA 4DMZA 4R6LA 4CLCE 3T4LA 3E98A 3D3OA 4HHDA 3PBTA 1LL8A 2K2NA 3MXQA 2HF6A 1N9LA 5KSHA 4BBTA 3NJAA 5HWVA 2OWJA 4MCWA 4O0PA 2P04A 1OTBA 5F5YA 3BY8A 3OCNA 2DMWA 4P6ZS 2FZ0A 4LRZE 3T50A 2B18A 2J80A 2V0WA 2O9AA 2J3WA 4HP4A 3F1PB 1YKDA 4XT2B 3OBFA 4G3KA 3GDIA 3PYPA 3PBSA 3CAXA 3LYXA 4EXOA 1XJ6A 4Y3IA 3S7PA 4HI4A 4O01A 2FH5A 3JVVA 2IA2A 3BJNA 3TJZC 3UE6A 3RTYA 1GSWA 3MF0A 2A24B 2D01A 3TRCA 1XFQA 4PHTA 4PKYG 1ODVA 2L4RA 4LLOB 5TBMA 3OOVA 1DP8A 3LICA 5FL3A 2OAQ1 4GS9B 4ETXA 2WKRA 2VEAA 4GS9A 4YOFA 4WEKA 3KSGA 4DJ3A 4HJ6A 2J3TC 3C38A 3NOUC 1G6OA 1UGUA 4CLCC 2QJ5A 3F1NA 1Y28A 3R7WA 3LIDA 3MQQA 4EESA 3R7WB 4EERA 2W1RA 3LR3A 1LSWA 4MN7A 4ARZA 3CI6A 1V9YA 1TS0A 4R70A 4I5SA 4EQ1A 3VE4A 2JKTI 4GCZA 5K5BA 3IBJA 1ZHHB 2OWHA 2VV7A 4BBUA 4CLCB 4LRXC 1S1ZA 5G4ZA 1G28A 2GZAA 3E4PA 1TD5A 2JKRI 2PD7A 2GJ3A 3P7NA 3T4QA 4L9FA 1NWZA 3KSHA 2D02A 4NKPA 5HDDA 1TF1A 1OT6A 2B02A 4JGQA 1F5MA 3LIEA 2QHKA 4HP9A 1P9RA 4O8GA 2KOIA 5CX7A 5HPIA 3C8CA 3EQVA 2V1BA 4MN5A 1OTIA 3FPWA 3F1PA 3EOIA 5IT5A 4DN0A 4Z1WA 1T1AA 4HQAA 2W3FA 5HZHA 4K08A 2ZMFA 4LRYC 3K3DA 2GX5A 4F3LB 3CWFA 2I9VA 4ME4A 4JGOA 1ZTUA 3B33A 2P08A 4IUKA 1H3QA 1D06A 2PYPA 1W63Q 4KUOA 4AFIA 4I3AA 1XJ2A 3RFBA 3IS2B 2PYRA 1P9WA 1IFQA 2ZBBA 5AJGA 3S7OA 3T4JA 4EEPA 2L1MA 4Q0HA 1S67L 4M4XA 3KSIA 3T4KA 4HH3A 2XA7S 3P01A 3UB8A 2W1TB 4MMNA 1X0OA 1EW0A 3UB6A 2HGVA 3FG8A 1N9OA 1NLYA 4FSFA 3BWLA 3R4KA 3VE3A 2V1AA 3KYZA 2PT7A 4KUKA 5DFYA 1STZA 2QJ7A 2R78A 3A0SA 3H82B 4F3LA 1UWPX 3PBRA 2KLIA 3PHYA 3GECA 2PD8A 2KDKA 5DJTA 1KOUA 4GHIA 3H9WA 2VJWA 3T4OA 1GSXA 4FOFA 1NLZA 4G3VA 1XJ3A 4L0LA 3S7NA 3OLOA 4UQIS 4H6JB 2NUPC 3ULFA 2CMNA 1MZUA 3UB7A 2EWWA 4R3AA 4WLAA 2VA0A 1LSXA 2ZOHA 4QPRA 5HDSA 4EW7A 1OT9A 3LIAA 2OAP1 1S4RA 3S7QA 4HH2A 2W3HA 4L9EA 3H7WA 2EA9A 1JNUA 5TJJA 1DRMA 3SW1A 4HIAA 5L8MA 1V9ZA 1IOUA 3UMDA 4JGRA 3IS2A 2W3EA 3EGDC 4ZRRA 5HPFA 4E04A 3T4SA 1XFNA 4KQOA 3BQ8A 1DP9A 5HWWA 3LIFA 5AVEA 1TS8A 4P6ZM 1P0ZA 2JKTM 3UE3A 5MC7A 5HSQA 3MQOA 3FC7A 4Y5FA 1F98A 1VB6A 2V9AA 2LB5A 3BW6A 2Z6CA 4EETB 1YSPA 2XSSA 4MDZA 4WF0A 4Y2FA 2LB9A 4HY8A 2PHYA 4PAUA 5IS1A 4BMWA 1D7EA 1N9NA 3OCLA 3EQUA 4YWZA 4WELA 3W2ZA 5HL6A 4OOMA 3ZQ5A 4BBVA 4GHIB 5DKKA 4G3WA 5I5LA 1NRJA 4RQ9A 3PBOA 4YNRA 3E0YA 5F69A 1OJGA 3KX0X 3EEHA 5DF9A 3F1OA 3HJKA 2W27A 4ETZA 4WEJA 1H8MA 2HJ9C 2G7UA 4EEUA 2XROA 1XJ4A 2M7UA 3G6OA 4NEED 5F6AA 3K3CA 4LPZA 1OTEA 2OOLA 2M1CA 5IU1A 2KX6A 3MMHA 2JKRM 3KO6A 5DKLA 3H7WB 5KIZA 5HWTA 2K7SA 3A0VA 4OOLA 5DJUA 3LFVA 3NOPC 4NXBA 2XRNA 2O9CA 4HNBA 3TE8A 2O9BA 3EEAA 3E4QA 5C5KA 5A8BA 3RH8B 5J4EA 2VZWA 3HCYA 3A0RA 1VHMA 4UEYA 5TBMB 3PBQA 2PR6A 1UWNX 4CQHA 3PBNA 2QYBA 3CLOA 2HV1A 3B42A 4I38A 4BWIA 1DP6A 3LR5A 4WN5A 4Q0IA 1LSVA 4JGPA 2L0WA 3EGXC 3C2WA 2VV6A 3F1NB 4H6JA 2WKQA 1OTAA 4B93A 3D72A 2O99A 1MC0A 1LT0A 4BJPA 3CUEA 2W3GA 2V0UA 2ZMVA 3CUEC 4Q0JA 3UB9A 3JVUA 3U2AA 3KYQA 3MQ0A 4I3JA 1TS7A 3TW8A 2W3DA 5HD3A 3DBAA 1T1CA 2W0NA 1F9IA 4B9OA 4GJ4A 4EUVA 2YKFA 2QWSA 3LR4A 2Y8HA 3BY9A 4L9GA 2A2LA 4HOIA 1MKMA 1S1YA 4ARZB 4NXEA 3K2NA 2PDRA 2M7VA 1YSQA 3EWKA 2WKPA 2Z6DA 3MJQA 3C30A 2K31A 1YAXA 1W63M 2W1TA 4IJGA 1T19A 4CLCA 1T1BA 3PR6A 5HDCA 3LI8A 1OTDA 4IUHA 2XA7M 4NXFA 4WL9A 3BQAA 1WA9A 2P7JA 3UMEA 3HJIA 3VOLA 3LI9A 3LIBA 4CLCD 4DJ2A 5AVFA 4WUJA 2JN7A 2PR5A 4I39A 2Y79A 3H82A 2YKHA 4II7A 3VV4A 4HJ3A 1P97A 2A24A 3B47A 4XT2A 4GLQA 2MJ6A 2H28A 2VX8A 3NHQA 5LBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R70 A;  2OOL A;  2O0Y A;  3MMH A;  3IBJ A;  5K5B A;  3KO6 A;  2VKS A;  3NOT C;  4LRX C;  2VJW A;  4FOF A;  4G3V A;  3CIT A;  1TD5 A;  3LFV A;  3NOP C;  3S7N A;  3KSF A;  2XRN A;  2O9C A;  5DFX A;  3IBR A;  3KSH A;  2O9B A;  3EEA A;  5C5K A;  4EU0 A;  1TF1 A;  3O5Y A;  4QPR A;  2VZW A;  1F5M A;  3HCY A;  1VHM A;  3S7Q A;  4O8G A;  2KOI A;  2W3H A;  4CQH A;  5HPI A;  2QYB A;  5TJJ A;  4BWI A;  4Q0I A;  4GW9 A;  5L8M A;  4DN0 A;  4Z1W A;  3C2W A;  4DMZ A;  2W3F A;  4R6L A;  2W3E A;  2O99 A;  3E98 A;  1MC0 A;  3D3O A;  2ZMF A;  4LRY C;  4ZRR A;  2K2N A;  5HPF A;  2W3G A;  4E04 A;  4Q0J A;  2GX5 A;  3MQ0 A;  4MCW A;  4ME4 A;  1ZTU A;  4O0P A;  5HSQ A;  4IUK A;  2W3D A;  3DBA A;  4LRZ E;  2B18 A;  4Y5F A;  2O9A A;  1YKD A;  3OBF A;  4G3K A;  4EUV A;  2LB5 A;  3RFB A;  1YSP A;  2XSS A;  2Y8H A;  4MDZ A;  4Y3I A;  3S7P A;  4Y2F A;  2LB9 A;  5AJG A;  3S7O A;  1MKM A;  4O01 A;  4PAU A;  2IA2 A;  3BJN A;  3K2N A;  4Q0H A;  2M7V A;  3MF0 A;  3TRC A;  1YSQ A;  3KSI A;  3W2Z A;  5HL6 A;  2K31 A;  3OOV A;  3ZQ5 A;  2W1T A;  4IJG A;  2W1T B;  4MMN A;  4G3W A;  5I5L A;  4ETX A;  2VEA A;  4YOF A;  4RQ9 A;  3KSG A;  2HGV A;  4YNR A;  3E0Y A;  4IUH A;  3NOU C;  3R4K A;  2W1R A;  4ETZ A;  5DFY A;  2Y79 A;  4MN7 A;  1STZ A;  3VV4 A;  2G7U A;  2XRO A;  3CI6 A;  4GLQ A;  2KLI A;  2M7U A;  3G6O A;  3NHQ A;  5LBR A; 
#chains in the Genus database with same CATH topology
 2HP9 A;  5A92 A;  4BD0 A;  4LEN A;  4R3J A;  1S66 L;  1VEU B;  1IEM A;  3KSF A;  3ZG7 B;  1JWP A;  5DFX A;  5M1A A;  3E4O A;  1GSV A;  3CZD A;  3IWO A;  5FAS A;  1ALQ A;  1LL9 A;  3BFE A;  1VM1 A;  3OPH A;  4R38 A;  4OQH A;  3LUQ A;  3T4T A;  1BYW A;  3KYE A;  4CLC E;  3T4L A;  1MY8 A;  2HF6 A;  5HL1 A;  5HWV A;  5FAO A;  4OP8 A;  4N1H A;  5F5Y A;  2FZ0 A;  4LRZ E;  1MPL A;  5DF8 A;  5EPH A;  4S2N A;  4Y3I A;  2WGV A;  3IF5 A;  4O01 A;  2ZL1 B;  5F1G A;  3L7H A;  4S2L A;  3JVV A;  2Q9N A;  1PW1 A;  3TRC A;  2A24 B;  2PAV P;  3HLF A;  4WMC A;  4WZ5 C;  3SZT A;  5CHJ A;  1I5Q A;  4PKY G;  2L4R A;  4LLO B;  4OLG A;  3LIC A;  4ETX A;  4YOF A;  5GHZ A;  2WGI A;  3KSG A;  1VEU A;  2J3T C;  5AQB A;  2WK0 A;  2QJ5 A;  2FFY A;  1XP4 A;  1HVB A;  4JF5 A;  4EER A;  5AQ9 A;  3T1X A;  4GDN A;  3BFG A;  1V9Y A;  4FH2 A;  4R70 A;  4LFU A;  4OON A;  4Z9Q A;  3IBJ A;  4R1G A;  1ZHH B;  2XD1 A;  4IED A;  4BBU A;  4CLC B;  1PWG A;  2GZA A;  2ZM0 A;  2GJ3 A;  1Q2P A;  4KEN B;  3KSH A;  4QB8 A;  1HD8 A;  2HZ5 A;  1OT6 A;  4LGW A;  4LCM A;  3O87 A;  4DDY A;  4OQ0 A;  2KOI A;  4S2J A;  3C8C A;  3QNC A;  4MN5 A;  2V1B A;  1N9B A;  1OTI A;  5L10 A;  3FPW A;  5IT5 A;  5EM0 A;  4DN0 A;  1T1A A;  4HQA A;  5HW3 A;  2E8J A;  3C7V A;  3B3X A;  4GZB A;  5EVI C;  1W8Y A;  5CER A;  2E8I A;  4F3L B;  2A3U A;  2BLS A;  3W4O A;  3BYD A;  5FEG A;  4X53 A;  1H8Z A;  2XD5 A;  1W63 Q;  2Y4A A;  3BRM A;  3IWI A;  2XK1 A;  3IS2 B;  2GDN A;  4Y0T A;  4E6W A;  1IFQ A;  4PPR A;  3ZCZ A;  5DTS A;  2Q9M A;  4EEP A;  3IF6 B;  3RJU A;  2PRF A;  2Y91 A;  3P01 A;  3UB8 A;  3Q7V B;  2JC7 A;  5KSC A;  1ZC2 A;  4KZ8 A;  2Y55 A;  3FG8 A;  1K25 A;  1PIO A;  1NLY A;  4FSF A;  3R4K A;  4Q8I A;  2V1A A;  3ZHH A;  4MEZ A;  2FFF B;  3TOI A;  4C75 A;  4S2O A;  3M2K A;  4OKP A;  4F3L A;  3PBR A;  3SS5 A;  5EOE A;  2PD8 A;  4NK3 A;  3ZG9 B;  3I7J A;  3H9W A;  5FI6 A;  2VJW A;  3VP3 A;  3MXS A;  1ACF A;  2JBF A;  2NUP C;  1MZU A;  2WUQ A;  2XQZ A;  2EWW A;  4X69 A;  2VA0 A;  3C7U A;  2WKE A;  4EW7 A;  3IX4 A;  2IWB A;  3LIA A;  2ZJ9 A;  1S4R A;  1ZG4 A;  4B4X A;  2W3H A;  2EA9 A;  3DTM A;  4GN2 A;  5EEC A;  3MBZ A;  5L8M A;  1V9Z A;  1PI4 A;  3V39 A;  4KZ4 A;  3GR2 A;  4ZRR A;  5HPF A;  3BQ8 A;  2EX9 A;  1TS8 A;  4P6Z M;  5GHY A;  2OLV A;  1YLY A;  4DKI A;  3BEC A;  3IWQ A;  3FC7 A;  4P87 A;  2HPB A;  5DTK A;  1VB6 A;  2LB5 A;  3BW6 A;  2XSS A;  4PM8 A;  1KGG A;  4Y2F A;  3NC8 A;  3OCL A;  1HTZ A;  4K91 A;  5FSR A;  5CGX A;  4EWF A;  4GHI B;  4JF4 A;  1XX2 A;  1FR1 A;  3HVF A;  4Y15 A;  1KGE A;  3NCK A;  1OJG A;  5DF9 A;  4WMC D;  1MWR A;  3F1O A;  3ZG5 A;  3HJK A;  4ETZ A;  2H5S A;  3VP0 A;  4EEU A;  1AWI A;  2XEP A;  1BTL A;  3UDX A;  3MMH A;  2JKR M;  1TEM A;  3ZFZ A;  2K7S A;  5FQJ A;  5EVI D;  4HBU A;  3NOP C;  4NXB A;  2DNS A;  2O9C A;  2ZC6 B;  4HNB A;  1WYB A;  5GL9 A;  2Y2G A;  4WBG A;  5J4E A;  5CHM A;  5TBM B;  2PR6 A;  2XDM A;  4CQH A;  2QYB A;  3CLO A;  4PM7 A;  2HV1 A;  4OPQ A;  1DP6 A;  1LSV A;  1WE4 A;  3DTK A;  4JGP A;  5FDS A;  2VV6 A;  4H6J A;  1OTA A;  3D72 A;  1GA9 A;  3VFF A;  2W3G A;  2V0U A;  5EV0 A;  3CUE C;  1RGZ A;  3U2A A;  3KYQ A;  3MQ0 A;  1TS7 A;  3IX3 A;  1CQA A;  3UE0 A;  5JYP A;  3UN7 A;  5DVA A;  4EUV A;  3BY9 A;  4N9K A;  4E3N A;  5CEB A;  2A2L A;  4HOI A;  1PWC A;  4NXE A;  3K2N A;  3TG9 A;  4DE0 A;  2HDU A;  2M7V A;  1YSQ A;  1F2K A;  4OLD A;  4IJG A;  1T19 A;  2WYX A;  3CMZ A;  2ZMA A;  3A3J A;  1OTD A;  4IUH A;  4X68 A;  4WL9 A;  3BQA A;  1WA9 A;  3HJI A;  1MBL A;  1DJB A;  2BTF P;  1FCN A;  4KQQ A;  4IBX A;  3SS3 A;  1Z6F A;  2PR5 A;  3H82 A;  2YKH A;  4HJ3 A;  2A24 A;  3B47 A;  2VX8 A;  4XT2 B;  3LCE A;  4HJ4 A;  3ZYT A;  4F94 A;  2BG1 A;  3OC2 A;  1GA0 A;  3IHB A;  2WKI A;  3MR0 A;  2VKS A;  3NOT C;  1S4S A;  4N9L A;  1OJ5 A;  3O88 A;  1G5U A;  2VGL M;  4IVI A;  3IBR A;  2EWV A;  5EFW A;  3V3R A;  4EU0 A;  1JTD A;  2VV8 A;  3Q81 A;  5HD5 A;  3VSL A;  5J3W A;  3FPV A;  3HRE A;  2QKP A;  4E3I A;  1SCW A;  3G31 A;  1TS6 A;  1U60 A;  5DTT A;  5FAQ A;  4JPM A;  2EFX A;  3D3O A;  3LY4 A;  2J8Y A;  4BBT A;  5KSH A;  4GOG A;  4O0P A;  2XFT A;  3BY8 A;  2WGW A;  4P6Z S;  3HUN A;  2J80 A;  3ZG0 A;  2O9A A;  4X1L A;  2FH5 A;  3DW0 A;  2IA2 A;  3TJZ C;  4IVK A;  3UE6 A;  1BLP A;  5L07 A;  3D9Y A;  3OPL A;  2Y2M A;  4PM9 A;  4PHT A;  2EXA A;  1ODV A;  1KE3 A;  3OOV A;  2X02 A;  2OAQ 1;  2WKR A;  3IXB A;  2ZQ8 A;  4GS9 A;  4ZJ2 A;  1EI5 A;  3S1Y A;  4HJ6 A;  3NOU C;  4CLC C;  3F1N A;  1LI0 A;  3LID A;  3MQQ A;  4OOY A;  5EE8 A;  3ITB A;  3QP6 A;  4ARZ A;  4XUX A;  5U47 A;  2XH9 A;  4K0W A;  3VE4 A;  3BEB A;  5F82 A;  2JKT I;  3CJM A;  4GCZ A;  3QHY A;  1ESI A;  3SOI A;  2VV7 A;  4ZJ3 A;  3ZGA B;  2JKR I;  2PD7 A;  4UA6 A;  4JXG A;  2P9V B;  3T4Q A;  1NWZ A;  4NKP A;  4LV2 A;  5HDD A;  2A49 A;  4JGQ A;  1F5M A;  1E3U D;  4S2M A;  2QHK A;  4HP9 A;  2HDS A;  3EQV A;  3F1P A;  5TR7 A;  4Z1W A;  2W3F A;  5FQ9 A;  4E3O A;  2ZMF A;  4LRY C;  2IWC A;  5EOO A;  1GHI A;  3K3D A;  4R0Q A;  2I9V A;  4ME4 A;  4JGO A;  1ZTU A;  3QP4 A;  4OP5 A;  5BOH A;  1D06 A;  1J9M A;  3GQZ A;  2PYP A;  4KUO A;  5G18 A;  4AFI A;  4ZDX A;  3RFB A;  4RA7 A;  2PYR A;  1Y54 A;  4MBH A;  3S7O A;  3VP2 A;  3T4J A;  3Q07 A;  2L1M A;  3DWK A;  4M4X A;  2RL3 A;  2XFS A;  4HH3 A;  2XA7 S;  5TGF A;  5F1F A;  2HP6 A;  1EW0 A;  5M19 A;  1YMS A;  1ONH A;  4KZ5 A;  1M40 A;  1K55 C;  1A0K A;  2VK3 A;  3ZNY A;  2QJ7 A;  3H82 B;  2KLI A;  2Y2N A;  1M6K A;  5DJT A;  1K4F A;  5HAQ A;  1KOU A;  3N4I A;  4GHI A;  3MSH A;  3UPP A;  1K0K A;  5HAP A;  3G2Z A;  4L0L A;  3WS4 A;  3NUL A;  3S7N A;  3UPN A;  4B88 A;  3QP2 A;  5A91 A;  4FD8 A;  4MBK A;  3IXD A;  1K38 A;  1FIK A;  1K54 C;  1LSX A;  3SH9 A;  4QPR A;  1OT9 A;  4RVA A;  4NG2 A;  3NI9 A;  4HH2 A;  2EXB A;  2XLN A;  3H7W A;  4L9E A;  2Y2Q A;  1JNU A;  4ZTK A;  5TJJ A;  3T1S A;  1NYY A;  1AXB A;  5EM1 A;  3WS0 A;  3UDI A;  3IS2 A;  4CJN A;  3PAE A;  3EGD C;  2ZC4 B;  1MKI A;  3T4S A;  4E04 A;  1NZU A;  1K55 A;  5AVE A;  3MKE A;  3DWZ A;  5FI7 A;  3IQA A;  5HSQ A;  1FSW A;  1MXO A;  1ZG6 A;  3OZH A;  3SS4 A;  2Z6C A;  3A3D A;  1YLJ A;  1CI9 A;  1TDL A;  3M2J A;  5FQM A;  4NET A;  4PM5 A;  3EQU A;  4YWZ A;  4BL2 A;  1KE0 A;  3IXG A;  3FWL A;  5DKK A;  5I5L A;  3JPU A;  3PBO A;  2V20 A;  3EEH A;  4QWO A;  4YIN A;  2W27 A;  2HJ9 C;  2G7U A;  1XJ4 A;  3G6O A;  4NEE D;  3ZDJ A;  1OTE A;  1RCJ A;  2M1C A;  3H7W B;  2VGK A;  3G4P A;  5KIZ A;  1G6A A;  5HWT A;  4C6Y A;  3HLG A;  2X71 A;  3LO7 A;  4UA9 A;  3W8K A;  1XKZ A;  4DE1 A;  3V3S A;  5A93 A;  3HCY A;  1ONG A;  5D3O A;  4UEY A;  3SH7 A;  3PBQ A;  1IYP A;  4QHC A;  4BWI A;  4WN5 A;  1DJA A;  3VFH A;  4S2P A;  2AVX A;  4MBF A;  4B93 A;  4H8R A;  1MC0 A;  4S2I A;  4LV3 A;  4OVD A;  2V8F A;  4Q0J A;  1J3W A;  3UB9 A;  1SDN A;  3JVU A;  2B95 A;  3TW8 A;  4QY5 A;  4ZBE A;  4KG2 A;  2W3D A;  2W0N A;  4B9O A;  4GJ4 A;  2QWS A;  2Y8H A;  4L9G A;  4DXC A;  1FIL A;  2ZQD A;  4UA7 A;  3N8R A;  1L3L A;  3WRZ A;  3S4X A;  4JBF A;  1NYM A;  3C30 A;  1FCM A;  4CLC A;  1T1B A;  2B5R A;  4KZ9 A;  3ZG8 B;  5AQA A;  2HDQ A;  2Y2L A;  1NY0 A;  5AVF A;  4N92 A;  4BEN A;  4LCL A;  1K56 A;  2ZC5 B;  4X1M A;  1IYO A;  4IBR A;  3TE8 A;  2H28 A;  1TF1 A;  1GHP A;  1TVF A;  1SZV A;  2Z2M B;  2O0Y A;  5G4Y A;  4UQI M;  2Y2J A;  2ZOI A;  1OPX A;  2JHE A;  4KQD A;  4MN6 A;  3CIT A;  2VLG A;  1BLC A;  4Y0U A;  2X01 A;  5J8X A;  3WS2 A;  3GV9 A;  3GRJ A;  3ICY A;  5F68 A;  4IHQ A;  4X56 A;  2PBY A;  3PXP A;  2VGL S;  4NXG A;  3N8L A;  3O5Y A;  4LV1 A;  2BAS A;  1K56 D;  5CTM A;  3GVB A;  2PU4 A;  1TDG A;  3CPT B;  2NUT C;  4GW9 A;  4DMZ A;  4R6L A;  2ZM2 A;  1CI8 A;  3PBT A;  3MXQ A;  2Q0O A;  2OWJ A;  1BUE A;  2P04 A;  4ZJ1 A;  2DMW A;  2XR0 A;  4FUW A;  3T50 A;  2B18 A;  4WZ4 A;  4HP4 A;  3C4P A;  3OBF A;  4G3K A;  3PYP A;  4BQM A;  3PBS A;  3CAX A;  3IXH A;  3LYX A;  1E3U A;  3IHA A;  1XJ6 A;  3GTC A;  3S7P A;  1Z09 A;  3BJN A;  3RTY A;  5E43 A;  1GSW A;  1FCO A;  2D01 A;  5M18 A;  4DRT A;  1XFQ A;  2Y2H A;  5TBM A;  5FL3 A;  1CEF A;  1L0D A;  4GS9 B;  3SH8 A;  5HFO A;  5GLD A;  1G6O A;  1KVM A;  4UHU A;  1UGU A;  1FSY A;  3R7W A;  2JKG A;  3R7W B;  4S2K A;  2DRW A;  5A90 A;  2Y2K A;  4R4S A;  2QMI A;  5KZH A;  4I5S A;  3W4Q A;  4EV4 A;  4EQ1 A;  5L09 A;  3HBR A;  4U0X A;  2IWD A;  1KE4 A;  1L0E A;  4LRX C;  1S1Z A;  3HLB A;  3UNW A;  5G4Z A;  1I2W A;  3E4P A;  4RYE A;  1CK3 A;  1TD5 A;  4WZ5 A;  3P7N A;  3NY4 A;  1JWV A;  4L9F A;  2J9P A;  4OQG A;  5GLB A;  1NRF A;  2OV5 A;  3VOZ A;  1IYS A;  4EBN A;  2B02 A;  5E2F A;  3LIE A;  1VQQ A;  1PW8 A;  4D2O A;  1GHM A;  1H8Y A;  3CHW P;  4O8G A;  5TFQ A;  3RXX A;  3WS5 A;  2P74 A;  3GMW A;  3LY3 A;  1PZO A;  1L2S A;  4WYY A;  4DE2 A;  3ZVW A;  1YMX A;  4K08 A;  1YM1 A;  5FQK A;  3T12 B;  1CJF A;  5I94 A;  2GX5 A;  1KVL A;  1HLU P;  2P08 A;  2HP5 A;  4K0X A;  3BLS A;  5FQQ A;  5CHU A;  4BD1 A;  1MWS A;  1KDW A;  3N6I A;  1P9W A;  3DAV A;  4XUZ A;  2QPN A;  3NBL A;  1YLT A;  5AJG A;  1K4E A;  4GNU A;  3PTE A;  3O86 A;  1S67 L;  2RCX A;  3KSI A;  3MZF A;  2ZD8 A;  1MWT A;  2ZM8 A;  1X0O A;  3UB6 A;  2HGV A;  2G2W A;  3VE3 A;  2HDR A;  1JWZ A;  3G2Y A;  3WS1 A;  1QMF A;  2R78 A;  1UWP X;  2JCH A;  3PHY A;  3GEC A;  1RP5 A;  1W7F A;  1Q2Q A;  4KZB A;  2V8C A;  4JKT A;  3T4O A;  1W79 A;  1NLZ A;  4JXV A;  1XJ3 A;  4UQI S;  4Y0O A;  3ULF A;  2V1Z A;  4E3M A;  4DDS A;  3FYZ A;  1BSG A;  4R3A A;  4WLA A;  3WRT A;  2ZOH A;  5HDS A;  1IEL A;  3HUM A;  4FTX A;  4E3L A;  1DRM A;  3SW1 A;  1IOU A;  3V5M A;  2XGN A;  4KQO A;  4QD4 A;  1DP9 A;  4FH4 A;  3LIF A;  4P85 A;  1P0Z A;  1PYY A;  2JKT M;  1JVJ A;  1F98 A;  5E2E A;  4B4Z A;  3RXW A;  4EET B;  1YSP A;  3LGO A;  4OPY A;  3Q1F A;  1OME A;  3VSK A;  1NJ4 A;  4JXS A;  4Y17 A;  5IS1 A;  1D7E A;  2WAF A;  4WEL A;  2PU2 A;  1K54 A;  3ZQ5 A;  4BBV A;  1L0G A;  4G3W A;  3HLW A;  1NRJ A;  3VMA A;  4DXB A;  5F69 A;  5AQ7 A;  3KX0 X;  3VP1 A;  4MNR A;  1XA1 A;  4WEJ A;  5JYO A;  2XRO A;  1KGF A;  1PWD A;  3M6B A;  2M7U A;  1SKO B;  5F6A A;  2OOL A;  1FR6 A;  5IU1 A;  2EX6 A;  5HAR A;  5CED A;  2CC1 A;  3OPR A;  4OOL A;  5DJU A;  2Y59 A;  1LL5 A;  3MS6 A;  2XRN A;  3HLD A;  3T1Q B;  3EEA A;  4D60 A;  3P98 A;  3WWX A;  3RH8 B;  2VZW A;  3BFF A;  4Y13 A;  1CEG A;  4P6B A;  5FEF A;  5EVL A;  3B42 A;  1L0F A;  2L0W A;  3EGX C;  3C2W A;  2WKQ A;  2VGJ A;  1LT0 A;  3CUE A;  1BUL A;  2G2U A;  2ZLY A;  3NEC A;  2OSU A;  3MZE A;  5FAT A;  2UV0 E;  1T1C A;  1F9I A;  5CEC A;  4A5R A;  1EWZ A;  3LR4 A;  4GB7 A;  1PNE A;  1YLW A;  3O3V A;  2ZQA A;  1MKM A;  1S1Y A;  4ARZ B;  4PM6 A;  4GKU A;  1G68 A;  1K6R A;  2WKP A;  2Z6D A;  1O07 A;  5DF7 A;  5E2G A;  4UAA A;  5CGW A;  1BT5 A;  1W63 M;  2W1T A;  1SHV A;  3PR6 A;  3LEZ A;  5HDC A;  3Q7V A;  4M3K A;  5EVI A;  4RX3 A;  4NXF A;  3VP4 A;  3VOL A;  3BFD A;  4DJ2 A;  1H0M A;  4O7D A;  4WUJ A;  3ISG A;  3DTE A;  5HAI A;  4I39 A;  2Y79 A;  4II7 A;  1FQG A;  3VV4 A;  1PRQ A;  1P97 A;  3UDF A;  4BLM A;  3NHQ A;  4QY6 A;  3V67 A;  4I3I A;  3GSG A;  2HJE A;  2H10 A;  3IH8 A;  2XF3 A;  2J3T D;  5E2H A;  2GNX A;  4ESP A;  5J7E A;  3MFX A;  4MLL A;  2WAE A;  2INW A;  3F1O B;  3NDG A;  5FA7 A;  4EQI A;  4JF6 A;  3LR0 A;  1ERQ A;  1T18 A;  5EUA A;  1ZKJ A;  1S6R A;  4R4R A;  4KZ7 A;  4PKY A;  5CGS A;  2P9V A;  3E98 A;  4CPK A;  4HHD A;  3LEQ A;  1LL8 A;  2K2N A;  4EUZ A;  4S2N C;  4X6T A;  1N9L A;  5HX9 A;  3T1R A;  3NJA A;  4MCW A;  3W4P A;  2Z2L B;  3OPP A;  1OTB A;  4XXR A;  3OCN A;  2J7V A;  2QZ6 A;  2V0W A;  2ZC3 B;  2J3W A;  3F1P B;  1YKD A;  4DE3 A;  3GDI A;  4C3Q A;  3A3E A;  1YQS A;  3N7W A;  1BLH A;  4EXO A;  4QU3 A;  4HI4 A;  3QNB A;  2UWX A;  3L9K A;  4QJG A;  3HLC A;  2ZQC A;  4RX2 A;  3MF0 A;  4KG6 A;  3FKV A;  5FDH A;  2JKF A;  4KZA A;  1DP8 A;  2VEA A;  2ACG A;  4WEK A;  4DJ3 A;  1ES5 A;  3C38 A;  3BM6 A;  1Y28 A;  4EBP A;  4EES A;  2ZQ9 A;  2W1R A;  1LSW A;  3LR3 A;  4MN7 A;  1SKF A;  4U0T A;  3CI6 A;  1ERM A;  1SDE A;  1PZP A;  1N4O A;  1TS0 A;  1SKO A;  3S22 A;  1PFL A;  4KG5 A;  5K5B A;  2OWH A;  1IKG A;  5GLA A;  1VET A;  1G28 A;  5FQI A;  4U3T A;  2H0T A;  4FCF A;  4GD8 A;  2D02 A;  4R23 A;  3AGE A;  3C4O A;  4WM9 A;  1DJC A;  1P9R A;  3MXR A;  5CX7 A;  5HPI A;  1I2S A;  1ES4 A;  4R3B A;  3EOI A;  1D1J A;  3IX8 A;  1XPB A;  3IH9 A;  1K6S A;  5HZH A;  1LLB A;  4GDB A;  1YPR A;  2H0Y A;  4GD6 A;  2Y2P A;  1ERO A;  3CWF A;  3ITA A;  1KDS A;  3JYI A;  4OH0 A;  4E3J A;  3B33 A;  4IUK A;  1H3Q A;  3NDE A;  1XGJ A;  1NXY A;  1BLS A;  2OLU A;  4I3A A;  5L2F A;  1XJ2 A;  3MZD A;  3MKF A;  2ZBB A;  2ZQ7 A;  1H5X A;  1IYQ A;  1BZA A;  4Q0H A;  1E4D A;  3IF6 A;  5GHX A;  1S0W A;  3Q82 A;  3T4K A;  2W1T B;  4MMN A;  3CG5 A;  2WKH A;  4JLF A;  1N9O A;  1WYC A;  3UO9 A;  3BWL A;  4Y7P A;  3N8S A;  4HES A;  2ZC7 A;  2C5W B;  2PT7 A;  3KYZ A;  4KUK A;  2Y2O A;  5DFY A;  1STZ A;  3A0S A;  5EVE A;  2Y2I A;  2KDK A;  1GCE A;  4HBT A;  2EX2 A;  4N1X A;  1GSX A;  4FOF A;  4G3V A;  3FV7 A;  5IHV A;  3OLO A;  4H6J B;  1K57 A;  2CMN A;  3UB7 A;  1E25 A;  1LHY A;  4YFM A;  1W5D A;  3DTI A;  3Q7Z A;  4KZ3 A;  2EX8 A;  2PBD P;  3G32 A;  5CTN A;  2OAP 1;  3S7Q A;  3IT9 A;  2C6W B;  2I72 A;  2EFU A;  1Y4O A;  3G35 A;  1YT4 A;  4HIA A;  2JE5 A;  3UMD A;  4JGR A;  2W3E A;  1LI9 A;  1DY6 A;  1XFN A;  3C5A A;  5HWW A;  3UE3 A;  3HL9 A;  5MC7 A;  4X55 A;  2R9X A;  3MQO A;  4Y5F A;  3UPO A;  2V9A A;  1HZO A;  3QP8 A;  1FOF A;  4MDZ A;  1YLZ A;  4WF0 A;  2LB9 A;  2ZL1 A;  4HY8 A;  4KQR A;  2PHY A;  4PAU A;  4E3K A;  4BMW A;  1N9N A;  2V2F F;  3W2Z A;  3UE1 A;  5HL6 A;  4OOM A;  5FAP A;  3FKW A;  4RQ9 A;  4YNR A;  3E0Y A;  3P09 A;  4X25 A;  5GLC A;  4HEF A;  1MWU A;  4OPR A;  1H8M A;  1QME A;  1IKI A;  3K3C A;  4LPZ A;  4EBL A;  2WGW B;  2KX6 A;  5DKL A;  3KO6 A;  4P0M A;  4JXW A;  5EVI B;  3CPT A;  2DCF A;  5KMW A;  3A0V A;  3LFV A;  5CRF A;  3E2L A;  3IF6 C;  3G34 A;  1ES2 A;  1XA7 A;  2O9B A;  1ESU A;  3BFC A;  3E4Q A;  5C5K A;  5A8B A;  3A3I A;  3AGF A;  3A0R A;  4BL3 A;  1VHM A;  3E2K A;  1UWN X;  3PBN A;  5CXW A;  1NZO A;  4I38 A;  3BLM A;  3D4F A;  3LR5 A;  4Q0I A;  3QP5 A;  4OQI A;  3F1N B;  1JTG A;  3AGD A;  3A3F A;  2O99 A;  3M6H A;  2R9W A;  3G30 A;  4BJP A;  2ZMV A;  1YLP A;  3V50 A;  3UB5 P;  3VOY A;  2WAD A;  4I3J A;  5F83 A;  4LV0 A;  1O7E A;  4ZAM A;  3HUO A;  5HD3 A;  3DBA A;  1XGI A;  1PI5 A;  1CF0 A;  3NIA A;  4DF6 A;  2YKF A;  1W8Q A;  5FI2 A;  3MFD A;  3TSG A;  1C3B A;  1XXM A;  4E6X A;  2WZX A;  1ES3 A;  2PDR A;  3ZVT A;  4OPZ A;  1RGY A;  3EWK A;  4PMA A;  3MJQ A;  2K31 A;  3PAG A;  1YAX A;  2WZZ A;  2J9O A;  3LI8 A;  1VET B;  3ZNT A;  3QP1 A;  4ID4 A;  2XA7 M;  2P7J A;  3UME A;  3LI9 A;  3LIB A;  4CLC D;  2JN7 A;  4KZ6 A;  3U4L P;  3UY6 A;  1K57 C;  3HLE A;  3FZC A;  4XT2 A;  4GLQ A;  2MJ6 A;  5LBR A; 
#chains in the Genus database with same CATH homology
 4HJ4 A;  3ZYT A;  2O0Y A;  3OC2 A;  3V67 A;  4I3I A;  5G4Y A;  2HJE A;  3MR0 A;  2VKS A;  2J3T D;  3NOT C;  4UQI M;  1S66 L;  2GNX A;  1S4S A;  2ZOI A;  1OPX A;  2JHE A;  4KQD A;  4MN6 A;  3CIT A;  5J7E A;  2VLG A;  3MFX A;  1OJ5 A;  3KSF A;  2INW A;  2VGL M;  3F1O B;  5DFX A;  3IBR A;  3E4O A;  3ICY A;  5F68 A;  2EWV A;  4IHQ A;  5EFW A;  1GSV A;  4NXG A;  3PXP A;  2VGL S;  4EU0 A;  3O5Y A;  2VV8 A;  2BAS A;  3LR0 A;  5HD5 A;  5J3W A;  3FPV A;  2QKP A;  1T18 A;  4R38 A;  1TS6 A;  3LUQ A;  4PKY A;  4GW9 A;  2NUT C;  3T4T A;  1BYW A;  4DMZ A;  4R6L A;  4CLC E;  3T4L A;  3E98 A;  3D3O A;  4HHD A;  3PBT A;  1LL8 A;  2K2N A;  3MXQ A;  2HF6 A;  1N9L A;  5KSH A;  4BBT A;  3NJA A;  5HWV A;  2OWJ A;  4MCW A;  4O0P A;  2P04 A;  1OTB A;  5F5Y A;  3BY8 A;  3OCN A;  2DMW A;  4P6Z S;  2FZ0 A;  4LRZ E;  3T50 A;  2B18 A;  2J80 A;  2V0W A;  2O9A A;  2J3W A;  4HP4 A;  3F1P B;  1YKD A;  4XT2 B;  3OBF A;  4G3K A;  3GDI A;  3PYP A;  3PBS A;  3CAX A;  3LYX A;  4EXO A;  1XJ6 A;  4Y3I A;  3S7P A;  4HI4 A;  4O01 A;  2FH5 A;  3JVV A;  2IA2 A;  3BJN A;  3TJZ C;  3UE6 A;  3RTY A;  1GSW A;  3MF0 A;  2A24 B;  2D01 A;  3TRC A;  1XFQ A;  4PHT A;  4PKY G;  1ODV A;  2L4R A;  4LLO B;  5TBM A;  3OOV A;  1DP8 A;  3LIC A;  5FL3 A;  2OAQ 1;  4GS9 B;  4ETX A;  2WKR A;  2VEA A;  4GS9 A;  4YOF A;  4WEK A;  3KSG A;  4DJ3 A;  4HJ6 A;  2J3T C;  3C38 A;  3NOU C;  1G6O A;  1UGU A;  4CLC C;  2QJ5 A;  3F1N A;  1Y28 A;  3R7W A;  3LID A;  3MQQ A;  4EES A;  3R7W B;  4EER A;  2W1R A;  3LR3 A;  1LSW A;  4MN7 A;  4ARZ A;  3CI6 A;  1V9Y A;  1TS0 A;  4R70 A;  4I5S A;  4EQ1 A;  3VE4 A;  2JKT I;  4GCZ A;  5K5B A;  3IBJ A;  1ZHH B;  2OWH A;  2VV7 A;  4BBU A;  4CLC B;  4LRX C;  1S1Z A;  5G4Z A;  1G28 A;  2GZA A;  3E4P A;  1TD5 A;  2JKR I;  2PD7 A;  2GJ3 A;  3P7N A;  3T4Q A;  4L9F A;  1NWZ A;  3KSH A;  2D02 A;  4NKP A;  5HDD A;  1TF1 A;  1OT6 A;  2B02 A;  4JGQ A;  1F5M A;  3LIE A;  2QHK A;  4HP9 A;  1P9R A;  4O8G A;  2KOI A;  5CX7 A;  5HPI A;  3C8C A;  3EQV A;  2V1B A;  4MN5 A;  1OTI A;  3FPW A;  3F1P A;  3EOI A;  5IT5 A;  4DN0 A;  4Z1W A;  1T1A A;  4HQA A;  2W3F A;  5HZH A;  4K08 A;  2ZMF A;  4LRY C;  3K3D A;  2GX5 A;  4F3L B;  3CWF A;  2I9V A;  4ME4 A;  4JGO A;  1ZTU A;  3B33 A;  2P08 A;  4IUK A;  1H3Q A;  1D06 A;  2PYP A;  1W63 Q;  4KUO A;  4AFI A;  4I3A A;  1XJ2 A;  3RFB A;  3IS2 B;  2PYR A;  1P9W A;  1IFQ A;  2ZBB A;  5AJG A;  3S7O A;  3T4J A;  4EEP A;  2L1M A;  4Q0H A;  1S67 L;  4M4X A;  3KSI A;  3T4K A;  4HH3 A;  2XA7 S;  3P01 A;  3UB8 A;  2W1T B;  4MMN A;  1X0O A;  1EW0 A;  3UB6 A;  2HGV A;  3FG8 A;  1N9O A;  1NLY A;  4FSF A;  3BWL A;  3R4K A;  3VE3 A;  2V1A A;  3KYZ A;  2PT7 A;  4KUK A;  5DFY A;  1STZ A;  2QJ7 A;  2R78 A;  3A0S A;  3H82 B;  4F3L A;  1UWP X;  3PBR A;  2KLI A;  3PHY A;  3GEC A;  2PD8 A;  2KDK A;  5DJT A;  1KOU A;  4GHI A;  3H9W A;  2VJW A;  3T4O A;  1GSX A;  4FOF A;  1NLZ A;  4G3V A;  1XJ3 A;  4L0L A;  3S7N A;  3OLO A;  4UQI S;  4H6J B;  2NUP C;  3ULF A;  2CMN A;  1MZU A;  3UB7 A;  2EWW A;  4R3A A;  4WLA A;  2VA0 A;  1LSX A;  2ZOH A;  4QPR A;  5HDS A;  4EW7 A;  1OT9 A;  3LIA A;  2OAP 1;  1S4R A;  3S7Q A;  4HH2 A;  2W3H A;  4L9E A;  3H7W A;  2EA9 A;  1JNU A;  5TJJ A;  1DRM A;  3SW1 A;  4HIA A;  5L8M A;  1V9Z A;  1IOU A;  3UMD A;  4JGR A;  3IS2 A;  2W3E A;  3EGD C;  4ZRR A;  5HPF A;  4E04 A;  3T4S A;  1XFN A;  4KQO A;  3BQ8 A;  1DP9 A;  5HWW A;  3LIF A;  5AVE A;  1TS8 A;  4P6Z M;  1P0Z A;  2JKT M;  3UE3 A;  5MC7 A;  5HSQ A;  3MQO A;  3FC7 A;  4Y5F A;  1F98 A;  1VB6 A;  2V9A A;  2LB5 A;  3BW6 A;  2Z6C A;  4EET B;  1YSP A;  2XSS A;  4MDZ A;  4WF0 A;  4Y2F A;  2LB9 A;  4HY8 A;  2PHY A;  4PAU A;  5IS1 A;  4BMW A;  1D7E A;  1N9N A;  3OCL A;  3EQU A;  4YWZ A;  4WEL A;  3W2Z A;  5HL6 A;  4OOM A;  3ZQ5 A;  4BBV A;  4GHI B;  5DKK A;  4G3W A;  5I5L A;  1NRJ A;  4RQ9 A;  3PBO A;  4YNR A;  3E0Y A;  5F69 A;  1OJG A;  3KX0 X;  3EEH A;  5DF9 A;  3F1O A;  3HJK A;  2W27 A;  4ETZ A;  4WEJ A;  1H8M A;  2HJ9 C;  2G7U A;  4EEU A;  2XRO A;  1XJ4 A;  2M7U A;  3G6O A;  4NEE D;  5F6A A;  3K3C A;  4LPZ A;  1OTE A;  2OOL A;  2M1C A;  5IU1 A;  2KX6 A;  3MMH A;  2JKR M;  3KO6 A;  5DKL A;  3H7W B;  5KIZ A;  5HWT A;  2K7S A;  3A0V A;  4OOL A;  5DJU A;  3LFV A;  3NOP C;  4NXB A;  2XRN A;  2O9C A;  4HNB A;  3TE8 A;  2O9B A;  3EEA A;  3E4Q A;  5C5K A;  5A8B A;  3RH8 B;  5J4E A;  2VZW A;  3HCY A;  3A0R A;  1VHM A;  4UEY A;  5TBM B;  3PBQ A;  2PR6 A;  1UWN X;  4CQH A;  3PBN A;  2QYB A;  3CLO A;  2HV1 A;  3B42 A;  4I38 A;  4BWI A;  1DP6 A;  3LR5 A;  4WN5 A;  4Q0I A;  1LSV A;  4JGP A;  2L0W A;  3EGX C;  3C2W A;  2VV6 A;  3F1N B;  4H6J A;  2WKQ A;  1OTA A;  4B93 A;  3D72 A;  2O99 A;  1MC0 A;  1LT0 A;  4BJP A;  3CUE A;  2W3G A;  2V0U A;  2ZMV A;  3CUE C;  4Q0J A;  3UB9 A;  3JVU A;  3U2A A;  3KYQ A;  3MQ0 A;  4I3J A;  1TS7 A;  3TW8 A;  2W3D A;  5HD3 A;  3DBA A;  1T1C A;  2W0N A;  1F9I A;  4B9O A;  4GJ4 A;  4EUV A;  2YKF A;  2QWS A;  3LR4 A;  2Y8H A;  3BY9 A;  4L9G A;  2A2L A;  4HOI A;  1MKM A;  1S1Y A;  4ARZ B;  4NXE A;  3K2N A;  2PDR A;  2M7V A;  1YSQ A;  3EWK A;  2WKP A;  2Z6D A;  3MJQ A;  3C30 A;  2K31 A;  1YAX A;  1W63 M;  2W1T A;  4IJG A;  1T19 A;  4CLC A;  1T1B A;  3PR6 A;  5HDC A;  3LI8 A;  1OTD A;  4IUH A;  2XA7 M;  4NXF A;  4WL9 A;  3BQA A;  1WA9 A;  2P7J A;  3UME A;  3HJI A;  3VOL A;  3LI9 A;  3LIB A;  4CLC D;  4DJ2 A;  5AVF A;  4WUJ A;  2JN7 A;  2PR5 A;  4I39 A;  2Y79 A;  3H82 A;  2YKH A;  4II7 A;  3VV4 A;  4HJ3 A;  1P97 A;  2A24 A;  3B47 A;  4XT2 A;  4GLQ A;  2MJ6 A;  2H28 A;  2VX8 A;  3NHQ A;  5LBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...