4G3YH

Crystal structure of tnf-alpha in complex with infliximab fab fragment
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
220
Chain Sequence
EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKSAVYLQMTDLRTEDTGVYYCSRNYYGSTYDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords infliximab Fab L
publication title Structural basis for treating tumor necrosis factor alpha (TNFalpha)-associated diseases with the therapeutic antibody infliximab
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g3yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g3yH01
1IEBA 1X5LA 2FIKA 2AXJA 4FFVC 1HILB 1UH3A 1T6WA 2L0DA 4K23L 5J0BA 5EORL 1WFUA 3HG1B 2GYSA 4HXBL 5EOQL 3TVMD 5J8OA 2UY7A 3CXHK 1MFCL 4OTXL 1T2JA 1I3RB 4L9LC 1R3LA 1B4JL 4KZDL 2ITDB 5FECB 4ONGH 1EMTH 3PJSA 1V8HA 5GGQL 4MLIA 3S37H 2VRAA 1T6VN 4L3CA 2FEDD 32C2A 4YFDB 4RAUB 1CFNA 3KPQA 2VLRA 1SY6H 3QEQD 3V6FB 5D1XA 4LNRA 2HFFB 2VDLH 2VQ1B 1EMTL 2P44B 1IQDA 3BZ4B 1G7JA 3S37L 3MR9B 1HYRC 3ARFA 1XCTB 1S5HA 3TV3L 5C0RH 5E2TH 1YY9C 3RY4A 3CVIL 3UYRH 4MS8D 1JFQH 4R6UA 3SGKA 1MELA 4G6FD 4WI6A 4YPGB 4M6MH 2IG2H 3V6BR 1A7QH 3EW3B 1T1WA 3WKMH 4NYLB 5C0RL 5E2TL 2P47B 4LKXA 3UYRL 2W0LA 2F9BT 2JIXB 1I8KB 2A38A 2J4WH 4IMKC 5CBAB 4ODHH 5HYFA 1IBGH 2V5RA 1CGVA 3BVNB 3C87A 2EDLA 2IG2L 1BZ9B 3V5HB 1A7QL 2YSSB 1FRGL 4PJIF 3WKML 2EDKA 2XACC 3I75A 4Z7UE 5DRWB 4XCYB 1EV2E 3KDMB 5FYLD 3D6GA 4YWGH 4A6YH 3K7UA 3TZVB 2J4WL 4Z7NF 2HJKA 3K1DA 3LKSB 2VLKD 3C5JA 4XCEA 5JLZA 5LWYL 2YUZA 4X8XA 3HE7B 4D0DB 1QBMH 5CGYC 2H2PC 4BQ6A 4A6YL 5F71A 3MCLL 4KDWA 5EB9A 1XGUA 3HMXA 4IRZH 4FABH 1WBXA 2BNUB 5GGSA 3S98A 5ACLA 3RWCA 2XN9A 1G6RA 1NL0H 5ADPH 4K7PY 1R3HA 1QBML 2CDGA 4O9HH 4P23D 4CN4A 3ULVE 1KTRL 4WHDA 1QO3B 4IRZL 4FABL 1R5VA 4G8IA 2QSVA 1T0PB 5E8EB 4C56A 4JZOB 1MHEB 5ADPL 2DQEH 5GHWL 1TZIB 2P49B 3NAAH 4M1GL 3KLAA 4YC2B 2QV2A 4ESKA 3QH3B 4LCYA 1RZJH 4NM4H 4PRNB 2DM3A 3VXRD 4G8GD 4JFFB 2GCYB 1XGTA 1GVIA 3QUMH 1NCNA 2DQEL 3DV4A 4NQVA 3CLEL 5C0BA 4FFYL 1DUYB 4QRPB 1C5CL 4NT6B 3W9DB 4JFZH 2RR3A 4QYOB 5GS0C 4U4BA 1GGBH 3U82B 4F15B 3T3ME 3ISWA 3GGWA 2P8PA 3DUSA 2EDEA 3JZ7A 4K71C 1M71A 3DGGB 4MQSB 3PP4H 2A6DB 5L2JA 3KLHD 4Y5YA 5M94B 1BZQK 1GGBL 5FYLH 3RUGF 3H7BB 5IFHH 1A7OH 5I75C 4GKSA 3SY0B 1FL3A 3UBXA 5CIPB 4JM2F 2A83B 2VZTA 4WI3A 4U6YA 3VFMB 4OUOA 2ZCKL 3PP4L 1HXMA 4OV6F 1L6ZA 5CP3A 2FHCA 3BYYA 2VJXA 3QIBC 2ATPB 3PHOB 5IFHL 1A7OL 3IFLL 4R4NC 4H5SA 5HJ3A 5E95B 3LPWA 4Z7WB 2A9NH 2OSLA 4JQXA 1RHHA 2NY4C 4XP6L 1LGVA 2IPKA 4YJZL 2XG5A 4U6XA 2WQRA 5KS9E 4DZBB 4E0RB 4XTRD 3EYUH 4WV1B 2Y5TB 4YO0A 5IOPB 1ZHKB 2A9NL 3S34H 1Z9MA 1EHXA 4PY7A 5F96H 4XC3H 1CFQB 3K4AA 4GKOA 4XMLL 3D69B 3KG5A 2XWBA 4MNQB 4FMKA 4ZSOE 5D2LB 4QHKJ 3EYUL 3NCBB 3QYCA 1WCBB 4RMRA 2P5EE 5GZOC 2X9YA 3S5LA 2RCSL 3EFFB 1NAMB 1WAAA 4X7SH 4LLMA 5DJYB 4JPVH 1MCJA 6FABH 4GMTL 1OF2A 3REVA 2R0LH 2BY3A 1U41A 3BJ91 1XF4A 4K9EH 1MCDA 3CC5B 3SCMD 3FJTA 4ZYKB 4RMTA 4YDVA 2X1PA 3GSOB 5IVXF 2ITDA 4JPVL 4RDQG 6FABL 5GJSH 5F9AC 3DX8A 4XVJH 1HXYB 1EPFA 2N1KA 3O4LA 4Y1AB 3T0AA 5IESH 1T89A 1CD1B 2VC2H 5H37H 2H45A 1OCWL 5JW5B 3LRHA 4RAUA 5DJDB 2E6PA 4PJXB 3MCG1 3F7VB 5GRJH 2HFFA 2VQ1A 4LSPH 1J5OH 2VLJB 4XVJL 5IESL 2X4UB 1OTSD 4QHNA 4HH9A 1ZVYA 4R9HA 5F89B 4KKAC 1OQOA 2EDJA 5JW3H 1INQB 5GZND 3VFWB 4E41B 4YPGA 1DLFH 4ELMF 3VMOA 1I3VA 4JZJB 4XZUA 2EXYD 3CVHB 3FTGB 1L9MA 3EYQD 5EFIA 4ZUUB 1I8KA 5I8OL 1XIWB 4HUKB 2X6MA 2VL5B 4NN6B 2WWKT 3QIUC 5CBAA 5BQ7A 3I6GB 4XP5H 4XAKD 4E42A 4ACPA 4WFED 3OZ9H 5HHNA 3AB0C 5E9DB 2YSSA 3SDAC 4P2QD 3STBA 4AL8L 3VXSA 5DRWA 4OKVB 1TDQA 1WZMA 3KDMA 1E27B 3NIGF 1CD9B 5DI8B 4P5TB 4XVSH 1CFVH 1WTGT 4XP5L 2HVKB 1TVDA 5AD0B 1G7MB 3OZ9L 4LHQB 1AQKL 3G6DH 4D0DA 1ZAGA 4YFEA 3DTXB 4GW5A 1ONQA 3B3IA 5ECJE 3UJJH 3QHTC 3HI1B 2B1AH 4OB5H 1CT8B 1MCFA 1XH3B 4M1DL 2AJYH 1KIRB 4JQVC 1LP9E 2AXHA 3VFNA 3G6DL 5F1SA 1T5WB 2WBKA 4LCCB 3MRNA 3VW3L 5I1LB 4OLYH 1DEEB 4C57C 1S8DA 4QRSB 1GC1C 1QD0A 2B1AL 3IDUA 1D6EA 1KCSH 3OPZH 4OB5L 5F7KC 2AJYL 4HIXL 4JZOA 1AGDB 4LLYB 4U1LA 4ZPVA 4LGRB 3MBXL 3OG6B 4AEIH 1OM3H 4QF1A 4R97B 2ZUVA 3QH3A 1NUNB 5IFJB 3BKML 1KFAH 3PHSA 2CH8A 2XG4A 3OPZL 1AXTH 2GCYA 2DMBA 4ONOA 4X98B 3MQIA 4GBXD 3VXUE 4PRAB 1P2CB 3TIDB 3BDYH 3MOAH 4UAOC 5F97E 4YHNA 4QTIH 4NIKB 1JNLL 1FVDB 3J7HA 1OM3L 3O6LH 1LE9A 1EEYA 4OGAC 5I1DA 1A47A 1HIMH 5I74B 5DTFA 3SOBL 4AH2B 4OZIE 1KFAL 1BQHA 3C5ZC 5HHME 1AXTL 5F9WC 4OLUL 3IS0X 5HGBA 1JHKH 2DM4A 2W9LA 3BDYL 4FQQB 4LPCA 4HG4J 3L5IA 4N1EA 4QTIL 3TO4C 5F7LB 4GAJL 3IGAA 1JF6A 5DFWH 3DNKA 2NY1D 5EBLB 1S3KH 3H7BA 1JHKL 2PKDA 1NMCB 3SKUD 4WENB 5GGVY 2Y06L 4XNYH 1KLGB 4M7KL 2GT9A 3RVVD 4Y2OA 2VXSH 4GH7B 5SV3A 1JYWA 4P46C 2D9QB 1I1AA 4FQJH 2R56H 3LEXB 3GMRA 1JN6B 3THMH 4Z7WA 1HKFA 1AR2A 3NFSL 5GGTH 4XNYL 2AV1B 4H20H 2QSQA 1IL1B 5GS1C 2QKIB 4AIOA 2A74A 2VXSL 1YN7B 3QWQB 4G6AD 2V9QA 4JFDA 5FKPA 5I1AB 1YYLH 4E0RA 4GAGH 4L9LA 4MJIB 2R56L 4DKEL 2AJVH 4QCIB 4LPWA 3THML 3DURA 3ULVF 5GGTL 4HS6A 1XMWA 4FTVB 4H20L 4GW4B 1CFQA 5TF0A 5I0ZA 3UPAA 1ODAA 1XEDA 2NX5B 3HC3H 2NXZD 3D69A 3B2UC 1MCPH 3KYAA 1YYLL 4X83A 1L0XA 3RBGA 2AJVL 3HI6H 3UZEA 2ADIB 4WHYH 2X4OB 4PD4J 3BIKA 1VADA 2EE6A 3JWNC 4MX7B 4NHUB 3HC3L 4I18C 4WI9A 1JPSH 3QEGH 3QFJD 4JY6A 5EOCJ 1HQ4A 1I7TB 3G08B 1WV7T 3GSRA 4NN5C 2R1YB 5HHXH 1XR9B 3GSOA 3NN8A 5IW1A 4G6JH 43C9B 2F54B 2QHRH 5BV7B 1DBAH 2BVTA 5C0ND 2Z35B 4X4XA 3IDXH 5IW6B 4U1SB 5JW5A 4IMKA 3C8KB 3MUJA 5HHXL 5KN5A 1W0YT 3BP4A 3WEXA 5D72H 4OGYL 1T0MA 1H5BB 2BY2A 3C6LB 4Z0BL 2F53A 4PJEB 1HSBB 4G6JL 3GSNA 3U4BH 2QHRL 5ICZB 1DBAL 1N2RB 4MVBD 4U49A 4EQ2A 3KXFB 3DX7A 3KJ4B 2X4UA 2GK0A 2FEEL 2BNRD 5E6ZA 4OCYH 5D72L 5I9QC 2P45B 1MHHB 3TWCL 3U4BL 3CAFA 5E8OB 2GJJA 4ODVH 2EICA 1N3NB 3P0YL 4J4PC 4OUUB 4OCYL 1QZ1A 3ULUF 4KJYA 1NCWH 1G9NH 2ZPKL 2BSRB 1K4CB 3B5HA 1EHLH 1FL5B 1T4KA 4Y4KC 1XIWA 2VL5A 5IF0A 3FFCE 2H32B 5DJ2B 2W38A 2V5SA 1CDUA 2YHGA 4ODVL 4OCNC 3GMQA 5C08D 4YHMH 1NCWL 4HULB 1ITCA 3T08A 1EH9A 3NFNA 5JPNB 4Q9CA 3QXVA 1ZLWH 3ZO0A 1EHLL 2B20A 3WNKA 4GS7C 1YMMB 3EOBA 1ZANL 4DVRL 3DV6A 5GGUA 1MFDH 1MREL 3EJYD 3F7QA 1UZ6F 3NPZB 3QXDB 4RFNC 3O2VH 1AH1A 3SHSA 1AGCA 3MBEC 5BMFL 3QO1A 4MD4B 3HI1A 4RGNB 1ZHLA 5D7JD 4Q9QH 1CT8A 2J6EL 4Y2DD 1JF5A 1FFPB 4Q9RH 1HSAA 2WIMA 4JPWL 1NANH 3LEVH 2DM7A 2H9GB 1T5WA 1KXVC 5ABDE 4LHUA 2YD5A 3O2VL 3VDBA 3PL6B 3GI9H 3SO5A 2WINA 3BD5A 4OZFG 4QRSA 4Q9QL 4Z6AT 2B0SH 4WHTA 3W2DH 1AGDA 3AXLB 3KYOA 3U0WH 4G80B 4XPAH 4K3DL 5TDPB 3UDWC 5JXED 2XI9A 3WN5B 4HT1L 5HVFB 3L5JA 2X70A 3GI9L 4L4VA 4J6RH 3QHFH 5SWQB 4JRXE 4PRPD 2B0SL 3JXAA 1QFPA 2UZYB 2BNQB 1HNGA 1P2CA 3VXTB 1F2QA 1DBKH 3QIBA 4BSVB 2O5ZH 4ORZC 1S9YA 4PJ9D 5MENA 4R8WH 1JF1B 1W8NA 2UZIH 2AJ3B 3LN5B 4M6AA 4RBPK 4AQOA 1J11A 3OKNB 4NZUH 4BJLA 4FQQA 3BRDA 3F8UB 1ZHNA 5EIVA 2QJDA 3VFPB 1JWUA 3B9KD 3A67L 2O5ZL 4YBLC 1PX3A 3NPSB 1ULVA 5EBLA 4JN2B 4R8WL 2QL1A 5CLWA 1KB5L 3QFDB 4NZUL 5LCVH 5EO1A 3UJIL 4K94H 1LO5B 3MZTA 3ARDC 3LKQB 5JORB 2NXYC 3UO1H 3WSQL 2PYFA 3GDBA 3RL1A 2FLRT 3GJEB 2RBLA 4XPGL 3QDJA 4N9OB 1N5AA 4OFYA 3LOWA 4OI9A 1V3JA 3BPCB 3EOAA 5KSAC 2CLRA 3DPBA 4BKLB 2P5WE 3UO1L 5ICYB 4LK4A 5KAQF 2IANB 2UYLA 4PJGE 2YZ1A 4S1SH 2MKLC 2QKIA 4O2FB 2UUDK 4XB8A 1YN7A 3QEHB 5BS0A 4PG2A 4D9QE 2ICES 1XF3B 4GG6A 1K6QL 4YK4C 2E9JA 2R1XB 1G1CA 1OAUH 1KEGL 4HJ0C 1BP3B 4FTVA 4PJCA 4S1SL 1FBIH 1QLRA 1H8SA 4PJXE 2IAMD 1VEOA 1A4KA 3T0EB 3ARGB 3BGFB 1A1MB 3EHBC 3OMZA 2IBGA 3LKOA 3WS6C 3IJHA 5KSBA 3VH8B 4MSWB 3MRHA 4LCWA 1FBIL 4MX7A 5IB4B 5D7KE 1DLHA 4IOIB 2ARJB 5SWSE 4XI5C 2YEZA 2MFNA 4AENA 4X6DA 1I7TA 2CPCA 5E1HB 2WBJD 2V2TB 1TMCB 4LSDA 4JREB 4YQXH 1YQVH 5EO9B 1Q1JL 3UCRA 1U3HD 4G3YH 5IHZB 5F88B 3T0BA 4L5FH 1Y6NR 4NUGH 1AFVH 2C26A 2R0ZH 4XMPH 3U0PB 3VDAA 1LWRA 4NQCD 3BH8B 3FO1B 1IMHC 3OWEA 4Y8AA 3X13B 4L8SB 4U1SA 5CMAB 3QIUA 4YQXL 1YQVL 4G3YL 1MJ8H 4HUWB 4NUGL 4EBQL 4XMPL 1FYTB 3SDAA 2ZSVA 3S8WA 4TYUA 1MIMH 1NKOA 2FR4B 4I13B 1FCGA 2Q8BH 1IC7L 3PQYD 1CIUA 3V8CA 4E5XB 1X5GA 3MFGB 3WS3A 3H3KA 1NC2D 4HIJB 3LQAC 1MJ8L 5AAWA 1QHOA 4KRMB 5JXAH 4YXHH 5JHDD 5E8OA 3GJFH 4J3WA 4U05A 1NEZB 1BWMA 2OL3A 1N3NA 4CU6A 5CEXA 2ZSWB 1FGNH 1N26A 3MREB 1EK3A 5HI4C 2Q8BL 5A43C 3QDMD 4BZ2H 5E4EC 1KLUB 4XMKH 4X4ZA 1B4RA 2FYYA 1ZLSH 1FL5A 5T3ZD 4KY1L 2H32A 5DJ2A 4YXHL 4JRYB 1QACA 1ZTXH 1FGNL 4LSVH 4UDTA 1KIPB 4XMKL 5DUBA 4QXUH 4Y4HC 4PGDB 4Y19E 3IAPA 1JGLH 5FYKE 1F4YH 1RZGA 1ZTXL 4YHYC 3O3EB 2BVOB 4LSVL 3QCVH 3ILQD 3Q5TA 3I6LE 1QFOA 4QXUL 5INCB 3MV7E 1RURL 1CDYA 4MD4A 3E6FB 1F4YL 1LK2A 4TNWK 1FFPA 3QCUL 2YC1B 1S78C 3QCVL 1J8HB 4PRBA 1A7BA 4HUXB 4U1NB 2RIKA 5CHNA 1EFXB 3HUJE 1A6VH 3PL6A 4BFEA 1MCRA 1PG7H 2CDFA 1QSFA 1T1XA 3NIFE 4XPBH 3B5GA 3TO4A 1M1SA 1NPUA 4EDXB 3FB5B 2BVQA 3QXUA 4FZ8L 2NY5H 3MODH 4HX1A 4WCYH 2VWEE 3WUWB 4IDJH 2NW3B 5C0CB 4KMLB 4F7TA 3V6ZA 3DIFA 3VRJB 2R0WH 4XPBL 5EZOL 4GXUM 4ZPTA 3T0XA 5E94B 2A6KB 1UEYA 5E5MB 2NY5L 4V1DE 5GS3A 2ZUXA 1E4KC 1RFDH 4P46A 5C07D 3C8DA 4IDJL 3EZ8A 2PYEB 5JW4M 4W4NA 1KGCD 4RISH 2R0WL 4ZOAA 3LN5A 5T3ZH 3MRJB 1QVOB 5GS1A 1NAKH 1IGCH 5LG1A 2J7LA 3EDEA 3W5NA 1RFDL 1RU9H 2XPGA 1H15A 4IRSB 1A1OB 3BFOA 4JN2A 4RISL 1M7IA 1KPUB 3NH7H 3CDCA 5T3ZL 3QFDA 2Z91A 1FZKB 4PTTA 1IC5H 3LKQA 2BJMH 4X9IA 1JJUA 3T4YA 4PV8B 1WBYB 4LCUA 1D5ZA 1LEGB 5D1QB 1P7QD 5HVHC 4MXQD 4JFPA 4OZHE 3NH7L 1HK6A 1T20B 4H1LH 1KN4H 3BPCA 4HPYH 1ORQB 5LGJB 3VFUB 3DRTB 5ICYA 4HDIB 3QUYD 4MJ6B 4XBPB 4R7NA 3TVMC 2KH2B 1E28B 3VFVA 4P99A 1AIFA 3IDYB 3BPOC 2QR0B 5FKAA 1EVTC 4TPRH 3V2AR 1KN4L 1XF3A 4HPYL 3ZTJG 1C7SA 1G7QB 2F74A 5K9QI 3O3AB 4JHWL 3FO2A 4NOBA 3BP7B 1PY9A 2YRLA 3X11A 4WFHE 4TPRL 2ADFH 5D7IA 7FABH 3ETBF 2ESVD 3JTSA 4UUJB 1WISA 4MSWA 5B39B 3MRMB 4OCMC 1AHWB 1RZJC 3P4OA 4WEUD 1WICA 1KTLB 1RULL 4EJ1C 2YA2A 4MS8C 2D2OA 4NKDA 2ADFL 7FABL 3QULB 4XBEH 4V2BA 1LO4H 4LU5L 2V2TA 4WEBH 3HAEB 4P57B 5EO9A 2A73B 1T83C 2EE9A 2VDNH 4FFZH 5FUZL 4HD9A 5F88A 5JDSA 1N4XH 3PWJA 1PKQB 1AO7D 4Z7OE 1T80A 4NFDA 2UWEB 1MH5B 1K3IA 4XBEL 1LO4L 1OP5H 3DYPA 4NNPH 3CK0H 5DMJB 2PUQT 4PRHD 5CUSH 4M93C 3B6SB 2VDNL 4FFZL 5HYSA 5J12C 3MGOB 3KJ6H 1TCMA 4TTGA 1FYTA 3BE1L 1N4XL 3UTTA 1Z5LB 4N0FA 4WTXA 2OLDA 3IRZA 2I24N 4TSCL 5D2LF 2VDQH 4UNTA 3SO3B 4NNPL 3CK0L 2VZVA 3ZYZA 4E5XA 4JO3L 5CUSL 1IGJA 3GSQA 4PFEA 5E08L 3L3OA 4P3DB 2AQ2A 4PJDB 3TNMB 1ED3B 1XF1A 1Q9KA 5C0JA 5FO8B 5F1KC 2VDQL 4F3FB 1J05B 2DLGA 3O0RH 1JNJA 4FQCH 4X9FA 4RIRB 1OHQA 2Q3ZA 5DJ6B 2JLLA 1K8DB 2R4RH 5D71L 1KCUH 1K2DB 4R4FH 4YHLH 1KIPA 4HWUA 4TVPD 4NNYB 4FQCL 4PJXF 1RZ8B 2R4RL 5HGDA 3UDWA 1FGVH 3B9VA 1S7TA 1KJ2B 4O4YH 5KAQG 2F8VA 4N0UA 1LO0H 3VXPB 1IGML 4EEEA 3NIDE 3WXVH 4KJWD 1FGVL 3MRFB 3JVGA 5JW4N 3MRGB 3EFDL 3EO0B 4K9EC 3TIEA 5DYOB 5L2KD 4P9HH 4O4YL 4LHJB 4LIQH 5F7HA 1VFOA 4HUXA 4U1NA 1FYHB 4L3EA 3C60A 1JGEA 2BCKA 2NR6D 4ZS7H 4NJAL 4XNZC 1R3JA 3FT3B 1F8TH 3O9WB 3KLHC 4P9HL 3FB5A 3RDTB 4LIQL 1ES0B 4GAFB 4IHOB 3UBXG 3D85A 3KPRB 2GW5A 1WLHA 5IBUG 3WUWA 2X4TB 4XRCA 4RCAA 3RNKB 5DHVB 1KCVL 3HZMB 3ARDA 2VNCA 4DFIA 4XNUL 1F8TL 1V3KA 3O4OC 5BXFA 4KK8D 1ZS8A 1MFEH 2YD1A 5E5MA 3MJ8B 4WUUB 5AG9A 3DMMB 4HQQL 2Q8AL 5SWZB 2BOCB 1G9MH 5JOPD 5IKCA 5I16A 5KSAA 1I9IH 2J8HA 4KMTH 2OMNA 4KHXL 3UTQB 4N5ED 4HC1A 1MFEL 4KFZC 3L3DA 3O3BA 4XTRC 2PO6C 1WCQA 4QOKA 2IBZX 1G9ML 3RVWD 4NP4H 4IRSA 4R3SB 3V4VH 1TETH 1IJ9A 1SYVA 3LPFA 1E4XI 1I7UA 3D3VB 3MRDA 4C83B 1N7MH 1VKXA 3PGCB 2RJMA 1FZKA 2FLBT 2XTJB 1I1RA 3HB3D 4LMQI 1A3QA 5F9JB 2VXVL 1S7SB 5D1QA 1T0NA 2VZ3A 3WJLC 4BH7A 5KJRH 3WS6A 5M95B 3QRGH 1OLZA 3U83A 1DQTA 2ZOKA 1N7ML 3QIWD 4QHLB 3FHQA 4F37K 1MI5D 1XF2B 1CR9H 1WIOA 2E8YA 3BWAB 1QFWI 3VFUA 4OFPA 3DRTA 4HDIA 3RWDB 2R4SH 4DUWA 4JM2D 3SCMC 4NUJB 4DN4H 1SM3H 3BSZH 5IMOA 1BVLA 5BOPA 4FQXB 1AQDA 1UM4H 4JFED 3U0TA 5FUCE 1G7QA 4XNQA 1TENA 2O5YH 1TQBB 3HC0A 3O3AA 3EYSH 4NSKA 2R9HD 4DN4L 1SM3L 4M8VA 4ZAKD 1CDIA 4CVWA 3BP7A 1IGYB 1NBZA 5DA0B 1WWWX 3MV8A 1LDSA 5KBNC 1WT5C 2JB5H 4X9HA 4JDZA 1UQSA 4NQUA 1OTSC 5B39A 3FQXB 2DWDB 4WW2C 1ZA6A 3DJ9A 4BM7A 2D4FA 2VXTL 2JB5L 5B3JE 2CKBH 3LRGA 1G7LB 2GAZA 1WJ3A 3HAEA 3PWPB 2A73A 3U36B 2Y72A 3UPCA 3OL2A 2EXYC 1CXKA 3L5XL 3ZKXB 4TOYH 3MGTB 3EYQC 3WJJC 1A9BB 1QSEE 2UWEA 2I60H 4PREA 2VB5A 3ECBB 2Q87A 2FH8A 3SJVB 5FGBC 5CJQH 4G8EA 5CJ5A 3MGOA 4KWUA 3T77B 4CMMB 3ARRA 1Z5LA 3VWJD 4JANA 1LK3H 3QQ3B 4Y4HA 5H94B 1WGOA 3MYJA 5CJQL 4U33A 2AXGB 1IKFH 1FJ1B 1KPVB 4P3DA 3K81A 3FQNA 2VDMH 3V9FA 2NY6D 3M1BB 4HCRA 1LK3L 5IB5A 1J05A 4F7MB 4L1DA 1TITA 2E8ZA 5FA4A 1VGKA 4F7PB 1IKFL 3HZYB 3C2AL 4IDLA 2WMPA 15C8L 1W0VB 1C08B 2VDML 1XAUA 4W6YB 4GXVH 5F3HB 4HIHB 1F2XK 4FXGB 4YX2H 1XGYH 4Y16B 3RA7H 1JP5A 5D5MB 4URTB 2ZWLT 3U9PH 4JFOB 4FQ1H 4OD2B 3EO9H 2BVPB 4XHQA 4M6NH 4NNYA 5FUOH 2X7LB 5HPMA 3B4NA 5F7YC 1H3VA 4PJEF 5FO9A 3P11H 5GISL 4PGEA 1SY6A 4XH2B 1NGYB 4YFLI 4BFGA 2GY5A 1KJ2A 4PY8I 4ZUSB 4FQ1L 3EO9L 4JFYA 3PG2A 4GBXC 5HYJB 1MPAH 4LASL 3KPSB 4OZFH 4M6NL 5FUOL 4HUVA 3VXPA 2ORBL 3KPNB 1K8IB 2BY1A 3EO0A 3VFTA 2X4QB 2B4CH 2MNUA 2R69H 2D9CA 2B39A 2GIYA 3D9AH 4J2XA 2LTQC 5AEAA 3MV9E 4YHIB 1J8KA 3ARWA 3HNTH 4QEGA 4J8RB 3LDBB 2NY1C 4L4TD 2H8PA 5JHLH 1MCSA 3GIZH 4KV5E 2B4CL 3RDTA 4JO1H 3O6KH 5DEFB 3WO4B 2LAGB 4KRPB 3PNWA 4F7CB 4L29B 2NY2D 5IFAH 5DHVA 1FIGH 4FN0A 2WSKA 4Q97A 3SDDD 3RVVC 3VXMA 5TDNA 3OTTA 2AXFA 3GIZL 4GRLD 4EI6B 4JO1L 2C3WA 4JO2L 4WUUA 3R1GL 3DMMA 3AS0A 2J8UA 4BZ1H 3MUZ1 3I85A 1P5VA 5IFAL 4ONHA 2VLRE 1U8HB 1FPTH 3G6AA 4F8TA 2A6IA 3QWRD 4MQ7B 4LNVA 4G6AC 1G9NC 1MCOH 3NACL 3ARVA 4DOHB 4WI7A 1DBMH 4BZ1L 2R2HA 1CDHA 4R3SA 4D2NA 5B4MC 5HHOB 1J1OH 2NXZC 1XGQA 5HDOA 1MIEH 3HLAB 5IW3A 1N5YH 3FN9A 1KG0A 1NLDL 1DBML 1CU4L 5CZKA 1YEGH 2EE3A 3LD8B 1BFTA 5F9JA 3QEQA 3K3QA 4M61A 4QXGL 4HMDA 1J1OL 2CSPA 4QHLA 3D48R 3QPQD 1XF2A 2B1HH 4F9PC 3BO8A 2PF6A 3QUMA 3NBNA 1KCRH 4OM1H 2KQMA 5CEYB 1T83A 5GJTH 1VFUA 5EOCL 3QAZC 5I71C 3BXNB 5CJOL 2CK0L 1I7ZA 1CICD 3RVXD 3P0GB 4MZ2A 1KCRL 2A9MH 3BPNB 1E0OB 4ISVA 1IGYA 4OM1L 1XGRA 1JRHI 3FMGL 2YD2A 4TVSa 4NM8H 1G7PA 4MAUL 1QUNA 2BZDA 3OR7B 3AS1A 4MVBC 1HWHB 4NQED 3ULVD 3JUYA 3UAJD 2VDPL 2Z31D 5C9JB 2A9ML 2YPKB 2ZG1A 3BZDA 4I3GA 1CVSC 5HYEA 5K9KB 3G5VB 2VLKA 3CLFH 1F4HA 4BK5A 5HYIA 1G7LA 4WHCA 5I66A 4Z7VA 2ATKB 4C56E 2I9TA 5AZEL 1JZ3A 4K8RL 1LEKA 4FQHB 3D0LB 3NZHH 3LKPB 2ICWI 3HCVB 1I9EA 1UENA 4K3EH 5GGRB 3UTSD 1UZ8A 3CLFL 3U2SB 4PRDB 1R3KB 4PGBA 3UPRB 3TESA 3ARSA 3OHXB 5F7WC 4P23A 3FB7A 4G9DB 2DKMA 3CFDA 4TRPL 1FH5H 2HFTA 3K4ZA 4X6EA 5C0BE 4CMMA 5EPMA 2O26U 2AV7B 3UMTA 5TE4H 3UC0L 5C8JB 1S7UA 4G6MH 4K94C 5EULV 1ORSB 3C9NA 3DX6A 1BD2B 1MCWW 3EJYC 5H94A 4NHCH 1ADQH 4U1MA 2EH8H 2AXGA 3H9SB 1KPVA 3WFZA 2WV3A 4G8GA 4WTZG 5TE4L 3CZJA 4G6ML 4GKNB 2LABA 3QQ9D 4JDVB 5D7JC 4Y2DC 2VL4A 2WBWB 3L6FB 1OB1B 4NHCL 1ADQL 5ANMA 2EH8L 3BPLB 5E2WH 4LHUG 3UYOD 1Z3GL 1PJ9A 2VUYA 1C08A 1RUQH 5EO0B 4HIHA 4FXGA 3RHWF 4Y16A 3R06B 5D5MA 4QY8A 5JNYB 3O11A 5E2VH 3ULUD 4UV4L 4OFVA 1MSPA 3GMPA 3EBAA 5HHVH 5E2WL 1T3FB 5JXEC 1KJMA 2VAAB 3Q6FB 3P4LA 1NMAL 4TUJB 3HS0B 1RUQL 1KT2A 4BUGA 3CNKA 5KVEH 4XGZB 5ERWA 4LSRH 5IK3B 1NGYA 4ZUSA 2W1NA 3V4UH 4WWKB 1RJYA 5HHVL 1Q9OB 2X1OA 3RU8H 4N5UA 1DUZA 3VWKD 4PJ9C 2E7BA 4L8BB 4NO2B 2X4QA 3GO1L 2EDOA 5IJVA 1T1ZB 4HZLA 4PJ5E 4GKZB 3V4UL 2DJUA 4ZS6D 2EIEA 2CJUH 3W11D 4D9RD 2APXA 1WUNT 4LVHC 4DEPC 3FQTA 3RU8L 3TJEH 3GHEH 3ARTA 2YPLB 3BGAA 4MAYB 3MRLA 1KB9K 4PYHA 3B9KC 1Q0XL 4JJHA 4ODXB 5C09B 2YS4A 4MZ3A 1LVEA 3DXAD 2CJUL 5E2UH 5E6IB 3LVEA 5DLML 4L29A 2Y7QB 4L8CA 4LLDA 3QXTA 1IAIH 2KUTA 2F15A 5KSVB 1FLTX 4P59L 5I73B 1KUMA 1NCCH 2VITA 3G6JE 4WNQB 2ZJSH 1X6LA 3O4LE 1UB5B 3RKPA 3WJLA 4DGIH 2YWYA 5FO7A 4UOJA 4M62L 3TBSB 4ZO7A 1I1YA 3TBWA 1IAIL 2XYCA 3T1FA 4BQBA 3BH9A 4ZFGL 3FFDA 2Q6WB 1NCCL 1S7RB 3IDIB 4HFWA 2ZJSL 5JOEA 3MJ6A 4WIQA 2JE8A 5HYQA 1U8LB 5HI5C 2ZUQC 4DGIL 4HLZG 1UJ3B 2P24B 2HKHH 4ZNEA 1JNHA 3ULUH 1JE6A 1RZFL 5EBGA 3BP6A 1BBDH 2IAMC 3VFOB 3NA9H 5CBEA 4GRWB 2NMSA 2EC8A 2HKHL 1XGPA 1WT5A 3BHBB 5EZJA 4YEFA 3ULUL 1MCQA 4MXVF 4JAMB 4XCFL 2DF3A 3ZTJH 4CN1A 3AGVA 4N8CH 3O6FD 2APWA 4WW2A 4W4OA 4QRRE 2R39A 3NA9L 4O00A 1BF8A 1MAML 3ROOA 2EC9U 3K8LA 4O5LL 3VXSE 4ZXBB 2DYPD 2QADD 5KANG 3D0VA 4QRQB 2Q76B 3RIAF 4MD5B 4LQFH 2F5AH 2VKXA 3L3KA 1U2HA 3PV7A 3AM8A 3CMGA 2V9RA 4QTHA 1D9KC 3QHZH 4LPVA 1MVUB 2PCPB 1RIHH 1A7NH 5IHLB 5CD3B 3CDGB 4JR9H 4LQFL 1DP0A 2F5AL 4MB5A 4YDLC 2DLTA 4P2QA 4NO5B 2NY5C 2V7NA 3W0WE 3RGHA 1MLBA 3LKNA 1MJ7H 2HT2C 4YHKH 3FZUD 2P8LB 1EEUA 5D7LB 1N59A 5IEKA 1RIHL 5HXMA 1QBAA 4D0BA 5CWSB 1REIA 3G04B 2EO1A 4GAYA 4PGCB 2I07B 2VO5A 1JZ5A 4M43L 4KQ3L 1CYGA 2CRZA 3O41B 5B3NA 4TSBH 1MJ7L 2CXGA 1JWMB 3VJ6A 1B0GB 3HCVA 1QQDB 1F11A 4YUEH 2APTA 1MJJB 3BKYH 4PRDA 1R3KA 4YXKH 5EOTA 3OHXA 4OV5A 1MFAH 3MLYH 3RWHA 4YAQA 4UAOB 5DS8B 5DMIH 5CSZB 4HFUH 1U8MB 3QJHA 3IAQA 2VABA 3BQUD 4MCYA 4NO0D 5HHMD 4S0TD 1IILE 5C8JA 4WI4A 1A1NB 4HBCH 4YXKL 5L8KB 5DZNA 3C5ZB 5J6HB 1YC7A 1I1CA 5D9SA 4OLZL 2Q7YB 3ILQC 3HNVL 4MA1C 1AE6H 2XY1A 4L4JA 4GBXA 2OTPA 1A6PA 1G6RL 4RZCB 2NY7H 4ZTOH 1BQSA 1HN1A 3FT4B 2EIZB 2IADA 5FCUH 1T5XA 3ESUF 4CNIB 4DZ8B 1AE6L 4I8DA 1MVFA 1XF5A 1BQLL 2NY7L 4ZTOL 5JNYA 2UWEF 4JFHD 3LSOB 1BHGA 2OJEB 5TE6L 3HG1D 5FCUL 2VAAA 5B38A 4PJ7E 4TUJA 1BIHA 3C5SA 1O7VA 3KPTA 3UTOA 4JFDE 1F3JA 2V2XB 5I1EL 2RAMA 3LS5H 1A3RL 4WI8A 2DQUH 1Q9OA 2PW2B 3CFKA 2Z8RA 3EDDA 5D6DC 2O61B 4H26B 4EIZC 1TZHB 1CK0H 4PJDF 4L8BA 2MHAB 1T1ZA 5DR5H 1NBYA 3DRQB 4PYGA 3LS5L 2E9WA 4X99A 1EHNA 3W81A 1U58B 4JB9L 4JVWA 4OI7A 2YPVH 2EDTA 3O81A 1CK0L 3DSNA 3HR5A 4I2XB 4NRZB 3QUKA 1V7MH 4HK3N 4ODXA 5H35B 2FJHB 2LU4A 1OD9A 1UXSB 3L5HA 3QSKB 2QQKH 1UG9A 3MACL 3OBAA 1HI6B 4ZFFA 4R0LA 5C7XL 4JHZA 2YPVL 2JIXD 4WNQA 4NZRL 3WNMA 4OD3H 1V7ML 3RNQA 4KKCD 5I18H 1SEBB 3U48A 4KGJA 4EKXA 5EN2B 2AJSH 2QQKL 5DJCA 3PWNA 1DDHA 3QFJA 3QUYC 2Q6WA 3P4MA 1S7RA 3IDIA 4M6OH 2WBJB 4IJ3B 1EEZA 4KK6D 4P5KA 3TZVD 4QWWD 1FLRL 4UMGA 5I1CL 1YDPA 5I18L 5EC2A 2EKSB 1J0ZA 4OZGA 1AGBA 2AJSL 4ZUVB 1ZLWK 2C9AA 2KDGA 3HE7D 2UY6A 3MLSH 1WSST 3VU2A 4MA3B 2X09A 2N7AA 3RWIB 2OJZL 2GJ6B 3EOYG 4JHAH 4Z7QF 1VFAA 4XVUD 4FXLA 4WFFE 5DURB 3O8XC 3FO9B 2R8SH 3MLSL 1UCBL 3TBVB 2BNRA 2X40A 3C09C 4EUPB 3PWVA 3K4DA 1IAMA 4Y4FD 3DO7B 2XKSA 4OAWB 3S35H 3WLBB 4MD5A 2R8SL 4GUPA 3H9ZA 4P9HC 2AKRA 3RBSA 1QFWM 3GUTB 5KVFL 5TQ0H 4JFFD 3Q0HA 4YEEA 3U6RA 4U0RB 4YHZH 3H7LA 4QRPD 3CFJA 5C08A 1JUFB 4UIMB 4TSAL 3N1FC 3L5WA 4AK1A 2W65B 4YHZL 2DOCA 4KVCH 3G6JF 2JCCB 1NEZG 3N50A 2E9IA 2AK4B 2ZCHH 5F6HJ 2NY0B 2DIAA 3E1F1 1G9MC 3PDDA 5D7JA 1K3ZA 4QLRA 4AIXA 5T3XE 4LLQB 1QQDA 4KVCL 4Y2DA 5C9KA 1MJJA 3MLWH 3P77A 4KUCF 4MMXC 4LDEB 5EBWB 4I4WB 2FBJH 4HS3B 2FD6H 2H3NB 3UX9B 5DS8A 1PGRB 2XV6B 3TC9A 2BVEA 5MENE 1QRNB 3MLWL 4XBGB 3EKCA 3F62A 4UTBH 5ETUA 5CP7A 5MEQA 3O2WL 2FBJL 3P9MB 5JO5B 4LVOC 3W39A 1RK0B 5H2BB 1BWWA 5D96C 4PRPA 3T1WA 1OAQH 1F13A 3OAZH 1W2KT 1ZLUH 4ZFZA 3F7PC 4HKJB 1N6UA 3QUXD 4NZTH 4KJWC 3OJDA 4PJAA 4ZUTA 4MNQD 3LH2L 2HRPH 2ICWB 3FT4A 3W9EA 4YGVA 5DMKB 2EIZA 4Q2ZB 3ARXA 4PJ9A 4CNIA 3GSUA 1EEQA 2V2WB 4DZ8A 1OAQL 1FV1A 1MY5A 2NR6C 3EDKA 4ZG1A 5ID1A 4G9FE 3WFHB 2G5RA 2A2QT 3QDJE 2HRPL 5JIKA 1OP3K 5EIIB 3R8BB 1WWBX 5TGBB 5EU7C 3H3PH 4QRTA 3WUWG 1AD0A 4I5BB 1BOGB 2OMBA 4FP8H 4MQTB 2X89D 2V2XA 3E8UH 5BS0E 1PW3A 1RMFH 3ORJA 4Y1AD 4ZDHA 3JV0A 1HZHL 4X0KB 3H3PL 1WC7B 1YEIL 4AM0A 4PJCE 4H26A 4P2RB 4OCXL 4UOW1 3I84A 4FP8L 5CIPH 1FZMA 5K59E 1RUMH 2NNAB 5L7XH 2FWOB 1A9EB 2EEDA 2VLJD 1NFIB 4N5EC 3GJFA 3D25B 3RY6C 2ERJB 3FAWA 1Q0YH 3VGHA 5KSBE 4LCWE 1J1PH 1CGSH 1LNUA 3RVWC 5DJ8A 5D6CB 3TCLB 5FGCB 3Q48A 5L7XL 4PJFB 3SPVB 5H35A 4E41D 4X6DE 4UIKL 4X7DC 4NQDE 3I6KB 2K7PA 3HB3C 1HI6A 1OAZH 1J86A 2IAMA 4HWZB 4RGMB 1CGSL 1OT2A 1XIWD 3GJFK 2MMXA 2FJFB 2FO1A 1VACB 2UVFA 1XT5A 4PJBB 1E6JH 3QIWC 3B43A 5E9DD 4P9ML 5DXWA 1JZ7A 2W60A 5E7BA 1OAZL 3TEUA 1NGXA 3OB0H 4OCRH 3AVEA 2R1WA 2WBJA 2E6QA 1KULA 3SGEH 4P5TD 1NH6A 1NAMH 2G75B 4L8DB 1E6JL 5FF6B 1U3HA 1VGEL 3FT2A 4M3KB 4ZUVA 1K4DA 4OCRL 4TULH 4RMUA 1D6VH 2NLJA 2PW1B 3IDNB 4ZAKC 4NQCA 5I6XC 3KHOA 4H88H 2FO4B 1GSMA 3RWIA 3U1SL 1X5HA 4PRHB 4LMQE 3VG0H 3MLPA 3ZTNL 2FL5A 4HKZA 5DEGA 5B39G 1GIGH 1D6VL 3FO9A 2VR5A 1IAKB 5CCKH 1BFVH 4WI5A 4EI5B 4H88L 1HCVA 4MD0A 4Z18A 3PQYA 4AT6B 1UGNA 3JUZA 4EUPA 1NC2A 3T2QA 3VG0L 3HAEG 3DO7A 3CXDH 3RI5K 1QBBA 1GIGL 2L4OA 3FRUB 5JHDA 4M00A 5FYKD 5CCKL 4MQXC 5IMLB 4OT1H 3BEVA 4AY0A 2AABL 1BFVL 4KU1A 2B4CC 4WY7H 3JTTB 2HMID 1C12B 1EJ6A 3R0MA 5DUML 3GSNL 2OR9H 3KYNB 4X5WB 1ZGLA 3GHBL 4M7JL 3VD9A 3HZKB 3WL9A 4U0QB 5HY9A 2A77H 3CVHH 3VWJC 2ZP0T 5J1SC 2WP3O 2G2RB 2IF7A 4KTDL 2OR9L 1LD9A 1MRFH 2W0FB 2VDOH 3LQZB 2DD8H 1S5IL 3WFBH 3MRBB 1QSFE 2A77L 2EDRA 4ONFH 3BZEB 3MNZB 4H1LA 2I27N 4BELD 4PR5A 5LBSH 4HXAL 1ZT4B 4OD1H 2NQCA 5J9PB 4LLQA 1MRFL 3DVGB 2VDOL 2DD8L 1H3PH 4GSDH 2E7MA 3WFBL 1A0QL 5JMOC 1Y18A 3PXJA 4ONFL 3CMOH 5LBSL 4OD1L 3S36X 5I0DA 3MLXH 2CDEB 4YH6A 3MNWB 3SDXE 4NNXA 4XBGA 4GSDL 3SKOB 4TNVF 2P42B 4I48A 1PD6A 3X12A 5GRWA 4MJID 5IMMB 2E7LC 2W59A 1SVZA 5ALCL 3NGBB 3VXNA 1KC5H 4FTVD 3ZDXE 4HKJA 3DI2B 1NANI 1AXSA 2JK5B 2NX5D 3TN0B 4LRIC 1RIVL 5GS0L 5J89A 5AZ2L 5FB8A 5C07A 5DMKA 1SMAA 1KB9J 1IT9L 5KG9B 3EOTL 1KC5L 5DQJA 4P2OB 5EUOA 3WHE0 4U1KB 4HV8A 5DSCB 2MOVA 1FNEA 1ZEAL 1IC4H 1EO8H 5T3XL 3SKJH 1ZV5A 1BBJA 4NKQB 5D1ZB 3JV4B 4HGWB 2EZ0C 1IGTA 1XZ0A 2DTMH 2NY2C 1PQZB 3P40A 1A02N 1IC4L 3H9HB 1ACYL 2F54D 3SDDC 2EC9T 1JI2A 4HGKC 4GRLC 3SKMA 1P7QA 5EG6C 2P7TA 3P0VH 2UUDH 1ITBB 3C6LD 3HNSH 2IMMA 1BGXL 1A9EA 5C0EA 1AJ7L 1X7QB 1NFIA 2PR4H 3QUYA 5D7IE 1U91A 3D25A 4JM2B 3KXFD 5DQ9A 1KLFA 4NPYB 4AEFA 4I9WE 4JKKA 4KAQL 4EN3C 4JKLA 3P0VL 3L1OH 3M8OH 5TJWK 5FK9B 2IH3A 3HNSL 3TCLA 5IB3B 1YJDH 3GM0A 2FB4H 3GBML 4U7SA 4X6FA 2XWJB 1RJCA 4H0IA 2VR9A 3MJ9H 3PUCA 3VI4E 5EU6B 1GGYA 4OLVL 3L1OL 5J11C 5DJXB 5DC0A 4HLZH 2FJFA 3OKOA 1MQKH 2V5YA 3RAJL 4JO4L 2FB4L 3RQ3A 4JZNA 1ZVHA 1I9JH 3QPQC 5JMRA 3QA3B 4GG8A 1JZ8A 5CGTA 4O2CB 4POZD 4AYFA 2OM5A 3U30B 5JDJA 2CLVB 1JL8A 3MPCA 1IRAY 5K9OB 4GQ9L 1A4JA 5D4QA 2EYTB 1YMMD 3UTTE 4RQQB 3PF2A 1CVRA 2EYRB 4XHJD 5I2IB 5C6PB 1J0IA 1ZOXA 4HIEA 1DQJB 4XP9H 5F7UA 1CICC 3ALPA 1RIUH 1AO7A 4GLRI 2KPNA 3IDNA 2H1PL 3N9GL 3B2VH 2FO4A 1EFQA 1UYWH 3BRFA 4RGND 4PRHA 3ZHLA 1UVQA 2VQUA 4XP9L 5GQBA 4DW2H 4JJ5B 5F1OB 4XNMB 3G5ZA 1RIUL 4BQ8A 5BV7H 1DQQB 3UAJC 2Z31C 4ZO8A 2LV4A 1C16B 1UYWL 4AT6A 1YUHA 5MERA 3OR6A 2GITB 5KW9H 2ZZUT 2KZWA 3OX8A 5BZDA 1CXLA 2LE9A 4ELKB 3FRUA 5DDHA 5IMLA 1G7HB 4HWBH 4IS6B 1H9VA 2DQCL 2G60H 3JTTA 1KJVA 3OKDB 4NRYB 1S9WB 2BNQD 1Y0LB 5D70H 3A6BH 5C2BH 4N0UE 3KYNA 4X5WA 1QPPA 4ZODA 3F7YB 3NTCL 5D2NB 5INDA 1MY7A 4AEHH 4RAVB 3RPKA 1KXQE 3UZVB 1OGAB 2CIIA 3PHQA 4ZUWB 5D70L 3A6BL 2EIDA 5C2BL 2RHEA 2H32H 1I85C 4L3EE 2DM2A 3T2OA 2GTZA 4M7ZB 2OL3L 5C0IA 3MUGA 3R0NA 4H0GA 1RUPH 1ETZB 1CQKA 4PJIA 1L7IH 1JV5A 1TNMA 2JTDA 3PDOB 4FRWA 3MNZA 4HK0B 4RA3A 5F6IB 4Z78B 3FB6B 1OAKH 3DVGA 1NMBL 5L2KA 1RUPL 4L9DA 1B9ZA 3T3PE 1UACH 1FFOB 2MQ0A 2D7MA 3BI9X 2H41A 1OAKL 3MRRA 3ULUC 3RJQB 4NQXB 3UROR 2IAND 3FB8B 3MNWA 5C70A 1LILA 3MMEB 2I9LA 5DVLA 3TGXA 5BW7C 1UACL 4HPOH 1U93A 4LOUD 3ULSA 4PJ8B 2G5BB 1FL6B 2CUMA 4QOKE 5BJTB 1UWGL 2P43B 1QFUH 2PO6B 1C1EL 4F9LC 3I2CH 4NBZB 1X5ZA 2A6JB 4HPOL 4Q6IB 3S36L 4X5XB 3CCHB 1MCHA 3N0PB 3VWKC 4BFIB 4QT5B 3T0ED 1KTDB 5D1XC 3ARGD 2CKBA 1TQCB 4ZS6C 1IQWH 1S9XA 1YNTB 3GSWB 3FN0H 1P4LB 5TDOA 3W11C 3ARFC 1I8MB 1DSFH 1GL4B 2EDXA 3D39E 3RY6A 2IPTH 5GIRB 3RKDC 3TH3T 1OSPH 3QXAA 4OF6A 3SGKC 2DQTH 1IQWL 4W70A 3OV6A 5D1ZA 3JV4A 43CAB 4HGWA 1R6VA 1DSFL 1FIEA 1NGWB 4F33B 1A3LL 3IXTA 3IDJA 3OJMB 1ZK9A 5IP4A 1CE6A 3MA7B 3CZFB 1U8JA 5IMKA 1NCUA 3W5MA 1HHHA 5ITBH 3P73B 3QIWA 2IBBA 1MI5A 1F6FB 3RUGA 3V0AC 5J13B 1FYTD 4EDWL 4G8FA 4Z7UB 4JM2A 5CEZE 2HH0H 2PTTA 2X4SB 1I9RH 3MSPA 4NQSA 4XCNB 1HHJA 5DD5L 1G7IB 2K3TA 3ZKNC 4JFEA 3V5DB 4OGXL 4OBRA 4N90D 2C1OA 2XWJA 1QLFA 2ILLA 2DN7A 1I9RL 4ZAKA 2EDWA 4P4RB 3SDXF 4QHMB 3ZE1F 2SEBB 4KMQA 2CO6B 4ERSH 4Q0XH 4JRYD 1S7VB 1MWAB 5EU4A 3ARUA 2DQFA 4O2CA 4JKMA 3ZE2E 5BVPH 4OZFA 4U7MA 4RQQA 3OG4B 2AEWA 4ERSL 3SQOH 1NCBH 2VTFA 4Q0XL 5E99H 5HGAB 1HHGA 1OD7A 3IYLW 1J12A 3BP5B 5BVPL 5GSRA 3VGEA 1BECA 1F4XH 3PWUB 2J5LB 4B7IA 3SQOL 5E99L 5GPRA 4OLXH 3PGDB 1BLNA 4ODTL 2YMXL 1IGFH 4JJ5A 3KYMA 5IVXA 1J8HD 3VWJA 1D5IH 1EFXD 3FZUC 4YFLF 3C8HA 3MFFB 5E8NB 1FE8H 4K2UH 1EAPA 4OLXL 5C6TH 25C8H 4LARH 4JKWA 3QI9B 1CLOL 4Z77A 4Y5YC 3GB7A 1X9QA 1RVFL 1G7HA 3UJTL 4IS6A 4MHHG 5C0CD 3BKCL 1FE8L 2NW2B 5IHUL 5CILH 3KWWB 1OTUD 1S9WA 25C8L 4LARL 1A5FH 1FCCA 1Y0LA 3QDGE 3GMOB 2Q86A 5GS2H 1G84A 3BEWB 1RJZA 5F3BB 4LLWB 2EECA 5CKGA 3F7YA 5D2NA 1T7ZA 4CVZA 3T65A 3CD4A 2PYED 3DYOA 5EU3A 3BQUC 4ELMA 3RWGA 1JPFA 3NZ8B 3WNNA 5CILL 4P5MA 4S1DC 4RAHA 4WU7B 5DO2D 1A5FL 3STZA 1IKNC 2QTEA 2EXWD 3RWJA 2IBZY 3BX7C 5AUMA 3S37X 5KS9B 4NKOB 1UXWA 4IRSD 1MJUH 2CUIA 3GKZA 5DVMA 1NEUA 2AJUL 1CLYH 4KI5F 2DWEB 2KQNA 4U31A 3FB6A 4LRIA 3HE6B 2M1KA 4ZSOB 3WNPA 4F7EA 2ZKHH 1MJUL 3WNLA 3FCTA 2P5EB 2R15A 3LV3A 4EIGB 3L95A 3VXME 2J3SA 2V6HA 2YBRB 4NC2B 1CLYL 3ZE0E 4CMHC 2FX7H 2BVUA 2J8UE 2PTUA 3WIFB 5B38G 1FN4B 4L4TA 3VD5A 4HUUB 4MB3A 2YA1A 3MMEA 1FNAA 1J0KA 5HDLA 4KQ4L 1P7KA 4HHAA 5D8JH 4MWFA 4NWTH 4OZ4B 4U1GB 3RRQA 1OARL 4BQCA 1U9KA 3SDDA 4DKFL 3A6CL 1IEAA 1RZIB 4LAJH 1LE5B 4GRLA 4K3JH 2A6JA 2JCCF 5HDBF 4BFIA 1DL7L 3IDMB 4M4RA 1KTDA 1JHTB 1DJSA 1JK8B 4XNXH 3HHRB 3MCKA 2AJXH 2C1PB 2HN7A 3RGVB 1U8KB 5KVGH 3GSWA 1P4LA 5T5NF 2VKWA 1D5MB 3QEQE 3QWRA 1RPQA 4U1HB 5EZIH 1EERB 3VGGA 3ZL4L 3MRKA 4TN9A 3LIZH 3SKNA 1UWEH 4TUKH 1FG2A 4NC1C 3C2SA 5KVGL 4UT6H 5IR1B 4HC1H 2GTWB 1J18A 2X41A 4YR6A 5EZIL 5ID0B 4F33A 4LSUL 4OBSA 5IBTL 3RVTD 5DD1H 2W9DH 4RA0C 1UWEL 1U8OB 4TUKL 4YDJB 4KKCC 2DBLH 4IOSD 3QAZB 2P8MB 1I8IB 1IM9D 4HC1L 1OOAA 3O6FB 3P73A 3PWLA 3TT1H 3VRIA 4UQ2B 2ED9A 3K80A 1FORH 4BFBD 1ZWIB 4U6HA 5DD1L 3SEPA 5DVOA 2BRRH 3L3JA 1IC1A 4KK6C 4OF7A 2BSED 3VE0A 1N0XH 4QWWC 3TZVC 2WQ8A 2YKLH 5FYLE 5JA8B 3V4PH 1BZ7B 4XCNA 1G7IA 1VENA 3TT1L 2R2EA 3T3PF 3QNYB 3V5DA 1SJXA 3AS2A 3HE7C 3MYZA 3QISA 4QHKI 5K9JH 2VLKE 3ARYA 2HAZA 2BRRL 2DIBA 4KZEL 1N0XL 4UINL 4Z7VE 3BW9B 1T7YA 4TUOA 4LEXL 4N68A 3V4PL 3LAFA 3EUUA 4XVUC 4I77L 3NCEB 1LP9B 2O5XH 1MWAA 4KUZH 3B8YA 1KB5B 4J3XA 4JQIH 5ESAA 3IFNH 1CDJA 5IG7B 4KTEL 3HRZB 1CDBA 4LQ1A 4ZO6A 1M05B 2Z93B 1PZ5A 4YC2C 3L7EB 1X3DA 4KUZL 3EYOB 5L6YH 5ENWA 1DEDA 4TTDC 3IFNL 3UTSA 3BP5A 5CEZL 3VXUB 4G8GE 3VXRE 1T21B 2N7BA 4NO3B 3HAEH 5E8DH 2ZUWA 4PJFF 3AREB 3ZDZF 5I1HL 4FXKA 3VDCA 4CDHA 5ANME 1AGFB 4F15C 4OZIB 5DT1L 4Q58C 3DVNB 1TTGA 2Y23A 1I85A 3QJFA 2AI0H 3O9WD 4N9GA 4PJBF 5JR1H 1DVFB 3QI9A 2MJWA 3AAZB 2X1WL 3MZGB 4K7PH 2HLFD 3KPRD 5A2LH 5IVZB 3AROA 2NW2A 1ND0A 1MCWM 3EZJB 1TLKA 4X4YB 2B5IB 4S2SB 35C8H 4K7PL 1HH6B 5SWZD 4HCRH 4M8QA 1UT9A 4XCCH 2YUWA 1FO0B 3NZ8A 4PJ5D 1MCCA 4Z5RB 3FONB 2MWCA 4I3RH 4Z0XB 1GRWA 1T03L 3WIHA 5BW7A 2ITCB 4LLUA 1BMGA 3LMJH 5EUKB 1CD8A 4WV1C 5LKNA 4HCRL 2HFEB 3WYRA 2CIKB 3FRPG 4DEPB 4F80A 5A2JH 4YIQB 4X9GA 3V8OA 3D3VD 1EO7A 2DWEA 4F9LA 2DMCA 1MQ8A 2EKJA 3JV6A 2XTJD 2EO9A 3VWKA 3KPOB 1KJ2H 2CMRH 5KVDH 4ONGL 3DBXA 3QR2A 3VFRB 1U95B 1L0QA 2YBRA 3HPJB 3WIFA 4MNGA 1YN6A 1FN4A 3SBWC 4L1HA 1SY6L 4HUUA 1KJ2L 2CMRL 5KVDL 2VDLL 4HIIB 4KUCD 1U8PB 4FQXD 5LJYH 3DXAA 5DRZA 3C08H 4OZ4A 5L0QC 1A6TA 3GEWB 5J06A 2YD4A 1P9MA 2PXYB 2ID5A 4ZNEE 1RZIA 1JFQL 2ICEB 3WFDH 2W0PA 4CU7A 1FFNB 4M6ML 2JELH 3IDMA 5EDXA 3DUUB 3FOLB 1JK8A 1GGUA 2YRZA 4JPIB 5DHVH 2C1PA 3N85H 3H0TA 2YOCA 3TA3B 5IBLD 5CZVH 4U1HA 3WFDL 1K85A 1N64H 2JJUA 4ODHL 1IBGL 1Q9WA 1NDMB 2YR3A 4HKXB 4QRRD 4GQPH 3INUH 3AMLA 3JWOH 3MXVH 5A16A 1E4JA 3PWPD 3OJ2C 3KPPB 4UU9B 4JGUA 1RHFA 4JZJC 1RUKH 4YWGL 3DROB 3E2HB 1KPRA 1WEJH 5T1LB 2MCG1 1CGYA 3LY6A 1G0YR 3DUHA 4YNYB 5DJZB 4HAFA 4UT9H 3QT2A 4ETQA 4YZFF 5GGSY 1XIWC 4NN6C 2VXUH 3INUL 4ZFOA 1WWAX 1IAOB 3MXVL 3IU4H 4GRMB 3FFCB 3U46B 1FZOB 3SJVD 1RUKL 1D9KB 3O6FA 4W81A 1WEJL 4WFEE 1ZWIA 2BOBB 4Y4FB 2ZG2A 1QA9B 3W0WD 4P2QE 3BESR 5DRNA 2DYPA 1NL0L 4P5TC 1OQXA 2GQHA 3IU4L 4O9HL 2YXMA 4N0RA 1FQ9C 1IARB 3O3UN 3VI3E 1OAXH 3FAXA 4RGOH 1FVCA 4WGWB 3ZE0F 3QB7C 4JN1H 1CG9A 3G5YA 3GSXB 4LVNB 3ZHDA 2Z0BA 1AY1H 4LPXA 1MUJA 3NAAL 2VLLB 5F1IA 2C7UB 5LXGH 1QR1A 4LP5A 3HPLA 4LSQH 1M6OA 5E0QA 2V5TA 2LVEA 3ZT7A 1RZJL 4NM4L 4H0HB 4RGOL 1H0DB 3NFPA 4LCCC 1XR8A 3QUML 4JN1L 4EUPG 4Y16D 5EWIH 2YD8A 4ODWB 1AY1L 5IG7A 1U8IB 2Z8VC 3NVQA 5LXGL 4LSQL 4JFZL 2WK2A 1CL7H 2QHLA 2UZXB 5MEPB 4R97C 3X14B 1BX2B 1YNLH 5EWIL 4I1NB 1NJ9A 2HMIC 1MF2H 5JIIA 5HYJD 2DAVA 4JRXB 3BGMB 5HGHB 2OXHA 3KPSD 1CL7L 1YEKH 1SJHB 3ARBB 1E4WH 1I7RB 2XZAH 2BSSA 4R4BB 5FYLL 1A6ZA 5TQ2H 5ESQA 5I74C 1W0WB 4Q74A 3LKRA 1YNLL 3LS4H 5ESVA 2HT4D 5LVEA 2H6PA 1MF2L 3BQUA 5DUPH 4NO0A 1S7XB 2VXQH 3IKCB 1IZKA 1YEKL 2X4PB 5MP6H 1E4WL 1IKNA 3BRGC 1P7HL 4HGMA 2ZOLA 2GEEA 2XZAL 1TPXB 3OXSB 5TQ2L 3MJ7B 1MOEA 3EAKA 3IJSB 1DVFA 4H1LG 4U1IA 5T5NG 5DUPL 4CUCA 2VXQL 1CZ8H 1FNFA 4KRPD 2NZIA 1NMCC 4F2MB 3U79A 1W8OA 3KYKH 3QUXB 5TH2B 5EBMA 2F8XC 2FJGB 1RI8A 1K9TA 4H25B 2DQHH 4S2SA 1ZSDA 3S34L 2JKXA 4PJHE 5F96L 4XC3L 3KYKL 4WW1B 4DTGH 1Q94B 1YJDC 4M4PA 4GW1B 1HILA 3V95A 2P5WB 4KJQC 5IQ9B 4Z76B 1GGCH 3HG1A 4PJGB 1CI5A 2LFGA 2DQHL 3SDCB 4PG2C 4X7SL 1I3RA 3SGDH 2MQ3A 2HFEA 5FECA 2CIKA 1ZA3B 3RX5A 5HHOD 3QG6B 2R0LL 1GGCL 3CFEB 4K9EL 3J8F7 3QO0B 3MLRH 3JSSA 4KPHH 3KPOA 3GRWH 4X6CE 4LEOB 5TPWH 4ORGB 3V6FA 2ENSA 5GJSL 5EIQA 3BZ4A 3MR9A 1A7PH 2VC2L 1XCTA 1U3ZA 2R23B 2A0LD 3HPJA 3AUVA 3D87B 2WLYA 1A14H 5SWSB 3AS3A 4KPHL 5GGVH 3B9DA 5GRJL 3QFJE 4LSPL 5C0FB 4HIIA 1J5OL 1U8PA 2Z92B 2ZNXA 4MCZB 5JIHA 2FCBA 4NYLA 1I1FB 4OF3A 5DVNA 2GSGB 5BV7C 4OZGE 1A14L 5JW3L 3X3FH 1MHPH 2JIXA 3SE9H 4HWNA 1FFNA 3BVNA 2X5PA 3K8KA 1DLFL 1BZ9A 1Q9LB 3DUUA 3C6LC 2H2PD 3V5HA 2BMKB 3FOLA 5EC1B 5FDYA 2ZUSA 4XCYA 4WFFD 3X3FL 3KJ4C 2ADGB 3UTPD 2XA8H 3BD4A 4JFXB 3TZVA 3O8XB 3LKSA 1PAMA 1IAII 5DK0B 3C09B 4UT7H 1UB6B 2WWMD 3BIAX 3G9VA 3HE7A 5J1TC 3KPPA 4UU9A 1CFTB 3DROA 3FO0H 2BNUA 4XVSL 1CFVL 5DJZA 4M7LH 3U4EB 2JB6B 3RWFB 3N1QC 4NRXB 4LLAA 4UT7L 1AGEB 2CUHA 1QO3A 1YEJH 3UJJL 1QG3A 4QHUB 1CGUA 4M7LL 3WMSA 2BOBA 4Y4FA 5C08E 5E8EA 1HYSC 1MHEA 1ZHBB 1TZIA 1BD2D 4Y19B 5DK3A 4XHJC 3H9SD 3S96B 3CX2A 2LU3A 5HI3C 4OLYL 3L7FB 4PRNA 1BVKB 2FZ3B 1EHAA 1KCSL 4JFFA 3MRPB 1QEWB 3K2UH 3QP3A 1N8ZB 1PEWA 1YNKH 4RGNC 3MV7B 4OFIA 4RWYH 4AEIL 2VLLA 1DUYA 4QRPA 1R5WB 3W9DA 4NT6A 3OAZK 2NTSP 4QYOA 3U9UB 1ZLUK 1H0DA 3PL6C 4PLJD 3WLWD 1YNKL 3HUJB 3MOAL 5CJ8A 4QNPE 4ODWA 1F6AB 4RFEB 4L3AA 1EIBA 4RWYL 3O6LL 1J9CT 3DVIA 1X44A 3DGGA 1HIML 4R4ND 2A6DA 3QWOB 3RZWA 3WN5C 1CQYA 2QEJA 1BX2A 3SY0A 1YEHH 2J1KA 4Z7UF 4IRJB 2YN5A 5CIPA 2AGJH 2A83A 8FABB 4WWKD 4JRXA 3VFMA 4AG4H 3KLSA 5HGHA 5L9DH 4PRPE 1NBVH 5I30H 4XPTH 1KIQB 1S3KL 4PV9B 4V1DB 2ATPA 3PHOA 4R26H 4PJAE 1YEHL 1QLEH 2AGJL 5DF0A 3QDHA 5K33A 3WNOA 4AG4L 3P30H 3IKCA 2NYYD 3L9RB 1NBVL 5DZLA 4APQB 5I30L 1B0RB 1HQRB 4G9FD 2YPLD 4MAYD 4EXPX 2YA0A 3MC0A 4DZBA 4R26L 2VLMD 4FQJL 4WV1A 3NPSC 2Y5TA 5IOPA 1QLEL 4BQ9A 1KV3A 1ZHKA 5C09D 1TJHH 3P30L 4X6BB 5E6ID 4F2MA 2M8XA 3QUXA 2D4DA 1T22B 4MNQA 5D2LA 4GAGL 4NQTA 2MTPA 1UEMA 1I3UA 1WCBA 2OI9B 1TJHL 1JGVH 3EFFA 5EZLB 4YHPB 1NAMA 1MCLA 5FYJD 3D18B 5DJYA 4OZHB 1MCPL 1PFCA 3VMPA 2Y4SA 1SEQH 2P5WA 4OIIH 4E9LA 4N1HB 4UV7H 4YGAB 3SBWA 3CC5A 3HI6L 4LOUC 1JGVL 4ZYKA 5E56A 3OB0K 4JRWA 2X89A 2IH1B 1ZA3A 3GIVB 1JPSL 3CU1A 3QEGL 3T3MF 5SV4A 1SEQL 3MTRA 4KKAD 1HXYA 4RX4D 4Y1AA 3CFEA 3LHPH 5IGXH 1CD1A 2AS5M 1CBVH 3IB4A 3HFMH 3T09A 3CU7A 5DJDA 3T0EC 4DAGH 4PJXA 3ARGC 1F3DJ 3BGFC 3F7VA 3Q5YA 3DX9B 9CGTA 3ZKMD 3KR3H 3KAAA 2VLJA 1CFSB 3LHPL 5IGXL 3IDXL 5F89A 1UM5H 3MRIB 4XP1H 1INQA 3SQBA 1B90A 4ZXBD 3VFWA 4JREC 4E41A 3RTQB 2Z92A 3PDGA 4X8JB 1YMHB 4JG0H 4Z8FH 4JZJA 4FMFA 1I1FA 3MLUH 1UM5L 4CW1B 4XP1L 3CVHA 3FTGA 3GMMB 5F8RC 3UBXI 4ZUUA 2ED7A 3ZYIA 4YBHA 2XKUA 5T1KB 1DE4B 4L8SC 5KS9F 3GSVB 3CPLB 3I6GA 1JVKA 1ZT7B 1JGDB 4MB4A 5E9DA 5LAXB 4Z8FL 2DS4A 1G9NL 3LB6D 4OKVA 2ADGA 4NOFA 5F93C 1RK1B 1E27A 3M17B 5J6GB 2E7HA 3QNZB 4P4KB 3EYFB 5D7LD 5DI8A 4P5TA 2OTWB 5FYJH 2HVKA 3ZT5A 5AD0A 1G7MA 1J10A 5GGRY 3OJVC 3PQYE 4YHML 2KBGA 4NN7B 1EA9C 1U2CA 3S3PA 3TYGH 3DTXA 4WTZA 5JHDE 5HHPB 3MUHL 1MFDL 1INDH 1XH3A 1JTPA 1KIRA 2CLZB 3V79C 3QDME 1PG7X 3RZCB 2R2CA 5MEOB 5T3ZE 1PYWB 4KGLA 4LCCA 2VQTA 5I1LA 4ALAH 1DEEA 2NY3B 5IROA 1IM3B 1CLZH 4WO4B 4GRWH 3O3DB 5BRZE 4OGAD 4Q9RL 4LLYA 1EZVX 1ZHBA 3LEVL 1U8QB 4Y19A 3C5ZD 4IIQB 5IFJA 3WFEH 5DJ0B 4X98A 3L3IB 1FZJB 4PRAA 3TIDA 3W2DL 5IEHB 3EJZD 3U0WL 3MV7A 4XPAL 3QEUB 3JVGC 1FVDA 1R5WA 2JJSC 2HVJB 2AEPH 2JJVA 4J6RL 3QHFL 3IDGB 4AH2A 3OAUH 3Q1SH 3C60C 1JZ4A 4MJ2A 3P9LB 5ISZE 3P4NB 3DVFA 4RFEA 1DBKL 2CR3A 4UILH 1L0YA 1BM3H 3Q1SL 2UZIL 2Y25A 1UADC 5LQBH 3MX0A 1PSKH 4IRJA 1KNOB 8FABA 1GXEA 4WVRA 1OTUC 1BFOB 1KLGA 4UILL 2VISB 4PP2B 1BM3L 4R96B 5LQBL 5I1GH 5LCVL 3LEXA 4K94L 1PSKL 1W72B 3CXHJ 1JN6A 5IV2B 5C07E 5DO2C 2AV1A 3DETD 5MI0B 1IL1A 1JCKA 2AK1H 3AU1B 1KCLA 3MJ9A 5I1AA 5EUOE 1S9VB 1LP9F 3ARZA 4IRSC 4MJIA 5BOZG 5I1GL 2PTVA 1HHKB 3MXWH 4QCIA 5AYUH 2WUBH 3GMNB 3FQRB 2GSIB 1GZQB 4GW4A 3MV11 2NX5A 2DI7A 3OKKB 5FA3B 2BXYA 5D1QC 4BSJA 5GRUH 2ADIA 1OP3H 2W07A 2X4OA 1OAUL 4XB7A 5EZLA 3D18A 5C0DB 4NHUA 1A2YB 2YD6A 3EJJX 3T0DA 1WBZB 3HTLX 2QQQA 3G08A 1ACZA 3V0VB 2GUOB 5GRUL 3VCLB 2R1YA 1TVHB 1XR9A 4OZIF 1ZGLP 4JG1H 5DHYB 43C9A 3UTZB 2F54A 5DRXB 2W9EH 3VA2C 2Z35A 2X4NB 3HR6A 5IW6A 5FV1L 2GJ6D 3C8KA 3CSPA 1AP2B 1A8JH 2P48B 4L5FL 1H5BA 3C6LA 1AFVL 2R0ZL 4J4PD 4PJEA 1HSBA 2H2SC 5DURD 2OK0H 4K7FB 1MRCH 5ICZA 1N2RA 2X10A 3KXFA 1C5DB 1AHWC 4HWBA 2ESVE 4Y4KD 5B8CB 1OPGH 3E3QC 4JFQB 3MRIA 4JLRB 4KI5D 4Y5VB 1MHHA 1TCRB 1MRCL 1VHPA 1WF5A 4ENED 2XOTA 1MIML 3PXHA 4OUUA 3F5WB 4QXTB 5CS7A 2BSRA 2FRGP 3WE6B 1K4CA 1SYSB 3OF6D 1QSEB 1FG9C 1MHCB 4U3HA 2OQJB 4LIQE 1N0LA 3GSVA 1BF2A 5JXAL 1AO7E 5C0AE 2EYSB 3F58H 1I3GH 5LAXA 3RWEB 5CFHA 4LGSB 1HHIB 1LO3H 5JPNA 5IB1B 4BZ2L 1I75A 1OSZB 1RK1A 1ZLSL 1YMMA 3SO3C 1YPZE 1H3UA 1TJGH 1UA6H 1I3GL 3QXDA 1LO3L 3B83A 4PS4H 1D5XB 2AK4D 3MLZH 3KVQA 3EDJA 2NY0D 5I8EB 1DCLA 3VD7A 5GSVB 5HHPA 1JGLL 2V7HB 1UA6L 2D31B 4UI2A 4Q7DA 1FHGA 5BVJB 3UP1A 4PS4L 2H9GA 1PYWA 2HLAB 1O0VA 4OQ1A 5F7FA 1IM3A 4WO4A 4GO6B 2DLFH 1QRND 4I0PB 3AXLA 3D1MC 1MEXH 4G80A 1B0WA 4PRIE 5TDPA 5FOBB 1WVZA 3WN5A 1A6VL 4ZQKB 1VPOH 1PG7L 4EUPH 5SWQA 1PBYA 2BFVH 2BHZA 3L3IA 2BNQA 2DLFL 5ACZB 5IEHA 1MEXL 1Y6KR 3VXTA 3MODL 3KNBB 4WCYL 3IF1B 1P6FA 4BSVA 5I19H 3D2UB 1VPOL 4MJ5B 2ZG3A 2FNBA 2Z4QB 3PIQB 1JF1A 2BFVL 2AJ3A 4O2EB 2NXYD 4Z7NE 1BJ1H 5L2KE 4O02H 3OKNA 2VDRH 3MRQB 4LSSH 2P1YA 5F72S 3VFPA 5DMGC 3MV9B 3O9WC 3BZFB 1EGJA 1D5BB 1H3WM 1IEBB 3RDTC 3E6HB 2HLFC 1VA9A 5A1AA 4KK5C 3RX7A 5EU7E 2VDRL 4G5ZH 4LSSL 5JTWA 1KNOA 1LO5A 1QTYT 1NAKL 1IGCL 5JORA 4FQ2H 1EDQA 1QFHA 1R3LB 1RU9L 2CO7B 4PP2A 4ZO9A 1AI1H 3PJSB 3DMMC 4PGJA 3GJEA 5IQ7H 4P2RD 3QG7H 4LDLB 2XZCH 3JWOC 1W72A 1IC5L 4BKLA 4FQ2L 1NFDE 5E2JA 3AC0A 2BJML 5JOPE 2VZOA 3KPQB 2IANA 1INEH 2VLRB 5D1XB 4LNRB 4O2FA 5DFVD 3D39D 1IQDB 3VG9B 3QEHA 1G7JB 1JRHH 5HVGB 4HSQA 2D3VA 2QLVB 1S5HB 2XZCL 3DYMA 4XI5D 2R1XA 1MCEA 1INEL 1AR1D 2BHYA 2FEDC 4I3SH 2XTJC 3OKKA 5E6YA 4ODUB 4P2YA 1JRHL 5F9OH 5C0GB 3T0EA 1T1WB 3ARGA 1A1MA 2Y6SD 1CXFA 3F65A 5C0DA 3VH8A 5IB4A 2DJSA 4NCDA 1P5UA 2W92A 1KXTB 4FG6D 4I3SL 1A2YA 4IOIA 2ARJA 1A6UH 1JMZA 2ED8A 1WBZA 2F58H 1MI5E 3V0VA 3RUGE 2GUOA 1KEMH 1RSFA 3I75B 4FQXC 4R90H 1TVHA 2HTKD 5IHZA 1ZXQA 5B21A 3RX8A 3U0PA 1A6UL 3O2DH 2HJKB 4JFEE 2F58L 3C5JB 3QCTH 3BH8A 1KEML 3FO1A 4PB0H 4F57H 5JLZB 2IQ9H 3X13A 1NGQH 4HAGA 4WEBL 4L8SA 4R90L 5CMAA 1IM9B 1M7XA 4EOWH 1XGUB 4HUWA 5GGSB 5CKAA 3LPGA 2CGRH 1TFHA 1C5DA 2FR4A 3QCTL 1G6RB 1X5JA 2FX9H 4EI5D 4F57L 1LDPH 2CDGB 4WFGD 3RHWK 4HIJA 3TH2T 3KJ6L 4Y5VA 1R5VB 4G8IB 4W6XB 1NEZA 4C56B 2D7PA 3ZKXC 5CJBA 5I1KH 2ZSWA 4J7RA 3MREA 12E8H 3KLAB 3HI5H 4PJGF 2PNDA 4U6VH 1KLUA 2Z8WC 5FHBH 1QSEA 5TE7H 1FC1A 2OQJA 4P23C 3RL2B 4JRYA 4HJJH 5I76B 1CDGA 5I1KL 3RWEA 1F45A 4RMVA 3DV4B 4Y5XB 4KKLD 1IGIH 2BVYA 3O0RL 4NQVB 5C0BB 4KRNA 3HI5L 4U6VL 3K74B 5FHBL 5TE7L 4YDKH 2YXFA 3BAEH 4PGDA 5DGQA 2BERA 5IVXE 3CFCH 3WFCH 3O3EA 1KCUL 3GGWB 4R4FL 1QBLH 2BVOA 4YHLL 1GPOH 1IGIL 1D5XA 4GXUN 3DUSB 1M71B 5INCA 3WD5H 5L2JB 4AMKH 4YE4H 3E6FA 3U7YH 1WZKA 2VYRE 3S4SB 5IUSA 1IAIM 2JJSA 1A7RH 4GKSB 1FL3B 1QBLL 2AQ3A 2YC1A 5IBUB 1GPOL 3QDGD 4YBQD 1J8HA 4U6YB 1EFXA 1LO0L 4XT1C 4Y16C 1QSZA 1HXMB 3WD5L 3U7YL 1NCAH 3WXVL 4JY4B 4PLOB 1A7RL 5HJ3B 1A6AB 4H5SB 3MUY1 4ELME 4EDXA 1RHHB 2NW3A 4ZS7L 5C0CA 2DICA 4ODBD 1Z9OA 4U6XB 3VRJA 1NCAL 3VGFA 1FSKB 4YXLH 5E94A 4YO0B 2A6KA 5ACZA 1TNNA 3TN0D 3P9WB 4JPKH 4PY7B 5HD8D 3NIGE 2PYEA 3VGAB 4UBDD 1LO2H 4PJ5B 2EEAA 4P2OD 5EORH 1BREA 5FOJA 3MRQA 3MRJA 3ZLQC 1QVOA 5L88H 3S5LB 4OTXH 3LDBC 4BUHA 4JPKL 2MKWA 4LLMB 1B4JH 4KZDH 4CMHB 1A1OA 1EBPA 3ZT6A 1TTFA 1I9IL 3E6HA 3WO4C 5D1ZD 5GGQH 1LO2L 4KMTL 4L4TE 1OF2B 1KPUA 4KRPC 4TVPH 3REVB 1XF4B 2QSCH 2OZ4A 5L88L 4R2GB 3RIAK 4YDVB 1YPZF 1GYAA 4PV8A 1KELH 1WBYA 4NP4L 2HRLA 1LEGA 1B3JA 3V4VL 1JYVA 3G6JB 1TETL 3DX8B 2D7TH 4TVPL 3B9AA 1T20A 3O4LB 4OF8A 3T4AB 3TV3H 1ORQA 5LGJA 2QSCL 4JKPH 3CVIH 2YUXA 1KENH 7CGTA 1OWWA 4MJ6A 4EZMA 4XBPA 1KELL 1JTOA 1E28A 5KJRL 1YYMH 4MNHB 2D7TL 3QRGL 5T5FH 2QR0A 2VZ1A 4QO1A 4QHNB 3P2TA 4HH9B 1CR9L 4JKPL 3HUJF 3NCJH 1KENL 2R4SL 4MDIB 4LCIH 4P48A 3BSZL 2YN3A 3NIFF 4ODUA 1YYML 5T5FL 5EU6D 3LD8C 5C0GA 5HPOA 1XFPA 1FRGH 1UM4L 4XZUB 2R2BB 3NCJL 4UUJA 2O5YL 5EFIB 4LCIL 3EYSL 3MRMA 2A0LC 4W4OC 1AHWA 2IALB 5BQ7B 1MAKA 1YEDB 4QRRB 4E42B 1KTLA 5GZNC 4HEPG 3IVKB 3BYTA 5HHNB 1JBJA 5A2IH 3QULA 5LWYH 3VXSB 2EEBA 1CD0A 4P57A 5IJKC 3MCLH 5KVMC 1HE7A 3AM8C 2X1XR 1EBAA 1PKQA 1MH5A 2CKBL 3BPNC 1IM9A 3D5OF 4WUKH 1MAJA 3B6SA 4GW5B 1DTUA 1ONQB 3B3IB 4GT7A 2G9HB 3HKFA 4TOYL 2I25N 3ARQA 3W0WB 3BMWA 4I0KA 2I60L 5GHWH 5FCSH 3VFNB 4M1GH 4NQEE 4WUKL 3MRNB 1S8DB 2WWMC 2CKNA 1D6EB 4OZHF 4PJDA 3TNMA 1ED3A 1RY7B 2AEIT 2IPUK 3QUZB 5FO8A 3TH4T 4F3FA 1NFDF 4U1LB 4ZPVB 3TM6A 3CLEH 5E00B 4FFYH 4QF1B 1NFKA 1C5CH 1KIUA 4RIRA 2MSPA 1VFBB 5SX4I 2BSTB 3UTSE 5DJ6A 3RL2A 1K8DA 4LP4A 5I76A 1K2DA 3EO1B 4YHNB 4Y5XA 4O51B 1LE9B 1EEYB 1OGAD 5I1DB 2F5BH 5DTFB 4RRPA 1BQHB 1RZ8A 3WDIA 2YD3A 4QRUB 4GXVL 5HGBB 4YX2L 1XGYL 5D7SH 3RA7L 3U9PL 3IGAB 2F5BL 2ZCKH 3T2PA 1YZZA 3MRFA 3BPLC 3S4SA 1S7QB 2XQYK 3MRGA 3IFLH 3P11L 5D7SL 5DYOA 5C71A 4PLJC 3V6OC 1MPAL 3WLWC 5A3ID 4XP6H 2EE2A 2GT9B 1X5FA 3L3GB 3N1PC 4Z7OF 1V3MA 1WWCA 5FAAA 1I1AB 3FT3A 4JY4A 5H8DA 3O9WA 1A6AA 2D03H 2W91A 4ETYA 2FSEB 3GMRB 4KROB 3ULUE 1ES0A 4IHOA 4PJ7B 5CINH 3KPRA 2R69L 3LZFH 5KZCD 1HKLH 2OCFD 4PJ8D 3D9AL 2X4TA 4XMLH 2A74B 4JFDB 4WWKC 3RNKA 5FKPB 4CBPA 3HNTL 3HZMA 2PO6D 4L9LB 2D03L 5JHLL 3DURB 3MJ8A 3ARPA 2RCSH 3O6KL 4HS6B 3MOQA 5CINL 1J0YA 3LZFL 1HKLL 5SWZA 2BOCA 3WV0A 1Q38A 1RZKH 3TPKA 1FIGL 4PJ5A 4GMTH 2NYYC 1U8NB 3UTQA 4PPTA 1UZ6E 4MAYC 3VMNA 1NC4B 4BH8B 4FZEH 1F4AA 3BIKB 4KKNA 4D9RE 4XXDB 1VADB 4LF3B 4WJ5B 2MQCA 1RZKL 4MNGE 4JY6B 1H3TA 1HQ4B 4S0SD 2B8OT 1FPTL 5E6IC 5E7FA 3D3VA 4C83A 3PGCA 4R0LC 2DTSA 3GSRB 1OCWH 1MCOL 3DXAE 5T1MB 4FZEL 4POUB 5I73C 1O7SA 1AKJB 3NN8B 5IW1B 1V05A 1S7SA 3G6JA 4OFKA 5L0QB 1T66D 4CAGA 5F7MC 4WGVB 4HWEH 4X4XB 3T4AA 5FM8A 1MIEL 3BWAA 1CDCA 1LHZA 5KN5B 1N5YL 1GOGA 3RWDA 2Q20A 3BP4B 3WEXB 1YEGL 4NUJA 1T0MB 3NIDF 2F53B 5TF1H 4AEEA 3GSNB 3OGOE 2K1MA 4MNHA 4FQXA 3DX7B 4HWEL 1UJ3C 2GK0B 2B1HL 4U1JB 1EAJA 1GZPB 5C0NC 2VSCA 4MDIA 4G7VH 2EDHA 2OR7A 5I8OH 5TF1L 3BOVA 3IRPX 1F3DH 2OYPA 1X5XA 5HBBA 5GJTL 3ZKMC 4AL8H 1PLGH 4KJYB 2R2BA 2XN9E 2WAHA 5IVOA 4G7VL 1C7TA 2WUCH 1A6WH 2DWDA 1T4KB 3FQXA 2Y5EA 1KBGH 4OLWH 2IALA 5IF0B 4OIBA 1YEDA 4QRRA 3IVKA 1IFHH 4ZXBC 4NM8L 3GMQB 4NBYB 1PLGL 1AQKH 3NFNB 1NDGB 3PWPA 3SDYH 3U36A 2WUCL 1A6WL 1KBGL 4OLWL 3EOBB 3GK8H 3DV6B 3E0GA 5GGUB 1FAKT 3MGTA 5IWLC 4M1DH 1A9BA 1IFHL 2OTUB 3ECBA 2JJWA 4DQOH 1L7TH 3SJVA 3SDYL 3K8MA 3CH8A 3GBLA 3VW3H 1AGCB 2G9HA 3GK8L 3LB6C 3NZHL 3QO1B 1ZHLB 4K3EL 3T77A 4NGHH 1KF9B 3W0WA 4HIXH 2VZUA 1HSAB 3QQ3A 4DQOL 3MBXH 1L7TL 4LHUB 5BCAA 2OXGA 4UDUB 1FH5L 3ET9F 5CGMA 1FJ1A 1NSNH 4NFCA 2WINB 1QNZH 1PY4A 3QI9D 3BKMH 4NGHL 4WHTB 4OKDA 2I5YH 3QUZA 3U7AA 3M1BA 3KYOB 4K71B 3ESVF 4F7MA 3CSBA 1JNLH 5E00A 1PX4A 2X70B 4F7PA 4X4MA 5I75B 3HZYA 1NSNL 3SOBH 1QNZL 1VFBA 4L4VB 2BSTA 1W0VA 2X1QA 4OM0H 4OLUH 2I5YL 5F3HA 1J0JA 3EO1A 4Z95H 3VGDA 4FFWD 4O51A 4JFOA 1AD9B 4OD2A 3VRLE 4GAJH 5JQ6H 1YY8B 2BVPA 3QIBB 1KOAA 1S9YB 2X7LA 5MENB 3CX5K 2E27H 4QRUA 1MWAH 3BMVA 4OM0L 2NY4B 3ULVH 5EA0H 4XH2A 3GRWA 4Z95L 1BVZA 1ZHNB 5E2VL 2Y06H 5HYJA 5JQ6L 1JWUB 5GRZA 2Y36H 3KPSA 4ZTPH 4M7KH 3EJZC 3G9AB 3ZDYE 2E27L 1MWAL 3KPNA 5J1AB 1K8IA 5KVEL 5B3JF 1S7QA 3HE6D 3ULVL 5EA0L 4LSRL 5EO1B 2HWZH 3U4AA 1H3GA 2P5ED 3NFSH 2PYFB 3F7RA 2Y36L 4CRPA 4ZTPL 3RL1B 1KYOK 4KHTH 3CSYB 3L3GA 1WAAE 4YHIA 4G9FB 3QDJB 1N5AB 4J8RA 4KDTC 4DKEH 3EOAB 2HWZL 2RGSA 2FSEA 4JFHE 2CLRB 5F7NC 3PE9A 1ZVSB 4PJ7A 4CKVX 5DEFA 2UYLB 3HG1E 2RB8A 3CDYA 4F7CA 3CJJA 1ZKAA 5JW4R 4KHTL 2GJZB 3IKKA 3TJEL 3GHEL 2DI8A 5BS0B 4D9LH 5ELIA 4GG6B 4EI6A 1WK0A 5B4MD 4JVPA 2WIIB 5KSUB 4PJCB 1QLRB 5E2UL 3KLDA 2AEQH 2E3VA 1UKQA 3RGVD 1A4KB 1U8HA 3DETC 4WI2A 4D9LL 1U8NA 4MQ7A 5F6HI 1SJVA 3LKOB 1NC4A 3DHJA 3IJHB 4XPFH 4BH8A 5KSBB 3BDBA 5A40E 3MRHB 4LCWB 4XXDA 4LF3A 4WJ5A 2AEQL 4CU8A 1DLHB 3ELAT 2YEZB 5HHOA 4AENB 4X6DB 4Y89A 5JW4Q 4NQDB 3HLAA