4G41A

Crystal structure of s-adenosylhomocysteine nucleosidase from streptococcus pyogenes in complex with 5-methylthiotubericidin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
236
structure length
236
Chain Sequence
GAMGSMKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELILVQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDQIKTAFSNVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQILMTFLENLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of s-adenosylhomocysteine nucleosidase from streptococcus pyogenes in complex with 5-methylthiotubericidin;
rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
molecule keywords MTA/SAH nucleosidase
total genus 72
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2012-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g41A00
4M1EA 1XE3A 3SCZA 1Y1QA 3KU4A 1VHJA 1V4NA 3NBQA 4D98A 4E1VA 1JDTA 2B94A 5ETJA 4DA0A 1JPVA 4WKOA 1A69A 1PR0A 4EB8A 4GMHA 4R2XA 3DF9A 4D8VA 5F7JA 1VMKA 5EUBA 2ISCA 4YJKA 4LDNA 3FOWA 3KUKA 5IU6A 3ENZA 4LNHA 4TS3A 1PR2A 2OXFA 3QPBA 1PR6A 4GKAA 5EFOA 1RCTE 4TXMA 2H8GA 3D1VA 4DANA 1JDVA 1PKEA 3OCCA 3LGSA 5F73A 4GLFA 1U1EA 1Y6QA 1A9QA 4U2KA 3EMVA 4G8JA 4DA7A 1PF7E 4I2VA 5B7GA 4X24A 1A9SA 3UAXA 1ODKA 4WKCA 1TCVA 1Z34A 2AI2A 3INYA 3DP9A 5K1ZA 5C80A 1ECPA 2A0XA 4TTJA 1SD2A 3K8QA 4L5AA 5EPUA 4G89A 4L5CA 4DA8A 1YQQA 5IFKA 1Z39A 5B7NA 4MCHA 1SQ6A 1NC3A 1Y1SA 2GUWA 3BGSA 3C74A 5CYGA 1U1FA 3KVYA 1OUMA 1JE1A 3PHBE 3NM4A 5DK6A 1T0UA 1QE5A 4QAQA 1RR6A 3UAWA 3MMSA 4R31A 4PNPA 1Z38A 5B7PA 2QPLA 3OZEA 4OF4A 4GLJA 4YO8A 2Q7OE 3EUFA 5F7ZA 1Z5PA 1YQUA 5FAKA 4M3NA 3F8WA 1PK7A 3UAVA 3OZDA 4L0MA 4YMLA 3GB9A 5CXQA 1OTYA 3EEIA 4P54A 2I8AA 1PWYE 5B7QA 3FB1A 4F3KA 5CXSA 1V41E 3O6VA 1ODJA 1NW4A 4NSNA 4D8YA 5F7XA 1C3XA 1PBNA 1Q1GA 1OU4A 4MCIA 4DARA 3UT6A 1OTXA 4OGKA 1YBFA 1TGVA 4UC0A 1JP7A 1U1GA 1T8WA 3UAZA 4F2WA 4WKNA 3IEXA 1LV8A 4JWTA 4G41A 4DAOA 3IOMA 4BN0A 3BSFA 1SJ9A 2HN9A 1VHWA 1RXCA 4TTAA 1WTAA 4DA6A 1K3FA 4LNAA 1PR4A 1B8NA 4TXNA 1FXUA 1V48A 4EARA 3GGSA 3P0FA 1ODIA 4D9HA 2AC7A 1K9SA 5I3CA 2A0YA 4TS9A 4RJ2A 1V2HE 1VFNA 3OF3A 2P4SA 1TD1A 1Y6RA 1ULAA 4JOSA 5CYFA 4WKBA 1CG6A 4F2PA 3FNQA 4KN5A 1NC1A 3OOHA 1ZOSA 3PNPA 4M7WA 3ONVA 5CCDA 3LBAA 3KVRA 3U40A 3FWPA 4L5YA 4LKRA 2IQ5A 1LX7A 5F7OA 1PK9A 5JPCA 3UAYA 2ON6A 3BJEA 3EUEA 4L6IA 5F76A 1M73E 4BMZA 1V45E 4OJTA 1PR1A 1A9TA 1OV6A 2I4TA 1Y1TA 3LA8A 3DJFA 1ULBA 1Z5NA 4NY1A 3OPVA 2HWUA 4JP5A 5KB3A 3MB8A 1V3QE 4YNBA 3OOEA 2BSXA 1JDZA 1TGYA 1RT9A 1JE0A 1ZL2A 1Z33A 1RFGE 4F1WA 1Z35A 1Z37A 3KHSA 4OGLA 4WKPA 4ECEA 5F77A 3E9RA 1OVGA 4PR3A 3BL6A 4K6OA 2OC9A 1YR3A 1PW7A 4D8XA 1RXYA 4R2WA 3E9ZA 4NS1A 1B8OA 1RXUA 1Z36A 1U1DA 4QASA 4QARA 3OZBA 3E0QA 3OZCA 3PNSA 1RYZA 1JDSA 1I80A 3T94A 4TXHA 2HRDA 1ODLA 4OY3A 1JYSA 2QDKA 3DPSA 2PGAA 1RSZA 3NM6B 1JDUA 2RJ3A 1T8RA 3FAZA 4TTIA 4TXJA 3TL6A 4QATA 5CCEA 1A9OA 2AI3A 2XRFA 3PHCA 4DABA 1G2OA 1N3IA 1SD1A 1T8SA 1CB0A 2OC4A 5F78A 1PR5A 1LVUA 1Y1RA 4IP0A 4BMYA 1Z5OA 1YRYE 1RXSA 2OECA 2QTTA 3NM5A 1TCUA 4OEHA 4TXLA 3KVVA 4MARA 2QSUA 1U1CA 1A9PA 3K8OE 4H1TA 3O4VA 2A8YA 4BMXA 1T8YA 2QTGA 2AI1A 3ODGA 4FFSA 4QFBA 4QEZA 3DDOA 4LZWA 4DAEA 1A9RA 4F3CA 3FUCA 1K27A 4TYMA 3P0EA 2HSWA 2A0WA
chains in the Genus database with same CATH superfamily
1Z7WA 5JSKA 1E1MA 3PNOA 5ICFA 5JD3A 5CFRA 1UXJA 3K73O 2O8FB 3ZD7A 3D7NA 1XE3A 3BMQA 4C4AA 2W83A 5JEDA 1Q7CA 5B37A 3HVRA 1P9NA 4N5HX 2ZRGA 4RTJA 1J23A 1ZM7A 3CW8X 4AZ3A 2CK3D 1CUHA 1P31A 3H75A 1VSVA 4K6MA 1PYDA 2Y4NA 4RIIA 1R5BA 4Q05A 4V0MA 4ZVKA 3F74A 1IXYA 3Q7TA 1XXHA 3QH4A 3DE3X 4BL5A 1PYOA 1QTIA 2F64A 3OJCA 5CT4A 5ALGA 1S4MA 3FDFA 1LPPA 3QLJA 1ECCA 1EEHA 4V39A 1ZSVA 2XCIA 3DLCA 4V0KA 3WSWA 1T26A 3FZEA 4I8XA 4WVFA 3ZVLA 1DARA 2VHQA 3F6PA 2ISCA 4QU5A 2WKQA 2P4HX 1JPJA 1D2CA 5IJ9B 3KUKA 1N2JA 1H23A 1UT6A 2XY4A 3WDMA 5I47A 4DREA 2ZRJA 1DC6A 4JBWA 1IK4A 2R8PA 1JSCA 1WM1A 2JZCA 5KNDA 1RQRA 2DWQA 3OM0A 5FI1B 4LNHA 3B7GA 1UWKA 1M6YA 3AR4A 4QYIB 1W2HA 4I8DA 2AYYA 5EFOA 2IXTA 2IIVA 1WQ4A 3NT2A 1R6UA 5FPPA 1T36A 2PHZA 5GJVC 3FMPB 2CLCX 2JA1A 5KCZA 1WXFA 5K6RA 3BQ9A 3RR2A 2RAFA 2QL5A 1P0PA 3AW8A 3L06A 3IRVA 3CB4A 2I8CA 1E1CA 4KQ6A 5K3DA 3VJMA 1ZWKA 3ISTA 3EPLA 4Z2YA 3R9KA 1C41A 2PZKA 8LDHA 4G0WA 3IO3A 1HXHA 1ZRNA 3O1HB 3R5FA 4AX4A 2WWHA 4BU0A 4G1CA 5FEUA 5IC4A 2PJRA 3GZNB 1JDVA 1T4GA 1ZK3A 3W3AH 4CLRB 3KV3O 2IPXA 2XQGA 2Q4OA 1XP5A 3OY2A 3OF5A 3FPKA 3DBRB 3IQEA 3HGTA 4MNTA 5F73A 3GEEA 4B32A 3KKMA 2V7QA 5TMPA 2HPVA 3WHKA 5IG2A 3DXYA 1BDMA 5D3KA 4BJHB 5A2QA 1RBQA 1HYBA 1HFEL 4JI8B 3VR6A 3W4IA 4Q03A 3AM5A 1EDOA 3R5KA 2Z6UA 2GPWA 521PA 4W6QA 2ZIVB 2W98A 3HXPA 3KOUA 4I2VA 4UUAA 4TMFA 5HK8A 2MINB 2FPRA 2VUIB 5LB2A 3BCRA 4HZGA 1EVIA 5ALEA 4MV6A 2E89A 4OKNA 4PYLA 5CDFA 3CV3A 5KVCA 3COZA 1NY6A 3JV7A 4HQRA 2FEXA 3PIIA 4L9WA 4ILKA 2BEWB 3E70C 2Y0CA 3WYCA 3MHPA 4FD2A 3MWGA 4H08A 2Z4TA 3WJ7A 2HRBA 4EM6A 2FUCA 3AERB 5AK3A 4HTFB 4ZO9A 1GG8A 1PFKA 5LFAA 3DP9A 3LI2A 3O75A 2PT5A 1UBKS 4X44A 3F7NA 1SQ0A 1OGJA 1CJSA 2C42A 3QE0A 4PLHA 4TYQA 1ZX1A 4FZRA 2Y6UA 2VZ9A 4PZPA 3THSA 5DN6A 1H0HA 2VPQA 3N8DA 5CT6A 2D5CA 3T9DA 3TQFA 4YCSA 1F06A 3GGCA 3LCCA 5JXHA 1E3TA 4BFSA 4K7JA 2ZYIA 2NZJA 3IKVA 2WQ6A 2H1OA 4UMEA 5KYVA 2WJJA 3R44A 2UZIR 4BLSA 3EVBA 5K99A 1IJEA 3UFXA 4PW0A 1J06A 3I2GA 1TT7A 3LCUA 3MJ4A 4F72A 1KTIA 3TZ6A 3UWPA 3PGJA 2ZZNA 3H42B 1BN6A 1MR3F 3WK7A 4PPYA 4AXXA 3E1KA 4EGAA 3JATA 3HU3A 1Y9AA 1L9KA 2JF0A 5K3SA 2XB8A 3WLOA 4E12A 5C46F 2HDNB 2NLOA 1T3LA 4DBLE 1QZ3A 3BE5A 4BZXA 2MSLA 3KYDA 3SXUB 2DLCX 2AMFA 2B7LA 2DBRA 1VHDA 2YC2C 5ELMA 2AQKA 3DDNA 5HKBA 2WSSD 4RF3A 2B4TO 2G6TA 1H9BA 1G98A 4R4JA 2AFIA 2PZJA 1DAGA 4GPTA 3RRJA 2V4ZA 4LF9B 4AKGA 1R8XA 2X1LA 1OA1A 3DEAA 1FSZA 5LNK6 2BEKA 5E6UB 3UXYA 3LHDA 2QM8A 4L16A 4FNOA 4M9CA 2Z3ZA 3DOIA 4E21A 5IUJC 2QWXA 5JCZA 1HTBA 3L6DA 2WG2A 1U5AA 5K3EA 3G88A 1Z7EA 3UAWA 1ACJA 2R8OA 5CIWA 5JZMA 1YD7A 3T3DA 2V3WA 3IQFA 5ITVA 1BS1A 2VP3A 5TS3A 2C61A 1XD2A 4FHFA 3JQBC 4L76A 5C7OO 1COWA 5AW1A 4YJ2A 2JH9A 2FZEA 2ORED 1TX4B 2YJNA 1DG3A 5I9TA 5BVHB 4UNRA 3MWEA 3PIDA 4PEVA 1MAWA 4UHKA 5DM1A 3EUFA 3OFJA 1M0TA 3E9DA 3FTEA 1YSCA 1HL7A 3B2NA 3QMWA 4M1QA 1JHYA 4O1IA 4ZV9A 1F9EA 4DCOA 1R88A 1HFWA 4ZYYA 1X86B 5B6IA 1P5FA 5ITZA 3OZDA 4L4ZA 4Q9LA 1FVOA 1FUEA 4O3FA 3NEYA 4KODA 3UANA 5C32A 4IDOA 3DAPA 1WSDA 5A6VA 3VZCA 3NNNA 1S2OA 1JBQA 2JGDB 3LX4A 1ZCJA 4DBVO 1ZH6A 4U4AA 3K0CA 3UGJA 1LWOA 3AXTA 1F51E 3CISA 3BAZA 4C05A 4LAFA 4DPMA 5ICCA 4YUAA 3GJ5A 1R37A 2CXUA 2P3SA 2VQEB 2IWRA 3HHPA 2RONA 4Z4EA 4X7PA 4JGGA 2QPAA 5EZYA 1I10A 2NSDA 4Z53A 1GCAA 3FVQA 3TXYA 3X1KA 1ZK1A 1H93A 1E1RD 2G72A 2F3PA 1NIPA 1H6DA 3VDNB 1EFKA 2YJ5A 5HVNA 1RWMA 1V7ZA 4UD2A 1G3QA 4C4YA 4BLRA 1D2RA 2DKOA 3JD0A 4KQKA 1G7RA 1SVLA 1QH1B 2VFAA 1CWUA 1EGMB 2PLRA 2VJBA 3I0NA 2WLSA 2LRHA 4UBJA 1D03A 5DE3A 3WRYA 1GVHA 2QORA 2YWRA 4OFWA 5CNKA 1DX4A 5CRIA 5HDBB 5JSUA 1YZ3A 3L82B 2WHEA 3IDZA 3Q72A 5WRFA 4FYWA 1S2DA 3D4LA 3PL5A 3MTIA 3E22A 4NK4A 2GPJA 5DNAA 1XHLA 1U81A 2PUFA 1GV1A 2Q21A 1KP9A 2OVBA 3PT5A 2BHRA 4B76A 4JDPA 4EITA 5D7BA 2FP4B 2OHXA 3AF2A 1FFWA 3UKDA 4CDRA 3ZE2B 2QUJA 1XYVA 2ZDHA 3AEQA 1HT1E 3WMFA 2JPDA 4XTRA 5AW0A 5JZSA 2ZRHA 2FZWA 3CF4G 1QZZA 1LPMA 4FGSA 1Q1BA 2BR3A 4YUWA 1I7NA 1SC3A 3PWKA 4QC2A 3AONB 3FVTA 4EB0A 1C1DA 2H9YA 1GARA 1E2KA 1K86A 4JHLA 5BRNA 1KK3A 3FOFC 2AC7A 4MJLA 4WIAA 5K01A 3LRPA 2ZW9A 1Q2XA 3CN7A 1HKUA 4HAUA 1LCIA 3ND9A 2QMYA 1BE8A 1CETA 4MS1A 3RKUA 3UHFA 3LX6A 3OIWA 3A70A 1KDZA 2PV7A 2YIDA 3KVNA 2FX3A 2QUHA 2LVBA 3LCJA 3KR2A 2QMEA 4A8PA 2Z5VA 4A10A 1E0DA 2J5QA 1RQGA 2G4LA 5KX5A 3DBRA 3G0IA 2NYVA 1SUBA 2G71A 3LLSA 3ILSA 1TD1A 4UNPA 2BI8A 3G0DA 2O8DA 1OAAA 3AETB 5LZ2A 4TYYA 3CUYA 3SZMA 2Q8NA 4EZBA 4Q9HA 4B85A 1GZ6A 4YT2A 4F06A 3TBFA 5K3FB 5C1BA 1KO8A 1HE5A 1CEEA 4KN5A 3DTVB 1Y3FE 1AKVA 4U5QA 3OTOB 1E69A 2H59A 4FBGA 4NHEA 4YJ2F 2H51A 2YHUA 3JYPA 3LNCA 3PNPA 4TKLA 1V3TA 3VO1A 5DHUA 5IBCA 1IEVA 2J33A 4W7HA 3IQWA 4CODB 1DJLA 3LOUA 1EVEA 5B3AA 4HGZA 3C5VA 3WGGA 3HDQA 3ONEA 2X5KO 3ZWWA 1UBFA 2AX3A 3NJ8A 1GVNB 3C3YA 3BN3A 3SQLA 3RNOA 3S1SA 2HU5A 2X0KA 3PHLA 3DZGA 1MDFA 2OBLA 1PK9A 3QOFA 2R65A 4Y2XA 2BDEA 4FWBA 2G4VA 3JRNA 2G36A 5AM4A 1L5NA 5U4QA 3NHMA 1JWLA 1KEZA 2QR3A 1M2HA 5JT1A 3RJMA 5BRJA 3I23A 4MYHA 3OLXA 4RMIA 1BGVA 5HOQA 4UBIA 2C9BA 1GL9B 4DDWA 3ZGZA 3QVUA 3AI1A 4TTQA 1AKEA 1TU0A 4BO3A 5MGNA 4B1FA 2RSLA 3AZQA 3UICA 1MJNA 1N6HA 2WSYB 2W0SA 4LE0A 2GTPA 3PCRB 3RJZA 1ZHFA 1MPTA 2QX9A 3QE3A 3A27A 3HP7A 3PUIA 4UJ5A 5J40A 4F56A 2X9GA 1OV6A 4G3XA 1CDDA 4PYRA 3R6TA 4YDSA 2H00A 4ADSG 1O97C 2FWAA 2GBPA 3G1WA 3WL7A 2A5GA 4V3CA 2G07A 4IQ4A 4IHJF 2Z6AA 1Y9EA 3VKHA 3KZMA 3UVEA 4V0NA 3ZHZA 2IOQA 4BMCA 2XWQA 1WSAA 3BE4A 1T4MA 2WYWA 3LYLA 3GW8A 1KZ4A 5AK0A 4UXJA 2UZAA 3MB8A 4OQNA 4AQDA 3ETHA 4ZFNA 1WXEA 5I7VA 1TMKA 3IKTA 1TGYA 4JUAA 4QAJA 1JG4A 2M32A 1QTNA 2VG8A 5KTNA 3KOZA 5UKDA 2WP0A 1O57A 1PV2A 2P1DA 5J59A 2HUPA 3LS2A 3G2QA 2FJ0A 5BSFA 5M3BA 1KQOA 1KMIY 3ILVA 4B7AA 4PGMA 1XTJA 3EARA 1LZLA 1R9NA 3A4VA 3H05A 2NO5A 1KI8A 3AFIA 3UQZA 2FDXA 1GDHA 4KCGA 3GX1A 3JQ6A 1B74A 1E8DA 1JVBA 1J0CA 1N0WA 3OCUA 2REBA 4JT2A 4S2UA 1QHXA 4XIGS 4ZOBA 1GCUA 3RI3A 3ZZ1A 4JJKA 3U81A 4B6RA 1WF6A 1T91A 3ZYCA 4J07A 2ADFA 3SZLA 5IK2A 4CL8A 3MTGA 1OBCA 3PC8C 4LJSA 1JAXA 1PDVA 1LS1A 4MI9A 1NRIA 3VVBA 2W2LD 3OZBA 3LUDA 5TPWB 4AJHA 1R8YA 4ECAA 1NNI1 3CTPA 3HEMA 3RYFA 3WHLA 2WJHA 2BSQA 4B3SB 2OB1A 3M1LA 3N8GA 5FWDA 1I4OA 3ND7A 3BJMA 4BP9A 1RQPA 1R00A 2BI4A 3IVRA 1Z3CA 1Z5VA 4AWBA 4BWVA 2XBMA 4QYSA 3BMCA 1VKZA 2IX9A 3M0EA 1K0FA 1MVLA 1WUYA 5KYWA 4LJAA 4RZUA 1UKZA 2E48A 4RY2A 5DULA 2CYCA 1V6SA 2VZEA 3DV0B 2JFNA 4K9DA 1E1QA 1GZDA 3A6FA 4QBFA 3D8UA 3T4UA 4PGFA 3ZGNA 1Z8DA 3ELWA 4FEEA 5JAUA 1SCBA 5FBWB 4EKGA 3BK2A 3VTZA 1FLAA 2IOHA 3FNIA 1KVTA 3D8HA 3DEYX 1P7ZA 4TKUB 3WWYA 4ALJA 3V4SA 1OJ7A 3VO8A 2B0CA 3Q0TA 5EJ9A 5CH3A 3IESA 4EPTA 1ENZA 4ZVRA 5BMOA 3LZDA 3WE7A 1N2BA 1GNVA 1NHWA 4GWKA 4F2HA 1CDZA 2AWOA 2DUMA 3BL5A 5I7AA 1FY2A 5B55A 1AZLA 1GV0A 1HQYE 4FYXA 1V11A 2EJUA 3UCFA 1W5EA 1Y4ZA 1H42A 3IPAA 1JLRA 5IAGA 3R3JA 5DCWA 2VL7A 3HM2A 2BMAA 4ZT4A 3FCXA 3ZIUA 1MVOA 1RPNA 5TQ0B 4DWWA 3KVVA 1URPA 2NYAA 4AIRA 3U39A 1GAXA 2YNMA 3R7FA 1SIBE 4Z86A 3KV1A 1YB2A 3S2GA 4H0NA 4LVOA 5HRAA 2PQMA 3I72A 1JEDA 1H66A 1JT2A 3EGWA 5ERYA 4H7EA 2FEPA 2VLIA 1OBOA 4D02A 4EPVA 8ATCA 1E5QA 1UMCA 3FMOB 3LPLA 4TVBA 2PWBA 5F23A 2OBFA 3QFRA 2CLOB 4BMXA 3O82A 2W58A 1WEHA 2GMWA 3UV7A 2Y99A 4CHGA 3ZHXA 4V0SA 3EISA 3FG9A 4K88A 1ABEA 2QT9A 1R6TA 1G3RA 2X1MA 4W99A 3QENA 4QDTA 4YASA 2YIJA 4E6EA 1R74A 3GT3A 3NTXA 3IPCA 4KYUA 4PR0A 4C0JA 3OTIA 4QEZA 2R6HA 1CR1A 3BSYA 2BJVA 1TTHA 4QUIA 4DAEA 4QQ8A 4DLYA 5J58A 2IHNA 1XRLA 3HWRA 1S02A 5EJEA 4MYUA 1DX6A 1S96A 3GVHA 1ECJA 5TLSA 4RWEA 2PZ8A 5EIAA 3S8MA 1LQ2A 2HSWA 3IDOA 4GKBA 4LUCA 5CM9C 3ZWYA 3CX8A 3DAFA 2PH7A 4UTNA 2PIAA 2FPOA 2C7OA 1Z8HA 2W6NA 3HYCA 4L6CA 1KOGA 3KQQA 4RFSA 1NRWA 1ZGCA 2NAFA 3TR6A 4M1EA 3KX2A 3LL7A 3O31A 1U3GA 3VC3A 3S2EA 5C4MA 2VZLA 3VOSA 5AVRA 5KO2A 4O5AA 2WVJA 5ABPA 3ASYA 1WCWA 1AY0A 4MLDA 1OV4A 2CZGA 3UYKA 4Z2AA 3IRUA 4YUXA 4UU7A 3NXKA 1IDN1 4G0PA 5K8UA 1MX9A 1NP6A 4JYMA 2YINC 4MA0A 4N3CA 3WICA 1Z0FA 4JLWA 5LP6F 2PRIA 3LXUX 1OFHA 5ALIA 3QY9A 4EOGA 4F3YA 3PGLA 3MUNA 3RBXA 3FVVA 5BN5A 1PR0A 3QY0A 1AGXA 1PGPA 2N0SA 4MQFB 3KUCA 1QGOA 3D1LA 4TZ0A 4GRAA 1OYOA 1JKXA 4C88A 1K5PA 2JFZA 1KJZA 4OLAA 4HUQB 1XTBA 5AJWA 4MUNA 1RJFA 4G24A 4YMTA 3A3NA 3OQJA 4RY9A 3AHFA 3D0RA 3L6CA 2FVXA 2VDJA 2NAPA 2VJCA 5K6AC 1C9DB 3CRNA 4CETA 3W3AD 2ILVA 4XSGA 3K20A 1TIKA 3LBNA 3QU4A 2D1YA 3K1AB 4HX5A 2RHRA 4HAIA 1V0JA 1ZRMA 1JMVA 1U90A 2ZKIA 3KJNA 1Z25A 2WMYA 2QNRA 1YB1A 1TVKB 2QN2A 3TSWA 1J9EA 1RWOA 1T9BA 5E6UA 1E2FA 3LRTA 1LLQA 2FN7A 2XEDA 5TGTA 3QVJA 4L15A 1ISGA 5J4VA 3O8CA 1QKJA 4J6EA 1CUSA 1YULA 4J2TA 5EQFA 3PDHA 2CXQA 1C8KA 2KLBA 3PNBA 3NEPX 3WO0A 2QVZX 3P9XA 1WW3A 1P4HA 2H7VA 3VKUA 1NMYA 4IXDA 1FXSA 4Z4IA 4KE9A 4BO8A 1Q22A 3KKQA 3KZ1E 5T3YA 3MRVA 4B9EA 2GEKA 5ESWA 4CLOA 4CIYA 2M6LA 1PRYA 3FMFA 2B8TA 1T5OA 1XCMA 5ISMA 5LD2B 1SU8A 3HB9A 3UAXA 4YAGA 1U5BB 1U28A 2BPOA 3B2QA 3CSUA 3KVOA 2EDCA 3RRBA 1RXEA 2CVFA 3LXXA 3UAGA 3W1WA 3QBVA 1UDXA 5A2GA 3GLFE 3L02A 1YUBA 2H0AA 1L8XA 3IUSA 2HO5A 2QW8A 4UZSA 4OXXA 1ZVMA 3L8ZA 1OD6A 4ZARA 2NO4A 4MUGA 4Q9DA 1P1CA 1X7WA 4ND3A 3C0KA 3LBHA 5H80A 1I0IA 3D6VA 3S7TA 1ECPA 4WZBA 1R7RA 2WP8J 1FX0A 1Y3IA 4RD6A 1M6HA 1JU9A 2YYSA 3HBMA 4C22A 2BM0A 1BCSA 2PWAA 4OMDA 3NBYC 2YWGA 2ZSUA 3ZWVA 1UR5A 4DC0A 3GP8A 1IVNA 3KTDA 3OKCA 2WOJA 4X95A 3GZNA 3TIGA 1DBSA 1FU7A 1V8PA 4HB2A 5LKRA 4M9XA 3GIDA 1G2PA 4GX1A 1YQQA 5F1OA 1P19A 3TAHA 3D8BA 1A4IA 2PO7A 4AKEA 1T4CB 5E2AA 4HQLA 1MW8X 3RC8A 3RVPA 3L43A 2F8MA 2QTBA 4TMKA 3OT1B 1PEKE 4OHOA 2HWKA 4ND4A 4JJGA 2ODBA 3PNQA 4GR5A 5G3YA 3S0JA 3C74A 4ZO4A 3CMCO 4UREA 4FIZA 3ZY2A 2TSYB 1CP3A 3UWSA 4CMHA 4A16A 3AZOA 1J00A 3OFKA 3I9NA 1R64A 2JCSA 3KHUA 1U0TA 5G41A 2ACWA 4KRYA 2QG9A 3ZWBA 4XYLA 4AJ1A 1WXIA 3EPHA 3QVKA 4RE5A 4AJIA 5FL7A 1QH0A 1NW8A 1YZNA 4QDZA 2QLBA 3SQNA 1S7CA 2ARKA 4H3SA 3NTQA 3C85A 3PC2A 3QE4A 2CJWB 4PX9A 4WY5A 2PAFA 4HI0E 2FFHA 2I4LA 1UMKA 2YL2A 4DCSA 4DMHA 1GSHA 2AMVA 2C8JA 1TK9A 1UT8A 4LHVA 1VJ5A 1O9HA 2ONJA 1AV6A 1B0UA 4CT5A 3EPKA 1WB6A 1V5IA 2A9JA 3ZZUA 1GPWB 4KKVA 1OROA 5KS2A 1DTWB 1HMYA 1RHUA 2I0FA 4NJEA 2ZK7A 4KX3A 2PX2A 4IIJB 1E4VA 1E2LA 3DVQX 2PBLA 4ERXA 1QORA 5FDFA 4BLOA 4H7HA 4EKYA 1O5TA 4D57A 4Y1FA 5DOZA 2AFHE 3EVCA 4RHFA 4A36A 3PA6A 4Q34A 5J63A 5AUOB 1NR1A 2C5SA 5KPDA 4J0JA 5FPYA 3HBAA 5KNLA 1U4OA 5JNLA 4V0QA 1MJ5A 1T34A 3CKMA 1Y5NA 2VKTA 1CS4C 1WB5A 2VUHB 3JWIA 5KQMA 4MQMA 2JGIA 3IBFA 4B6SA 1YE8A 3OICA 1RYBA 4ZYXA 1S8AA 1TMGE 3ZJ4A 4YRCA 3NHZA 3T7KA 3THRA 1BGXT 3HCNA 4XR4A 2DM6A 4P54A 2AJTA 4JROA 4K86A 3RARA 3UWMA 2JHAA 4PGAA 2Z3VA 1BMFD 1J2EA 2AFIB 2QN7A 3A06A 1E99A 3WNQA 4AZ3B 5IKXA 3AJEA 2AL7A 1R0KA 4RMHA 2HCJB 5DMXA 2C9DA 2GVDC 3KWFA 2G80A 3C4VA 4JC4A 3AIKA 2H4XA 1FLNA 5IKMA 2PYDA 1RI1A 2VF7A 3PHHA 4Q7QA 1QP0A 2F1RA 4NMLA 2P65A 4U5XA 1EFPA 4AJJA 1DC3A 1S2MA 3OPYA 1HLDA 4LMBA 4OXKA 5HBGA 4KWHA 2IIQA 3LVRE 3OEHD 2NIPA 4IH9A 4M1ZA 3T5AA 3S55A 2AA3A 1SKBA 4EGJA 6REQB 4RQBA 1UBTS 2CNBA 3LUFA 3V42A 4BQEA 4J7XA 3WOHA 3VNBA 3DO6A 3DEZA 1NUUA 2BELA 1CZHA 1F2VA 4GZMA 1Z5UA 3MXOA 4QT0A 3DNPA 5D8DA 1DRWA 2UVPA 1DIRA 1G20E 1E59A 4JLAA 4OQZA 3SZRA 4PZUA 3W9SA 4CKWA 4NRDA 1NVXQ 2A86A 5DNCA 1EX9A 1Y42X 2GZ3A 3U4HA 3OWHA 4HDNA 1UJ4A 3D6TB 4J0FA 1WCXA 4LZNA 3SHTA 4HT3B 4YR9A 2D0PB 4IO1A 1CV2A 4TTAA 1E2UA 2I65A 3N86A 4X1IA 5H16A 2C9OA 3KUUA 3OKAA 2NO7A 1M1NB 4XSVA 2I9KA 1XZJA 5L45A 1V1MB 4INJA 3LT2A 4FDAA 3GEBA 4YV1A 2VDWB 2B20A 1IN6A 5A6SB 2ZDQA 3OCZA 5IVPA 1YB4A 4K6GA 4HS4A 4K8RB 4Y2GA 2VBFA 4TLAA 1ENPA 1M2OA 2C99A 3GGSA 3VMMA 5L3VA 2QYHA 4B73A 5CG1A 2XVMA 5L7YA 3TQTA 2FSSA 3H65A 1B6GA 2X0IA 4A6DA 1Q3HA 1SKUA 3MAJA 5JY6A 4AN0A 1RBMA 1PJZA 3B9BA 2LIPA 5CPBA 4TS9A 4C7MA 2KHZA 3GDFA 1H4VB 5IAEA 3RTBA 3GFPA 5A6SA 5I3ZA 5LIRA 3QXSA 2HXGA 2PSSA 2Z2IA 4XOUA 2BP7B 4D4JA 3WYNA 1PT8A 2DSNA 3HB0A 3OWOA 5FLKA 4BQOA 3OLVA 3UT0A 2IUFA 3DMTA 2CLSA 5DDIP 5BSMA 2X7XA 3JS5A 3NKVA 4EA9A 1PG2A 3N1UA 4M36A 2R68A 1H1LB 4MW2A 4MV4A 4UEWA 1YACA 2AEFA 3WDSA 4JEMA 2HRQA 2VTVA 4BEBA 4ETNA 5KYUB 1CNFA 4UVHA 4D0RA 3O8OA 4CJXA 4AK9A 1M1UA 2X76A 3CLTD 3OX1A 3U37A 1JR2A 3MILA 1OIVA 4W9RA 2XQVA 1N1DA 1WKCA 5HF6A 5JS8A 4J03A 3WMWA 4Q66C 2ECKA 2YVQA 1JKJA 2POQX 3PRKE 4WW0A 5K4GA 3WIVA 1JG6A 1CCWA 1P2VA 3ID6C 4P3KA 2LDBA 5IVIA 1J1IA 2FHPA 1GYRA 1E6LA 1KO1A 3C5EA 5HFNA 3L7IA 3UAYA 1IB6A 4DQ0A 4N8SA 1Z17A 3RASA 3BMXA 4BKQA 4YUVA 1VIYA 1YQ9A 1GRCA 2LUOA 1WE2A 2HYIC 3RT7A 3R41A 1L8QA 1GRRA 4K9MA 2XTJA 2Z30A 4NZ9A 1UP7A 1IRXA 1KMHA 4FYIA 4LY0A 4MROA 3LCVB 4PQFA 1Y3DE 2HPZA 1PR1A 4NHOA 3VHXA 2J45A 4B4OA 5K4HA 4EIWA 1XXLA 3CPHA 4FE7A 1N4DA 2GGSA 4B79A 3EASA 3LX5A 2C4UA 4HH0A 4H4CA 4D99A 3FYSA 2PANA 3ROZA 4G67A 2H2FA 3GUZA 3HU1A 4JS0A 5GGXA 3DJFA 3IA7A 2YXPX 2Y1KA 4NY1A 4XB1A 1NRJB 1OI7A 4IOLA 1NNEA 2CZQA 5IBPA 1ES9A 1PJSA 1FVFA 3EDCA 1TRHA 4YFVA 1L7PA 3E0XA 3M8KA 6LDHA 3DCJA 3SEAA 1MAAA 1YS9A 2ERXA 4RF4A 3RIEA 3CLHA 1ZGHA 2CBGA 3IR5A 3PG5A 4CR8A 3T6KA 1S5PA 2B2XA 2FA9A 3OOEA 4AW9A 4DR5B 1BXRB 1BYUA 4N03A 1Y3HA 3KOOA 4ZT5A 4QOEA 2EAUA 3H97A 4K9KA 4PFQA 1U3WA 5CDUA 5IJ9A 1ZL2A 3L0SA 1TM1E 2IHJA 2YY5A 4QRDA 2CL0X 4V0ME 4RPCA 4WBSA 3RC3A 3X1ZA 2EATA 4WJZA 5L3SA 4IRMA 4QQKA 4JIGA 4KJZA 3RFCA 4XPIA 1DEKA 4NIMA 3KOWA 4OGLA 2IPAB 2D4HA 2INGX 3JWJA 3TTWA 1HDRA 1I3NA 2Z8YM 3T38A 3GHYA 1X8LA 5IH3A 4BVBA 1WMFA 1N6PA 2HU8A 4Y2TA 2HW8A 5KI6A 2EKQA 3I45A 2W2XA 4UUQA 4YVFA 5DV9A 3LPCA 4RSGA 1YR3A 2HREA 2N42A 1AO0A 1K5DA 1I01A 4WBNA 1XPRA 3QU9A 2Z4RA 2A67A 4U2FA 4UTZA 4PLCA 3OQOA 4Q47A 2I99A 2F1HA 2HQSA 2P2CA 1NUAA 4M8IA 4CEIB 3DL2A 1XTUA 2ID9A 2HWYA 2GVZC 2JJ2A 2OHIA 4WLVA 3RSSA 1B3RA 4CT4B 1DQRA 2UV8A 5SY9A 3BRCA 2ZULA 4LXIA 2QRKA 1EE9A 3PNSA 3SIRA 7ABPA 4WY2A 3T94A 3QKTA 4LBYA 3W8EA 4REMA 3ZGYA 2Z09A 4C0LA 1Q6ZA 3HVKA 2IYZA 3KD3A 4CDMA 3H7AA 1SUPA 4MW4A 1SXIA 2R60A 1MCZA 1KVSA 2ZJ4A 3PNKA 5DYYA 3T7AA 4EG6A 1KEPA 1JILA 1OFIA 3D59A 2PGAA 4DG8A 1JUDA 4G9BA 3AFGA 3NM6B 1UJMA 1INLA 1GWNA 4ZI3A 1NVVR 1ZR4A 3AUFA 2J59A 4YMUA 4N47A 2QNIA 2YMQA 1XZEA 2ZIEA 4KVAA 4PQRA 1MU0A 1H05A 2P0EA 2OZLB 3AKZA 1DV1A 1GDDA 2EFHB 1XTPA 4J76A 4MP6A 4DIFA 2BEVB 4JYAB 1ISHA 1MO4A 1EWVA 3LU1A 2WSMA 2Q07A 3GFBA 5LMZA 1Z6PA 2QZZA 1N7IA 3K0HA 4MI1A 1E98A 2OMKA 1JV2B 3HA3A 2GBCA 5JPIA 3QUSA 3F9RA 3IAM1 3DZIA 4FC7A 4IP0A 2UXBB 5JG7A 2BHTA 2OO5C 4IF6A 5FA8A 3OA0A 5HQ3A 2I6TA 3ML1A 2QV7A 3JSXA 3M3DA 1ZGBA 2IXEA 1S2IA 1JQEA 2JLQA 3HA7A 4M0EA 3SN6A 3ZWAA 1ICEA 4XFJA 1DHRA 1OZ0A 4FPXA 1BKDR 1OWNA 1TDJA 1U6JA 3C3JA 1A5TA 1H8HD 3L5OA 1LU9A 4PTYA 2RGGA 1M0SA 1MJFA 3VSEA 1B00A 3WOVA 1C30A 3TAUA 2RCYA 1RM0A 1KC3A 3IB6A 3JVEA 1S2LA 2A8YA 2OAP1 2Z04A 1FLDA 3B48A 1XRRA 3D31A 4L74A 4UUOA 2R7AA 1QP7A 3H1EA 2YIVX 3K0CC 4NENA 4ZRDA 1E6KA 5F2EA 4Z1MD 1ARZA 1P0IA 1RJ9A 3E7XA 4C04A 2NU9B 3KO8A 1CUVA 4NG5A 4EBFA 4Y6SA 1F7UA 1J22A 4CM6A 3ZNNA 4RVGA 3Q87B 4RYLA 1B23P 3I6YA 4CM9D 1STOA 3HV2A 5DCUA 5KU1A 4HQOA 1VCHA 3FUCA 2QL7A 2PUAA 1OIWA 1HDIA 1X1TA 2ZRNA 4G63A 3T35A 4CYMA 1R6BX 2A30A 1BVYF 2YWHA 3U16A 3R9XA 4MPDA 2NU9A 2L19A 3KUDA 4LJ8A 4HWKA 1KBZA 2KX7A 2NYUA 4X8OA 1ZOLA 2NQTA 3QFFA 3SCZA 4Q4AA 4XUEA 3TRDA 3KJXA 4ZALA 3C7AA 3QKRA 3G6KA 5KWIA 1I14A 1EP2B 2WA1A 3AY0A 3D3EA 1Z13A 5H02A 1MC4A 5H0IA 1EGVB 3ENVA 2J3HA 4J0HA 1HOXA 1KR2A 1TUIA 2ZE6A 5KAMA 5HKLA 5K0ZA 2PT6A 2ZJ5A 1OI3A 1WV0A 1MOSA 2BD0A 5CDHA 1VMEA 1PE0A 2XE6A 3JASB 4ZI2A 2SKDA 3QG5A 4Q93A 2W6JD 1O6GA 3B12A 3IAS6 2J7PD 1W0CA 4BNKA 4Z7OB 4UBKA 4ZYLA 4RTPA 4WZZA 2QTAA 1PFVA 2YN4A 3GLGE 2QN1A 1YT5A 3AK4A 4K0KB 2OOKA 4YJKA 1YIDA 4JYCA 2AK3A 4PLZA 2JEYA 1XZKA 4JJ6A 4YBRA 5D84A 4H6WA 4RZSA 4W1SA 1FNDA 1J70A 1SBNE 1UADA 3QI7A 5LA6B 2WW8A 3P4XA 4BVKA 3FLEA 4GRIA 1L5RA 1N0HA 3BSWA 4WINA 4N5NA 4HNUA 4KYIB 3L40A 1U7ZA 1ZM4A 1MC1A 1K6JA 4TL6A 4ETMA 1M6NA 4B0OA 3DBOB 2CLIB 1USVA 4W8OA 3T5GA 1XHFA 1XRJA 5CB4B 3A2KA 3EHDA 2PDAA 3UJCA 3GEGA 5JBQA 1TIPA 2YYAA 2MR6A 1UPAA 4MQUA 3SDZA 4C2AA 3ICPA 4INZA 5C1PA 5B53A 4EHBA 4JLVA 4NMWA 2A1UA 4CMKA 3EGIA 1G4HA 1AGNA 5KWSA 1Z68A 4JBIA 1BWRA 2RGAA 4FYHA 4XUCA 2Y0EA 1U7WA 2W2OA 1Y6QA 1PQ4A 3MCZA 1MV8A 1X14A 5DTRA 2ZUDA 3W5JA 4B3DA 2RGRA 4PPGA 2GQ0A 5B4UA 1IC6A 2R48A 1YL7A 3CA8A 4TLCA 1JDNA 1F6DA 4ZVTA 1U0SY 1X7WB 3N2GB 4HR7A 2YUIA 1DBQA 5F3WB 4C7BA 2PPLA 4YMIA 2XD4A 3TDKA 2RJOA 3GA0A 4GMKA 3SHVA 2Q29A 4KQ2A 4BE4A 1YC2A 2QT1A 3MM4A 3OD5A 2MOKA 3QYJA 5ADVA 2F1IA 3RS3A 2FR8A 5EJAA 3FVWA 2QMUA 1A8SA 1E61A 2NU7B 3R7WB 1X3SA 1E2GA 1P80A 3FYDA 1QIJA 3BKWA 4Q9NA 1BEUB 2FSVC 3IMCA 5EMJA 3RUHA 4CR6A 3O4IA 4ZCPA 4CIWA 4C0AC 5D85A 2G08A 1L5FA 2OCBA 4Y6OA 5EUCA 2G7ZA 3TLZA 3ZWPA 1N1MA 1SC9A 1Y63A 3C6MA 3EG9B 3INYA 4LHEA 1VPDA 4TV9A 3WLEA 4UDXX 2VJQA 1WW2A 2FH5B 3NAQA 1JHZA 2ZVQX 4I9HA 1GNQA 2OKCA 1FYDA 4QYWA 4DC9A 2C0CA 2PTGA 2ESRA 2W8BA 4ESVA 2DT8A 3IVGA 1Q50A 4RHUA 4EY8A 5ALDA 3EVNA 5FTMA 3AHCA 3EPJA 4XASA 1DAPA 1MABA 1NNSA 3NBZC 2X9LA 4CCAA 1VE1A 1E3EA 4OMUA 1BEEA 3VJKA 4ZOLF 3O4JA 1ACLA 4CKBB 1EGAA 4MHTA 5IF9A 3HUFA 4CDNA 3HRIA 3NC4A 4OXQA 1W0JA 1VCNA 2OGZA 2Q9AA 2EFDB 4D4KA 4GZLA 2QN8A 3H2ZA 2CDAA 3DYIA 3M4YA 1Q0UA 5B2EA 2FWNA 1XR3A 4KAAA 2JVKA 2WSSA 5EUQB 2VQFB 4JHXA 1RI4A 2AJCA 3WA7A 4C89A 4YCCA 3L1IA 3OQ1A 5BXYA 1JFVA 5KOHA 2FPLA 4AWAA 2R6R1 1KIFA 5HM8A 2JKVA 1S1MA 1J6UA 1OILA 1NBMA 1U7PA 2P41A 1XQ6A 2ZQYA 1EJ2A 1TJNA 2Z83A 2O9JA 3HUTA 4IHAA 1K1EA 3U44A 2QRQA 3LMKA 4I3GA 4Q3KA 4MB0A 2C96A 1CQZA 3PEVA 2E4AA 3A4IA 1DHTA 1KSGA 1JEQA 1MRZA 5COBA 5ALJA 4CMGA 3B3JA 5C8VA 4CF5A 4LFBB 2Q6VA 4R31A 3WIUA 4QOFA 1Y1LA 2P79A 4KUEA 1L7MA 4RIFA 2O06A 5GOTA 4OK6A 2IBSA 1M2KA 5K3AA 3ADOA 3IQIX 3TDNA 4ZZIA 4OL0A 3L6EA 4Z9YA 2AKAB 3H99A 5G4KA 3L77A 4CCSA 2FLKA 2AC2A 1U0EA 2V98A 4LMAA 4ACAA 1NMQA 1X7YA 5IKOA 2I80A 5KNCH 4JIMA 3X1XA 4C0SA 5KMGA 1GG5A 4F9EA 4RLHA 3ZDFA 1EDZA 4NU6A 4TS1A 1M1XB 1XZDA 4L08A 9GPBA 3SQOA 4BNJA 2CXHA 3CF4A 4YCJA 4HAXA 4ZDJA 1A7JA 2AMLA 2NVOA 4CRWB 3M1YA 1YKGA 5G4KB 5CXQA 4EG3A 1L5YA 2EP5A 3OMLA 1ZCBA 1B8UA 2P4UA 2YCBA 3PP8A 2VNAA 3LQ1A 1USGA 1Y48E 1N75A 2HDHA 2WG1A 2PH3A 3EIOA 3F5MA 4I50F 1IHYA 2VN8A 4MQEB 2IYLD 3WGNA 3MGCA 3S6JA 3AKEA 4M60A 2DGDA 2CNDA 4ZDIA 2Q2WA 1CJCA 4TM8A 2ACEA 3FMGA 5JY1A 4NFYA 3OAAD 4OHMA 3UBTA 1RWPA 4IFIA 1YA8A 2YJTD 3R6DA 4FR0A 6YASA 1Z2DA 2X42A 5FBLB 5IJXA 2A9QA 5D86A 1PBNA 4RESA 2CVQA 4RD1A 4DV1B 1GFIA 3PXAA 3TJMA 4JQYA 1RI5A 3HGMA 1ENOA 2PU5A 3UT6A 1ZCFA 4TLMB 5AFSA 3BRWA 2I3DA 4A0QA 1SM4A 1Z73A 1DKMA 5I9SA 2ZBRA 4MR8B 1GSIA 2JJ2D 3E4DA 3IVXA 3Q1KA 4OH7A 3CWZA 3W6NA 3IOYA 2UYHA 4HVCA 1QF6A 4E08A 3MJSA 1JP7A 1T1GA 5BN4A 2ZAYA 1YZLA 3CLRD 4IXWA 3WJ1A 1MW9X 1U0FA 3I64A 3DA8A 1RHJA 2AHOA 3WYDA 4EFMA 1VB3A 1EBUA 1F38A 4N3NA 2CLMB 4I4TF 4KFCA 3NTRA 3QLVC 3UBMA 3IJPA 1NMZA 1K7SN 4P0PB 2AE2A 2ODPA 1YRLA 2OBXA 4B83A 2H2HA 3T9CA 1P73A 3HI4A 1T5IA 4ZQFA 3RRNA 1IOWA 1SAYA 2O50A 3I5UA 3IOMA 4Y2RA 4C6TB 1UBLS 4Q3LA 4KWCA 1LB1B 1RXCA 2KPOA 1N9GB 4P4GA 4RY8A 4H7KA 3QBTA 5HFAA 3ZJTA 2J9FB 3HKEB 1J97A 2HA4A 3TQRA 1KYWA 4D3XA 6Q21A 3Q8KA 3A6LA 3F3KA 3OWXA 3GZTB 4OJYA 5KKAA 3KETA 4QM6A 5F3RA 4DDTA 5KJ6A 3E7FA 4TXNA 3TLGA 2JLWA 2JHCA 4AJPA 1Z47A 2G9VA 3W77A 4HWTA 5CK4A 4I46A 4MQFA 2W8ZA 3JCZA 1ZQ1A 3K9HA 1F5SA 2OPHA 2GESA 3LUJA 2WVAA 1SHKA 3D3QA 2X4LA 1JXMA 3IP7A 1CZUA 1P5HA 5T4FA 2PZEA 5LIPA 3CRZA 4G0YA 4LYAA 1DCKA 4EQZA 2ZYSA 4O4IA 1DDGA 4WN9B 5I4BA 4FS3A 4EYKA 5JANA 3A6PC 4UEQA 5E6SB 5AW9A 4RPGA 3TRFA 3V8PA 2WB2A 4IIBA 5G0WA 5IAOA 4Y1EA 4U9IS 4F93B 1KNQA 4E4YA 3WAJA 1TAQA 2ZE5A 4JOSA 4Z4FA 5DTIA 2GDJA 5FULA 2H1WA 1F0YA 3WLFA 3E84A 3GUVA 1G5HA 2XYRA 3Q40A 3HFJA 4IJKA 3HKBB 3QVSA 4NJMB 1D5CA 3QW2A 4YLGA 1RQ2A 3FJ1A 4XWOA 2IS6A 2BJWA 4D9EA 3AESB 2IYSA 4H18A 4P9NA 1QZTA 2RHOA 3IT3A 1RWVA 1QKIA 5J4HA 3N76A 4B2IA 4P2GA 2MCFA 3OE4A 4WGGA 3UMRA 2UUCB 1S2GA 2PMCA 3QLUA 3AUAA 3VNQA 4R3UC 3N70A 3C6BA 3HWWA 1WJGA 3QELA 2C2XA 3R7WA 4NU0A 1NSTA 2CJFA 3QQ5A 5EXEA 4NQZA 3L7YA 4XWTA 3BTSA 4ZTBA 3RAEC 2QRGA 1BYIA 3OE7A 4OAQA 3WWZA 4L6AA 1UPFA 3IXQA 1DIAA 2QA5A 3E18A 3EG9A 4Y9TA 3G49A 4MO2A 2REOA 1DC5A 2ON6A 4MVJA 1NN3A 2QAGC 4IWNA 5CCXA 2PT7A 1NGSA 2E21A 3CVWA 1TYCA 2X6TA 1G1MA 4JVMA 1KU0A 1YVRA 3ENQA 4AO7A 1L5GB 3V3TA 3P9KA 1IULA 5AXDA 2ZIXA 3HDJA 4G5XA 2X0NA 1AK9A 1YU9A 1G18A 1Y9ZA 3X1YA 1G64A 2HQ1A 1FL9A 3LXRA 2WZDA 5CFNA 1XT6A 4EPYA 4JUBA 4BKOA 1P61B 1HEUA 1MNQA 2XB4A 3BS4A 5K20A 2Z98A 3NIFB 3KR9A 2SCUB 3DWFA 3AZPA 4JU8A 1GGNA 4ODIA 3U3MA 4PC2A 5EE5B 2NO9A 4KNVA 5EOVA 1E3DA 1JDZA 4GPZA 2AQIA 3DBIA 4E7PA 4TTTS 1SUCA 4DSAA 5FPSA 1RFGE 2ZE7A 2G8LA 4F96A 5AVQA 3EFBA 1XVTA 4TUYF 4LSZA 2ZE8A 3RRFA 2O48X 2Q28A 1UPCA 3KLPX 4F5WA 2XE4A 1OKKA 4GP9A 3U31A 4DSNA 2A0FA 3GELA 4FE3A 1YZQA 1C0LA 2G28A 2V7UA 3EZ9A 4IRXA 1T25A 4IG9A 5DI9A 3T61A 4AZ0B 2JCBA 2MSNA 4L3OA 4D8XA 1XZFA 1RXYA 2YYZA 3SMQA 3UGKA 4UCFA 2EKBA 3E9ZA 3QNWA 3WB0A 2WJ3A 1XKQA 5ITSA 1MOQA 3ER6A 3TTTA 1PAUA 3ILYA 2J4DA 4NFHA 5E9AA 4CKYA 3MUEA 2G04A 4QASA 1FP4B 3WGMA 3P0RA 1U3TA 3JQAD 2A9RA 5D6OA 2HSDA 3OSUA 4Q4AB 2GSDA 3G2NA 3F5FA 4L5BA 1UBUS 4CL0A 4GBMA 1RYZA 4AMUA 3C3XA 5ECYA 4F0JA 1NA5A 2CXSA 3TPFA 1KA9H 3G8CA 2X22A 3JATB 4HF7A 4MP8A 4DLBA 2W6ZA 1H1TA 2Y66A 3B1WA 3AR8A 1SC6A 1SHTX 3FNBA 4LXXA 4DWJA 5HMLA 1KI3A 3OEYA 4DRXB 3TJZA 5KTYA 2QPTA 2JC3A 1GLNA 3GBVA 4DR3B 1PKXA 3HZHA 4J0KA 2CBXA 1TMOA 2VOEA 3I9V6 2WAYA 2WF7A 1IBMB 2DH5A 3U7EB 2ZRFA 3IC5A 2FPUA 2GEJA 4X45A 2YFKA 1RFLA 2FCRA 4K40A 1XD8A 4NULA 1RWQA 4O4LF 1F5NA 1B2RA 5JMPA 2IH2A 5ELXA 4BNYA 1XJWA 3FPCA 1V95A 4H1HA 4PHHA 3CZCA 4CU2A 4UOEA 2HMUA 5JQGF 5EHGA 1UPXA 2B99A 4WKGA 5JUWA 5IDYA 5HP4A 3NVKI 5BY2A 2I1VB 1ZH2A 2B7CA 4KXMA 2CNOA 2IYAA 2YHIB 2ZSIA 3II6X 4KE6A 4CMEC 4OU5A 4E32A 1FYVA 1QJ4A 5G1NA 5GPBA 1FRZA 3HN7A 1VKNA 1QKKA 2JA2A 2PKXA 4I4NA 4X63A 4CLDA 1Y6FA 4O4JA 1LD3A 1K6XA 1Y89A 2EZTA 3P4UA 1PHRA 3T1TA 5JQGA 1A8UA 5EMNA 4M7PA 1JG7A 3AHJA 1Q12A 4W63A 1AD2A 4QHTA 9ATCA 4HLUC 1WHSA 3UATA 3SWWA 5JS7A 1HQCA 4FWTA 3C14C 3PKJA 5I7RA 4JR0A 1L5ZA 2OQIA 3DHNA 3Q98A 4QHYA 2H1CA 2RHLA 3HY6A 4HX2A 5DSZA 5F1KA 4YAJA 3ANTA 3SJ7A 4EPXA 4BATA 1KETA 2HOQA 4NCIA 3RRYA 2GS9A 2V6FA 3TQHA 2N1BA 2XYVA 2SECE 3AP1A 3RV4A 4QT4A 3B8HA 3C3AA 4C4OA 5IDXA 5HRUA 2IBTA 1NVMB 3ESCA 2AI1A 1NZDA 3GH3A 4FFSA 4DWVA 3R4VA 4ZVQA 1AQNA 1NJ6A 2WWRA 3T4EA 5EJ5A 6ADHA 3RADC 1E2EA 2GO7A 4LWZA 2AUMA 4URWR 1CUIA 4QUKA 2P90A 2X8JB 3C2QA 1THZA 2LCQA 1NLUA 1W0KA 5FWXA 1K27A 1ZIXA 4ZXFA 1U1IA 3BSSA 3MT7A 2GD0A 1PJQA 4H35A 4P31A 5BSEA 2WOOA 4ID3A 4MKRA 1U31A 3PNLA 2BHSA 5HQTA 2Q3FA 3ZH2A 1YZUA 4DPKA 3IHKA 3Q8LA 4NS4A 2ZYVX 4J7UA 1PV1A 2ZIZA 2J9ZB 4M49A 5KCMA 5HOEA 4KUHA 3N2KB 1W7AA 4L8GA 2EERA 5ESXA 1QRUA 5DCYA 4NNJA 4WBNF 3SFVA 3RTDA 3S2FA 1MLDA 3R7LA 3SM9A 3UWDA 3AKCA 1D0SA 1P0FA 1RKBA 1ST3A 1YGPA 2VSFA 4D98A 1F4LA 3JZAA 4Q4JB 4R1LA 2PUBA 5ALUA 3EGOA 3QP9A 3S1LA 1BNCA 2Q9CA 3FDIA 2J67A 1N6RA 3MLAA 1L7BA 2A1IA 4P38A 1Q0TA 3KE8A 3VKVA 4FGWA 4MS1B 3EQ8A 3ZIAA 4EQ6A 3GIWA 2JRCA 1NR5A 1SXJA 4KPYA 3CH4B 2FLVA 1E64A 4IDNA 2CLLB 4YJFB 2QAGB 3KDAA 2IV2X 1Z7BA 3IBGA 4RPKA 1R4NB 4QG7A 2O8NA 3C6XA 2VEDA 4I14A 5EUBA 3HNPA 1XZPA 5IMSA 4UULA 2F43B 5C53B 1CR4A 2G25A 3QBEA 2W6ID 4ZAWA 4C6RA 2LNDA 1M83A 4N7BA 2MDTA 2M6KA 3LQ4A 2D2FA 3NU1A 1OAOA 2GWRA 1ZISA 3GJZA 3MTAA 2JBHA 1KYXA 3BHNA 4C6TA 1P44A 2DX7A 4FDVA 4ZJYA 2QLNA 2DP4E 4PYMA 2BMWA 5EKXA 2HNBA 3ITEA 2Q5LA 3ESXA 4HYQA 2W4IA 3FSEA 4PZCA 4XPIB 2Y1LA 4GVXA 4DFDA 3Q6NA 2CDNA 2ZFUA 1E5DA 3EF1A 5JFOA 2HMAA 3PKZA 5IJ0A 1RCFA 1DINA 4AL4A 3OHPA 2WLTA 3Q3JB 1ZD8A 1U2RA 2WF6A 3M5CA 3OEWA 1ZICA 4II3A 3TO5A 1FFBA 1GQOA 5C18A 2HSZA 1YZGA 2QE6A 2YUTA 2YV5A 4IEEA 3THXA 4QNNA 2YWXA 4YO7A 3V55A 1OPXA 2HF2A 2NO1A 2VH5R 2QV0A 1CNMA 4BGDA 3LUGA 1ZO8A 4EEXA 1X19A 2IP4A 1TVCA 2FY8A 1XTIA 3EDYA 4YJFA 1JAZA 2PYIA 3U3XA 4ZCRA 5D5PA 1VP3A 2B4YA 3O2JA 3PBKA 1CVRA 3RTCA 4YR7A 1ZESA 2G76A 5HSGA 2JG3A 4GP6A 1NBEA 1LPOA 3P2EA 2A6PA 1NPYA 3BERA 5BR8B 1WP9A 3PQ4A 5BW5A 2ZSKA 3BIJA 3Q85A 5C1IA 4Y1RA 3FGOA 4RD4A 4EH1A 5KQLA 1TFRA 1O58A 2WF9A 2XI4A 4D8WA 4WXPA 1U2GA 1RXVA 4ZREA 2R8YA 1TCVA 3KXLA 1PZEA 3LSYA 1B42A 1D8TA 5EP2A 5GONB 1SCAA 2OV1A 3JWPA 1EB8A 1TIBA 3G0GA 3PEEA 3QSGA 4IMPA 1IMJA 1SOUA 2DOKA 3G5MA 3L93A 5ADHA 2PE5A 3FRIA 4YXFA 1E9EA 3NPAA 4QGSA 1RLTA 4UMDA 5JC1A 3OKPA 5CXXA 4BB6A 4JVLA 5HUJA 1L7DA 4MS4B 5DYNA 2ACKA 3U5TA 1A9ZA 1WMSA 3LGAA 4AJ2A 3JQGA 4FMCB 3UXMA 1GFSA 3O8DA 2K4MA 2PYZA 4Z49A 2FPKA 3C15C 2WIGA 5KWVA 5ICGA 3QU2A 2C07A 2VXCA 3N6VA 2JZOA 2BH2A 4BYGA 1BROA 1N6NA 1RXIA 2H7CA 3ME5A 4FFBA 5A05A 4CU5A 4HBZA 2Z9BA 4S2EA 4ENUA 1QLWA 3MWKA 3BWCA 1SCQA 5CVCA 5INTA 2RGDA 4H7IA 4RZ2A 3V97A 4Q0MA 2J30A 4Y7DA 1NI4B 3PEUA 4BKMA 3SYTA 4BC0A 2GO1A 4ARVA 5JATA 3KT3A 4JXXA 4EB6B 1FTYA 1OBVA 2GEUA 1YJBA 1EJBA 4DCVA 3JRWA 1NG1A 4P93A 3WGIA 1HE4A 3A2NA 5CX4A 2BTQB 2VK4A 3DL4A 2YVKA 3FFXA 2J4FA 1KBQA 1Q77A 2IZ0A 2NVWA 3M5DA 3TTXA 2B6NA 1PT9A 1VFPA 2O8BA 4RMJA 3RVNA 1CQJA 2C3OA 1B7GO 1WZCA 4WE3A 2UUOA 1TLFA 4TT3D 4RS4A 2W2QA 4IQ8A 2GSWA 3L7KA 3JQRA 5E7MA 2BBWA 1PNTA 3HZRA 2XVYA 3MMSA 4G84A 4KSYA 1OFUA 3G23A 3M3HA 3TNYA 4B6PA 2QL9A 3RRMA 2QPLA 2POCA 1H6BA 2R1TB 1DUIA 2C2BA 5EIEA 3OZEA 4NCAA 3D43A 5IPFA 4HDCA 3VAAA 3GLGA 4BMPB 3V7NA 1A3CA 2BM8A 2JGEA 5DZSA 3MTDA 1Q92A 3UT5A 4UOZA 1SXJC 2IBMA 1Z5PA 3KYCA 4HDNB 2IH4A 4MTLA 1UMBB 4O1HA 2Z56A 4UQPA 3GVPA 3OCJA 3L0YA 3TH5A 1CUBA 4G5FA 2CE7A 1LRJA 4OQDA 3WGUA 3UAVA 1NJ5A 2Y2VA 3O9VA 4KQFA 1JSLA 2WWIA 3C6QA 5AKKA 1TT5A 3WHIA 2PGLA 1Z12A 3SZOA 3R75A 3NANA 1PFUA 3GB9A 3MWYW 2XXBA 3QEJA 3DDUA 5CDTA 1OYYA 2FSIA 2J8ZA 3WV4A 4QJ3A 5B4TA 3KOYA 2ODWA 4NBNA 4RETA 3OX2A 3TSYA 3PEYA 4UATA 2YFQA 4RJJA 1G0NA 4FMPA 2GXUA 2DBYA 4LTDA 3WZMA 2ZEJA 1RZRA 1VZ2A 2OR3A 3GRKA 1J09A 2JL1A 2HUNA 3E48A 3MYYA 3AOEC 5CUQA 5JMOA 2VS1A 2YS7A 3FPBA 2Z2XA 3O90A 4IVPA 5L3RA 4F3KA 2I1QA 5DW3A 1M1ZA 5K2MA 3KSZO 3NDRA 4K3UA 4TKVB 4Z51A 4F92B 4D8YA 4HAWA 3PRHA 5JJ5A 1ML4A 1Q3TA 3FWYA 3HXOA 3GLRA 5IAAA 1M6EX 2GEVA 3EH2A 1XK6A 3Q6IA 3LKZA 2RK3A 4BP3A 3NIWA 2EX1A 4KH0A 4A8JA 4LTMA 4JBXA 3VZPA 2C8VA 1SCUB 3OQNA 1Z45A 5IM4F 1YCHA 1TTQB 1RRGA 3SYLA 2AG0A 1NBMD 3L46A 3E03A 3LHSA 1NY5A 4DIBA 2PUJA 4OXIA 3H1TA 1WU7A 1A7KA 3WLPA 1UWCA 4HEHA 1T5SA 2O8EB 3CLRC 3QKSA 1DOHA 4K1LA 4C76A 1AIPA 3C8ZA 1XMXA 2BGNA 1YS1X 2Q6OA 3T7EA 2NSJA 3Q3CA 3RVLA 3P2IA 1YR7A 2HNKA 4G41A 2ZBUA 4K6HA 5E8JA 5CFOA 3CNBA 4DAOA 4CF7A 4L95C 1ZZGA 1T5DX 1BKSB 5CHYA 3C7KA 2GM9A 3PUYA 4GDMA 4TMTA 3A2LA 1NNUA 4P32A 5TY0A 2PWPA 4GI3A 3BQMB 1HDCA 2VPWA 2ALJA 3CJQA 4B3TB 2CJPA 2J32A 3FOAA 2IHZA 3IBSA 1E2NA 4YBZA 1EIZA 3D4OA 3CRW1 3HKDB 5CVUA 1JFRA 1CY7A 2DB3A 2VDPB 3NYQA 1U8AA 2ZRKA 5AICA 3JX9A 1I7QB 1KI2A 2YYYA 3CF6R 4NBVA 2YIMA 1MFZA 1CZRA 1PVVA 1G6Q1 2H63A 2V3VA 3SIXA 2C54A 3T9BA 2NUBA 3EXHB 3CE6A 2WIDA 3ORSA 5JEEA 4N48A 4KBFA 2AHRA 3UWOA 3NAZA 3HYRA 2GFQA 1JNXX 1ULZA 4GX2A 2IZ5A 1F0PA 4NCJA 1XXHE 3T0GA 4B80A 2O1EA 3TRJA 3MGGA 4JJIA 2L82A 2PEZA 4HPXB 5JSZB 3CVVA 4DCCA 1QYVA 4X6LA 3EMKA 3NHPA 4YRSA 1ZHHA 3DXXA 1DAEA 4HJXA 3FHOA 3GK3A 3HG7A 4PSAA 4RJ2A 5E4JA 3VJLA 2FFQA 4ITUA 3D6UA 4BGIA 1NW6A 1KBOA 2LBPA 1JECA 1M8JA 1U7DA 1E8NA 1GITA 1XL1A 5EE0A 2YN0A 3SY8A 4C0XA 5G0VA 2HJWA 1E3LA 4HB4A 4PF1A 4A0SA 5C1DA 3NYIA 4O33A 1GP2A 3U1TA 5K8JB 4XDHA 4KACA 4G0UA 2YW9A 4KLNA 1MQSA 3ZJ5A 4KYVA 1A5ZA 4ARCA 1GZ7A 4ZYUA 4KVFA 4ZOAA 1YI0A 4QM7A 4JA2A 1FYEA 3DE1X 4C3VA 1RQLA 4HAOA 3KNZA 3P9YA 3AYXB 2XUKA 4BX3A 2YWCA 4A91A 3AVTA 2XUGA 4J9UE 4RPIA 3TD2A 2Y1EA 1XZBA 1M74A 4RK6A 1UFOA 3FWPA 3QPWA 3AU8A 1S8OA 1U4NA 2IQ5A 2ZBFA 1TA4A 4CL3A 2QGNA 3O93A 2ZYUX 4I50A 4UTXA 2DQ4A 2JLBA 4FR2A 4KRGA 3M89A 4RTLA 4P3YA 4JI5B 1EUDB 4Z1OA 1P81A 4NFSA 4R2JA 4CQMA 1ORHA 1RVV1 3ZLTA 3U44B 2QRZA 1SB8A 2IUUA 4DJFC 2BI7A 1RWBA 1GHTA 4WECA 4ZCTA 2N3ZA 2I6GA 2NV6A 2X86A 3F6EX 2DFVA 3ITKA 3LBYA 2J0SA 2QUAA 4OI2A 1CFZA 3F67A 2AIRA 2WTEA 1S8FA 2RGBA 3G0OA 4I50B 3ANLA 4LTNA 2H8KA 4B3GA 4AS1A 3DDCA 2IU4A 4QPJC 3I8XA 3A4MA 4IW3B 3QEBZ 3A1VA 4F97A 1KPGA 1YKSA 3SKYA 2D3WA 2PBFA 2HSEA 3K9NA 1EG7A 4ONEA 5F5NA 4IL5A 3QUCA 4HDOB 3JAMA 1XEXA 2IZ6A 2KM1A 621PA 3PPIA 2FK7A 3GJQA 3NBXX 1SKAA 1X1CA 2EFYA 2HB6A 2VSYA 5HHTA 2IYEA 3A1DA 3DFKA 2FR8C 2I6FA 3QXGA 4I4TA 2Q1XA 4Q4JA 4R1OA 1RPZA 1LF0A 1PIWA 3MC1A 4PLTA 4XYBA 2A14A 2FMFA 2MMCA 4B6OA 3BXZA 1VI5A 2R7LA 4IGEA 4LF8B 2TMDA 1GGFA 4XA8A 3IE2A 1QLHA 3VR5D 1M8FA 4D25A 2GBGA 3L4BC 4QU0A 1BE6A 1MD9A 3E61A 3GDOA 3UFBA 4YYEA 4LCBA 1ZD1A 3BGWA 1TLLA 4PAOA 5DWQA 1K8RA 2OXTA 4YGXB 2CV1A 2FZLA 4FZ5A 2WIKA 2QB5A 3L6OO 3LWBA 4QLAA 5C1OA 1QGAA 5F9MA 2VHUA 1JHAA 4MV3A 1TKAA 2C04A 1N25A 3K0FA 2PA0A 1QH8B 1DBVO 4XGKA 4E2FA 4D6XA 3AY6A 3VVLA 4FN5A 3SYMA 1EFVA 1NJGA 1LX6A 2NACA 3HC7A 5THQA 1C5KA 1FSSA 1I0ZA 1M7GA 3JQ7B 4EF5A 5I7OA 3UK0A 1FPQA 1VRWA 1B1CA 3DFFA 4LHSA 2FDRA 3C70A 3HZZA 3RVKA 4E94A 4EG1A 1U1DA 1J99A 4Q7KA 3A2MA 2YMPA 3AJRA 3LXMA 4ZU1X 3GUUA 1ILWA 1E79D 4MIYA 1NMEA 2JIDA 2NZ8A 5J4LA 4LJRA 4RGQA 2IYFA 4ZC1A 4EMUA 2G8NA 2XZPA 2QX4A 1N2HA 2R86A 1OXVA 5HDQA 1POWA 4F8EA 3KB2A 2PKQO 4MCAA 1JDSA 3LP5A 3AB8A 1TCBA 2E87A 3EA0A 3OIUA 4K05A 5KYYB 3OC6A 4I4IA 3BIOA 4HFNA 4FT4A 3WLKX 4Z7JA 3HU5A 4IFEA 1SHLA 1P4SA 2HO4A 1VP9A 1XPUA 2H3EA 2B34A 4QQFA 1Z06A 2AZTA 4R68A 4IZOA 2VH2A 3H17A 3B1KA 3V5NA 4ZMBA 5C51B 1CQIA 4I99A 3OOYA 5TS2A 2IS4A 3IODA 1RZRD 2VT6A 3PGKA 1BXKA 3G5LA 5BYAA 1MBZA 1UKVY 5DXFA 3SEQA 1Z2EA 5BV7A 3FHTA 4Y1RB 2VXOA 3H1FA 1T8SA 1XZMA 3BGIA 1PZHA 3ZQUA 3JQPA 1PD1A 3WWDA 1E5LA 2PWYA 3DE2X 2Q50A 3QA3E 4AWXA 1F0NA 4BMYA 1PNQA 3Q9UA 4UDYX 4MZXA 2QTTA 2OECA 4KH1A 5FTKA 3T9FA 1E4EA 1IAVA 3VDRA 1ABBA 4TXLA 4P4UA 4N4AA 3GEMA 1OLUB 3A3OA 2VJNA 4XCXA 2BGGA 1VL8A 4US1R 4JB2A 3TOZA 1A9PA 4N39A 3SG0A 3ETNA 4P6VF 5BOVA 4OQYA 3VJRA 2ZYTX 1NMXA 4IJUA 1NONA 4RSRA 1LWNA 1ZONA 2OKGA 4WPGA 3V2IA 4DQDA 5KOHB 4IVQA 1DRUA 3UJ6A 121PA 2IYXA 3M6VA 3SX0A 2H0QA 3VGJA 4EELA 5KQPA 5L53A 5JLJA 3L1UA 3OQBA 1L4EA 3EK2A 5FKJA 5K6AA 1HOTA 1FP2A 4QXAA 2YQ4A 5J9FA 1X9GA 1WPXA 2C1ZA 1G21A 2XVZA 3KPJA 3MS7A 1YU6A 3UPUA 1VE3A 3KSMA 1SBCA 1OAKA 3WK6A 2JFVA 4L4XA 2GXSA 2JAOA 2H1VA 3DUFB 3H2YA 4URVR 2E85A 4R9VA 5AKHA 2CW5A 1R16A 3KLBA 4LJ4A 1A1SA 5D01A 4GKVA 2QG6A 1HE2A 3QOXA 1C81A 3DT6A 4MQ6A 4N5DA 1V26A 4Y9SA 3TK1A 4BLVA 4EY3A 1F6WA 3FIJA 3LQKA 3N2LA 3PD1A 4NOKA 1C50A 2B9VA 3H6GA 3H8VA 4JB0A 3P0EA 4TTVA 2GZHA 4O2AB 4WOJA 5LKAA 1EE1A 2LGJA 4LQ4A 1Q0PA 3DFUA 5ERXA 5JCOA 1PNVA 5TT1A 5T64A 1ESNA 4KO1S 4QGGA 4XQ9A 3I09A 4D81A 5IT4A 3OE5A 5A4IS 1X92A 5DOVA 3GD5A 4L73A 1PS8A 5BV2P 1J0EA 3DZDA 3UHOA 2O2XA 4TGLA 1J1ZA 3CWQA 3DQQA 1NOIA 3FF1A 1GADO 1NT2A 1NUHA 1XNQB 5AM3A 3GJ3A 2F43A 5CVJA 3TLGB 3AEUB 1IU9A 2C98A 3D02A 1TZKA 1GZ4A 4JLUA 2OK7A 4FSDA 4GG1A 4RK7A 3V8BA 3FPJA 3QIVA 1Q1EA 4G8BA 1I1QB 1C8LA 1V47A 4Q12A 1JPVA 3AM1A 3TJRA 1ZINA 5I7WA 2QD3A 4AS2A 3OLWA 5CLLA 1FDWA 1KGDA 1TXGA 1E3WB 1JHOA 1T0JB 2ZJ2A 4PVCA 4HG2A 4KQJA 4E5MA 3H4IA 1NJFA 3MJDA 3UB2A 4KAJA 3LC0A 4KUGA 4DEYA 5F7JA 2RI6A 3IPYA 1IJFA 1HTTA 3L8DA 5IJWA 1DQZA 1SXQA 2NT3A 3O26A 4LSMA 4N5IX 3T1OA 4R2MA 4DCMA 1NG9A 2H2AA 4J3JA 3ENZA 1J8YF 2F2TA 5JWRA 1FW6A 5AKJA 1M76A 1FFCA 4IRUB 3NIGB 2O7SA 5FWXB 3DM5A 1TRKA 2P68A 2IYPA 1XGKA 1GOTA 4MX8A 4WXRA 4B7CA 1FP1D 4I1SA 3SS7X 4EJSC 4D3SA 1PR6A 4RHEA 4RL4A 1WBJB 4IQ0A 2PZMA 4HXFB 4GZ3A 3L0BA 4NTZA 4BAUA 4E14A 3ED5A 4J6FA 5C4IA 1E1LA 1I7SB 5JS1A 2XTZA 3IP9A 3NV9A 1AXRA 3I8SA 4V0RA 5LZ5A 4O4LA 3EGVA 4NCNA 1C9YA 1FX0B 3KFXA 3TFQA 4KOAA 4EUHA 1GNRA 5JAHA 2A35A 5F35A 3CTMA 4M1KA 1DZ3A 1TM5E 4F3TA 1GFWA 3L84A 3KKKA 4XJXA 2IGTA 4CQJA 2XMSA 1ZK2A 3MWFA 1PGOA 4C2BA 1U2TA 4C4ZA 1E5TA 1HBJA 4ATNA 3VC1A 3R7SA 3TNJA 3X2EA 1P2BA 1KO7A 1RQ7A 5J2TA 1VYUA 3QEAZ 1MHTA 1DOAA 4MDEA 4WACA 4KR7A 2ID4A 4TL7A 1YZHA 2J5XA 1U02A 4FXOA 4AF7A 5HJ5A 1CF4A 2GPYA 3BF8A 2CF5A 4G81A 4E3ZA 2WWWA 2EBFX 2FVYA 3LQYA 1JI3A 4NP6A 1LFAA 4B3BA 4RTSA 1GQSA 2VVTA 4XQ0A 4RZIA 1RYNA 1IUNA 3KWJA 2C92A 2UUPA 1S3FA 3MSCA 5HILA 4F4JA 4PO8A 2GEDA 2ZWPA 5EKSA 4F6LA 1U7TA 1YCDA 1B8VA 1F2TA 1XELA 3NDPA 4IR7A 4QEDA 4REQB 4RW0A 1N2ZA 5CFPA 5EZ6B 2O2SA 4WBNB 1COWD 2F3SA 3KT0A 4IH4A 5AH0A 3SFTA 4N0MA 2DZDA 1K06A 1MJHA 3T5DA 2ZAIA 4UM9B 1M9NA 1JG3A 1ZOIA 3ODPA 1MB4A 3U2QA 3B1JA 4RULA 5GZ3A 1ZR2A 1VLMA 4QEKA 2A0XA 4NJMA 5JV5A 1C1DB 1NVBA 1W1UA 4UDNA 3QU7A 3AR3A 4CFSA 3GRPA 4EFDA 1RMQA 2XUFA 2C0QA 2P3LA 3CCBA 5EPUA 1A4XA 4KO4S 2REQB 1XEFA 2ODNA 4M7OA 4F3RA 1KJWA 3JQ9C 3R0XA 1LTHR 5EXPA 2IY8A 1SQFA 3TX6A 1GTZA 2FEMA 2ZR0A 3PXUA 5A03A 2BGIA 4ALMA 1JKFA 4KXFB 1HGXA 3MMPA 1O8CA 2C2ZA 2WUDA 2ZYWX 4MCHA 4KITB 2BTEA 1RZUA 1X38A 2VT2A 4JEHA 3T7JA 3PFGA 2C2WA 3FE2A 4DLVA 1DWPA 5B3JC 3Q0IA 1MB0A 1KAQA 3KLNA 1O95C 4Y9DA 2YOGA 2C77A 3TB6A 3D5EA 2VATA 3GFGA 4DY4A 4EG4A 2HCRA 1MQAA 4JL6A 1IWBB 4M6WA 4G09A 2QQGA 3TX2A 4PAGA 5HR5A 4WY8A 3TG8A 1AUVA 2XXAB 1T1SA 1DKQA 1P9WA 1Q0QA 4G4JA 4O4HB 1DGQA 3U6BA 1UDBA 4LQCA 2LKCA 1ZMTA 1X1AA 2GEBA 3BILA 3ZXIA 3BH7A 4XVRA 4ZQGA 2Z95A 5C7IO 4EENA 5JLAA 4M86A 3TIIA 2OBNA 3KELA 4JA0A 4M0UA 2I2XB 3UMFA 2FWRA 1X7DA 4L4SA 4MVJP 1AKUA 3JD2A 1Q2UA 1RAIA 1L5KA 5FLYA 1BOOA 4CG1A 4HEA1 4HDKA 4KREA 4OFXA 1E9FA 1HUQA 4H4EA 2GLTA 5ALYA 1SD5A 2YR0A 1QQ6A 1I9CA 4C87A 2Q5CA 1WY5A 3PE4A 1VL1A 2VQ6A 1NXXA 2FSVA 4LC0A 1JLHA 3R7BA 1GKYA 1M72A 4GGPA 3V1LA 4W8HA 1C7EA 2WPDD 2Q7XA 3EVAA 5I7FA 5CW1A 2VF4X 1MUUA 1XV5A 3OPQA 4GLJA 3N5KA 2PKQP 2Q7OE 5BURA 4UVIA 1I8TA 1A76A 4CTNA 1KDTA 4RLFA 3C5CA 3CEHA 2OFXA 3GJSA 1H3EA 2BBOA 2BFCA 2VDKB 3ZG6A 2GNAA 4JLDA 1NVTA 4LC9A 5EKDA 3W0LB 4C4RA 4ZCLA 4B2LA 4MJ7A 3RS2A 3ANYB 3O3MB 2VJMA 5CIYA 1KIMA 1T9DA 3NTLA 2ZJZA 3ZHOA 2V58A 1XDZA 4DMRA 3QF7A 3F8TA 4YMLA 4JY7A 3FLBA 2XMPA 3DKRA 4I6EA 2AKYA 2J3MA 3ASUA 5EJMA 4NICA 2VR1A 4NU5A 3CNOA 4Q3NA 1P1IA 2FWIA 2JIRA 1R4NA 3H11B 3R3SA 4HNAA 5JQGB 3DLTA 4PZAA 4F91B 2GCOB 1FP4A 5K0SA 4M87A 4O4JB 3RUAA 5KUTA 4IJWA 1NW9B 1PTKA 2C2OA 5A1JA 2O3RA 3AG5A 3F7OA 3OT4A 1ODJA 4IBOA 4A8HA 4M0KA 4E88A 2AG1A 2FWPA 4GW3A 4NLLA 4J90A 1X42A 4I0WB 3MLEA 5LU9A 1AN9A 2CVOA 2F3RA 3U26A 4QZVA 4RXTA 4MCIA 1W5FA 5AQ1A 1M67A 3IOEA 1KEEA 1WCIB 2WZBA 1DTEA 3FOCA 2PWZA 5G1OA 1W36D 1XRNA 4DV2B 5L7TA 2FUEA 2RB4A 4FYPA 1EVLA 1TGVA 4PAMA 5DNDA 5AP9A 4BBPA 5HPYB 4ZOQI 1W19A 3GLIA 1KMMA 4ND7A 3OTQA 3QK7A 3O0DA 3K0EA 3DS8A 5H4GA 2WY2D 4DCUA 4PPQA 2X0EA 1WSWA 1Z0SA 3AG6A 1FDOA 3N59A 2GM3A 3B20A 3DZFA 3QVMA 2FRDC 1KMCA 3GZJA 4MW6A 5FPHA 4PRLA 1Y9JA 4UCXA 3BH6A 1I6MA 3S5JA 1U2ZA 2RG7A 4H7PA 2KE5A 4W9NA 1QU3A 3JTMA 4NYIQ 4XI9A 3G2MA 3ZC3A 2UZ4A 2DFLA 2IA5A 2QTRA 4I6JA 1YAJA 2A94A 4UW9A 3ZQKA 1PL6A 4XVQA 5C5EA 3NASA 3VO2A 2JI4A 5C31A 3L7MA 1KY2A 2GVNA 1MB2A 1K3FA 4EI2A 1EESA 2SKEA 1WDWB 2FEKA 3DWGA 3VC7A 1U6IA 3MJHA 2GJKA 4FM9A 2NU8B 4R54A 1YMUA 4MV8A 2WD7B 2J31A 3P0FA 1CTQA 3R74A 5F5LA 4RTKA 4DLUA 4L0CA 2W2KB 5FUVA 5JISA 1K9SA 4C9BA 3VVMA 2C03A 4N6OA 4G2TA 4OSEA 1JPNA 2PD4A 3VU8A 2N47A 4P82A 2PR7A 1ZNQO 1CYDA 4PIVA 2CHEA 4OUKX 1KY4A 4NX2A 2AUTA 1V1MA 2OXRA 3D3WB 3TZKA 2WFMA 3QVVA 1Y33E 1PGNA 4DNPA 2AZXA 3C4QA 4KQ1A 3T1VA 3HCFA 4GLLA 3SD7A 3OF3A 3H5IA 3FNRA 1EDEA 4JBHA 3WL5A 1SOMA 3HP4A 4FVTA 4TMYA 1NWHA 2NO6A 1KO4A 1Y6RA 2VOJA 4OHCA 1KZHA 4JXZA 1L5LA 4KFRA 4WKBA 5IEBA 3VKFA 3E2MA 1IBLB 3AEQB 1XEWX 4KBGA 1JHVA 4CKEB 2F90A 3ENWA 4IHQA 3QTLA 5KTRA 1W4AA 5JFTA 1BHJA 5J5VA 1E4OA 4TRNA 3VPDA 4HX9A 3DONA 4URHA 3RIGA 1SVNA 4HCJA 4L7QA 1JPUA 2J3EA 2PLWA 3WR5A 5KNCA 4FSHA 5JOQA 1FVHA 3U40A 3ZIDA 1BE0A 2C4NA 3MWDA 4NAUA 4F5EA 4KQHA 1D7OA 4KN6A 5AXAA 3IV9A 5JXGA 1TQ2A 4M83A 5LR6A 4X93A 5FTLA 3L8GA 3VAZA 2ODAA 5JVDF 2CJXA 4QDKA 3DDHA 2EG9A 1AKWA 1N7GA 2IT1A 3LT4A 1Y6GA 3IV6A 4AXBA 4WWHA 1QGED 1JF8A 2NZYA 5DNWA 5LZ7A 9LDBA 3IQDB 3B5EA 1AUPA 4WFIA 1N33B 1O94D 3TD9A 3D6HA 4MO9A 5KOJA 1NV8A 2D3TA 4RXMA 4DYDA 4XKJA 4WZ6A 3GZ4A 1KL7A 1BC5A 1OREA 2KQUA 5EEGA 2I2CA 3NJ4A 5K3OA 3UGQA 4DY6A 2GNOA 1W2GA 4BNZA 4KJXA 3K6JA 2X2PA 1ZGAA 4JUCA 3STYA 2HGSA 5DX0A 3GPBA 1G55A 4IHJB 3TLKA 3EEFA 4EKIA 1MXHA 1VPEA 5HIJA 4IS2A 1KYVA 3LY8A 4UTPA 3FM9A 1OXKB 1ZI9A 4PS0A 3PHIA 3QI2A 2MSKA 3I37X 3LA8A 4QU9A 1TYDE 2Q27A 5FJJA 3A6JA 2IVFA 3KHTA 2FNAA 3DMDA 4WADA 1AURA 5LU8A 1M5UA 3IMGA 3MD0A 2ZXUA 4O63O 4MEAA 3KKNA 4G4IA 2X2EA 1QBGA 1YS2X 3QF4A 4HPWA 1E7YA 3PE6A 2QYOA 1L6IA 4IUCS 4HFMA 4B17A 4ENWA 1VLVA 3PR3A 2AWNA 3MELA 4Q82A 1D4OA 1Z4QA 2Y8EA 1EQUA 4JT4A 4KK3A 1DTWA 2CEKA 3ZV3A 1U0HC 4BO1A 4F1WA 4JOQA 2VJKA 4YPVA 2ZTUA 3WGHA 3WYFA 4GEGA 4QDXA 3D81A 2Y27A 1SUWA 4CM9A 5A4KA 3CGGA 3FFAA 3CNEA 1AN0A 1JTEA 4XD2A 4YA6A 3OCVA 1DQSA 1JJVA 3PQ2A 1R6XA 4P58A 3MCUA 2G1UA 2VRCA 4MUFA 4E33A 4WT7A 5A5DA 2JJ8A 2A58A 2Z5GA 3NG1A 1ATIA 2O2HA 3TSOA 4B44A 1C3EA 4TKVA 4TV9F 1XNGA 3V2HA 1ZD5A 1OQAA 4ZV4A 1Z7YA 1QRSA 1WIWA 3QQPA 3GBSA 1GUDA 4NS1A 2Y1OA 1LSJA 2O0KA 3H6HA 1G63A 4RHYA 2IP2A 4LBVA 5FBHA 4Q1FA 2IDJA 5K9ZA 1V7QA 1VPWA 8GPBA 2QN6A 3P96A 4GX0A 2PQ0A 1RM4A 4PGGA 4CKBA 1G3IA 1I6WA 3GJ8A 3M83A 4J1TC 1KKUA 3G0CA 3P4YA 4K26A 1Z4OA 2QD2A 4QOJA 2YRFA 3ZU5A 4LHXA 4Q7MB 1SOAA 4IDDA 2ZS9A 4TN5A 5H5JA 3U13A 1LK7A 7REQA 3W8DA 1TQHA 1G8FA 1J0BA 2ERYA 2FWBA 3DLIA 2A9OA 2BFPA 3IPLA 3M2TA 1JYSA 4LDAA 3RQSA 2C4KA 2GCEA 3A1FA 1Q44A 4U7HA 3GDGA 4QICA 3DL7A 3JQ8B 3OJXA 1MNAA 2JAHA 3P52A 4LRSB 4Q00A 4BQQA 1DFIA 1KK1A 1LDMA 3CINA 1JDUA 3HDTA 2EYUA 3ETGA 3IKLA 4WRRA 2RBGA 3WRXA 1DEHA 4BX0A 2FP3A 3RREA 5BXQC 2XECA 1GGVA 3IXMA 3X1JA 1FMLA 3A25A 1KTVA 4UHHA 1Y4AE 2JCVA 2XRFA 3A14A 3HCBA 3ICWA 3L9WA 4IIJF 5LD2C 2GNPA 1QC5A 1SKYE 3RUDA 1FFEA 1AB5A 3PRJA 3HVUA 4A6PA 4GPBA 3KPUA 4FILA 2B4KA 1VDZA 1XLUA 3HVIA 3JAWB 3PXBA 1N34B 1KJ8A 2H4JA 3GRRA 1YB6A 3I2IA 1DU4A 1WBDA 1WBBA 4MUYA 3WLTA 3B6ZA 4UFNA 5T57A 2A78A 1N5RA 1AV7A 4Q39A 1N3YA 5CNIA 2KBFA 2CCJA 2QUKA 3BDVA 4P3PA 1QIEA 4QBHA 4BGEA 3FKSA 3GT0A 4OHVA 5K8LA 3BCUA 2V03A 5JECA 1WNFA 4OA5A 3W5UA 3PR1A 1QGUA 4DV3B 2YICA 2GAOA 1U2DA 3JTEA 2WWXA 1DPFA 5GM2A 4D4GA 1GAJA 3CG4A 2WTNA 4ASUA 4FLEA 2NZUG 3FNEA 3QGMA 3QLTA 4D9FA 1EVYA 3A05A 3U17A 4D6PA 1HWYA 1L7NA 3BJRA 3WNDA 4R1MA 3PQEA 3TOCA 1XK7A 1KNXA 3HXTA 4FUTA 4P4NA 4EPWA 1QV6A 1DWQA 1PLKA 2BTQA 4J91A 1QQBA 1S01A 2WQ7A 3ODGA 3DZCA 1VYVA 1M66A 1X8JA 1YR6A 2VAVA 3CRMA 3ELYA 2DUNA 2GBLC 2QZ9A 3M1IA 5PNTA 2WJPA 2XUPA 4BO2A 3SZGA 5E9QA 2NADA 2ZYGA 3SR3A 2O8EA 5G40A 5J43A 3OQHA 2HBQA 3KAJA 5FXMA 4A6EA 1NDQA 3E4CA 4MWEA 5JJCA 2ZCVA 1WULS 3WL4A 4A1FA 2CMHA 4B3IA 3HBNA 1PEAA 3BBLA 4EJ6A 1L5HA 4DDVA 1QCDA 3QUAA