4G41A

Crystal structure of s-adenosylhomocysteine nucleosidase from streptococcus pyogenes in complex with 5-methylthiotubericidin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
236
structure length
236
Chain Sequence
GAMGSMKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELILVQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQMAGQPLYYDCDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDQIKTAFSNVLAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQILMTFLENLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MTA/SAH nucleosidase
publication title Crystal structure of s-adenosylhomocysteine nucleosidase from streptococcus pyogenes in complex with 5-methylthiotubericidin;
rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase
total genus 72
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 3.2.2.16: Methylthioadenosine nucleosidase.
pdb deposition date 2012-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g41A00
3SCZA 1A9RA 4QFBA 1G2OA 4FFSA 1ODLA 4U2KA 3K8QA 3EEIA 1B8OA 2A0WA 4DAEA 3PNPA 4JP5A 4LNHA 4F3KA 1C3XA 2B94A 3UAZA 1JDTA 1Y6RA 1ODJA 1JPVA 4M3NA 1RCTE 3ODGA 5I3CA 1V2HE 4L6IA 5F76A 5CYGA 1ECPA 2A0XA 2I8AA 5K1ZA 1JE0A 3OZEA 3INYA 1Y1QA 1LVUA 1NW4A 1PK7A 4G41A 4YJKA 1YRYE 2P4SA 5CCDA 1Z39A 3OOHA 4EARA 1PW7A 4DANA 4L5YA 1ODIA 4IP0A 3EUFA 1RXUA 2H8GA 3NBQA 1V41E 1U1GA 4DA8A 4QASA 1I80A 1U1DA 1TCUA 1VHJA 2AC7A 4QATA 3ENZA 4RJ2A 1K9SA 4OY3A 1JDZA 5C80A 2RJ3A 3F8WA 1ODKA 2A8YA 4MCHA 3FWPA 4BMYA 1PK9A 4EB8A 1M73E 3FNQA 1V45E 4GLJA 4DA0A 1LV8A 1A9QA 1U1FA 4D8VA 4BN0A 1TCVA 1SD1A 2QDKA 4F1WA 3BL6A 4TTJA 3KU4A 2Q7OE 1A9TA 4L5CA 4TXLA 1VFNA 1RR6A 4D8YA 1SQ6A 1Z5PA 4MARA 4WKNA 2OC9A 3E0QA 5CCEA 3KHSA 3OZCA 5F78A 3FOWA 1A9SA 3PNSA 2HN9A 3FAZA 1ULAA 3P0FA 5ETJA 4M1EA 1JP7A 4NS1A 3ONVA 4BMXA 3PHBE 4JOSA 2HSWA 4F2WA 1PR6A 3UAYA 1Z36A 4TS3A 1SJ9A 3KVRA 4QAQA 1Y1RA 3BJEA 4PNPA 3IEXA 4TXJA 4TYMA 3IOMA 1Y1SA 3P0EA 1OTXA 5FAKA 1CB0A 4DA7A 3KVVA 1Q1GA 4LNAA 4TXHA 4NSNA 3GGSA 2QTGA 1T8YA 2XRFA 3DF9A 1Z5NA 1SD2A 4TXMA 1PWYE 1TGVA 1A69A 1Z37A 3OCCA 1PKEA 1T8SA 3DDOA 1PR4A 4D9HA 4L5AA 1Y1TA 3KVYA 1JDVA 1VHWA 4WKPA 1XE3A 1ULBA 1YBFA 3FUCA 1K27A 4OJTA 1T8WA 1RYZA 2OXFA 3TL6A 1U1CA 3K8OE 1OUMA 4R31A 1T8RA 4WKOA 1TD1A 1Z35A 1WTAA 4K6OA 5JPCA 1JYSA 3O4VA 1OU4A 3OZBA 1A9PA 4DA6A 3DP9A 1RFGE 4UC0A 1PR1A 4WKCA 5B7NA 3O6VA 4QEZA 4OGLA 4WKBA 1YQUA 2ISCA 5F73A 4E1VA 4F3CA 1OV6A 5CXQA 4YMLA 5IU6A 3U40A 3UAVA 1T0UA 1B8NA 3MMSA 4D98A 5B7QA 1Z33A 4OGKA 4BMZA 4L0MA 4TXNA 1QE5A 3C74A 3DPSA 3NM4A 1YQQA 1VMKA 1ZOSA 1Y6QA 4GKAA 2PGAA 3T94A 1RXSA 4M7WA 5IFKA 4ECEA 5F7OA 4G89A 4I2VA 5B7PA 4PR3A 2HWUA 2AI2A 1JDUA 2HRDA 4R2XA 1N3IA 1PF7E 4DABA 1V48A 4DARA 1RT9A 3OZDA 1OTYA 4P54A 1NC3A 3KUKA 1JDSA 4JWTA 5CXSA 1TGYA 3LA8A 5EFOA 4TS9A 1LX7A 5F77A 3NM5A 4NY1A 1NC1A 1YR3A 1K3FA 2A0YA 3UAXA 3D1VA 4TTIA 3BGSA 1RXYA 3E9ZA 1CG6A 1V3QE 5F7JA 1PR2A 5EPUA 4TTAA 3NM6B 2OC4A 1Z38A 1PBNA 4G8JA 5F7ZA 3EMVA 4LZWA 4LKRA 4KN5A 2AI1A 3LGSA 3UT6A 4GMHA 1A9OA 1U1EA 2BSXA 2GUWA 1OVGA 5CYFA 3E9RA 3OOEA 4YO8A 1PR0A 2AI3A 3BSFA 4MCIA 2QTTA 1FXUA 1PR5A 3LBAA 1RXCA 1ZL2A 4X24A 4OEHA 5DK6A 4R2WA 2QPLA 2OECA 4OF4A 4D8XA 1RSZA 3MB8A 4YNBA 1V4NA 4QARA 3OPVA 3QPBA 3EUEA 2QSUA 5F7XA 3UAWA 1Z34A 5B7GA 4GLFA 4DAOA 3FB1A 5KB3A 1Z5OA 2I4TA 3PHCA 4H1TA 2ON6A 3OF3A 3GB9A 5EUBA 4LDNA 4F2PA 2IQ5A 1JE1A 3DJFA
chains in the Genus database with same CATH superfamily
3SOPA 4Q4HB 8MHTA 1NLZA 3L0CA 5JWHA 3GLFE 3VDXA 1EX6A 3MVEA 3EXEB 3EA0A 4PBTA 1BCSB 3ZR4B 5L6MB 2B1JA 4V0OA 2YIMA 3KYDB 1VJ5A 1SCUB 2O8DA 1Z4QA 2O5RA 1K3UB 1QHYA 3WNZA 1M33A 1N5OX 3G2HA 4MVJE 3QNUA 4E31A 1KMCA 2PH3A 3KSZO 3HPRA 3IVMA 1LDYA 4E5YA 4NV3A 4YLYA 1Y6GA 3PI7A 1FP1D 3H97A 3PWSA 4BFXA 3DEFA 4AYXA 1RACA 4ZZ0A 1Z0AA 4ZO7A 3OT5A 1WBJB 4LY3A 4AROA 4IUCS 4JK3A 4DMKA 1YZLA 1W93A 4F3KA 4M6WA 2GSWA 2PWPA 2X42A 4ZT3A 1BMQA 3QEAZ 3UAZA 2ORVA 1NVMB 4GE3A 5BRNA 5A4AA 2FUCA 5T5QA 1OLSB 1NFRA 1ODJA 4B32A 4INJA 2QTRA 3UGTA 3ZG6A 3FPFA 1YS7A 1B8UA 2ACKA 4M55A 1L5FA 4LF7B 3FUVA 1CUUA 3KE9A 2ZTUA 5K3FB 4IIDA 2GF0A 4O4IB 2C9OA 2YY5A 4EI2A 4TKZA 2C5EA 2O0JA 2Y1GA 3DEKA 3IVRA 4KXUA 4PVDA 1XNRB 1YXMA 2F64A 1XKTA 3F9CA 2J9GA 3O95A 4WZBB 3A6LA 4OH1A 3VO9A 1SVSA 2I3AA 4QFDA 3CINA 1W85B 3GI1A 5EP4A 5AOCA 1OYYA 1Z63A 5K1ZA 2HJ9A 1A95A 4ECAA 2YRWA 4IGFA 3WIEA 4MO9A 1AD2A 3W9BA 5KQMA 4YT5A 4EGCB 1VMDA 3QU2A 2QE7A 2ZBQA 1A7JA 2GPSA 2AD5A 2HZ7A 1SC6A 1FFEA 2C0QA 4PFKA 3QI2A 1CUBA 1AF7A 3VR6A 2CV0A 1U4NA 1W46A 1TK3A 5I9TA 3WAJA 1ODIA 1FBNA 4P38A 5D01A 3HO6A 1T0HB 4CG3A 1VBMA 2DX7A 2EW8A 3IQGX 2FPIA 3L7LA 3NWEA 3EJ6A 4Q3OA 1C3EA 2RHWA 4NFLA 2IHVA 5AXCA 2WUVA 3H19A 4ZYYA 1IG0A 5ED0A 2ZWPA 1U1DA 2BC9A 3KQTA 3L43A 3FYDA 3MILA 4I6JA 1T1EA 5BSUA 3ZQ4A 3QHAA 3H4TA 1OAAA 2V9CA 1TCCA 2ZUVA 1UC8A 3IRUA 3ENZA 2R6DA 1KHTA 4JI1B 3UMRA 2DFLA 2B5VA 2HMYB 2GEDA 2VP0A 1YL7A 4JLAA 1JFSA 2H1HA 3VXKA 2AEMA 2H07A 2WWYA 1X8JA 4PHTA 1ACMA 1Z68A 3A1SA 4D9NA 2ZTSA 4N18A 4RIEA 4JIMA 5AI8A 4B83A 5I4BA 4LZOA 4B2IA 2Z6AA 2A8YA 1OOEA 1CY8A 2WSYB 3ND8A 4PNHA 1VCHA 1UM9A 2O05A 4U02A 3TQOA 3LLVA 4NPCA 4KVZA 1PK9A 4EB0A 3G2NA 3KQNA 2REQA 5D8DA 3BC1A 3FNQA 4GLJA 1BN7A 3FHOA 4LVCA 5IJ9B 3F98A 4HQ6A 1DKRA 1LV8A 3A9RA 2XUAA 2VCHA 4BAUA 2FSSA 2H7CA 3BTVA 4TQAA 5ULLA 3WYCA 4RANA 4BMCA 4YMVA 1CUDA 2GD1O 4BX9A 1NMSA 1CVRA 3HBFA 5LMZA 4OX9Y 3FFBA 3CN7A 4LI0A 3UANA 4IM7A 5A05A 2I03A 3K94A 1Y33E 3P45A 3VUFA 1FC0A 1RHRA 4WJZA 4PN3A 3ROXA 1N2HA 1E1LA 1I2CA 3EDYA 4TTJA 4XCVA 2O8VA 5IAJA 3CSUA 2P5UA 2YZ7A 4L5CA 2XZTA 3CRZA 4GQIA 4BTVA 3WMEA 1QQ5A 3BMCA 1RVDA 4MUBA 4ZOLA 3PVSA 4G1MB 3P2OA 2Q9UA 5JZSA 2CUNA 121PA 2A30A 2B4RO 1V8OA 3CZ9A 3GCDA 4FYHA 3LBNA 1QBGA 3I01M 1EJ0A 1QZZA 3GUHA 2I7XA 3OZCA 2IC5A 1I3MA 4TTSA 3RAJA 5B3LA 2E2WA 2WJIA 1JU9A 2BONA 5B1IA 2E55A 4CM4B 3OLCX 3K0HA 3BE8A 2HN9A 1J9EA 2AC2A 1RE0A 4IIUA 4PEVA 3RUEA 3P0FA 2NG1A 4RGBA 2H4WA 1FDIA 5JD3A 1VTKA 5M04A 1VL8A 1JLLB 2X86A 2FFBA 1CU1A 2R6GA 3SC2B 3PFWO 6REQB 2EF0A 1EHYA 2ZBVA 4P80A 3AUAA 1P0PA 4BWYA 3B1FA 3TCKA 2G4CA 2IZOA 1PWXA 1A4UA 5JCOA 1NXXA 1C3LA 1U2GC 3WS7A 1E2KA 4TROA 3ZWKA 4YTEA 6Q21A 3CVYA 2FSPA 4YX9A 1RVV1 3UW1A 1Z5WA 3I9V1 1EFVA 4CQMB 1AXRA 2R1TA 3ER8A 1T36B 4YRZA 1L5HB 3HY3A 5AM1A 5KYNA 5LQAA 3AEKA 2XYPA 3PUWA 5BYKA 4HS9A 1QC5A 1JEQA 1YC5A 5KDLA 2MSEB 4CJXA 5BWNA 2XVAA 3IRVA 3UPDA 1JQAA 4BQEA 1PEDA 1CUZA 3N3AC 1B00A 3AIMA 3KJNA 4RXMA 3O38A 4HLUC 3S3TA 2FFRA 3SE0A 3UEOA 1PBTA 3VVCA 2C2YA 3VNBA 2VDNB 3HA7A 1KEWA 1QX3A 2VWHA 3ILXA 2RBKA 3JYOA 3UK7A 5BV8A 4G25A 3KVVA 2QRUA 3MOGA 3QUSA 3LO5A 1DRVA 2BT4A 1MOZA 3HYNA 3MCZA 4LNAA 1T1RA 4DSZA 2DBZA 4IS2A 2HRBA 2ASVA 3U3RA 1YB2A 4TWZA 1QKJA 3ZWVA 4CN8A 1A72A 3I6QA 1KVQA 4O2BB 2EG5A 5D87A 3RUAA 1SA0B 3MINB 2WVJA 4DLXA 1WP9A 3TMYA 3U13A 2BGUA 2I4OA 3FVQA 5T3UA 5SY4A 3ZDYB 1RM0A 4UHEA 1DAKA 3HNOA 1N8KA 3BXFA 2YZKA 3CT4A 4P53A 2EZ4A 2F8SA 2MSWA 2X0JA 2W93A 2VJYA 2I2AA 3DB1A 1A69A 1PQPA 2ZFUA 3U3DA 1RMYA 5AT1A 3WKBA 4ER7A 2FZWA 5JBQA 2DGDA 1KJJA 1XRSB 3MBKA 3DVSX 5CGZA 5D6OA 1XTBA 4XJSA 3C3DA 4YB8A 3NIBA 1FW6A 2B69A 3GOHA 3U7QA 4PX9A 4QUDA 2DH5A 1VPLA 4D46A 1QJCA 2C2GA 4NBNA 3D7RA 3Q2OA 1NBMA 1ITZA 1C29B 1PFVA 1WOMA 2E87A 3CLRC 3DGEC 3FI0A 3IVGA 1GPKA 3BSWA 4KZPA 2H5IA 3ZDCA 5TF0A 1QYCA 2YZ2A 1I3NA 5TQ0B 1CUWA 3F6PA 3JYHA 4QSHA 4DB2A 4CLHA 3STWA 1Y8QB 1SVOA 1YA8A 5K8VA 1X1DA 3AZQA 3OD1A 2WU1A 1I3CA 1VPVA 2XMPA 4OJTA 1E0SA 4FGSA 3E81A 5IUKC 2IPLA 1EUDA 1WXDA 2PX0A 2PXCA 4KBGA 2DFDA 1CZRA 1SUBA 1U7DA 1BW9B 2W6QA 4OB7A 4OM8A 2ZRIA 4ZC1A 1CHNA 1ZIDA 3ABIA 1TU4A 3CKKA 1IHOA 1H2RS 4DMHA 4CTKA 221PA 3K30A 3HY4A 2ZRPA 4YRKA 3DEZA 1KYTA 3KYIB 2WIJA 1AHIA 1ZUIA 4HNGA 2W6ZA 1ZXLA 2C1ZA 1U8EA 1U94A 4WCFC 1R7RA 2XHEA 4XZ3A 4WXMA 1BGVA 4E12A 1ZIPA 4R9NA 2CDAA 4AWXA 1A8HA 2D0OB 4Q1FA 3RBAA 4FJ1A 821PA 5KKAA 5IT5A 1HT3A 1F7VA 1XTJA 3H1EA 3H99A 2JFGA 1RBQA 3U19A 3BCSA 1BH2A 4INZA 4PSUA 1KKLA 2OP1A 4KACA 1W35A 4D5GA 1J2UA 3EX7C 3V8VA 3OM1A 1TM5E 3K9GA 1I2AA 4DILA 1U9IA 4HGQA 3LCRA 4N7BA 3WRYA 1NFQA 4DZZA 1B6RA 2Y8EA 4PIVA 1OY1A 4WXYB 3WL8A 1JHMA 2WQ6A 5IDQA 3I73A 2B6NA 1E3WA 2GHIA 2RHMA 3MJTA 4JDPA 2O2IA 2C99A 1R16A 2QTFA 3Q3JB 2ZI5A 3H2ZA 3KFXA 2H4FA 1D4AA 1OLUA 1WDWB 4WTOA 4F6LA 3GLQA 4R51A 1RM4A 1Q16A 1ESMA 3VR0A 5F33A 5KQGA 1Z56C 4YV7A 4MAFA 1RADA 4EKNB 1E63A 2V97A 3R6LA 3KDPA 3T1HB 1Y8RB 3D6AA 2VT7A 4B9EA 2UVDA 3VPXA 1ECGA 1UMCA 1BDIA 2BFCB 5AIBA 1RJDA 2FW0A 3LNCA 4U0KA 4YMUA 2B9VA 4RY8A 4MV7A 1X7HA 3HXQA 1IBRA 4MB6A 4NDNE 2E4WA 4Z49A 3TLJA 5KQLA 1TMYA 2OQRA 3BYZA 1JHYA 3ED1A 5KYYB 3BK1A 2HF2A 7ABPA 4A6XA 1NR7A 2QN2A 3KQKA 2WLTA 3P19A 1LLCA 3P2MA 3E82A 3ZD6A 4ZV4A 2QTHA 2XNDA 1ABBA 1CK4A 1BE1A 3DTVA 4PNZA 2PUEA 2XDWA 2DCMA 3MIZA 2WDZA 2YDYA 1XCGB 2ZUTA 3TOSA 4C08A 5LZ2A 1T15A 2VH1A 4D26A 5CEFA 1Z6AA 5EL0A 4LQ4A 4UTVA 2PGAA 3FCUB 3O4IA 1E3LA 3S70A 5DRYA 4CLRB 2B1QA 4AJOA 1UZAA 4Y7DA 2GJSA 1PZMA 3HYLA 2JD1A 3M9WA 2Y0CA 3HYRA 4OG2A 5ECDA 4B73A 3TECE 2PIDA 1NX9A 3HCFA 1NNSA 2IPOA 3FX2A 5JXWA 2B3TA 2D13A 5FBKA 4UULA 5D3KA 3RABA 3B1ZA 2V7WA 1F5SA 4D0LB 2QR5A 2J07A 3FH0A 4E33A 1VRCA 2VQFB 4MWCA 4UE6A 2XCRB 3FMOB 4Q02A 1X1EA 1OTYA 1JR4A 1J42A 1RKXA 3CBQA 3ZV4A 4KQGA 1MX1A 1YNOA 1F4VA 5SZJA 3CCBA 3PWZA 4Q7EA 3C3WA 1E6WA 4O4LB 1IWBB 1SZPA 3JQCA 5AVYA 1RPNA 1KSGA 4YAUA 2N1MA 5JEDA 3UB3A 4UBMA 4R40A 1I7SB 1JA1A 4ME6A 2ZGVA 4CMEC 1GU1A 3G17A 3S27A 1ONSA 2IBMA 3F8SA 5BN3A 5FTJA 4US2R 4EX7A 1EFVB 3HDJA 1P1CA 1EDOA 4JA0A 2GA8A 3AEKB 3LZDA 1QRRA 3ENQA 1FLDA 1OXBB 2GEKA 3CVWA 4Q1DA 3U26A 2SCUA 2LCIA 1HR0B 5C8YA 3K1AB 4HQLA 1W19A 4ZI5A 3UIEA 5HUHA 3O21A 5KNBD 4TRNA 5DYIA 3DUFB 4AZ3A 1C1DB 4AU1A 2QMZA 1ILEA 1D6SA 3OZTA 1TF5A 5CT4A 4C0XA 4QTYA 2AVDA 3L9WA 4PYJA 2Z5LA 3W3AA 4Z0PA 4HY3A 1QO7A 2P67A 3H9JA 1PEYA 1RXYA 4IIFA 1T35A 3Q0EA 2Z0MA 5EPUA 5KZMB 1JG4A 3CR8A 4BNLA 1ISRA 5EN4A 4KVGA 1GRQA 3VR4D 3FZEA 4KIWA 2Q5LA 3ESCA 1TIBA 3LKBA 3O8DA 5BUZA 5ILOA 3L6BA 4BTLA 2G1KA 2P75A 1L8AA 4DCOA 1FF9A 1S3GA 1Z0ZA 2UYOA 2LBPA 3A05A 4RWEA 4ALKA 1NOJA 1BMFD 1C1YA 4MUYA 5C9ZA 1X19A 1J99A 1E2FA 2EIXA 5T6BA 4EG6A 2CVPA 4I6EA 4KUEA 1EDBA 2FNAA 2R1UA 2CD9A 3OD5A 1JMYA 4KXYA 2VT3A 4OU5A 3PYMA 1N0VC 3DLHA 2AYXA 1I6MA 3LUGA 2E48A 3JARB 1S2MA 1OD6A 2GN4A 3BIJA 3L6UA 1JNXX 1ISGA 4P1ZA 5HDQA 5IBRA 5BVGB 3VQTA 3LK6A 3P9KA 1P91A 2Q1UA 5AUQA 4G97A 2B78A 5EP3A 2FWAA 1YFJA 2EKLA 1YAHA 4EJSC 4G0PA 2OFWA 4AQ7A 2BR3A 5HVNA 5TGTA 2HJGA 2GKGA 1J0BA 5AFSA 1VMIA 2FMTA 4XQGA 4BO8A 1M1XB 1PVVA 1RPZA 2VSNA 4D4GA 4BNIA 1T2UA 1E77A 3R5SA 1IQRA 3H13A 2Q3BA 1CXZA 3PGA1 4C22A 3HVRA 1KA9H 3PGVA 3OTIA 5C7LO 1HM5A 3VZDA 4MS4B 4QUJA 1DCKA 1QZXA 3AONB 3F6YA 3RS3A 1ZK3A 4AJKA 1F4LA 4K6HA 4CLXA 3ETLA 4OOEA 3QY0A 2XQJA 2PZGA 3PXXA 4MUXA 2BGRA 4L6CA 1VI6A 4LNUA 4DRXB 3RYHA 1TU0A 1NSFA 1SBNE 3PCRB 3UAWA 1WZ2A 1SCQA 4O3MA 1GRCA 4JQOA 1DCTA 2BFBB 1U3TA 3X44A 3U3OA 1CR2A 2O8CA 5EGNA 3D7NA 3M33A 4C6HA 5CBPB 3IKLA 4H6PA 2YVKA 5HQ3B 2PGNA 3P9CA 3PRYA 2VHTA 4UE3S 5EE1A 5TV2A 3EB9A 3ICOA 1FNBA 3GROA 4BV8A 3INNA 3ZD7A 1G8PA 2IUSA 1NV8A 2ACEA 3P5SA 3E3OA 1GPMA 4OOFA 3G1WA 2RKOA 3AGPA 1D03A 2Q2WA 4OPMA 4D6PA 2QMQA 3B9BA 3PTZA 1MZPA 1KI2A 3RG2A 5DF1A 4QJ3A 4C7XA 3L7KA 4L8FA 1E66A 3NXSA 4BNDA 1N1GA 4HBGA 1JIUA 1VLLA 5TGDA 2QLBA 4ZC8A 4YRMA 2Q8PA 2PMCA 1PQYA 2C4HA 1J5XA 4PYQA 1NTOA 1P62B 2I7VA 1YCGA 1DAHA 3O2NA 1X1RA 2HSGA 3E3MA 3OJFA 5KQRA 3SD7A 5CITA 1IJFA 4B5LA 2VZLA 3RQIA 4E22A 2C4WA 4E1AA 3TNFA 5IKOA 1EGMB 3QXGA 4BY9E 1TZCA 1P9RA 2QTVB 1K0FA 4G2NA 4UQLA 3MT8A 1YD7A 3PFBA 4N65A 4YALA 2ZZKA 5JHHB 1K98A 1AE1A 1ZIXA 3FMGA 4V24A 3F7TA 4URYR 5CD9A 2VHWA 1SRRA 4BKUA 4URXR 5JNTA 4UUBA 1VDZA 2N1BA 2P90A 4GBMA 2UVPA 4MS3B 3FUWA 4HLNA 4MR9A 4X8OA 5EZYB 5K3OA 4L8WB 4QBHA 3FWYA 4A8TA 1EWKA 1DOZA 4IIBA 1EFRD 2VDOB 3G0DA 5CT9A 4JLPA 3OIWA 2BSQA 2ZSAA 1L8XA 2BKXA 2Z3ZA 2FZKA 1MPTA 2ZEJA 2G7ZA 4GP7A 3RUPA 3U7RA 3VTAA 4W5TA 4F12A 3Q8KA 2EATA 5K6AC 4OLHA 3U9LA 4YJHB 4XSHA 3VKWA 3QVUA 2PKXA 3LCVB 4YV1A 4GGPA 1BE0A 1HT0A 1P39A 1U2GA 1XTIA 2IJGX 1TKBA 2XTJA 4KQIA 4OHRA 5AOVA 3T8YA 5LQDA 1EINA 1CJCA 2FX2A 4BJ5A 5K20A 1L7PA 1VHLA 1EH5A 1JWAB 4Y2UA 5C3MA 4I4IA 2GCNA 3DFKA 4RQUA 3UUGA 1Z39A 4BIIA 5KUTA 3A4LA 5A6SB 1K7CA 4HAWA 4MUGA 5LQCA 1EYZA 5HM8A 5KNCA 1O54A 4FIDA 5EXPA 3Q88A 5EJ5A 1DKOA 4Q16A 3CTMA 1CY4A 1TNDA 2Z43A 1UZLA 5ALWA 2RGXA 3HJHA 5FT9A 4BXOA 4L57A 3OAAA 3K1ZA 4RXTA 2FSIA 3CX3A 4OTZA 3AUSA 2SCUB 3LHIA 2HWWA 4I14A 4B48A 3VVBA 3E7PA 4I66A 5F9FA 5FADA 5FTMA 1K6JA 1UQTA 1SKYE 2G40A 4KFSA 2IOQA 4U2EA 2EARA 2V7BA 2JGFA 3FGZA 3IAHA 1KAOA 4A7PA 1P0QA 2O0LA 3ROGA 3QIVA 1QB8A 3FNGA 5IANA 2NSDA 5BR1A 1C4OA 3ZXSA 4CI9A 1JVNA 1NLYA 1WHTA 2ZT7A 1DP4A 4BJ3A 3CZMA 3EVTA 1CNMA 1VFPA 2FMXA 4UNSA 3ZHXA 1TYDE 1E2HA 2CLHB 6NULA 5A5FA 5JXHA 2CV1A 3IAM6 4IICA 3OE5A 2WSMA 5AJWA 5ILGA 3TQSA 5H3CA 4C7VA 4WLOA 2XDAA 4DDVA 3EC7A 3T0GA 3WYGA 4TKMA 3O75A 3DQQA 2CJWB 2VAPA 4L27A 5JCJD 2R47A 1GQYA 3CEJA 4L95C 1KPIA 1N5LA 3R3ZA 4CLEA 1TVEA 1U2EA 3PXEA 4WK0B 3AEZA 3DEAA 2FQYA 3GY0A 3C1OA 3PKZA 4A36A 1F51E 2R6FA 1ATIA 3T5DA 3GHHA 1GITA 1R0BA 1E94E 3KTAA 1SZCA 1PJCA 3LWDA 4FZJA 4Q05A 2P2CA 3FPEA 1XHFA 3KOWA 3FZGA 5HILA 3QV1A 1WDLA 2HPZA 3SEQA 3TXYA 1ADCA 4OB8A 3UWMA 4BX8A 2HI0A 3C87A 5SY6A 2M6LA 3DYVA 3I9FA 1QE3A 1JFLA 2WE7A 4IKOA 4JB8A 5TJHA 4A2CA 3G9XA 2OFPA 2NYAA 2QVLA 2GK3A 3BFJA 4NE2A 4OM7A 1XKXA 4WKNA 5F1KA 1QHHB 5A7HA 3TJRA 1NXTA 2VZ0A 4L78A 2GA9A 2D4HA 2GBIA 2DHQA 3HDTA 3QVTA 3IE2A 4LPSA 3MCWA 2FMKA 4Q3DA 4UATA 3UGQA 5IDXA 1M1YE 1WUKS 3NTXA 4N03A 4DIMA 1XRPA 3HDQA 3WICA 2Q5EA 1E6LA 2GZ1A 5AOBA 2HT6A 4AJHA 2GVNA 3V4ZA 1XTKA 3AGQA 1FNCA 4HMPA 4Z4CA 1RP1A 2O7RA 4J9UE 4WCFA 2W4QA 1NDUA 1NHGA 1USGA 1IXKA 2QD5A 1IBSA 2LXNA 2QI9F 3Q8WA 4LOAA 4YP1A 3Q6MA 3S0JA 1G8GA 3L41A 3R5TA 1UBHS 1JALA 2VNSA 4E94A 5CDFE 2O2XA 2PXHA 3PD0A 1E89A 2FEWB 4JUAA 4DR4B 5EIXA 3L7DA 3TIXB 3GXBA 1MH1A 1Y80A 4YRCA 2WU8A 3JU3A 1LEHA 1PR6A 2GJKA 3ON5A 4LHZA 3MSXA 4UXHA 1RQRA 5L7YA 4KAFA 4XI9A 3UAYA 2PGIA 4M4SA 3PLAE 2VSYA 3GDWA 2WHQA 4Q3KA 4ZXFA 2ZYDA 3W5BA 3HJUA 1G291 2AF3C 4GQBA 4EPWA 1NPTO 3PC8C 3T99A 4DUGA 5GV8A 1E3IA 1KFEB 5JXJA 4NV1A 3E1GA 3KLOA 5GWXA 2XA2A 1AKVA 3R23A 1RQXA 3R3VA 5B37A 4YREA 3GEEA 3OJXA 4D92A 5K3DA 5K0NA 1R8JA 1PD0A 5ISMA 4Z4GA 3D0QA 2J59A 3QWIA 4ZV9A 3SG0A 1MQ8B 3OZIA 4GT1A 1J2RA 1KYQA 3JQFC 5H9VA 3IV7A 4YPVA 2PZEA 5DISB 3ESAA 3BJIC 4Q4AA 2WHEA 2NO0A 2A5GA 1T8YA 1HMPA 1MC5A 2WJVA 1IH8A 1X7DA 3CO0S 3JWEA 3QP9A 4AJ9A 2BMDA 3MJVA 4K6CA 5K2OA 5B3JC 3OQIB 2Z9DA 4W1PA 3K0KA 3KCQA 2X4DA 2PTGA 1FTWA 6PFKA 3RYFA 2JIZA 5FBVB 3VDQA 1FS4A 2RGAA 1GZDA 1DWPA 5LOVF 4R41A 4YMGA 3QBVA 1P81A 2BFEA 5DN9A 4FTWA 1OH8A 3COJA 1XJ5A 5ENVA 3EY4A 3QKWA 3IOCA 4D82A 4N3CA 3IE0A 3DONA 1H0RA 3ZOZA 3L77A 1JSZA 2EFCB 3PC7A 1BWSA 2PQ0A 3BXXA 3IDFA 4FS8A 1VXRA 3GDOA 1C9EA 3I9JA 5HJEA 1UXJA 3HZRA 3S2FA 3WGOA 1AY0A 4UJ3A 4ENRA 2BOVA 1KJQA 4BFYA 3GGGA 2BTQB 6ADHA 4NKRA 4ENWA 5IF3A 2OHVA 1BDJA 4G84A 3JATB 3M1AA 4U9IS 1P61B 1TYEB 1WIWA 1J0CA 1UFRA 2V7EA 1RYZA 3QLUC 1IC6A 1LFDB 1N6IA 2UUPA 1SG6A 4NZOA 3HP7A 3R09A 1P2UA 5EMNA 4FYPA 5ENZA 3HPQA 5ELLA 4OXIA 2YNMD 1MGPA 3FSEA 3A8TA 1WTAA 1N9ZA 3H8SA 1Y4DE 3ZE8A 3U17A 2X0NA 1IEQA 3BM5A 4Q3BA 5A0FA 5IFLA 3IQFA 5CTAA 1KVTA 3C6MA 1NHWA 1CKEA 4XQCA 1UAAA 3Q1KA 3EPJA 1D2RA 2GN1A 4OJQA 3V97A 4B0PA 3DZ8A 3OE1A 2ZR0A 2CXQA 3LYHA 621PA 1E3TA 1JLKA 1Z7YA 2QTBA 2Z9BA 3FCEA 3THYB 1XUOA 3W0LB 2BCEA 5AW7A 4WKCA 1BA2A 3PD7A 4XIIA 1C7JA 1EE2A 1P2BA 4D4LA 1KEUA 5IAAA 4EITA 2O2EA 3OQNA 4C2UA 3U6BA 2XQFA 3MS2A 3HMKA 1Z17A 1CNFA 2HCJB 2XYQA 3U80A 3D1JA 3I39X 5F73A 2PUFA 4NH0A 5AVKA 2JASA 2BEUA 1HPLA 2P9JA 2ZPAA 3VPSA 1XN4A 3Q8LA 3ROQA 4QX6A 4BP9A 3EYWA 3TM4A 2ORYA 3NZEA 4CLOB 5DGIA 1ZJZA 3DHYA 3IT0A 1N5MA 2CNKA 2GF2A 2ROQA 2P2GA 3OFVA 2QUBA 4TL7A 3VKGA 1IBLB 2KJQA 3MMSA 5HJ2A 3WGNA 3ILYA 1E2DA 4F5EA 2JLZA 2G0NA 4MWEA 3F73A 3GRAA 1E1YA 4DWWA 3FWZA 4L0MA 1L4NA 3ZZMA 2XB2A 5HDBB 4EPTA 1FU7A 1W0KD 2HCBA 2PPLA 3HI6A 4IVQA 5E1MA 1XYGA 5IYZF 1NX6A 5I7RA 1MDBA 1DS6A 1N0UA 2ZJ8A 2G6TA 3LCMA 4WADA 3N8IA 4EZEA 4DM4A 5IZ4A 3OQHA 2J33A 4YONB 3ELYA 4JJGA 3U3KA 1BDMA 4C6SA 5B55A 1JH9A 4WDRA 1GQQA 3VAYA 2P0EA 2II6A 3VMMA 3CGGA 2Z4SA 1AQIA 1LSSA 2WYHA 4J76A 3E4DA 4JP2A 4KTTE 4RDXA 2PKWA 3GLKA 3KWJA 3KZNA 4PZUA 3K8ZA 2L18A 5F7OA 1IY0A 2FQ1A 2YIDA 3KUXA 3Q1LA 4PR3A 4AJIA 4DT1A 4JZYA 4WVFA 5DYNA 2XNKA 5G41A 3ZBPA 3I62A 3CNQS 4I1RA 4GBGA 5I3ZA 4YRNA 3E22B 1ANKA 3ELBA 1XZ8A 2AS0A 4LBWA 3WHIA 4CEHA 1EJ2A 1QRSA 1R37A 2OHGA 4KMOA 1QHSA 3SLRA 4JLJA 2H1OA 2XCUA 5YASA 4ND5A 1JSLA 3MCTA 3WQQA 5A9SA 3UMYA 1GQ2A 3KPVA 3TR5A 3S2YA 4HAUA 1R18A 3C3XA 3L49A 4L28A 4UNNA 4DLLA 5CLLA 2D74A 2OCIA 2H2IA 4RCVA 1STOA 1IUKA 5AVWA 5D3QA 2H59A 3N0RA 4ZOBA 1Z0FA 2FW9A 1GTG1 1E3SA 1CF2O 2QI9C 4FYWA 1GUFA 4DNPA 3NCTA 1BG6A 1GYRA 4PGGA 2PL9A 4IQ0A 3ZHBA 1Y98A 4KNVA 1E5XA 3S2UA 3I4CA 3PD1A 2DXIA 4RX1A 3H1GA 1TQDA 3ONFA 3A9SA 2O23A 3UT5B 1WA5A 4YN3A 2VT6A 2WM3A 2Q8NA 3GAZA 3HB4X 5COBA 2ORIA 5A4JA 3EPHA 2Q1WA 1O57A 1VBNA 4OFXA 2C4KA 3KC2A 4G1BA 2PH7A 1KQOA 1UBKS 2CVZA 2ZJ1A 1KK0A 1N57A 3CF6R 3IAS1 4M0FA 4QELA 4CQMD 5I8ZA 1A9ZA 2WV9A 1DIHA 1XEXB 4AJEA 4RS3A 1FS6A 4FE4A 1UT6A 1NF8A 1QYXA 1Y3BE 2OC4A 1XLWA 1YQWA 3UH1A 3TW0A 4C5BA 4ZK6A 3WLQA 4Y1GA 2JAXA 1GHTA 4PYKA 4I5EA 3TSWA 2G28A 5EHQA 7GPBA 3LP8A 3MAGA 5IN5A 3CLKA 3RYTC 1HFKA 3PQ8A 1AUQA 1MIOB 2RH9B 4WDQA 4PLVA 1E2QA 1TLTA 3UF0A 1ST3A 1G5FA 1VKNA 3IGFA 4FLFA 1H2EA 1JSXA 1TJNA 3QTLA 2WJ6A 2BIFA 3BAZA 5CLQA 1EHIA 1XF9A 2RCYA 4Z86A 3LV8A 1ZIYA 3L7JA 4EA7A 4XYMA 1P17A 3FWKA 2MSDB 1W36B 4Q1BA 2OAQ1 1ZM3A 2ZYVX 4N6GA 2BFNA 1CWUA 2OV1A 4FQ8A 4W1QA 3SGLA 4DR5B 3GR6A 5H4HA 2FQQA 3G7NA 1T34A 4GRAA 4MDFA 1D07A 4CIWA 1E3JA 2OV8A 5C4GB 5DRTA 3T3PB 3HHPA 3U7EB 3TW8B 3WNQA 3R4CA 5DN6D 3RR2A 2V98A 1XZMA 1DQSA 4NONA 1QRAA 3H9UA 2FA9A 4HWPA 2RI6A 3ZJYA 1MJNA 5A0TA 1VPEA 3OTHA 1QUEA 3GNLA 1OYWA 4RZ2A 4UBKA 3RVOA 4P4SB 2P2DA 4R7TA 2E6UX 4DZRA 5EJ6A 5KTKA 2XRZA 2JBHA 1EZ4A 3NC0C 4UW9A 4M1TA 4ZD6A 4C88A 2O2SA 2LGJA 2D0DA 1FXUA 2J48A 3D02A 4II3A 5AK5A 5HW0A 5JNWA 3OJOA 2QN6A 3HBLA 5JRJA 2QY9A 2XGSA 2BJVA 1M2JA 1KJ8A 4FR5A 2IY9A 1QHXA 2JBAB 4MPDA 5A1TA 4GKJB 1DC3A 5GTDA 4PSAA 3QF4A 3GK3A 2ZAGA 5HF9A 4LF6B 3EGVA 4NFHA 3V8RA 1J2JA 3B1VA 2WT8A 3NJ4A 3HJGA 2C0PA 4I9HA 3AM1A 2JGNA 3LIIA 2DWQA 3H1PA 4OLFA 4F9TA 5CFOA 1U2ZA 1W30A 3BWEA 4M89A 1SELA 2HPHA 1MO6A 1F7UA 2H2FA 2E4XA 5IDWA 2I80A 4AY2A 5TB5A 4IINA 3BJRA 5CLHA 1JI0A 4Z5XA 4ER5A 2NMVA 3PHCA 2PN1A 2X1VA 2FSFA 4GKVA 4MKIA 3GLTA 3EIOA 3U7JA 4AJ4A 2OHJA 5BV1A 2MCFA 2HWKA 4ZYUA 3DDWA 3H1BA 3I72A 3IFSA 1LPBB 3A6KA 3NO4A 4HZIA 4Z3DA 4DADA 2ETXA 3BGVA 4NOKA 4ZVSA 3VH2A 4D4JA 2PO5A 2DG2A 5DCWA 5AVTA 3CCCA 5UKDA 4FYMA 1L5YA 2C77A 3HKBB 2X9GA 4JJKA 1Y5LA 2VSFA 3SEZA 1KI6A 2J67A 2ZRLA 3DDSA 5ESWA 2O2GA 4A26A 3U44B 1PJTA 1J9ZA 2OB1A 2CDBA 3IUSA 4CNQA 1CDEA 4EKIA 5JS1A 3I9MA 4FFSA 4Z9YA 5EWJB 4JI5B 4EM6A 3DFIA 3GFFA 4KQMA 4ND6A 3C39A 3RVMA 2BDTA 4DTCA 4MPPA 3SDZA 5BMVF 5M34A 3OIFA 2NP6A 1U28C 2JGAA 4OX9B 3W04A 3SR4A 3BKXA 3M7IA 2W6MA 2RHGB 4GPD1 5GM2A 2RIPA 3VZPA 1RZRD 3UHFA 4TLAA 1AHHA 2QXUA 2G5TA 4BUZA 1P7CA 4ENTA 1O4WA 4IKEA 4EJSB 3G0HA 1FFBA 2EIHA 4MVJM 1KO7A 4RF2A 1H5NA 5D6NA 5BVHA 3NBUA 5CA0F 2OLKA 2ZIVB 3EGDA 1O9BA 4J1SA 2C9YA 2ZOSA 4TSFA 5FV7A 5EEGA 5A5EA 3ESQA 3ICPA 1OFHA 3ROKA 4K0KB 1ZH4A 1QSGA 1OH5A 1BEUB 3CZ4A 2C00A 4LFAB 2GJAA 4Y6GB 1DMSA 1XCPA 2FWRA 4OQFA 4Z7JA 5CYGA 3G85A 3ECCA 3RIXA 1AQJA 1W88B 4N5NA 2FUNB 2V96A 4W1RA 3V48A 5C4IA 4OUDB 2VF2A 4XFDA 3IPYA 1IM5A 4DF3A 2IBTA 1CEQA 4IHJA 5TQ2B 3RUHA 3UYKA 5CJJA 2F3SA 3WMXA 4E5UA 3QVSA 2NP7A 5BSRA 2O8BB 5K2MA 3M4XA 4GS5A 4MPRA 5ITZB 3H5TA 1KFBB 1PO7A 2X2PA 4LIPD 4KXLA 2IF0A 2IOFA 1GPWB 3IBGA 4US1R 1BU5A 1UP4A 3MWEA 4G41A 2WHRA 2ZE6A 3E35A 4IXTA 3TVYA 1QK3A 3DOJA 1PW7A 2RH5A 4R8KA 1SGWA 2X5NA 3O2QB 5JQGB 1NLMA 1RXUA 1JHRA 2Q2OA 2TMDA 2H8GA 3PC8A 1UC5B 3LDFA 3NTUA 4R3NA 5EKDA 1O0CA 3Q5GA 4DN6A 1AH2A 3RD5A 1V41E 5H70A 3ADPA 2X8WA 2R25B 3AUYA 3LCUA 1EEHA 3DVQX 4C5AA 5EKXA 3HRIA 4MW5A 1XTZA 3FF1A 3UT0A 3BGWA 3LPCA 2JIQA 3X3HA 1CERA 3AJ9A 4M37A 9LDBA 4URHA 5I6DA 5I9LA 3FCCA 1J7KA 2BMFA 4DNXA 2NOAA 4DW8A 4JU8A 4Q7MB 2QW0X 1VL1A 2BE9A 1SUIA 2DULA 3H9CA 3JQFA 2WJ4A 4LYJA 4KO2S 4NBWA 1TKCA 3FVTA 5KAMA 3GLGE 4KHPB 1KJNA 4HEJA 2A9VA 3K71B 3KLNA 4L72A 1O7JA 1F9AA 5TMBA 3C14C 2XT0A 3OPYA 3FPHA 3ZHQA 3PQDA 5B3JA 3GQBB 2I6SA 5AK6A 5ALGA 3DKPA 4DPKA 4YPOA 3A6DA 4HJXA 4JITA 5KYVA 3OLQA 1IJBA 4JJZA 2ZB4A 2VZ9A 5BRAA 1H6AA 4IMPA 1UR5A 4NK5A 3TPFA 1Q14A 3GVIA 3TR0A 5C32A 4D8VA 5FL3A 1DIAA 3JRWA 1JZSA 3BXPA 4YRIA 5CLJA 2IIPA 5FEUA 2OO5A 1AXGA 3W5HA 4AF6A 1SU6A 3U4MA 4HADA 3V4OA 4TKVA 1VFNA 5KS2A 16PKA 1JMVA 1XO1A 2DUNA 1P2GA 1NLFA 1YRLA 2RDMA 5KHLB 1QU3A 2BMWA 3NRJA 3VPGA 1ZSVA 4IHKA 2AGVA 3CPHA 3GJ3A 2ESRA 2G4LA 3GT0A 2V54A 3PZRA 3QLUA 1Z7EA 2HBQA 1ZI9A 1BQ3A 1X7ZA 2PUTA 1I3LA 3EDOA 3OCZA 2VJAA 4JT9A 3OX2A 3T7KA 1ZEMA 3WBJA 4C7MA 3LL4A 4BMVA 3KX2A 1A9SA 1F9EA 1SK9A 2BLNA 4R1SA 2HF8A 1JQ5A 1QR6A 1ULAA 3ABSB 3FLEA 1LBQA 3GFGA 4ZJPA 5CDHA 5A0VA 3KKMA 4LI3X 4XD2A 3DHVA 2B61A 2DWCA 4MP6A 4AKGA 5EERA 4EEKA 2ZR9A 2WNSA 4IDDA 1PE0A 2O1WA 1XZBA 4KX3A 4MVCA 1OXSC 3RI3A 4CCAA 4Z2AA 2VNIA 3C8DA 2BGGA 3TTSA 4DBVO 2ZSFA 3K70C 1D0SA 2Q29A 3QEJA 1DI0A 1SVLA 3V4PB 5KYWB 4P33A 4PQRA 2QORA 3SYTA 5DH9A 2AR9A 1MUUA 3D5EA 4PQYA 3PENA 3ZV3A 4DVJA 4NAUA 4Z0TA 3VPFA 1A2KC 4TS3A 1A9XB 1BFUA 1V3VA 2EQ5A 2WWXA 4DIBA 1UM8A 2EBHX 3TIFA 3AF2A 4KGVA 3RTAA 4EJ0A 1ISHA 1G2QA 1GRVA 2I4RA 2WAYA 2MSCB 1PT9A 3EY9A 5AW6A 3ZE2B 3I8XA 1DQPA 2NO5A 3QKIA 3R0QA 1KIMA 2O06A 4R8LA 3EF3A 5CP8A 4D8UA 4K8RB 4MNTA 3UMSA 5KCZA 4JBNA 4M7PA 3RIHA 3GZJA 8GPBA 5DULA 4ATNA 2L0XA 2JDID 3BQNB 5KSPA 3FOEC 1UFOA 3OZUA 2OP0A 1SOAA 3TMKA 1H93A 3K0FB 1USKA 3BT7A 2QTGA 2I4NA 2QM3A 4F45A 4ZHSA 3L0SA 3C24A 4F5YA 1O6CA 5I8WA 4WASA 1N1MA 3U16A 4Y0VA 1OU0A 5B1DA 5A62A 2KQUA 2NZXA 4RK0A 1GCOA 4WXHA 2Q4RA 5EJ2A 1P0FA 2XVMA 3IP5A 1NI4A 4QVKA 1KOLA 3AB8A 3IQDB 3KD3A 3GFVA 2IELA 1ZGGA 3LI2A 2ZTVA 3NNDA 1EFPA 2ZU6A 2EKBA 3NS7A 4R4JA 4RZSA 4DV4B 4NCKA 3ZTWA 4DC1A 4YCBA 1UKYA 1GTMA 2GCPA 1G20B 2Q5QA 3KKPA 3LOUA 2R3SA 4H27A 4TMZA 4Y2YA 1LW6E 1D9ZA 3WZ2A 3IA7A 4D02A 2B2CA 1XJQA 1B0ZA 1PKEA 3ICWA 1ZMBA 1MW9X 4PIPA 1OB5A 1NUQA 2YYAA 1RM5A 1P4AA 3S4YA 3VBCA 3ENWA 4XCQA 3AU9A 3AESA 3UPTA 2I4MA 3NXKA 1VSQA 4WOBA 3M5DA 5TEWA 4JFRA 3PNQA 5EGSA 3B82A 4ISCA 4MW1A 4GXTA 4PCUA 3U4IA 2R751 4UM7A 1U3FA 4CW7A 1T10A 2ZJ5A 5AKIA 2EU8A 3VKUA 2J9ZB 2WZBA 4IV8A 4JLMA 1E9SA 2X22A 3SS9X 2I7DA 1T8WA 4N41A 3S55A 4O0LA 5L40A 1DG3A 5DK4A 3K73O 4CL3A 3AERA 5ALEA 4ZQCB 3SQDA 1DBPA 2NLOA 4B47A 3S81A 1KDTA 1IZ0A 4Y2XA 1PHPA 5D84A 3I2FA 3SMVA 3RRFA 1JJAA 4FQ7A 1XZCA 2VRCA 1SHTX 5FO0A 3LUJA 5ESXA 3WB1A 3CPJB 1OX5A 5SZHB 1GL7A 4KPFC 2W58A 3JD2A 1VL0A 3L0BA 3QE0A 1I30A 4WQMA 3FNIA 2IP2A 1KWGA 1T5IA 1GTL1 3M6IA 2PXAA 3RRBA 5AW1A 2DETA 3K96A 4AN0A 1GPBA 1KJWA 1ZM9A 4UVDA 2YKGA 1VZ2A 3C5WP 2JHAA 1FSZA 3NEAA 4YECA 4DYVA 2PSEA 3K4HA 4ESEA 4EGFA 3FCXA 2IYOA 4LDPA 1F3LA 3CNNA 2VDMB 1X0VA 5KTPA 1QIJA 2FLVA 3OY7A 1M9NA 3M2PA 3NBKA 3O6VA 3WK8A 1WXXA 3V34A 1E2JA 4OGLA 4WK2B 5JIBA 2KX7A 2O3RA 1SR8A 3CLSD 3HLKA 4P4NA 4ALIA 4DKJA 1Q1QA 3IIIA 2ZIFA 1E1CB 4K7JA 1N2CE 4U0JA 3AL2A 2MHCA 3R0JA 1HLPA 4CMGA 4GI1A 1ACJA 3G0BA 1XZEA 4XUDA 1F0PA 5AJXA 3KVOA 3TSYA 1J90A 3IHKA 3QMWA 1TC1A 4ZWNA 1Q12A 2GYYA 3G2LA 3OMWA 4KYVA 3NDIA 2YDXA 1NJGA 3L07A 4EEXA 3G89A 1X7YA 1BSVA 4I1YA 2WVAA 3ITKA 4DLYA 5L8VA 3DLIA 4EVQA 1RJFA 3AV3A 5TVKA 3V32A 5CFLA 3HO1A 5I5GA 5D7NA 1QQ6A 1Y3FE 2FWMX 2GAFA 2V5UA 1WEHA 2DR0A 3I04M 2NWQA 3H5VA 4A9AA 1GP2A 5JQWA 1LB1B 3D4IA 5L7TA 1BE8A 3B48A 2ZSUA 5C7OO 4BEVA 3OM8A 5KSWB 2E4YA 4IDOA 4LGYA 2P9TA 5A4IS 4EF6A 4GOKA 5LOVA 1GSAA 5D2CA 2C59A 1RLOA 3P32A 2HSEA 2Q99A 2QQ0A 2X23A 3M6WA 5CW1A 5KC8A 1M76A 1ZI6A 2QQEA 1AIPA 3IIEA 1R74A 5DHSA 4HDRA 1G2IA 1CS0B 1USWA 2R00C 1NUUA 4MVJH 4LF8B 3ONDA 1DDIA 2OXEA 1AKTA 1Z5UA 2BCGY 3KSUA 1E1QA 2IL1A 3IMEA 3IP9A 4AMYA 5JS7A 3K0SA 3FPSA 3JQ9C 5SV2A 2VJLA 1RT9A 3GJ4A 1U80A 5HIJA 2R6R1 5E6SB 3X43A 1OFIA 4FIZA 1WCV1 3DE1X 4TN5A 4MV3A 4XUEA 2PWAA 2X0IA 4Q48A 3GFBA 4LXIA 1BRTA 5EESA 3REGA 3L5KA 3QENA 4G4SP 1PK8A 1XNQB 3Q3HA 4MINA 5FTNA 4JX8A 3EZFA 3K1JA 2NUBA 1B1AA 1BTOA 2NV6A 1IMJA 4Y1RB 1RDFA 3JYPA 4AY4A 1N5IA 4FGUA 3VU8A 5FPPA 1J23A 3PGMA 4DLWA 3OC6A 1IUNA 1Z12A 4EY6A 1Y5RA 1YR3A 1N0HA 4H3SA 4BNJA 4EPRA 3Q7EA 3OICA 5BYJA 4BVHA 2PIAA 1BJRE 2VPPA 3ZV6A 4BB5A 4EKGA 3C8UA 2FPGA 1DC6A 4YR7A 1Z0JA 4CL2A 5EVCA 3T7RA 2QJWA 1DXHA 3KE8A 3W6PA 3CX7A 4BQPA 1UPCA 5EYPB 4DNFA 5C37A 4LXTA 1AMOA 2W2QA 1B23P 1QHFA 1UBMS 1L5QA 1TUGA 3P4YA 5E9QA 4FD2A 3U39A 3EBOA 3NCHA 4Q37A 5IC6A 1KHHA 2RGDA 3NM6B 3J81A 1E7WA 4TKUB 1FVOA 1T3GA 2AHRA 1HDXA 1AZWA 2QTWB 1Y7IA 3G7UA 4RVNA 2YVLA 3GP8A 3KOXA 1PG0A 1P4RA 1SB9A 1U28A 2ZYHA 3BH7A 4HN4B 4OVKA 2I3GA 1T9GR 5EIOA 4RLHA 4X97A 1SIWA 1TQHA 4QJ4A 4F71A 1M34B 1SIUA 4CKEB 4UFPA 1U63A 1KDOA 2HO4A 3NIGB 4JYZA 4LKRA 3H9QA 3S1LA 4ZZIA 4X92A 1NI4B 1P0MA 1XSEA 1P7VA 4QBGB 1QFYA 1S2DA 1DTWB 1OA1A 4LF4B 2JEZA 3HU3A 3PE6A 3N8KA 2CHEA 1XRLA 4TV9B 1IBCA 1Q7EA 1CCWA 6GPBA 4ZT2A 5IYZA 3OF2A 4DDTA 2BDUA 1A9OA 2HC9A 4RA6A 1XTSA 5GP1A 2B82A 1D2CA 1XVUA 1B6SA 1V1JA 1ZKMA 2HIGA 2JGJA 3QKSB 4LZPA 1PV4A 1CYEA 4CKCA 3QFHA 4JIGA 4LRUA 3WLNA 1WL8A 1T5SA 4M76B 4Z9BA 2CFTA 3PXBA 1NFFA 1OAOA 1V47A 5F1OA 1JU3A 5G1OA 2IHTA 3I01A 1Q11A 1ISIA 1XTPA 5C8XA 3TUJC 4RPGA 1PR0A 2PV0A 1NF3A 4ZN6A 5IJXA 1EQUA 4X1IB 2H92A 1NLUA 3FWHA 1IWOA 1MFPA 4GBJA 4D9IA 3FLMA 1GJRA 1ZVJA 3GN2A 7REQB 3L18A 3GLSA 3LBAA 4OA8A 5HS6A 4MQFB 4YRQA 3CIFA 3EBLA 4H17A 4X24A 1T26A 4AY3A 2QPLA 3JAKA 1F2UA 5I9IA 1YB7A 5JMTA 2JIPA 1FDRA 2ZUCA 1M8FA 2XB8A 2HSJA 1DRJA 1T4CA 3E53A 3QKTA 5REQA 1SB8A 1U81A 1W2HA 3RVSA 3WIUA 4E5NA 1JJ7A 3BJZA 3AI2A 4F5DA 4RVHA 2ECFA 4M8LA 2O14A 4A0GA 3FJYA 3QUBA 4RPJA 4O33A 2ZROA 2PFKA 1PQUA 1FVFA 2W37A 3G7SA 1UBTS 2HQRA 2HLNA 3IVXA 5IZCA 3R0VA 4HQKA 4ZEOA 2H1FA 3RPEA 1VYVA 3ZD8A 2PUHA 5DNCA 3DDUA 3GZNB 4WXRA 5AK4A 4QNNA 1R4MA 4MDEA 5ES4B 3ZY4A 2R7NA 2I4TA 1E5DA 2OGWA 5B4VA 2HGZA 3QVGA 3VDRA 3TQFA 3ROMA 1BH6A 4FZ3A 2OD2A 3KSBC 1KR5A 3BGIA 2AK2A 5DM4A 4MKGA 3QA9A 4C4OA 4NJEA 5FNVB 5GZ3A 2FX5A 1PW5A 3ELUA 4QXMA 4DSAA 2EZ9A 3ETCA 3M5CA 3EQ2A 1SBZA 2YQ4A 5JJKA 1A71A 1RXWA 1XD9A 3IUQA 4JJIA 3FW1A 3UWKA 1HYGA 2GCOB 3HA5A 3SMQA 3LNTA 3X1ZA 2Q6LA 4ZI7B 4WV3A 1O97D 4NCAA 4F91B 3FHJA 1PLKA 3ZD9A 2AV6A 3DQPA 2VPWA 5EMJA 2H8KA 4U7GA 4DQLA 4L9WA 1IY8A 1KRHA 4HNSA 4BBZA 3OQ1A 3R20A 3JWIA 2FZCA 4F86A 4Y9RA 3DXFA 5AR1A 1C3XA 2YWDA 5D1NA 4QYWA 4CF5A 1BJTA 2G9RA 1HFJA 5CK4A 4EBFA 2ZRBA 2IY7A 2YYZA 4EY8A 1R9JA 1ESDA 4ND4A 3DT9A 8ABPA 2HTEA 4MUJA 3WJAA 3VHQA 4Q93A 3BWCA 3SQXA 4KK4A 5HRAA 1ZD3A 4BJ6A 1ZC3A 4O1IA 4XR9A 4C1NA 1ORHA 2RAUA 1YFLA 1D2EA 3UJPA 1JR6A 3ZDZB 4DUPA 5EIAA 2QT9A 4ZVNA 2QJTA 1W1UA 2HMUA 3JALA 2C78A 3KHTA 3QXXA 3KS9A 1UXOA 1TECE 1JG1A 2BLLA 1QO0D 4YRDA 2GBFA 1ECCA 3JSXA 3T0FA 3V4VB 2R6ZA 4D6YA 5LQJA 1WPQA 5F51A 3WFJA 1NW5A 3VYUB 4RK1A 2BHLA 4DSTA 3ABRB 1O8BA 2QAGC 2YWXA 4ZYXA 1JBKA 1EPUA 4OU4A 2ODQA 4YVFA 2CBZA 2OESA 2Q8QA 5HOEA 4EUKA 1W7AA 1Z6XA 1C41A 3EMKA 4D4KA 1E6EA 3ZK9A 4B3XA 1G8JA 1R10A 2ES4A 3DMNA 4RH1A 2Y3IA 1SVMA 2HW8A 4LXGA 4OGGA 2YHIA 3H83A 5CX1A 1LPOA 4OMUA 3NBFA 3OWOA 2HUPA 3OLYA 1K6IA 5KU1A 5ERXA 4ERXA 1ULZA 2FPGB 2CFCA 1NRWA 4YDHB 3ZE7A 5FI5A 1I1OA 1CRPA 2X2FA 1SULA 3G8DA 1Z7BA 1KOGA 1P60A 2J3LA 1YI1A 2GN6A 1A7KA 2D8MA 4MGYR 4PPFA 3JZAA 4RKQA 1DQZA 1NQVA 1M1ZA 1Z6GA 2FHPA 3P9XA 4V3CA 4BQQA 5C80A 5CDSA 2VUUA 2VUTA 1JFTA 2RJ3A 4OHKA 4DSNA 1G98A 3DE7X 1XCLA 1CUEA 4RD6A 5JDIC 5KX5B 1OB2A 4PM4A 4U8GA 3PR3A 2I99A 4FEAA 1N6LA 1QOQB 1Z5ZA 4OMDA 3S99A 2PKYX 2DSTA 1WZUA 2R0QC 3TZLA 3VDNB 3OLVA 5LU8A 1UZMA 2B4AA 3Q6IA 1SQ5A 3E6AA 2PVCA 2WABA 3IS3A 3ZCRA 4EHNA 4OBXA 4PLCA 1SC9A 3KQWA 4XWOA 1ZNQO 2F9FA 3F4LA 4LG1A 3EISA 4M9RA 2WD7B 5JJCA 1VPDA 2W6CX 5IDVA 5BMVA 3ZK7A 5B6JA 5T4HA 5G40A 1FDSA 5J2TA 2J0SA 2F67A 4C3ZA 1ZMRA 2FPKA 4P4TA 1K75A 3LHSA 2GCIA 2IIVA 1YR9A 2PX4A 4Z7NB 5E6RA 4D42A 1DOHA 2C9ZA 4AIIA 2JJQA 5J2UB 1E98A 1KEEB 4R8MA 3I83A 3D1LA 1XNHA 2WF6A 3AVUA 1MABA 1RR6A 1CY6A 1DIRA 1XZHA 1WVMA 4IS3A 3NFRA 2BE7A 5CA0A 2ZBGA 4LPKA 3WFIA 4BMSA 4L9AA 9ABPA 2FG6C 2I78A 5DEOA 3N8DA 4MR8A 2EERA 5JDCC 4TTPA 4H6XA 5TC4A 3RW9A 4BFLA 2ENUA 2JEOA 4NE9A 2YXNA 4PRYA 1HT2E 2CVOA 5A04A 1W36D 3IB6A 1ZJWA 2XMBA 4QGHA 4KE7A 3FOWA 4J2TA 5FO1A 1CR4A 4B6PA 1XMPA 2HSDA 3G2PA 3A26A 2D5AA 3NWJA 1XJWA 3AH8A 4YT8A 3R8CA 5DXAA 2N47A 4EMBA 2Y66A 3UMBA 1A4RA 5T7BA 1P3DA 5IKEA 2VTBB 3IEVA 4HPJB 4LWOA 2WB4A 5G02A 1YCFA 2EL9A 4M1EA 4MR7A 5K0GA 2A1TS 1FBTA 1K7XB 1S3SA 3HV2A 5NLLA 2HIHA 3DW3X 2UZ1A 4MLDA 3F97A 1TM1E 1TZ2A 4P5PA 1U8UA 4JSYA 1A9YA 2XAAA 4N3BA 1RAFA 5C1BA 4Y2JA 1QOZA 3L6DA 4NYIQ 5FHRA 1BHJA 3TQCA 3JD4A 4Q0MA 3HBAA 2WNIA 3YASA 1JT9A 1WXGA 3OJ0A 4QUIA 4BLVA 4IY1A 1A04A 2WWVD 2H1RA 2H7YA 3N59A 4U2BA 5LMNB 1LS6A 5HGJA 4BP8A 2MINB 3BRQA 3CNHA 2SICE 3AYZB 5DNUA 3ZDQA 4Q9KA 1AKRA 4PQFA 2Y1EA 4PNPA 2M6KA 3F9IA 5HF6A 4AJLA 3IOMA 5G3ZA 4I3HA 2IP1A 4A2WA 4WI1A 2QTNA 2NSLA 5K0BA 5U9CA 2UU9B 1S2OA 2JW5A 4N1AA 1B93A 4L73A 3R7WA 3DFUA 1I6WA 1JGTA 2IYZA 2ZAYA 1RWWA 1Q19A 4QYIB 2CHFA 3GGSA 3GF4A 1W49A 4NF2A 2X5XA 2Q5HA 4MI3A 4O08A 3O73A 5C35A 1YH3A 4URWR 1Z6YA 4ZU1X 4QU0A 3IUMA 5ICSA 1U4OA 2ZRJA 1ZHFA 1YRAA 3CA8A 1MAVA 1N6NA 3WSVA 2FE4A 1QG4A 4RKEA 4UARA 2G77B 2IGBA 1GKUB 1D4OA 5CD1A 1EP1B 3O9MA 3NAMA 3RYCB 4W8HA 2QVXX 2C4NA 5HX7A 4DJAA 1EG2A 1Q1NA 3R7DA 1DCMA 3A9TA 4TTRA 5EJAA 1N2SA 2ZE5A 1Y9AA 2GNAA 5FPTA 2OBMA 1T3HA 3HEBA 1K5PA 2A92A 4MVJF 2FQXA 4AJJA 2ZJAA 4NNJA 3L7CA 4J7XA 3I92A 1ZMOA 5BSKA 3TBKA 1NDQA 2B99A 2R00A 3NGMA 3G5AA 4DL9A 3EWIA 1KZ4A 1WABA 1ZUD1 3HJBA 3HY6A 4JC0A 4QT4A 4D9HA 4WBNF 5FL7D 1X7XB 4L5AA 2P2NA 3JYNA 4MJLA 5H80A 4JYAB 3CS3A 4MHTA 3HE3A 3W8DA 2NU6A 1OX4B 3S1AA 1CTQA 3JQ9A 4RJLA 5IJ0B 1TFUA 2DY0A 2H2AA 1NKVA 2H5JA 2NZWA 5IJZA 1NKSA 3KQQA 3PFFA 1ZRMA 2H31A 1AUVA 2VBFA 1KQFA 1LLUA 1O94C 4ZO6A 5CCXA 2A6PA 3DOIA 4WD3A 4OREX 4HDNA 4KGXA 3IUYA 4R9RA 3W8EA 3KPUA 4C7KA 2UYCA 1MO3A 3CEHA 4MW2A 3VU1A 1CZOA 3D9QX 1K06A 5F5XA 5FYQA 1SOUA 2VF8A 2HXYA 1RQNA 3KYCA 3GCGA 1V96A 5JAHA 4KGDA 4C21A 1TD1A 1Z35A 4IJUA 2P5YA 1RPAA 4L2IA 4BAZA 3VNQA 4DMMA 3AUUA 3PDJA 3AHEA 3O1LA 3MXTA 1CUCA 2VXOA 1FRVA 1HTWA 2A5LA 3EGOA 4EI9A 1CPYA 3MD9A 1LCIA 3D4BA 3DMYA 1PFGA 1KDZA 3PDIB 4O63O 5LXTF 1DT5A 3MQ4A 3DP9A 5F9MA 2QBYB 1J56A 3CR7A 1RFGE 2EXXA 1J8FA 1F38A 2I7CA 3BMOA 3CR3C 1LKZA 2GRAA 3PFNA 4IO1A 4D79A 3Q9NA 2GPAA 4YQFA 2P9EA 3ILVA 4QYSA 3UMGA 5E3HA 3LTNC 1JKIA 3KSRA 4C76A 1TQ6A 4DS3A 3PICA 2ZTLA 3KKKA 4GVXA 2GAJA 4TWBA 1G55A 2QX6A 1DBWA 2ZS9A 5DCUA 1R5OA 4K81B 2BI8A 3KNZA 5TPZD 4CTMA 3LFTA 1LJ8A 5AOAA 3WL5A 5A02A 3TZHA 3PXUA 2BGMA 2R8OA 1WR8A 4ITVA 4OHUA 4BB9A 3BRWD 4F4UA 3IVAA 1X14A 1J8VA 4KI7A 4MB2A 3SJUA 2TMKA 1AGRA 1J2EA 5KINB 3MG9A 4LJ6A 3E2IA 3GLHB 3DG9A 1ZLXA 4J4TA 1AQUA 4BO7A 2O2ZA 2J9FB 5L9AA 1C81A 1GLVA 4GX2A 2PMDA 1VJGA 1YI8A 1HKHA 3OMLA 5I8PA 1PL0A 1QK4A 2G07A 3D6VA 1EXNA 2Q3LA 2BISA 3LW7A 3QTBA 3A3PA 1W75A 3RTEA 4KH0A 5KNBH 3MF4A 1C8VB 1OWNA 2IUYA 3VZCA 4F6CA 2IEDA 3N0TA 2NTVA 3G1TA 4FFRA 3HU2A 3IULA 2OZEA 1JVBA 2PR2A 2UUCB 4Y3UA 1ZGAA 1I51A 2EJWA 2JVIA 1ZQ1A 1F3OA 1VMEA 1HETA 4MHOA 3IE1A 4FMPA 1L1FA 1E5LA 2VHYA 1C3JA 4B43A 1AMNA 1UFQA 3K0CC 4FFBB 3VR4H 4BKPA 2Z6QA 1I7LA 1L7QA 4M2LA 3HCBA 2WSLA 2ZPUA 4M46A 4UOQA 2C5SA 3JQ8A 2AI2A 2F8LA 4GPZA 1XEWX 2IXEA 2OHFA 2CBGA 3JZIA 1XVTA 2A78A 2FPSA 3IHWA 4X71A 4LFCB 4AMVA 3RSGA 2VHQA 1YBVA 4PZEA 5MDHA 2FRXA 1ZM7A 1JHOA 5ADUS 3OZDA 1P31A 3QX8A 4FNOA 1Z0UA 3PS9A 4PX3A 5E3IA 1C7RA 2BFDB 3FGNA 4Z4IA 1NC3A 1A5TA 3CQ9A 1N5JA 1F1JA 2FMUA 1PN3A 1ZH2A 1BMDA 1OIXA 2IZ5A 4JWTA 3SZRA 4YCAA 2P27A 1DKPA 1QS0A 3QLTA 4BCCA 2E4UA 1NA5A 4E2YA 3KEFA 2ZIAA 2HCRA 4HEQA 2NUPB 1WKVA 3OHPA 2IOFK 3WK9A 2X1HA 2NZUG 3P9SA 3IT2A 4NY1A 2VP6A 2WIDA 4EQ6B 4POOA 1XXHB 3FHTA 2YH2A 1LSUA 3ORQA 1CRQA 1B1CA 3KALA 3NDPA 4QDKA 2JGIA 4C0KA 4CE6A 4KYIB 5HWSA 3HB1A 4C6TB 1U7WA 1ABEA 4U5QA 3QPVA 1K2WA 2JKZA 3VRHA 4G63A 4C14A 4Q15A 3A06A 4TTIA 2GHRA 1FJXA 1WCWA 2HK7A 2XE6A 3CPEA 4WCDA 2WV7A 1JDJA 2E4VA 3ELDA 3NRCA 4MQLA 2YFKA 5L3SB 3O7MA 2OCYC 2CWWA 1ZBDA 2N46A 4WZZA 2ZWOA 4C7BA 4E4YA 8ADHA 3AVYA 2VZEA 1CY2A 3LUBA 3LQRA 1SBIA 4R84A 4MQEB 1EKXA 4Y1FA 4RC9A 3R7SA 2Z9CA 3UXEA 2B7BA 1Y34E 3TD9A 5LSAA 5CCBA 3QLJA 4N0EA 4UHHA 3V4FA 4LRQA 1RWMA 4DC9A 4UUOA 3CB2A 5K01A 4P2GA 5F7ZA 2PRYA 1GZSA 4LZWA 4N7RA 2QZPA 4FKMA 1NZFA 1E1KA 1II8B 2G3YA 2JARA 2PGLA 3KRTA 2IZ6A 3L4EA 1FMFA 1WY7A 2NNLD 2R7MA 3LLCA 4ZARA 1Q0RA 4X20B 1M74A 1AU9A 2WWWA 4H77A 1WE2A 4PZ9A 3J80A 3B3QA 3ASZA 3REQB 3I0ZA 1QFXA 2F43A 1BRMA 2PRJA 1QAMA 1SHZA 3B3AA 4MO2A 4X63A 5JMPA 1D9XA 1NJ6A 2GYVA 2CLMB 5B1EA 1OF1A 1QHGA 4HWTA 3SYNA 2WINI 4X65B 1Z18A 3H8WA 2ONYA 3MMXA 1C5KA 1MB4A 2J32A 3G5LA 3WBBA 3DBLA 5A5DA 3EZLA 3IQEA 1I9GA 2J85A 1S7GA 3MBIA 2GO1A 3AB3A 4U6QA 1SM4A 2W2NA 3H5RA 1HORA 1U90A 4ZA2A 1HDEA 2BY4A 3LH5A 4ITRC 2D00A 2PT6A 2QAGA 2ZJFA 3OT4A 2B6HA 3HCAA 3MGBA 1ADGA 5AVJA 4YUXA 1IDN1 4HX5A 3WGMA 3WLSA 3UQYS 2BKEA 5M2QA 3U60B 2KB0A 1WMBA 4R01A 4OLAA 3PQ7A 1SN7A 2PJDA 1E20A 4KSCA 4B4KA 5BUQA 2XXBA 4G5FA 5AESA 3WXMA 1LX6A 3OCVA 1POXA 3BD9A 4X41A 1W76A 3ZUGA 3AUTA 3ZWCA 3ZW9A 3K9HA 1E0AA 2QMYA 4D8XA 1DFGA 1HNNA 3COVA 3WYBA 2HF9A 1KF0A 5K3EA 2J3JA 4XGIA 2BCJQ 2ZLBA 5LBIA 4GM4A 6YASA 1ML4A 2J0UB 1NXWA 2ZAIA 4IV0A 1RTKA 1QTRA 4MUAA 4A3SA 4A6DA 1Q83A 4N5HX 5B53A 5JBNA 3TJZA 3G6WA 3C8ZA 3LXRA 3B7GA 3L4KA 5ARCA 1RPJA 2CHQA 5KB3A 5HCIA 3C1UA 5K4HA 3WJ2A 2A0FA 1K6MA 5LP6B 3K15A 1O95C 5IH3A 1NZJA 1M2FA 2DECA 3MJ4A 4PG6A 1TIKA 3H11B 1Q1EA 4E07A 3ETNA 3LPAA 5JDIA 1K68A 4TV8F 5KTYA 1SQGA 3TTXA 4HEA1 5CPFA 3HXOA 2OBYA 2Z2KA 1M2OA 1VJCA 4HLQB 3RS4A 1JE1A 3DJFA 2I8CA 1QYVA 2QU7A 1JG7A 3FFAA 4X54A 4NBVA 3K6SA 3P9YA 1NBIA 2J9YB 3H3XA 4MHSA 1PRYA 5EE3A 3WJ1A 1A9RA 3N70A 4QFBA 4Y30A 3NI2A 2B4YA 3LX4A 4R2KA 4EJFA 1EWTA 3E7DA 4IX9A 2IS6A 1CETA 1ZCAA 2PWZA 2UUAB 2CNDA 1H8HA 4U2KA 4JAVC 4NVRA 4CNBA 4CV0A 1U5BB 3OZXA 2SKEA 3DOOA 1R9MA 3B70A 1E7MA 1UBRS 3BVPA 3KUDA 4QU9A 2WWTA 2HA6A 4EL5A 4QDZA 2VDLB 2ZETA 1P1RA 1WCIA 1CQJB 1Q3KA 4URFA 4A10A 3W5AA 1YJQA 3RBXA 3FPKA 1SXPA 4N48A 1QH9A 3ETHA 2XW6A 2BZ1A 2HIAA 3EA5A 4HAZA 3W5UA 4R0MA 5JDCA 5ERYA 1M6NA 4NE7A 3VPBA 3T5PA 4HJRA 2D2FA 3I52A 4KC0A 3QYFA 4OV6B 3L0PA 3DZCA 4ID9A 4RZHA 4U7WA 3G2KA 4UZSA 2IYRA 1Z13A 1WV0A 2VTDA 5G0TA 3RSSA 2EDAA 1Z25A 4JVOA 4LOIA 3DHWC 3S2GA 2XLBA 3IEKA 4RFVA 2V5AA 2X5KO 3SKXA 5AHKA 4XM1A 5ENDA 1CB7A 2ZIXA 2ZI9A 1G20E 3BBLA 4B31A 3ZWYA 1G42A 4U3JB 1D3AA 3DTYA 1H1LA 1R9GA 1HV8A 1PJAA 2FQWA 1JE0A 3ILSA 5DLDA 3SKVA 3KEQA 4AT1A 1T1JA 3INYA 5J40A 3VHLB 3DOCA 5FOXA 1G0NA 5LBTA 1TK2A 2B3DA 3M6FA 3ZHVA 2G9ZA 4M0EA 2W43A 1C0EA 4ML3A 1BYIA 1EVEA 3KQMA 1IHDA 2PSJA 2E37A 3O47A 3RB8A 4V3BA 3WQHA 1F0KA 1YRWA 3SPXA 3OOHA 4Q9IA 3LU1A 4ZYTA 5EJ7A 5HKOA 1R5NA 1O1YA 1KYIA 2IUFA 2O3UA 4QNMA 2FMFA 1A8IA 4KQKA 3I0MA 4PF1A 5C2JB 2XMQA 3CH5A 1HE4A 5FD8A 1W4RA 3EZYA 1RD4A 1ULSA 2ZI6A 4DG9A 1YA4A 3BRCA 3OECA 1TCUA 4OQLA 1LI5A 3CUVA 2JCBA 4PXYA 4R8SA 3RQSA 1AK2A 3HM2A 4ZI2A 3RLFA 4Z1MA 3EXIA 4KVAA 4C87A 1TW3A 2NVBA 2NVUB 1JNYA 3AEUA 3WLKX 3FTFA 3EF1A 3G9UA 3D8HA 4P3YA 3BTOA 1YZVA 2WYIA 4I9GA 1JHAA 3U1TA 4QTTB 4WHMA 1KORA 2V55B 4FE7A 2JLCA 1N33B 3IX7A 2GNOA 4GQAA 3N2KA 3OPXA 1XKLA 3HBNA 4HZGA 5HIIA 1GPAA 2MOKA 3E4CA 3TEMA 4YAGA 5DIZA 2C3OA 2QRHA 3L06A 3NT4A 4KXNA 4PANA 4F2HA 3AVWA 2J7PD 5F64A 2WJ3A 3FYHA 1L1RA 1SUWA 1U11A 2FFAA 1QIGA 2JJ8A 1F6DA 3GP5A 4AY6A 2VYNA 1NUHA 3HVHA 3PYXA 2FPWA 4FHEA 1QVAA 1A9QA 1MQAA 4LOHA 1GGMA 4A2QA 5BNZA 1NXVA 2P6MA 3DE0X 4TVBA 5F3DA 3L8MA 2EP8A 2DPLA 1GPLA 3LLMA 4FYKA 4PYIA 5DLYA 2BEJA 1Q95A 4BO0A 2CNWA 4LTDA 4ZMSA 4RJKA 3CBGA 5KDDA 1XWFA 2V7QD 3AEQB 4JC4A 2JFFA 4J0FA 4FOPA 1ATZA 4OP1A 1QP7A 1J07A 1NVXQ 1Z07A 2GDZA 1IPEA 3OPNA 1XEFA 2QQFA 3T6KA 1GTVA 1O94A 4D57A 3PQ3A 4PV7A 4UNQA 3ZCPA 2ZRMA 1WVIA 1YMVA 1OC2A 5EZ5A 2ECOA 3QV2A 3EC2A 2EX1A 2WFAA 2XZOA 5KOYA 3TE6A 2VTKA 1FX0B 1PJ2A 2GILA 1RZUA 2O3QA 3VR5A 1J0EA 2FP4A 4WLVA 5WRFA 1U7HA 1YB5A 3FHCB 5LQSA 3G5MA 4H0NA 2UV8A 1WY5A 4UNPA 3TEFA 2AJBA 4EG4A 1RKUA 3ZBQA 4JLWA 1MVNA 5KIAA 3ADDA 5TPWA 1DWOA 3N7TA 5A3JA 4BFVA 4Y2PA 1OBHA 4ZO8A 5ETJA 5HOQA 2JEYA 1I0ZA 1CX9B 2XXAA 3LGAA 3O82A 4I1UA 5ALUA 3B13B 1EDZA 1RLMA 1DNPA 2CT8A 1TRKA 2GETA 2VPIA 1JQJC 4Q3EA 1KH1A 4H7KA 2GQ0A 2H1SA 3EDRA 3L7IA 3RV3A 4FYVA 3SIWA 2FE1A 1J00A 4ASUA 4MS1A 3RADC 2XIQA 2NPFA 2QN9A 4GIBA 3C5VA 2WE8A 4BUJA 5CT5A 2BH9A 4J94A 2CFIA 5IT9A 3PEVA 4XPIB 1Q77A 1DWUA 3F49S 4UE2A 2HRRA 4EOGA 2X15A 2Q3CA 4CDNA 1RQPA 1C1XA 4UKDA 2DT8A 2ZWIA 1IM8A 2CLIB 3P9IA 2XADA 3HN6A 1DC4A 4KPEC 2ORED 4EY5A 2ID9A 3OTWA 4J90A 2HTFA 2ODTX 1NW6A 5EZSA 4YQYA 1RYNA 3F6BX 3RIMA 3IAFA 1KO4A 1TLFA 4JENA 2HCFA 2RC5A 3P26A 4R81A 5B5SA 4MKZA 4ARVA 5AMXA 4NBLA 1W52X 2J30A 3PF8A 4V0QA 5ALNA 4JEHA 1YQGA 5DNEA 4FX2A 3KDAA 3GELA 3W5IA 1FSPA 4D25A 1GZHB 2CCJA 2WAXA 3EOBI 4NX2A 4Q47A 5DWDA 3ZHOA 4RVUA 3FPLA 3RDPA 4U39A 2VR1A 2G88A 5AO9A 5AXBA 3A9CA 3QYJA 3W77A 2QTAA 2IVZA 3I2YX 3NOVA 1L6IA 3V7WA 3B38A 3ZGLA 8AT1A 5KC9A 1Q22A 5GJVC 1JR3D 2X77A 2HU5A 2IYUA 1XHLA 2VCYA 4ZT4A 3K0CA 2GVZC 5BSMA 2LRHA 3UWDA 3CWQA 1S2GA 4HXYA 4LDAA 4RTPA 2LIPA 1MO5A 3KTFA 3C6ZA 1JKJB 4G07A 3KKEA 2RB5A 4JJAA 5E1DA 4ID3A 2Z2XA 2VQ6A 1UT8A 5C8ZA 1M34E 4UHFA 4MRMA 4QOEA 2A9QA 1RABA 4AZSA 1QQBA 3UJ6A 3KR2A 5HP4A 1VHWA 1CQWA 3ADOA 3OP4A 2YJ5A 3SSMA 1Z08A 4G6ZA 1MB9A 4M1YA 1EWVA 3F67A 2GEJA 1Q7GA 3CNLA 3UQZA 2O6LA 3GWZA 3OIVA 3RO7A 2CUTA 1SVKA 4D81A 4DRZA 4ZIRA 3HXMA 5AWFC 4CKWB 1HG1A 2I6QA 5DHUA 3RYIB 2NU8A 3KT3A 1LRJA 2C4VA 2Y0DA 3WOHA 4RZXA 2QUZA 3GGOA 4MROA 5B58C 2CMGA 1CBUA 2E6KA 1JHDA 3RC3A 1T8RA 2RG1A 1NSYA 1JHZA 3MTEA 4BNWA 1C9JA 1TCBA 1MU0A 1NVAA 2AW3A 2VA9A 4IDCA 1T3TA 1EBUA 1ZVQA 2BMAA 4G09A 2R8EA 4YYEA 3R6TA 1IG3A 3DNMA 4HWSA 3FOZA 1N2OA 1TPZA 4DR1B 3O4VA 4U9HS 3LF1A 2XKJE 1KFCB 4ZANA 4PHCA 2IOYA 3LL7A 1QX4A 1RCUA 2CBXA 4XD7A 5DM1A 3ZC3A 2XX3A 4D8WA 2AL7A 3D2LA 4RMNA 5IAEA 5JYEA 1K66A 2ZT5A 1NATA 3PP8A 1I4WA 1KQGA 4I4TB 1PJBA 4DY6A 1QG0A 3JD3A 3X2FA 4PLPA 2G04A 5CURA 4R1NA 3JAMA 4B6JA 3FDXA 4W7SA 5FNZA 3E03A 1V8DA 4ZQEA 5A5GA 5B7NA 7MDHA 3VH1A 2FPPA 1YF3A 1ZN7A 1J25A 1J97A 1EP3B 3RHZA 5FI3A 3I5MA 3MT9A 2K5UA 2WIKA 3ORYA 3PWTA 4XARA 1LD3A 2R8BA 3FDFA 1TT5B 4BATA 4N5DA 3RU3A 4G24A 9MHTA 4GYWA 2W9XA 1CUAA 4OIMA 5CXQA 2Q27A 2H54A 3PGLA 2X19A 4WZAB 4EF5A 4FC7A 1S6YA 3WA7A 1VIDA 3DL4A 2POCA 1AQLA 1CZKA 4BDTA 2C98A 3TZ6A 3GPDG 1UUFA 1ODCA 5IK2A 5ALJA 1WCYA 4HQ0A 1I01A 1R15A 4J2OA 5COAA 3EDCA 4LTNA 4TXNA 3KJQA 2X2EA 3T3HA 4ACBA 3GLFA 1V6SA 3DKKA 3L8ZA 4MWGA 5AKYA 1RW4A 5E7JA 3TJMA 4BVAA 4YJGA 1HE5A 1X8XA 2V9PA 1MNAA 1OMOA 2AN1A 3N2GB 1FTNA 1OH7A 1V8BA 3RC1A 3H1AA 3ZXXA 4E46A 4XB6B 3HCOA 1JR3E 1K8XB 2QG9A 3KU1A 3CW9A 4OSOA 4OQXA 5EWMA 3W5SA 4IXDA 4S24A 5GMOA 3EQ8A 3C4QA 4I3FA 4M60A 4WBNA 1DG9A 2I55A 3GGJA 3K5WA 3ODPA 4EHKA 4CEJA 2UZ0A 2NUAA 4QBFA 5JD5A 4AL4A 4PC2A 3WHLA 2HRDA 1ZVVA 5I7WA 3UPUA 1PQ4A 1DZ3A 2FUG1 4YASA 1JXMA 4A6PA 1PJ3A 5AK3A 4LFBB 1UIRA 2FP4B 1DBIA 3I30X 3NKFA 3O03A 3QOYA 2FX3A 4NOJA 2IDKA 4RF5A 1U2DC 4PG4A 4WEOA 4JP3A 3EEYA 4BGUA 3QVOA 1UBNA 1RWOA 1X9IA 3D6FA 3TF5A 1RKVA 2F9LA 1WUIS 3Q5DA 3UTCA 3MJDA 1RIIA 1B43A 3IQIX 5FPYA 3B1XA 1UPAA 1BCRB 3EHEA 5EFOA 3PVCA 2JJ1A 3UFBA 4PG5A 2QD2A 3VZBA 1MF7A 3BF7A 3FIUA 5EZQA 2H6EA 3UJDA 2W4MA 1Y5MA 1GA6A 3Q10A 2FWIA 2VPYA 4PCLA 1XZFA 5F77A 2X9NA 1PGOA 4RH3A 4ZQHA 3T7JA 3SZMA 3K72B 3JQAB 5LA6B 1O95A 3GA0A 1ZK0A 5DT9A 1VLMA 4WXEA 6CHYA 1DBRA 2Q3MA 4YJ3F 2WMYA 4XGQA 2P4UA 4YYZA 1B3BA 2AF4C 1DAEA 5JTUA 1V11A 2IDMA 5JJBA 5LZ8A 5LXTA 2JLYA 3QE9Y 4GHWA 3AR9A 3DCNA 4KPUB 5J4LA 2LW7A 4MW4A 5KPDA 3RS2A 3HFGA 5IH7A 4WKGA 5ER9A 5CFPA 3T5BA 4M8SA 3KOUA 2CGEA 4W5WA 3RTBA 4NXMB 1KMIY 4QUKA 5EC8A 1GPH1 2IHYA 4PLWA 3DXXA 1TADA 4W9MC 1BWRA 3A6ZA 1QFZA 3BREA 2WLSA 3I45A 1X3LA 4Q82A 3HH8A 5ES3A 1UADA 5KREA 4BKQA 1H6CA 3HKEB 1T5TA 4GPEA 1GUAA 4JOBA 3F6CA 1M7GA 1RC0A 1VCIA 5BWLA 4DEYA 1PUJA 3W78A 1KP2A 1RHUA 3MD0A 4BB0A 1I24A 1G8AA 2E21A 1P77A 3L6CA 2YUIA 4LRWA 4C29A 5ARBA 3USES 2ZKLA 4ZAYA 1XQ1A 1WLSA 3TRKA 1GT91 1E59A 3A4IA 3ENNA 2ENWA 2P35A 4TS1A 5HIAA 3O8NA 4Q19A 2QPTA 1IJKA 2HMTA 3IHLA 3A9UA 5E4TA 5FB3A 1PS0A 3S7ZA 3E9DA 4DMCA 2QW1A 4RW0A 4WN9A 5JBIA 1Y4ZA 1Y4AE 1BFKA 1L5SA 1ZWKA 1DG1G 3PCTA 4FOTA 2BKVA 5EUMA 3W3ZB 1PNRA 2RHJA 4V0LA 2GASA 3KL4A 1RBYA 4E3WA 1G6Q1 4PW0A 1NBEA 1OVGA 2ZG6A 2J5KA 2P79A 2JIMA 3QEOA 3D31A 3MNFA 1AKWA 3KWFA 4UVIA 2XCSB 3QX3A 2ST1A 1SXQA 4OI4A 3QPDA 1UEJA 4Q34A 3IAAA 3E9RA 1P5HA 2AJDA 4KSYA 4B3HA 2FEPA 1JWBB 3BXGA 3SQWA 3LRXA 4E5SA 3P5BA 2EW2A 4BLTA 4EB3A 3AG6A 4JI7B 1ML3A 1VLZA 3NGLA 3WYDA 4JLDA 3T7AA 4B82A 4EG3A 4ZVLA 2OCGA 2XF8A 3INTA 4QGBA 4HXEB 2Z95A 4C0SA 2OUIA 5HK8A 1SU4A 2C7GA 1JSRA 1FP2A 3F4KA 5J9FA 3F4BA 4M22A 4ARZA 3IQZA 4GOJA 3IP6A 4O4HB 4F2GA 3RFTA 3TLGB 5M3BA 1A8PA 5EEHA 2H4JA 2Y99A 3GAAA 1B4DA 2C7VA 3D6MA 3JQ7A 1W0CA 5JNSA 3C98A 3IA2A 3QPBA 3D64A 1OIVA 4RZIA 2AWOA 3IOBA 3W2FA 2YJNA 3N8HA 3JAWA 4FJ2A 1XD2A 3DBHB 3SLKA 4C1BA 2YN2A 3AKYA 1VL5A 3FBTA 5AXDA 2COUA 2PMBA 2B34A 1SBQA 3RCBA 2O59A 3V4RA 1WSWA 3FYCA 3O1HB 2ZYUX 4P83A 5HSGA 2XMSA 3OT1A 3A3YA 3W79A 3GB9A 1I0IA 4DRYA 3GJ0A 1U7ZA 4LDNA 1KDRA 3AR7A 1P9OA 4YAIA 3L9XA 1VJ0A 4PO1A 3U3ZA 3LBHA 1ZZEA 4TL6A 4ZICA 3QKRA 4PPQA 4D9KA 1GV0A 5DGCA 1HL3A 1S96A 3AEXA 5NULA 2CNOA 3DD5A 3FLAA 3P71T 3CU5A 1VI2A 1E2PA 1LU9A 1FYWA 3I23A 4MV5A 5P21A 3AFHA 3BWYA 3DEJA