4G4IA

Crystal structure of glucuronoyl esterase s213a mutant from sporotrichum thermophile determined at 1.9 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
369
structure length
369
Chain Sequence
DTCSVSDNYPTVNSAKLPDPFTTASGEKVTTKDQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRVTVGSKSISFSASIRKPSGAGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSRGQGKFYDLFGRDHSAGSLTAWAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCARNGKGAFITGALVDRIALTIPQESGAGGAACWRISDQQKAAGANIQTAAQIITENPWFSRNFDPHVNSITSVPQDHHLLAALIVPRGLAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPNNMGFSLVGGHNHCQFPSSQNQDLNSYINYFLLGQGSPSGVEHSDVNVNVAEWAPWGAGAPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a novel glucuronoyl esterase from Myceliophthora thermophila gives new insights into its role as a potential biocatalyst.
pubmed doi rcsb
source organism Myceliophthora thermophila
molecule tags Hydrolase
molecule keywords 4-O-methyl-glucuronoyl methylesterase
total genus 132
structure length 369
sequence length 369
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4iA00
4G9GA 4AMZA 1B41A 3EIOA 4FKBA 4I3FA 1THGA 1U8EA 3CXUA 3RKSA 1ZOIA 2C5FA 4ZRDA 4KR0A 4Q05A 1QIDA 1LZKA 1F0NA 1DU4A 2JGMA 1UK8A 4C89A 3F9CA 3I2HA 3WK8A 2HU5A 5DNVA 4KEAA 5HF8A 5AO9A 3WK9A 2XQJA 5E4JA 2WG2A 2YASA 3IUQA 4ZXFA 2GZSA 2FUKA 1JJIA 4PV7A 1EVEA 1W52X 4W1QA 1N8SA 4W63A 3U0VA 3VKFA 1X2BA 1YS2X 5AH0A 3DEAA 4Y2XA 5T4HA 1CUHA 5AICA 2HM7A 1IUNA 5HKBA 4UHEA 4FDMA 1Q83A 3QYJA 4Q3OA 1ZIXA 2RGUA 4WCVA 5EIAA 2C58A 4BAUA 3IDAA 4U2FA 1GQRA 4EB0A 5I9IA 3LLCA 2XUQA 1ODSA 3PFBA 5FPPA 3FNBA 2G4LA 3W9BA 1MNQA 5K3EA 1EI9A 3L1JA 4UBNA 2ACEA 4H7JA 1CUEA 3V1KA 5ALZA 4AXBA 1W4LA 5AOCA 3C5VA 4L72A 5K3FA 2J4FA 4E15A 2DQYA 5BWCA 2R8BA 1LPPA 1PJAA 2XMDA 1EH5A 2JGJA 4BP8A 1BE0A 1MX5A 4KYVA 3C6YA 2HIHA 3FVRA 1MO2A 3PF9A 3WK7A 1SC9A 1XRRA 1YS1X 3QVMA 3V48A 3EF3A 3LCRA 3H1BA 4PQEA 1DT5A 1MJ5A 2FX5A 1IUOA 3I2GA 5FOQA 3AZOA 1QLWA 3IURA 3Q8WA 4Q1VA 3H2JA 4KRYA 1H23A 4LXGA 3STTA 1XZIA 2W6CX 4H7KA 3T52A 3NUZA 1CQZA 3AIMA 4K5QA 3BIWA 2CKMA 3KD2A 3O4HA 2R11A 4XWGA 5CXXA 5CMLA 5IVKA 2CEKA 4Y2QA 5CT4A 2HHAA 1CUSA 4C4ZA 5JD5A 4N5HX 2JBWA 5I8PA 1AX9A 2GBIA 3DCNA 1H22A 1A8QA 1LBTA 1DINA 3C6BA 2QZPA 5A7GA 4X00A 1D07A 2OGZA 3E1GA 1R1DA 1E3QA 2AJ8A 5K3CA 4M0FA 5EIHA 2VJBA 2OGTA 1WOMA 4BCBA 2GBFA 4FFVA 3VISA 4BVJA 5AKHA 2K2QB 5HKAA 3F8SA 1XZBA 3EQ8A 2JGLA 1H2ZA 2WFMA 2VT7A 2ORYA 2WUDA 1AZWA 2O7VA 4C87A 4Y2SA 1ZD3A 3M3DA 1TQHA 4U2EA 1MX1A 4Q3LA 3NGMA 1CUZA 1OCEA 5J3JA 1FFDA 2ACKA 1XKLA 1LBSA 3WKBA 1YASA 3MUOA 3C6XA 4ZV7A 4AO6A 1H2WA 1TCCA 4BP9A 2JGKA 1QOZA 5JAOA 2GYVA 1VOTA 4B7ZA 3BWXA 5ALSA 3QPDA 1R9MA 2VATA 4H18A 3HABA 2O2IA 5JZBA 4J0CA 1JI3A 3A6ZA 4OD0A 3HEAA 4EY7A 3I2KA 2RAUA 4ETWA 4DGQA 2G63A 4HS9A 5JASA 5JZ9A 1SCKA 2ES4A 5DYWA 4G4IA 2XUFA 3H1AA 4W1PA 5ALWA 4LIPD 1LLFA 2XMQA 3FVTA 2G5TA 2WIDA 4MQLA 2H1IA 2JF0A 1E8NA 5AIAA 1XZGA 3FSGA 1ORVA 1GXSA 1UKAA 1HDEA 5E4YA 2AJLI 5AKEA 1P0IA 4X97A 4HXFB 2WHPB 4L3WA 4DYHA 1L7AA 3DL4A 5D3KA 4GHWA 4CG2A 1LGYA 1CRLA 3D2BA 3U1TA 2WUEA 2VT6A 4EY6A 1JT2A 3F67A 4LXIA 3WKDA 3ZWQA 2D5LA 4QDZA 3EQ7A 5DTIA 1K8QA 2DHCA 4MWTA 5LZ9A 3GUUA 3STYA 3DKKA 5AKKA 2ZYIA 2C5GA 5DYTA 4OUKX 3VVLA 4V2IA 2XUKA 4BVLA 5LLSA 2PU5A 1JU4A 3QMVA 4YPVA 3FOBA 4GXNA 4D9JA 5KBYA 1WPRA 1XZCA 4JYMA 4H35A 1IZ7A 4DM7A 5LYYA 4OPMA 5AM2A 1W1IA 1DWQA 3WWOA 5CT6A 2WFLA 3G0CA 3I6MA 3TEJA 1XLWA 1M33A 1FSSA 3H2HA 4QLAA 1P0PA 1R4ZA 5ALGA 4QNNA 4AZ0A 4F0JA 1C7JA 5A62A 1XZLA 2H7YA 5LZ4A 2O7RA 1DWPA 1T4MA 5ALQA 1YAJA 2PUHA 3G9ZA 1ZD2P 5LZ2A 1YCDA 4N8EA 1ZJ4A 1UZAA 4H7HA 5ALPA 3D2CA 3O0DA 5FLKA 5KWIA 1GT6A 4HRYA 4BE9A 2CMFA 3WJ2A 4BE4A 4OSEA 3B3QA 5HK9A 3V1NA 4GECA 3PE6A 1EHYA 2XUAA 4P9NA 4B9EA 5ALLA 5FXMA 2H7XA 4X95A 4QDXA 2JGFA 2Z8ZA 5T4BA 3WKEA 3WYNA 2XMCA 2PVSA 3IVMA 1MT3A 3STWA 2QKYA 1DT3A 2OG1A 4B84A 4X6YA 4BVKA 1EINA 3BXPA 4IH9A 1XLVA 1UFOA 3H17A 2Z5GA 4G9EA 1XROA 4AQDA 2VA9A 2AJBA 4BYMA 1CEXA 2C4HA 1VA5A 5JIBA 3OC0A 2BUAA 3B12A 1AUOA 4B0OA 1TKRA 5HK8A 3I28A 2WLSA 3ED1A 1R50A 1EA5A 2RI6A 3HSSA 5DYYA 4BAZA 3G9XA 4I4CA 4C4XA 4DMKA 1JFRA 3DJYA 4ARBA 4OYYA 1QIKA 3C45A 3FYUA 3WL6A 1CUWA 3R41A 1Z68A 4U2BA 4YX9A 5JANA 2GYWA 1MN6A 4LHEA 2H7CA 2B9VA 2Y2VA 4E11A 1XQYA 1UKCA 2HA0A 3IBTA 4QDOA 3FCYA 4FLEA 5C8XA 2PL5A 3KWJA 3AIOA 2DQZA 4Q3KA 4AMYA 1X2EA 5ALVA 3UMJA 3AZQA 3WWPA 4LXHA 3HZOA 2CB9A 1XRPA 3A2LA 3TRDA 2Z3ZA 4CIBA 1AMNA 1RWQA 4J0DA 4DMHA 1BS9A 3PDCA 1HLGA 5EI5A 2QS9A 2YXPX 5ALKA 4Q82A 4PNZA 1ETHA 5ALNA 5FDFA 3HXKA 2X5XA 3W2TA 5ESRA 5HQ3A 4X3CA 5ALEA 4EUSA 4RPCA 1A8SA 4NMWA 2ZSIA 3AINA 3A70A 4MYSA 2GBCA 5ALUA 3GA7A 2DSNA 4INZA 5AM0A 2I03A 3FYTA 1Y7HA 1HBJA 2HA4A 1MAHA 4Y2VA 2BAGA 2C0PA 5JAPA 1FFCA 1Y7IA 4CG1A 5IVDA 3EBLA 4ZGBA 3FLBA 2BUCA 1ZJ5A 2PBLA 3HACA 4UBIA 4ZWNA 3C87A 4C4YA 1FFEA 2RIPA 4UUQA 2WM2A 4CG3A 3H2IA 1JMYA 5HQ3B 4X92A 2VF2A 4AX4A 1WPXA 3IIIA 2PSEA 3YASA 2AJDA 3MUNA 1P0MA 4K6KA 2WIGA 5ALMA 1VLQA 3WJ1A 4F60A 4G4GA 1UWCA 2HADA 5ALXA 1EK1A 4QZVA 5DTJA 5A2GA 4L0CA 5AI9A 4X91A 3WZLA 2JEYA 1CV2A 4C01A 5AKIA 1DX6A 4B81A 1MPXA 3O95A 1G4HA 1F0PA 2XQKA 3WMRA 1AGYA 2HA5A 1BROA 3FYUC 1E5TA 2DFPA 2PKYX 1G42A 2Y2UA 2FJ0A 3R3VA 1WB5A 3W9UA 4EBBA 5A6VA 1E8MA 2WHQA 2WU3A 3GFFA 5AI6A 4XX1A 2BCEA 3FSGD 4IH1A 1J2EA 5IKXA 4LKOA 1XZKA 2Y6VA 4E14A 3OM8A 4J7AA 2CJPA 4IH4A 3ESCA 1CFJA 4IO0A 1ZI8A 5SYMA 5AHXA 1O6FA 5YASA 4MQMA 1X70A 4BTVA 2OCGA 3WK6A 4B0PA 4GLBA 5FUMA 5AOAA 1JJBA 2QT9A 1F8UA 1W6RA 1DQYA 5CRIA 1A88A 5D6OA 4K6HA 5HF6A 1CUJA 4Y2TA 1VA4A 4G1FA 4J0JA 1XRNA 2VSQA 1XFDA 4Y2YA 5CT8A 1QE3A 3CCBA 5CTAA 3AILA 5AKLA 2XI4A 3S2ZA 2Y6UA 5LKAA 4MJ3A 4AO8A 2UZ0A 1ORWA 3VJMA 5DNWA 4G5XA 1U65A 2PUJA 4FTWA 2J4CA 4HXEB 1BU8A 4IQ4A 1XZHA 5AKYA 2JGEA 1W76A 4Y2PA 1CUDA 3D2AA 1TIBA 3IB3A 2PSJA 1TK3A 4J3JA 3RK4A 3SK0A 4QLOA 2PPLA 1GKLA 2OQIA 5LZ8A 1FFAA 4FBMA 3ZI7A 1WCYA 3ZLTA 4F5ZA 1YB6A 1QFMA 4E46A 2B4KA 4RE5A 4JUIA 4XVCA 5CT9A 2PSHA 3FAKA 1K4YA 3WA7A 4FWBA 1UT6A 4ZI5A 3UUFA 2OPHA 5CT5A 3FLAA 1CPYA 3B5EA 3K2IA 1Q84A 3ZV7A 4B9AA 1RYYA 3M82A 5EHZA 4WFKA 2RHWA 5ALYA 1LPBB 4U2GA 2DHDA 1MNAA 2PU7A 3KSRA 2WUFA 3WK5A 2RHTA 3IUMA 1BEEA 2HA7A 3L1IA 1ZD5A 2WUGA 3N0TA 1YR2A 1QIGA 4HAIA 4JNCA 4AN1A 2VJCA 3JW8A 4QEKA 3ZLUA 2WSLA 4NZZA 2IX9A 3TJMA 1DQZA 4C88A 1ODTC 1UK6A 4G8DA 4BC1A 5AI8A 3BE8A 5C8ZA 3WKAA 1NU6A 2V9ZA 4CI9A 4WJLA 2IIVA 2CBGA 1BN7A 2O2GA 3JWEA 4RNCA 1TAHA 2WIKA 4MYDA 4FBLA 3T4UA 5K5EA 4KJXA 3SWWA 2ZYRA 4UBKA 5K3FB 3C6ZA 3AJAA 4Y2JA 1K6EA 3DOHA 3I2IA 2VEOA 4CCWA 4J0GA 2BKLA 3DL7A 3QPAA 5DJ5A 4M0EA 2BGNA 4K6GA 1ISPA 2CZQA 3MGAA 2Z8XA 4W1RA 4B80A 4XIIA 3VJKA 2QMQA 3ESAA 4U2DA 3BJRA 1SCIA 4HXGA 1R88A 4TPKA 3LIIA 1DWOA 5AKXA 2PX6A 4Y9SA 5EFZA 5JADA 2YYSA 2OQVA 3L1HA 3R40A 1C7IA 3ESBA 3QM1A 5IVHA 1R9NA 2VJAA 1EK2A 4UHFA 1UXOA 3DOIA 3O9MA 4B82A 3WL8A 3WKCA 4U2CA 2QJWA 4DMCA 2WFZA 2DHEA 3STUA 3ANSA 2H9YA 3WQHA 1MX9A 2QXUA 5LIPA 1SOMA 4KE8A 5AP9A 2HDWA 1A8UA 3G0GA 5HF5A 3DYIA 1J1IA 3WZMA 4W9RA 2WQZA 4KACA 2XQGA 5D7BA 1LPMA 4DTCA 4BC0A 4QDTA 3AZPA 4UPDA 4N8DA 2QJRA 2V98A 1CUGA 3I2JA 1F6WA 1TCAA 3I6YA 4AZ3A 2GYUA 3ICVA 3FBWA 4ROTA 2QUBA 3O4JA 2B61A 3WIBA 4H7IA 1QFSA 2XDWA 3E4DA 3NWOA 4NVRA 3R3WA 1BCRA 2GBGA 2V97A 3DQZA 4G8BA 3F98A 3WYDA 4EHBA 1LZLA 3OG9A 2ZYHA 4BCCA 5EIEA 3MVEA 1LPNA 4CCYB 2EDCA 1XRMA 1Q0RA 2ECFA 2OAGA 4BAGA 4Z49A 4PW0A 3QMWA 3RM3A 4BB0A 1QZ3A 5D3ZA 2WU4A 2OXEA 5H3HA 4AN0A 2VQ6A 3W05A 1CUYA 1WB6A 5HZGA 2BJHA 2QUAA 3C8DA 4CIAA 3G9TA 1IUPA 3IUNA 4X7BA 4Q34A 1CUIA 1CUUA 1HL7A 4BRSA 1BEZA 2BGRA 2HA2A 3WWDA 4BRZA 4DNFA 5JYCA 1CUFA 3PUIA 1K63A 2AXEA 4QDUA 4YK7A 5LZ5A 2QTBA 1P0QA 4H7EA 1NX9A 1O6GA 3PICA 1A7UA 1QIIA 4HTAA 2C7BA 5AOBA 1CR6A 3SC2A 5AK3A 2WJ6A 2XT0A 3M83A 1TCBA 3E0XA 3OOSA 2PSDA 1EB8A 4EY5A 4BDTA 3KXPA 5FRDA 4HRXA 4DSAA 5ALHA 1WB4A 5CH8A 4WFJA 1ODCA 3X3HA 1XZFA 4WDRA 3KWFA 3LP5A 3I6ZA 3WLAA 5EGNA 4Y2UA 4OYLA 2HA3A 1I6WA 5AIBA 2XE4A 3NOXA 4BTLA 1EDEA 3BDIA 1LPOA 3HRHA 3D7RA 2I3DA 1Y37A 4PF1A 4PSDA 4UHCA 4KAJA 4H77A 1Q0ZA 3O4GA 3I1YA 4OB6A 4OB8A 3G7NA 4P93A 1JKMA 4CFSA 5EHNA 4PSCA 1ZI6A 1AKNA 4DSZA 2XMGA 4K2AA 5AKJA 3WWCA 3I2FA 1XLUA 1ZD4A 3R3XA 4Y2RA 1XKTA 3A2NA 5CURA 4H0CA 2XMRA 2ZYSA 5JALA 2BFNA 5C81A 4QWMA 1PFQA 1XZJA 2WIJA 3LS2A 2WILA 5AK4A 4XJVA 3GELA 3HI4A 1MAAA 2E3JA 4PO3X 1IMJA 1BRTA 5IH7A 5AK6A 4WY5A 4EZIA 5C7YA 4L9AA 3H18A 4TVKA 1LPAB 2OCKA 3ZPXA 5AM3A 2QR5A 4UFNA 4UBMA 3DNMA 4UHHA 1XQWA 2RONA 1QIJA 2XLBA 1KU6A 3WWEA 2VAVA 2WTMA 3DDUA 4RGYA 3BDVA 2XUJA 4G4JA 2ZVDA 7YASA 2HU7A 5ALIA 4BDSA 2C0QA 4FNGA 1EDBA 2OCLA 4BATA 5ALOA 4X93A 3ZLVA 3PFCA 2WHRA 4P92A 1U2EA 5ALTA 5DWDA 4CCYA 2OGSA 5ALJA 4EY8A 4QE3A 5ISMA 1IVYA 4UBLA 3F96A 4PSUA 5FKJA 3RLIA 5JD4A 5K3DA 2BUBA 5CW2A 4IHAA 2WHPA 4MWSA 1NU8A 1GPKA 4JH0A 5AI0A 4C6HA 4OU5A 2WJ3A 1UK7A 3EQ9A 2I3ZA 2B20A 3SX4A 3GZJA 4A5SA 1TRHA 2ZJ7A 1N5MA 4F21A 2OAEA 1DTEA 3VXKA 2G5PA 4MEBA 1PV1A 5BOVA 1CUBA 2VJDA 5EHQA 3GBSA 3FYUB 5CH5A 3JYHA 2WG0A 2XLCA 5ALRA 5AK5A 1G66A 2WIFA 1GPLA 2XMSA 3CCCA 3Q0TA 4BZWA 3VJLA 1IZ8A 3LIPA 4P08A 4ZREA 4WY8A 1QIFA 2WG1A 4DNPA 4B83A 4BBZA 4WDQA 1C4XA 2YH2A 3QH4A 3ESDA 3G0IA 3FWHA 3I1IA 2WTNA 1HQDA 2QOEA 5CBKA 1CIJA 1THTA 1CUCA 5AM5A 2OLEA 3D0KA 2XUDA 2EEPA 5K3AA 2VAXA 4UFPA 1XZAA 3F97A 4DNOA 1K5PA 2HL6A 1ZI9A 4GWLA 3R3YA 4FFWA 3D3NA 4LYDA 4GEGA 1HKHA 4KE6A 4X6XA 2XQIA 5ALDA 4J0IA 3DYVA 2XQFA 4OU4A 2X76A 2WJ4A 3H2GA 3DLTA 3S8YA 1WHTA 4Y7DA 4H7DA 4FLMA 1B6GA 2PSFA 1BN6A 4BZZA 3G02A 3H0CA 2HFJA 4UHBA 5ALFA 2XB6A 1H2XA 5T4FA 3C43A 2HFKA 5JD6A 3BF7A 4WFIA 3KOOA 5CH3A 3OPMA 1GPNA 2FJPA 3BF8A 1CQWA 2XMZA 2XUIA 5BV7A 4MXDA 4OCZA 3WI7A 4GBGA 1W75A 6YASA 4DNQA 1WHSA 3IULA 3WIOA 4RE6A 4YASA 1E66A 1U4NA 1QIMA 4FHZA 5A71A 4X6UA 2I78A 3WA6A 1CUXA 1FJ2A 3PI6A 1XZMA 5CXUA 3G9UA 1R3DA 5AJHA 4LYEA 4A16A 2XUOA 3TGLA 3D59A 4B85A 3STVA 4DMFA 1L7RA 3G0DA 3PF8A 4AB1A 4TGLA 1DX4A 5JAUA 1VZ2A 1QONA 2HRRA 1CUVA 4UBJA 5AM4A 3M81A 3R3UA 4N8SA 1KU0A 4KAFA 1YB7A 3OURA 4KAAA 2OCIA 4MEAA 1VXOA 4J03A 3QITA 4GI1A 5HCUA 1YAHA 1VE7A 2CUTA 1YA4A 3P2MA 3STXA 1ZIYA 1E8DA 2ROQA 3BJMA 1XZDA 3C5WP 2XMBA 1VKHA 1FFBA 1CLEA 2J3QA 3K6KA 5SYNA 3GROA 1QTIA 3E3AA 1UOPA 1ZGCA 4X94A 4UFOA 2HU8A 3D5EA 3IA2A 3G0BA 2QXTA 1UOQA 1QTRA 1XQVA 2DR0A 3UUEA 2IITA 5KREA 1QO9A 1SFRA 1EB9A 1GZ7A 2EDAA 2O2HA 4J0KA 4N5IX 3VDXA 3G8YA 1EDDA 3FCXA 4QA9A 3PUHA 2QVBA 4X71A 2DCMA 3H19A 1MTZA 2J3DA 5HFNA 4QWWA 1CUAA 1EVQA 2QRUA 3WL5A 1UOOA 5E2IA 5LP1A 4KRXA 3H2KA 3C8HA 2W22A 3DD5A 5JZSA 1HPLA 3V1MA 3C70A 3QBJA 5K3BA 1UKBA 4I19A 1SCQA 3R3ZA 2NW6A 2V96A 4NS4A 1OXMA 5AI5A 1UK9A 2QM0A 3VVMA 1JU3A 1LPSA 3CN7A 1JJFA 3QMMA 4JYPA 2AJCA 4EY4A 1GKKA 1N5RA 5KWJA 4A23A 2JGIA 3BIXA 5F4ZA 5IVIA 4J0HA 2LIPA 3O9VA 4FOLA 1AQLA 4G8CA 4OB7A 5FV4A 1N1MA 3DS8A 3K9BA 3V9AA 1G5FA 1T2NA 3ILSA 2JIDA 3AIKA 1ZGBA 4O08A 2XUGA 1H2YA 1E89A 2Z3WA 1QO7A 2PM8A 5LZ7A 1J07A 1CVLA 3RARA 1AURA 3HLKA 1XQXA 5AI4A 2XUHA 4S0XA 2JEZA 4GDMA 3AUKA 3HC7A 3WL7A 5T4EA 3N2ZB 3W04A 4DLNA 4JEIA 5JATA 1YA8A 5E4TA 1J06A 4W1SA 4UHDA 1OILA 4X85A 5FPQA 4X90A 2ZJ6A 3OTQA 5A7HA 1S8OA 1L7QA 3AFIA 4B6GA 1XRLA 4FMPA 4H7FA 1USWA 1VZ3A 3D4LA 4UBOA 3ICWA 4ARAA 1VXRA 2HA6A 4EA6A 3HYSA 4ITVA 5FP0A 1EXWA 2D0DA 1QIHA 1QJ4A 3HJUA 3WK4A 2Q0XA 2P8SA 2GZRA 5HF9A 1MU0A 1ACJA 1KEZA 5EHXA 3FLEA 1WM1A 3DKRA 3O4IA 5I7UA 4KE7A 4FNMA 5DNUA 5AKGA 1ACLA 1GGVA 3ANTA 1XRQA 4M0MA 3IUJA 1VJ5A 3QPCA 5JARA 1BCSA 1ZICA 4HZGA 3KDAA 4FLFA 2XUPA 4AO7A 5C8VA 2X8BA 3R0VA 3W06A 5A7FA 4GW3A 1LNSA 2HRQA 1GQSA 2ZJFA 5LKRA 3CN9A 1JMKC 2ZSHA 3BL8A 1XZEA 2VTVA 2WFLB 1VE6A 1EX9A 5JAHA 5HFAA 5DLPA 5AM1A 3H04A 1AC5A 1QGED 3V1LA 1RP1A 5AKZA 3A2MA 4HVTA 4ZV9A 2WKWA 3QZUA 2Y1KA 1YSCA 4KE9A 2ONCA 5BWBA 4DIUA 4BCDA 1QIEA
chains in the Genus database with same CATH superfamily
1EFVB 4D9IA 4EY3A 1B41A 1QHYA 1C3EA 4I6EA 4FKBA 2Z2IA 2ZQ5A 4MW5A 3MBOA 4B3MB 5ESWA 3S2GA 4P86A 3CXUA 5LD2C 5E6SA 3RKSA 3QE9Y 2PWBA 5IBCA 1TVKA 3H42B 2HNBA 3H9CA 4UCFA 4D3XA 4KQ2A 2FSGA 3VJRA 1E2BA 1GQQA 1T5OA 1QIDA 5JLJA 2VUHB 3OWXA 3AOEA 5J40A 1BD4A 2BL4A 4Q03A 4GEKA 3A6JA 2J3JA 3WXBA 4HPXB 4JI0B 2R2GA 4LNUB 4ZU3A 1D6JA 2C95A 2AN5A 4LXUA 1W0KA 5EQDA 1RWWA 5ED0A 2HQOA 4QSHA 3BQNB 3I2HA 2GT1A 3ISTA 4XDHA 3MMPA 4D9CA 2NU8A 3ZUPA 4M0CA 4BN5A 3ZGYA 1MENA 1XTBA 5JNWA 3R6LA 2PNJA 1U9YA 3T3NA 4X7PA 2NYRA 1W25A 3PQDA 3FROA 3WV4A 1EFRD 5C4GB 3LBIA 1N3IA 2JFOA 2VJYA 4OH7A 1ZLYA 5EL0A 3COWA 2YASA 5GM2A 3ANXA 1CFZA 4ZXFA 3FI9A 2PL1A 2PS1A 1V4BA 2C2GA 3QYPA 4B4UA 5JHGB 5DK6A 4WA7A 3RAFC 3PT9A 4XWOA 1H9AA 4BLQA 5ANRB 1H6CA 1A0OA 4PV7A 1U3GA 2WWYA 4D0GA 2ZTVA 1OI3A 2K4MA 1N8SA 1UC4B 3OWHA 4D8YA 5ADWA 4BXOB 4W63A 3U4GA 4DQLA 2QRVA 1WP9A 1XZNA 3PFHA 4K26A 3NHAA 4MS4B 5CGQB 3U0VA 3ZV6A 2FXVA 1X2BA 1FC0A 3RB8A 2OYSA 4IDGA 4NIMA 2E21A 2EEZA 1EJ2A 4N12A 5SZJA 3ZE1B 2OT3B 4U5QA 3DEAA 3AESB 4RKEA 3H2ZA 4EB8A 1L7MA 2CDAA 2BTQB 2AOWA 1Y3BE 3BMNA 2HM7A 1IUNA 5B6IA 2XF2A 3V7FA 3L8GA 4ZOLA 3HJTA 1OXXK 2HGZA 2CFCA 5I48A 3QYJA 4KR3A 4B74A 1W0JD 1VKJA 1W1UA 2O0HA 2PRIA 2Q07A 2RGUA 1U9CA 2BRUC 4H59A 5CW1A 1B8NA 4WCVA 1GFSA 1AMUA 2QRMA 2NZUG 3TEMA 4OMDA 5FV7A 5GONF 3ZJ5A 2NZ8A 1ILEA 1JHYA 2IJGX 2PX2A 3OM1A 3M4JA 2PX3A 3NT5A 1T0HB 4RPKA 3TOXA 4EO7A 4NF2A 3JQAD 1T2VA 1EM8B 1U3UA 1DUSA 4ZVSA 2ID8A 3WGOA 3FFXA 1EQUA 2XUQA 3LLCA 4OGGA 5EGSA 2ZYGA 4DLKA 2OHIA 1RPNA 4PGHA 3CR7A 1O5OA 3FNBA 2G4LA 3VNUA 2ZXFA 4IHQA 1I5RA 1SM4A 1SCUB 2E0IA 1XEAA 3BMXA 3L1JA 3NVAA 1J0DA 1DC4A 4KL8S 2OE2A 4XTCS 1BVHA 4I3GA 2Y0PA 3PGA1 1IAQA 4LISA 1CUEA 1P7ZA 2RC5A 1J8QA 4KXNA 5C4MA 2L82A 1GFZA 4QJBA 3UCFA 3ZY4A 2RGWA 3HBNA 3E9RA 4DCPA 3GEIA 4GPD1 5EJGA 3IPYA 5J4KA 3U3RA 4M4SA 1QLHA 4JLNA 3C5VA 1JH9A 3LUPA 4K9LA 5K3FA 4E15A 1QS0B 3LQ2A 4G4SO 4IVPA 2I7TA 2IYNA 4PHHA 2G08A 4QJ5A 6REQB 2WD8A 1JXMA 2IODA 4R40A 1ZSYA 1PJAA 2NO7A 3LPMA 3UXEA 3GBPA 2PQ2A 4A0QA 1R4MA 1BJRE 3S8EA 5KU1A 3N28A 4RD1A 5KAMA 2AGVA 1I4TD 2W00A 3MIIA 4U6QA 3EXHC 1U2DA 4NBWA 1UQUA 2HQRA 3F6BX 1OX6A 1RWXA 2O1XA 1KZGB 1EK6A 1E77A 2R5NA 5BNFA 1KFEB 5TT0A 4C7VA 2WHXA 2CXRA 1NE2A 2L69A 3QLUC 3HXOA 3X2EA 1DJMA 3A1VA 3JARB 221PA 3UJ9A 3SYRA 4GI5A 3T9AA 3TM5A 2Y68A 3ST7A 1Y7PA 5BURA 3PNYA 3PF9A 8MHTA 4ECAA 1SQ0A 3EDMA 4DJ5X 1TF5A 2AOTA 2ZVPX 3KWLA 5EQTA 1WXEA 4ED9A 3NX4A 3FHOA 5LWQA 1S2NA 1WU8A 5GJWC 1LH0A 5LLDA 5AXCA 2FA9A 4RQTA 2QUKA 5MFPA 1BXGB 1V5GA 2GZ2A 3O94A 1L9XA 1G2IA 1MJ5A 1I1OA 2X8WA 4LV5B 3PQCA 4WH0A 2VLIA 1CJBA 3I2GA 4ISBA 4ZEWA 2W2XA 3F4BA 5CA1A 4D45A 5HIIA 3W34A 4DF3A 4IZ6A 4YRRA 2RHHA 2DH5A 4WOBA 5EXPA 4FKZA 3J81A 1Y5RA 3IUBA 5A4MS 1A8PA 2C4KA 1CRZA 5JYDA 1NL3A 3RU2A 1DAHA 1JAXA 1KMNA 3H2JA 3MT8A 3NTQA 1B73A 4L2IA 4WN9A 4ZN6A 1J20A 1WCIA 1THZA 4W5RA 2EFEB 4OQ4A 1EMDA 5L6MB 4M2LA 4ESEA 3E3OA 4TUYF 5JY6A 2AE1A 3STTA 1XZIA 1JB1A 2AQHA 4YT4A 2JVJA 5INTA 5JAMA 1FP2A 2C4TA 1CQZA 3AIMA 4K5QA 4LDAA 4HNSA 4IDHA 2JGDB 1PZGA 4ESOA 3VRHA 5B2ZA 3TXXA 1RYFA 1KS2A 3PL1A 3IOCA 1T1EA 1VL1A 3EXG2 4HZIA 4MICA 4HN2A 1TJ4A 1IBLB 5F5NA 2NTEA 3QEMB 1MJFA 4Y0AA 1SQ6A 1EZZA 1QORA 1Y9JA 2ICAA 2R11A 4GR4A 1P31A 4QL3A 4NV3A 5EIWA 4CM7A 3EK2A 2FXIA 1BYIA 1QH0A 5IVKA 1KMHA 2JEOA 4F93B 1L5MA 1VRCA 3ZGZA 1JNXX 4Y2QA 3SLRA 1AHPA 1K6IA 3KOZA 4NU5A 2A30A 4CGYA 5CT4A 4REQA 3R7DA 2ZZKA 2HHAA 4KP7A 3UJDA 3ZH2A 1MB4A 1GSOA 4G5FA 1RSZA 3QU7A 1OC2A 2CHGA 1WO8A 5CAEA 2HDNB 3UO8B 1CY8A 4ZI3A 3R7WB 3L4KA 2VK4A 3ICPA 3C7TA 4KUHA 3RVJA 3ZDXB 4RZSA 2WQ7A 2FPLA 3ZDAA 2RD2A 1O6BA 3PEFA 4RF5A 1A8QA 4PHCA 3VPCA 2R7MA 3QXGA 4F12A 4O02B 4HC4A 4CGZA 5A7GA 4WGFA 4X00A 1KY5A 1NT2A 5AVKA 1M8JA 1D07A 1WKBA 3MT9A 3W8EA 1YRLA 2J59A 3RSHA 5IANA 4HGRA 1QVVA 3K8OE 3B82A 1K7EB 2BM8A 3CNNA 2IXEA 3E9EA 3QKRA 4XJSA 1SU6A 4MR7B 1FYXA 4N0PA 2C2MA 5DP1A 1AKUA 1PL7A 5KTKA 5LQMA 2EWWA 2HNKA 4LOIA 3WX0A 3L8DA 1Y9AA 4FGKA 2VJBA 3LUKA 3HL0A 2C7GA 1XTVA 2EW2A 1WABA 3N8DA 4WGGA 4HQKA 1R64A 2RHLA 5EP2A 3AVQA 4CR6A 1NUSA 1U7HA 1ORTA 4HDQB 3T4XA 4CLEA 5HKAA 5TS2A 3TS1A 2X9QA 1V35A 3U7IA 2KYRA 4PYNA 4FIDA 4E09A 5FBLB 3TUJC 2JGLA 3GG9A 2IL1A 4GMKA 2G6TA 2PNFA 3K72B 1NVTA 2VT7A 4LVUA 2WUDA 4LZOA 4RSMA 4KK4A 1J2YA 3ENVA 4TWIA 4Y2SA 1O95C 1IY2A 2OV2A 2O3RA 4TV8F 4BNJA 5ICCA 1MIOB 1T1IA 4FQ5A 4JEMA 1YL6A 2BKEA 2YWDA 4OKNA 3NGMA 4NDZA 1JV2B 3PUVA 5COBA 3WGKA 3EZ2A 4DR3B 2AD1A 4EW6A 3M9WA 3CEAA 1QUFA 3P9SA 4JEUA 4PG6A 4UE6A 1K2WA 3H86A 5B1HA 3E18A 3CGWA 4ARUA 1Z4MA 4DCNA 2IX3A 3NHFA 4EHFA 4YACA 2I34A 3Q8XB 4OXXA 2EW8A 6AT1A 2ZB4A 3DO8A 1Z4IA 4EELA 1W5AA 3BD9A 1KQGA 1KIMA 3C3WA 2H2DA 2JC3A 1YASA 5CA0A 1FQKA 1RQ2A 3OZRA 3MUOA 4R1NA 3A4VA 4ZV7A 3SF8B 3SLKA 4AO6A 4WXEA 3WNCA 2DLCX 1G7RA 1Y34E 1ZOLA 5DGXA 3FKQA 1GR0A 4P84A 3KKEA 4LHXA 3P9NA 1B43A 4MVWA 3QJ5A 1ADBA 1FXWF 4B4KA 2SECE 5ADVA 2QTHA 3T9BA 4B7ZA 3PTAA 4Y9UA 2VP5A 5ALSA 2JCBA 2I33A 4H18A 4HAWA 5JFOA 2H92A 1IY1A 1LX7A 1TA0A 1Z5NA 1YRQA 4HAVA 2O2XA 1Z82A 1MR3F 2WV9A 3CG4A 2IYLD 1N2EA 3E6AA 3VH1A 4R0MA 2C7QA 2AQIA 4PYKA 2VHXA 4EY7A 4IIDA 2O8FA 2VN8A 3FFBA 3PNVA 1DDOA 2RAUA 5ESXA 1DB3A 4ETWA 1IXKA 1MXFA 2G63A 1JEDA 4PN7A 4JLVA 1QQ6A 1R0WA 2RKBA 3MTGA 5IAAA 2AF3C 1UQRA 2ZJ1A 3AP1A 4G4IA 1JRLA 5DYWA 2FZLA 2XUFA 4A8TA 3LY9A 5KVAA 4QEZA 1Q0PA 3UWOA 1JA1A 5HKKA 4YAIA 2ON6A 3O3CA 4JZYA 3THXB 3FZQA 2VDRB 3D5QA 5EJ8A 2G5TA 3FKSD 3S5JA 2NACA 2QZ4A 4J1QA 2OBBA 1OVGA 3EXHB 1C8KA 1XXHB 3GEBA 3CVOA 4IIYA 4URUR 6REQA 1RAAA 1K92A 4D4LA 1PQPA 1OGJA 1K7SN 4M88A 2WIAA 1ZH0A 4I5IA 4C7MA 3W1WA 1Z28A 1GXSA 1UKAA 1C3OA 4ISCA 4FI3C 3TXYA 2PQ0A 3FD8A 3HADA 1Z2NX 1Z07A 4D8XA 4C2TA 4R98A 2J6BA 1NMXA 5LU9A 4TS4A 5M5BA 4EW2A 2QN7A 5KC9A 4GHWA 4LRXA 4R9NA 2B2XA 4WK6A 4CG2A 1R6XA 1JIXA 1N2CE 1RVDA 1URPA 4J6FA 4K6MA 2GDZA 1SHJA 1XKXA 4L15A 1JDUA 1CRLA 1M2EA 1NXVA 3FLMA 4AY3A 2O5CA 5ELLA 2ZDGA 2II6A 2QQGA 5J2UA 1NN3A 2A0UA 3KV3O 3U1TA 3COPA 1H2HA 2VT6A 1UINA 2GRJA 3C3YA 3WG9A 1FDIA 2WF9A 4N48A 3NWBA 3A0UA 1S1CA 4IR7A 1YBHA 3B6ZA 4Z0NA 4CQJA 1SPBS 2IVZA 3IP5A 1T26A 3C3BA 3IPLA 1P2TA 4RBNA 5G2OA 2FUNB 4C0KA 1A7KA 4UUPA 3UJBA 3T0FA 1Z6QA 2RCYA 4GMXA 1XI2A 2PFSA 3EQ7A 1HDZA 1HTWA 3TZKA 4JR0A 4IJKA 4CMIA 5CNMA 2E4WA 1U0GA 3P4XA 2CFSA 3PDWA 3OH8A 2ZIXA 2WIBA 3IL2A 4BQFA 3STYA 3DKKA 3H8SA 3ENKA 2ZYIA 3KJHA 4Z7OB 2H29A 1U8XX 3D8SA 1YQGA 3UOGA 1HE2A 2A92A 2X0KA 5KYYA 1Z62A 3HJCA 3N75A 1Y89A 1Z7GA 3OPQA 4OXYA 4NZMA 3LC7O 2FQWA 3AFGA 4L02A 2HMSA 3P7MA 1N5IA 1V7CA 1U1FA 4GXNA 4D9JA 1EM8A 4GQAA 1C0KA 1OWLA 2XCTB 2HJSA 2P0YA 3AU9A 1CT9A 3E7XA 4DZRA 2CLDX 1SBYA 4HUQB 1IZ7A 1VB5A 3OFSA 1E4OA 5JJKA 2D0OB 5LYYA 3QOYA 4UVDA 3TJZA 4D9FA 4DIEA 3LDHA 1JHQA 1COZA 2IZ7A 5JWHA 2H1FA 1KGSA 2JFQA 5DGCA 3RT7A 3PFNA 1DWQA 2B0JA 2IXGA 3TVTA 3PNPA 3OF2A 1M2OB 4OBBA 2J0UB 4XYBA 4P7GA 5K0LA 1DE0A 4U7TB 2WPDD 2XOXA 4OHWA 3VV3A 1A1VA 4MA5A 2IIBA 3EDOA 4UHKA 1UODA 1MF7A 2VQ3A 4UU1A 1HG1A 4UAJA 4G1VA 3TEJA 2NTNA 3W7VA 5BVHA 2P8JA 1M33A 1FSSA 1H93A 3H2HA 4IW3B 3UWSA 4JJEA 1W2WB 4D46A 2I6XA 4GI3A 1U3TA 2XNSA 5ALGA 4ERNA 3CTPA 1WDLA 1T9GR 3ONFA 3VKGA 2CZGA 4IIEA 4EMSA 1HT3A 5LQRA 1GUYA 1EQAA 3KDPA 4M0PA 4XWKA 2QN8A 1W5SA 3ETLA 4KBYA 3M5WA 3OZCA 5CNJA 1GKIA 1U8UA 2E49A 1ECPA 3PL5A 4MTCA 3PDUA 3RVNA 2MR6A 1FXUA 4Z8XA 3GH1A 4L3OA 4AVYA 2O7RA 1CJSA 3CUEF 2IXAA 4UOQA 3SIPA 1JAZA 1JH8A 3KPWA 5T5QA 1N57A 2B1QA 5ALQA 1YAJA 2FPIB 1XZ8A 4QTUB 1OLXB 2PUHA 5CU7A 5GP1A 3WFIA 8AT1A 2YV5A 1GPWB 2F6RA 4N8EA 3QVTA 1HZZA 3A6EA 1N2BA 1L5KA 5KSPA 4EF5A 4LYGA 1RCUA 4I1IA 4N3AA 1OA0A 2Z3VA 2Q5QA 2VNIA 2ECOA 1ETUA 4IKEA 3VR6A 4EUHA 1YZYA 5ALPA 2IK8A 5FLKA 2R7AA 2LKCA 1GT6A 1GPYA 2V7PA 3LLMA 4MKRA 3RV4A 3D3WA 5A6SA 4UNIA 1Y3AA 5C80A 5ITZB 3OZBA 4QPCA 3TR5A 5LP6F 3IT1A 2SBTA 3CEMA 2CLFB 4JUDX 3DJFA 4FW8A 3Q72A 4YQYA 4C2BA 2JDID 4C3VA 5AW0A 5DYGA 1YC5A 3PE6A 3NIGB 2W2LA 5C8YA 3SD7A 5C46F 2H2IA 5F2EA 1G0NA 1RCFA 2YVAA 4B9EA 4QARA 1L5HB 3BGOS 5L7YA 5SY6A 5JSQA 4M8IA 2F8LA 1U3DA 2V7QD 1VLHA 3VSAA 1G20E 1VM6A 4QDXA 2JGFA 4TXJA 1EEHA 3I6QA 1CJVC 1P1KA 5HQTA 2FP4A 2X2PA 5K8UA 2V55B 1J8VA 2A1UA 4KH0A 3TX6A 3IVMA 4YBZA 2XNDA 4JA2A 1EX6A 1PKXA 4HSEA 4I4IA 2NUAB 1YI8A 3STWA 2QKYA 4TKUB 2C4UA 3IIJA 3EMKA 2HF2A 1EVIA 4WZBA 3U4QB 3K53A 3ILXA 4LZNA 2UVPB 4W8GA 3R8XA 1F4LA 1QFZA 4EPWA 4TYQA 1XRJA 2EATA 1XJ0A 3FZYA 1EINA 2X8AA 1O0BA 1D2RA 4GKJB 4LE0A 1AF4A 2XMPA 3WQRA 1ODJA 3H17A 4DC0A 2Z5GA 3HUFA 4G9EA 3N7TA 4PIPA 5HRCA 2W2OA 1YB5A 1NIPA 3AFMA 4GX2A 5ERYA 3UQYS 4KR2A 3JQGA 1Q21A 2QDKA 1Q22A 1VA5A 3OZFA 1KDOA 2B8EA 4J90A 4OQFA 4CKBA 2CV1A 2VG8A 5KPJA 3ROGA 1I1NA 5G41A 3IP7A 4Z9YA 5BVGA 1FDWA 4V1CA 2G77B 2Q28A 3I34X 2QN9A 3ETJA 3PQ6A 1TA9A 4QXPA 2HO5A 2XYQA 3KYBA 1I36A 2G17A 3GEGA 5FBRB 2HMWA 4I99A 4O4LB 1T0BA 3L6CA 1QHHA 4NBTA 1QAOA 2G07A 4MMZB 4E51A 4JKIA 4ZJPA 1M6WA 2BCJQ 1Z0DA 1O94C 1VHLA 5EA2A 5KYWA 2WLSA 2M9MA 3ED1A 4KN5A 1EA5A 1KYXA 4B2LA 1T9KA 3PJDA 4D8UA 5FPSA 1VBNA 1MW8X 2EL9A 2JGRA 3WTCA 1M8KA 4AULA 1K08A 2F3UA 4BFSA 1G9XA 2NUPA 1N0WA 4JI2B 3LBHA 4I4NA 2AW3A 4KGZA 2GKSA 1EG7A 3D3JA 1IRXA 1VI6A 5T41A 4W99A 1E0AA 1P2GA 4ARBA 1EHIA 1A2OA 3EEBA 2RDMA 2W8BB 2BMJA 3WL6A 1ZQ1A 4BUJA 1L3CA 1CUWA 1KK2A 1R0KA 1BHSA 4KIJA 4YJFA 1PJCA 5JANA 1T2EA 1T4CA 3HR8A 4BQRA 4F97A 4YX9A 1GXSB 1SHTX 4L27A 4L28A 2O9JA 1YS6A 2QX8A 3DLHA 3EMVA 2H7CA 2B9VA 4QRDA 4ZAYA 3SYTA 1S4QA 3H83A 2EIHA 4E11A 4G1UC 1X8JA 5E3HA 4E5VA 2HF7A 1PZFA 4ZEOA 4G89A 3GEHA 5DU2A 3OMWA 1JHPA 1OZHA 2O20A 4BUCA 3IBTA 5KVCA 1BOOA 1YDMA 2JFNA 4QDOA 3QOFA 4ZZ2A 2HXYA 3QIAA 3ASYA 5C8XA 1RNLA 2DQZA 1NFFA 1T43A 2CJWA 3CZQA 4NJMA 4A92A 3DVLA 3ELBA 4B3XA 1YZVA 4G2NA 4IHJF 3A9SA 1EBUA 2X6TA 3LUAA 3TZLA 4X41A 5HA5A 2O8DA 3T35A 1KDTA 3TOVA 3OHSX 4YR9A 2J6CA 3QPBA 1RXUA 1ZC4A 4RJTA 1BD3A 5BSEA 4NY1A 5FBHA 5JU6A 3IJPA 3PA6A 3JQDA 3EQ6A 2IKQA 3A2LA 3E53A 3TRDA 1O9HA 1JHDA 3SZOA 1Y5MA 1RM4A 2OPBA 3N8GA 4EG1A 1AMNA 2XGJA 1YJ5A 4IXDA 4DMHA 2NPOA 1G17A 1OIVA 4K6OA 4Q6WA 4ZZ0A 2YXPX 3TZEA 3GVPA 5ERXA 4PLVA 1SCAA 5ALKA 1PZHA 1XDDA 2L2QA 4J7XA 4MW0A 1D9XA 3VZSA 3ICEA 1YL7A 2QSZA 4RZ3A 3W5AA 3KAKA 3RCBA 4BLUA 1LA2A 3DZDA 5ESRA 4JJAA 5ALEA 1FDUA 1W4CA 2VTDA 2J0UA 1EUCA 3OCYA 4JLBA 3F5DA 5LOVB 4EG3A 1U11A 3NBKA 1A9OA 2G9QA 3TVYA 2HCRA 2H5JA 1FFHA 1A8SA 3CNOA 3QTLA 4RPCA 3TQIA 5EJ9A 3DOJA 3A70A 1SURA 2FOXA 3Q5DA 1C8BA 1QCCA 3B85A 3QNUA 4INZA 5AM0A 2I03A 3FYTA 1RZVA 5BSUA 3ZVKA 3CVUA 2GBLC 4B33A 2WE8A 2PWZA 3PPYA 5P21A 5JAPA 3DZFA 3QUTA 2BGGA 1KEUA 3SSAA 5CYGA 1YQQA 4LYYA 3EBLA 4ZGBA 4G8JA 3GP3A 2DHQA 4C4AA 1RJ9A 2AG6A 2IP1A 4E3ZA 1E92A 2CSXA 3EASA 4TS3A 1GG9A 1KZ4A 1H9BA 2GAJA 4IRMA 4UTNA 4RMGA 3DAHA 2HK8A 4UBIA 4UDXX 3DFMA 3FWYA 1T2UA 2VO1A 4WNCA 5CUQA 4ZWNA 4MVJG 2DMRA 3A4MA 3MIZA 1V3UA 3BXFA 4XVQA 2RIPA 3DNFA 2OSBA 2VFAA 3FYCA 4LVOA 4UUQA 1VLZA 4IRUB 3TUZC 2QN3A 3FVWA 3H2IA 3NVMB 2OCPA 5DB4A 3JATB 1NBOA 5BW5A 5HQ3B 2BVNA 4JBXA 3RC1A 2VF2A 3AT1A 4AX4A 1WPXA 1N2JA 2X14A 3KG2A 2NT3A 3LFHA 1UJBA 5EESA 3FOCA 1UWLA 3IVXA 1GD1O 1YIOA 4Q9NA 4IXMA 4QG3A 1O6CA 2GWRA 3VOAA 1G8AA 2I55A 1UBCA 4WXPA 2G8LA 1Y42X 2UXCB 3E1KA 5DZSA 3EA0A 1ZX1A 2D3WA 1BW9B 4X9XA 4FNOA 2GMWA 4KR7A 2XWQA 4IJWA 1V6CA 4AZWA 2CL5A 5CLJA 5JZOA 1KI8A 1K7FB 3PFIA 1A5SB 4CDMA 3O93A 4N3BA 4C1NA 3CX7A 3WJ1A 2FRDA 4F60A 3MA0A 2ABWA 4E1AA 3SS9X 1TJ3A 3H7IA 2HADA 2P9EA 3LRTA 4V0RA 4AF7A 3DOEA 3IVRA 4QJIA 2CLMB 3WP1B 5AVYA 4BO8A 5JSFA 2XYRA 3FPFA 3G2NA 4PSVA 5AW4A 5JNTA 4LA4A 2F1HA 1K0UA 3RRBA 3D7KA 2EBFX 5DN6D 4UU8A 1Y4ZA 2BM9A 4ZCRA 3L8EA 2QU7A 3O8QB 1XYYA 4D81A 3WMRA 1CRQA 4R8RA 5HGJA 4MVJH 2Y05A 3KTOA 4X8LA 1U1CA 4KFUA 2UUBB 3KHKA 1BROA 4XWWA 1OLUB 2MSNA 1OFTA 2P30A 1KO5A 1E5TA 1T6YA 1O97D 1UDRA 2JATA 3NUGA 3S2IA 3VC3A 4EI7A 4JL5A 2BI7A 1UP4A 3E5RA 1IJEA 3AR8A 3IEVA 1G42A 2BFBB 2IIPA 3P4YA 3DCJA 2YMPA 2IOFK 2YXDA 3R3VA 5FD8A 4AL4A 2R8EA 2A9KA 2A1IA 5LMZA 3D3KA 1GQ2A 5DCYA 2DG2A 1C30B 1F4PA 2WYWA 3GQVA 4G84A 1E8MA 2G5CA 2WHQA 3G5LA 4BFTA 3S27A 1MO6A 2XCRB 1FFYA 3AHCA 3FSGD 3VO8A 2FUEA 2CXHA 3DBRA 4PLFA 1XEWY 3BREA 5JDIA 1MA0A 3DP9A 3EY9A 5IK2A 4XRRA 4CLOB 4LJ4A 3UJHA 4LKOA 1HDCA 3WADA 1VE9A 4NDAA 1OB2A 1D04A 3GW8A 2F90A 4ZMRA 3KZNA 3HM2A 5C8YB 3W1EA 1CR4A 2QTFA 1OXKB 3ESCA 2AR0A 1VYTA 3GP5A 4DIBA 2G7MC 2G9ZA 2EWVA 4M7OA 4G5GA 5SYMA 4BQPA 3D7MA 1EA7A 1OHHA 3F5SA 2CVZA 1DZ3A 1TO1E 4LWPA 1V2GA 3DTYA 3ZNQA 1Z0KA 4OP3A 2IPXA 2RGBA 4H0FA 4TMFA 1L7OA 1XTKA 4BTVA 1PFKA 3QFRA 1FNBA 1LBQA 1UCFA 4DJAA 5JZMA 2WD7B 5BN4A 5FUMA 1IWPB 2QWXA 2VJKA 4M36A 3O2JA 3DC2A 1LNQA 1NM5C 5AOVA 4OQMA 1JXOA 1P19A 3ZQ4A 4NPHA 3D6FA 3B48A 5FQNA 1PNQA 2HD4A 2VQDA 2HLDA 4AIRA 1HOXA 1T2AA 2VXCA 2B6HA 2JIRA 4GS5A 1LY1A 4K6HA 4P3NA 4YRLA 3I05A 5AD1A 1NFQA 1MOPA 2XRFA 2VSXA 4F3KA 4XQGA 2ZIFA 2X1LA 3UWDA 4QBTA 4G0WA 1YJQA 2BSAA 3IXQA 3LGAA 4LE2A 5LYJA 2QZZA 1ENYA 1XFDA 3OFND 3ZGOA 1JLLA 1FIUA 1WX1A 1T91A 3ABZA 4CDRA 1XFAA 1VJ1A 3CCBA 1NKVA 1N6LA 4C6SA 1EU1A 1GA4A 3OM0A 3O7MA 4P7BA 1U7TA 4O4JF 1KK3A 5AKLA 4HDNB 5C1DA 1W0CA 1PTKA 3CZAA 4OMUA 1L5YA 3UGTA 4C7OA 1ONBA 2G6BA 4BMXA 4MJ3A 2DTEA 3GCXA 4FHEA 2MCFA 4DSTA 5G40A 3EX7C 5CCDA 3WY9A 1P2DA 3M2TA 2FP4B 1ZMRA 4MS1A 1VG0B 2ZRPA 2PRKA 1JG6A 2J4CA 4F4IA 5IWCA 5AKYA 4Q4LA 2C96A 2PSSA 2AOVA 2WMDA 4X0EA 4Y2PA 1YBFA 3X2FA 1V95A 1TIBA 4C22A 2OO7A 3CO0S 3WMXA 4AIIA 3W2GA 4DBZA 3WXMA 3FDXA 4EUEA 3LKZA 5A03A 5TARA 3W2EA 3P8ZA 4I0WB 1OYOA 3EG9A 4PHGA 4QLOA 1VKRA 5BSRA 2OQIA 2HV8A 4GUDA 4KWTA 4Y1GA 4ZT6A 1FFAA 3N3AC 5EJIA 4BNYA 1M54A 2PHZA 2XA1A 4RZIA 4S2UA 4FBMA 3KYCB 2XZPA 2J0VA 4W7IA 3OEEA 2Q7XA 5HXAA 1XLTA 1DAIA 2HK6A 3HYCA 1SZJG 4E46A 1EG2A 4KIGA 5HOEA 3K0CA 4KO2S 1ZN9A 4RE5A 2CE7A 4FBGA 4ND6A 3S2YA 5D1NA 1N9GB 3FAKA 1A9PA 2IUYA 3PP8A 4UU0A 4YJ2B 5EJ2A 2AFRA 2J07A 2Q5JA 3WA7A 3QQPA 1XHEA 2NP7A 1TAGA 4ZI5A 2Y4OA 2ENUA 3HN6A 4RHUA 2YZ2A 3QBTA 4FYVA 3PU6A 5CT5A 3C8ZA 3VUEA 4AAYA 4P4SB 2FGKA 3RTAA 3A1FA 3I32A 5JW6A 1SZPA 1U2TA 2CXOA 2X0JA 4UULA 4YPOA 1XTRA 3CKLA 1SWVA 2QLJA 3DQQA 4QREA 3ZUGA 2O3JA 2XGSA 4L0MA 1QK5A 1Y5IA 4LGMA 3KJEA 3QY9A 4RKQA 4CM8A 5HJ7A 5EEHA 4KQIA 5ALYA 3TIFA 2REXB 3NETA 3KR9A 4MLZA 3MTIA 5C9ZA 3M8KA 3RVBA 5JNVA 5KKCA 4PTYA 4PBSA 2DHDA 1C50A 1EE2A 2E7ZA 5DNCA 3F78A 1MNAA 1JA0A 5E7IA 4FP9A 4RMJA 2WUFA 3DAGA 3BOSA 2P7HA 1RHQA 3AI7A 1G20A 1JEYA 4MI3A 3HCFA 4H1UA 2W2QA 3TRFA 3DEZA 1TVCA 1BEEA 4J0QA 3PB3A 2WUVA 2ZW9A 1ARZA 3N0TA 4YDQA 3B13B 2OC9A 4K9DA 1MRSA 1NY6A 1A9TA 1F14A 3ZW9A 1QIGA 3RHFA 4CLRA 5DHRA 3DQPA 1G3UA 3IV9A 2PVPA 4M9SA 2CNOA 4ACBA 4AN1A 2O5EA 2FI1A 3ZLUA 3IV6A 1KBOA 1N6HA 3JZIA 3UICA 4OK3A 2ZRLA 3CLKA 2JNWA 3G8CA 4J9VA 1YQUA 4PCAA 4GPZA 4ZT5A 4AC9A 1X86B 3WNZA 5T8KA 3WVNA 3GGSA 5CDHA 3X1JA 1D4ZA 3F49S 1OUMA 4F2PA 4WBNB 5F77A 1SHKA 3NJ8A 3RTGA 3KZVA 3F46A 1DQZA 2E5FA 3CZPA 1RAFA 5EYPA 1CDEA 1ODTC 3SFTA 2BBTA 2AVDA 5AW9A 4ZCQA 4ZFNA 4G0XA 4RDHA 1ICIA 2I71A 3BE8A 2BMWA 3H3JA 1KJNA 1J23A 4HATA 1SN7A 3PPXA 1P8JA 4R6WA 1VTKA 5MHTA 4R41A 2V6FA 1CSEE 3KXDA 4KQ6A 1W59A 3WSTA 3EPLA 1Z7BA 4WJLA 1C9MA 2V7WA 4JLAA 3QLEA 2IIVA 4GXTA 2D00A 2A6PA 3NPMA 1TUBB 1M2KA 3B1WA 4D6PA 4Q3CA 4TZTA 2JLBA 2YICA 3TI7A 3VYRB 2RJ3A 3NDPA 4S24A 5HS6A 4RNCA 1X14A 4CL2A 2QTZA 2BEKA 3UAWA 4M1EA 4RVSA 3J7AC 4YFYA 3UATA 3EOZA 2V5UA 4Y0NA 2DBRA 4Y6OA 3KX2A 3PE4A 5FPHA 4D74A 2WVHA 2V03A 4LCBA 4JBIA 4XPIA 1MV5A 3GLRA 4CTKA 3CVVA 3A9UA 4GSYA 1AUVA 3DLPX 4JOSA 1FMTA 2IYZA 3UJAA 4ENUA 1RLUA 3DOHA 4P3YA 4HRVA 4MYTA 1C7FA 4RTOA 1AV6A 2IXTA 2IDJA 4Q12A 3A1EA 3A1UA 3KQVA 4JYZA 2D5AA 1KEVA 2J33A 3Q7SA 3WLJA 1KRWA 1PEDA 4OF4A 3JYPA 1A9RA 3UMSA 4WZAE 2IPAB 3LHFA 1K6MA 2X13A 2G0TA 4K6GA 4EQ6A 3JQGB 5HMLA 1CZHA 5JCZA 5ECDA 4RPJA 1MEEA 4D0LB 3DZCA 1EFTA 4P5EA 5DULA 2OV8A 1N2XA 2PZKA 1T2CA 2VYND 3EYWA 2N0SA 3HYLA 1T4BA 4K46A 1AKQA 1L5OA 2BZ0A 5G1NA 1K75A 3U4HA 4WI1A 4UNRA 2BI8A 4ETIA 3K96A 4XWAA 4MPJA 1PGNA 2FFJA 5LBUA 1PV2A 4QBGB 4CIWA 4Z86A 4DA0A 3JQFA 1J09A 1SB9A 4GO1A 3RFCA 3A1NA 1SCIA 3IMKA 3LNCA 5LA6A 3FDIA 3Q1KA 3D31A 4BO3A 4IINA 1DWOA 3MWEB 5F1OA 3INTA 1RKBA 4LX8A 1RJDA 3OJXA 5JSZA 3ZVMA 3CYFA 1V5WA 3K35A 1K4KA 1CXZA 3VNBA 3ZZ1A 3C3DA 1A5AB 1BA3A 1M2JA 2R47A 3K9HA 4UNSA 3GLHB 2YYSA 2K7ZA 2OQVA 5ENDA 4OQZA 3ZG6A 4B47A 4J7CA 4KFCA 1CNMA 1ML4A 1Z13A 2EFGA 5A2QA 3TSZA 3ESBA 1S3SA 2BGIA 4N6NA 3MJTA 3DMPA 4W9MC 1FVFA 3M6XA 4G56A 2IH5A 4N41A 1Y1SA 3DBVO 2YW9A 2Q1XA 1AU9A 1UXOA 3DM5A 1JHXA 2C3PA 2QD1A 3DOIA 3O9MA 4G26A 5ITVA 5EUQB 1RW4A 4WESB 3ND5A 3RFXA 2NV6A 3LUFA 2VJLA 2R44A 5EG5A 3CX6A 2PANA 2QJWA 2YMLA 2HF8A 4U2CA 1SXPA 3P0IA 2OECA 2WKQA 3ANSA 1Y82A 2J31A 2A78A 3OY7A 2QPTA 2R00A 3KKLA 1A5ZA 3QVLA 1ZFNA 3VPFA 2H9YA 3H1EA 4QQKA 3UAGA 1D09A 3A6GA 2QXUA 2BHTA 1HLPA 2G83A 2FZKA 3CZ4A 5JDCA 1Q11A 4LJ8A 5KNDA 3BXEA 5LUBA 2EJUA 3O8NA 3X2SA 4A2WA 5K45A 2W6ID 2DBVO 1KJIA 1NHGA 2OCXA 3WZMA 3FNFA 2ZSDA 4UTOA 2F1RA 2OXTA 2NTYC 1M7HA 4K9MA 4DTCA 1PQUA 4NAUA 2LP4Y 1E2MA 2ADFA 3AZPA 3IAAA 1X1EA 2BTOA 5E8RA 4UPDA 4EW1A 2H08A 2FQYA 1H69A 1XIVA 2QJRA 2NSYA 1CUGA 1GITA 2OMKA 2ST1A 2VAWA 2V98A 2J3MA 3CV3A 1VBFA 2ZK7A 1Q44A 3V7UA 2AC7A 1N2OA 2MIIA 4PU0A 4TYWA 4GSLA 1YVDA 2OFOA 1Q7EA 5BUZA 4BFYA 4Y2GA 3V33A 1GRQA 4F71A 3E5MA 4H7IA 4J75A 5HG0A 3UMBA 3SS8A 5L4NA 1S1MA 4RK1A 4QUIA 3E4DA 4TXNA 3K1AB 4HWTA 4MI6A 4DG9A 4D79A 3TDKA 3U44A 2BBSA 3CUUA 3ZZTA 5EJ6A 1WKVA 1Z39A 4G8BA 4DCJA 1GLVA 4YUYA 2IGBA 1EFCA 2G76A 3KT0A 3V42A 3GMIA 1P7CA 2XIJA 4AJHA 2RH5A 4E4YA 4P34A 3SBEA 1BKSB 2HJRA 1G3IA 2B78A 3SDBA 2EX4A 3MSXA 4BCCA 5C3MA 4WZAA 5EIEA 3T15A 4GI7A 3SF0A 4RJLA 3MVEA 4DA6A 4E5MA 1YVRA 1IBRA 2QTAA 1G6Q1 1XRMA 1Z8NA 5LOVF 1VJTA 2JVIA 1PU2A 3OOEA 3TTYA 2X40A 3D6VA 2VRCD 4JLMA 4KXMA 5SY9A 4BNTA 4CETA 4MV5A 4Z49A 4I46A 1RWNA 1V6AA 2AE2A 1TKBA 3GLKA 4NQRA 1JDVA 1UAYA 2MYTA 2M1ZA 4KQ9A 4P54A 1QX4A 3TN7A 2CXPA 1TF2A 1BS2A 4MVJE 4R7ZA 5C34B 2XF8A 3E70C 1EDZA 2ZUCA 4BLWA 3WHPA 5AJYA 1XAGA 5H3HA 4LZAA 4AN0A 3OUZA 3VO1A 3CUYA 3I61A 1LWNA 3RSQA 3NWEA 1JB9A 1T5DX 1WB6A 1C0PA 2R7NA 4DA7A 3QE0A 2QRLA 4ZEVA 2QT1A 3C8DA 3DEJA 1BWRA 3KTAA 3L2OB 3B9RA 4JC4A 4LOAA 2KX7A 1IUPA 3CPHA 1VYHA 4X7BA 4Q34A 1XTQA 2QVZX 1Y4DE 1CUIA 4C30A 4CHTA 4GM1A 3K0HA 4DC9A 1JS1X 2UYCA 3DNPA 3IFSA 4Q9IA 4CM5A 4AG5A 3QPUA 2Y1XA 4BBJA 1BEZA 1QGDA 3F7MA 2XQVA 2NSLA 3LHSA 4Y6QA 4ZRMA 2HA2A 3WWDA 3DO5A 3H84A 1I1QB 3JCZA 3M5DA 5JYCA 1P4AA 4F9EA 5J23A 5BWOA 1JBQA 1II9A 3W6UA 4PXAA 4QDUA 2I4MA 4PLZA 5SZHB 1XD2A 5AK0A 4WL0A 3OVMA 4JDPA 1UFRA 3URMA 1X7ZA 2A14A 1ZRMA 3BGVA 3I72A 3ZCTA 3LBNA 4KMOA 3M6MD 2H48A 1YRWA 1AT1A 4DMGA 3I53A 1RPTA 1YKGA 5DBFA 1O6GA 3PICA 1Z5VA 2GNOA 1N2SA 5I9SA 1UBGA 2C7BA 5FTNA 5HDBB 5AOBA 3ZXXA 4B6EA 2EQAA 3WFJA 1WMDA 2H11A 3EIUA 1I9CA 3SC2A 3ZH9B 4BO9A 4KX5A 3MYYA 3ONVA 4B6QA 1W73A 1EVYA 3IE0A 5HMMA 3O8QA 4I2NA 1PFGA 2B21A 2WNIA 2YY5A 2Z4RA 1KE1A 2D4HA 2NOAA 1E6CA 4MVJD 5EMHA 1UPTA 3K05A 4AP6A 4E3WA 4N3GA 1DO0A 3SX0A 3F2IA 4EY5A 5CPBA 1KHTA 4COOA 3EPKA 1XJ5A 5BSTA 3D8TA 4XOIA 3L0OA 5A3SA 3W6ZA 3IE1A 3LWDA 4I8XA 1OH6A 1QRSA 4C4TA 2NSHA 5FADA 2CLCX 5CDGA 5FRDA 4E30A 1NP6A 3ESXA 3AIIA 4DSAA 3ZDFA 1WB4A 1L8AA 2O8CB 2XT9A 1IN6A 3TCNA 1ODCA 2BGJA 1XZFA 4RYDA 1R10A 1H6DA 1O95A 4F85A 5K0ZA 3LG2A 2RGCA 2J9YB 2H9AA 1T8TA 5I7FA 3G2QA 3I3SR 1R8JA 2D6FA 2ZE8A 1JHUA 5EGNA 4PYMA 1N9ZA 2KM1A 5IK2D 2B30A 2W90A 3CNEA 1GTJ1 2ZANA 3ZK7A 3IT3A 5E6RA 1I6WA 1R00A 2QNIA 4EW3A 1XO1A 2X9GA 2V6BA 4E6EA 4DEVA 3NOXA 3AG5A 3C2QA 4N5DA 3ZLBA 4CKWA 2ZBDA 3VH4A 2HXGA 3HRHA 4UDYX 4YMUA 1IWOA 2I3DA 1Y37A 1KMMA 3GGPA 4FDAA 1EWQA 5J2TB 4PPNA 4RGVA 2FSVA 2D1QA 4K40A 4C21A 3OQBA 4KAJA 3U60B 3PGMA 5F9MA 1VFNA 5FI5A 2IBMA 1ND6A 5HPYB 1E2UA 5AJWA 2VWHA 2OCYC 3MWLA 2XCSB 2MSKA 4XWTA 4OB6A 4ESHA 1P29A 4CIDA 4OB8A 4EL5A 3OQJA 1OU0A 1VLJA 1ZK2A 3TRJA 4BRUA 4AKEA 4C2UA 2R79A 3HBFA 3HPRA 1FMJA 3GAAA 3HB4X 3HBAA 2RH4A 2K2WA 3KKPA 4BLSA 4M54A 4PPQA 5KCZA 3V8VA 4TOIA 1YOVB 3LUHA 5T7BA 3O8BA 4XH9B 3G7UA 3CJQA 1I7DA 2AVNA 4YCLA 1ZI6A 4LZLA 4NJEA 5H82A 4O6VA 5DF1A 3WLLA 3PFGA 1KH1A 1SHUX 4RF4A 1PI3A 1AKMA 3E2IA 2XMGA 3OHMA 4DM4A 1MV8A 5HJEA 5AKJA 5AUOB 4AJOA 1XLUA 5BR8B 3SHQA 3R3XA 4Y2RA 4CI0B 4CMEA 5IKOA 3SVLA 3F7OA 1XKTA 2DWOA 2EG9A 2WT9A 3USCS 4DLRA 4Z5XA 5IT5A 4N3NA 3A2NA 5CURA 3PXGA 1M6NA 5G3ZA 3QX7A 1YRAA 1LLDA 1XA0A 1P2UA 2ZYSA 5ELMA 5JALA 1B7GO 1UKZA 3GD7A 1YCHA 2UXBB 4K1LA 1JEOA 3NLLA 4NWIA 1GDTA 5HIJA 3FTDA 3MG9A 4G1EB 4XB6B 4BB6A 1PSWA 3AI3A 3CC8A 1VKNA 5HTOA 2WIJA 3FDZA 3FRIA 4O25A 3FUUA 1JR4A 3HI4A 4RLSA 3MAJA 4AICA 2JA2A 3MJEA 4ZAWA 3MD0A 4DV5B 2NN3C 1PLJA 2ZIVB 2NYUA 1H4SA 1J1UA 3ZQJA 1E5DA 3H11B 1H3FA 1YJXA 3WDLA 4DVJA 3GCGA 2RGXA 4II7A 3PR1A 4NENA 3OZSA 2QQFA 2RI0A 1OV4A 3TIGA 4JU8A 2IHKA 1KPIA 1RTTA 2QR2A 3IELA 2ID9A 4MV3A 4PQRA 2YCBA 5CG1A 1SH7A 5CB4B 1KH3A 1G38A 3ZDQA 2QAIA 1C1XB 3C3JA 3ZPXA 4AJ2A 5JSUA 4XOUA 2O48X 4CL8A 4UFNA 4YJ2A 4UBMA 1L1QA 3KEFA 5JCXA 4X1KA 2LTAA 3OE5A 2Q3CA 4JUCA 3L7CA 1KYZA 1LI4A 1SCJA 2IA5A 4LMRA 4N1AA 3V4ZA 1K89A 1VGQA 4HN9A 4UHHA 3TLAA 2RONA 5LQAA 1QIJA 4N7JA 3GGOA 5D86A 5IM4A 4DBLC 2P5TB 4YP0A 2CC2A 3MWGA 2C7OA 3ADDA 3VR1A 1KU6A 1JU9A 1U7WA 4CM4A 1GTG1 1I0LA 3FKJA 1YDFA 4NICA 2VF7A 3WWEA 3MRSA 1Q77A 3AJ9A 3B6MA 3CMMA 4AURA 3SI7A 1A9XA 2R6AA 1T9HA 3ET4A 3I45A 4F1KA 2XUJA 4IFBA 5LQNA 7YASA 2I8LA 4LG1A 3MLBA 4F4JA 3OM9A 3LCCA 2P5UA 2QIOA 3EC7A 3G13A 4UCWA 4V24A 5CVJA 4O4LA 3DB1A 2IH2A 2OCLA 1J9EA 3BGSA 2CHUA 3LUDA 5DHSA 4BATA 4DMRA 2PA3A 1W0JA 3G89A 2Z98A 5ALOA 1TZMA 2C9ZA 4BO1A 1E59A 3UGQA 4DCSA 4F2WA 3D81A 3NDIA 2PUCA 3H4IA 1B93A 3IJRA 4ZOQI 3GUVA 2XITA 2VH1A 3GLFA 3KQQA 1YBVA 3BB4A 3GLFE 3O3MB 2XHZA 1KOGA 1UMDA 2E6KA 4LZJA 2C98A 1ZIDA 1BMFD 4BMZA 2COKA 1G8SA 1OTYA 5K0NA 2OGSA 3RS0A 3VMMA 1M2VA 4EFLA 2ZCJA 1N0IA 2JGAA 5LNK1 1KI6A 5D3QA 1OZGA 3I3OA 2BKXA 4TTVA 4NXNB 3DDZX 1Y1LA 1HFEL 4YGXB 1T10A 3C7KA 3HB1A 4B3DA 4GPBA 3OSZA 4BKUA 4EHJA 3FUTA 3HYRA 4RPGA 1A2BA 2B7LA 3NBQA 3L02A 3RJMA 1XVLA 1J4AA 1JDZA 2FU5C 4PSUA 2Y0DA 1FMFA 5E4FA 4PG8A 1JDNA 2AWOA 3R0IA 4ZOLF 3PKJA 3FYHA 4IHAA 4A2QA 3NS7A 3PQ5A 5DP2A 2KLHA 5E38A 3RJTA 4BNMA 4XLTA 3H99A 1N8KA 2O2EA 3NTUA 4K0RA 1PS9A 3FDJA 2Z1DA 4B8ZA 3KBBA 5AI0A 1LCIA 1PZXA 2NZVG 2O1SA 4OU5A 3Q9NA 3EEIA 3EQ9A 2I3ZA 1GEGA 4IILA 2WWVD 4Q7QA 2V4MA 4FINA 5KNBA 1CZRA 1EZ1A 1GCGA 4GD3Q 5JPDA 4FJ1A 5JS7A 3U7GA 3B1VA 3BMQA 3HKBA 4I9HA 4CE6A 4A5SA 4BZXA 2QB5A 1PW5A 3B6JA 4EIWA 2JHPA 1R15A 2GRUA 4B2PA 4JI6B 4DNXA 2H1LA 3F0TA 2RAPA 5B2EA 5DTEA 4RK6A 3G1TA 5JYEA 3QWAA 3N2GB 3EXFB 1PV1A 1TU3A 2DBZA 3GV0A 3OIDA 5TV2A 2XD9A 4DKJA 4QUGA 1NVAA 5G1PA 3EMBA 4FMBB 5BPFA 1AS2A 2B94A 3AEZA 1VKZA 3VOSA 2ZBFA 5CH5A 2AR7A 3ZNOA 4E5NA 2WG0A 3PCTA 2XLCA 3AY0A 3CUSA 1EGAA 1E4YA 3VI4B 5B1YA 5B7PA 1AUXA 4FR5A 1LK0A 4JSRA 3RVRA 3VDMA 4G0UA 2FCAA 3LF2A 3P9IA 4RIHA 2ZSFA 4U7HA 2TYSB 3VJLA 4TVSA 3BG5A 1Q91A 3BHMA 2HHLA 2PYIA 3EJ6A 4PLYA 5EIBC 3TEFA 1QV6A 1QE0A 2ATVA 4F2GA 3BWDD 4AZTA 4ZYTA 4O29A 1T15A 4QYTA 4B7UA 1O08A 3GP8A 2RHDA 5BSVA 3JSXA 5KTRA 1XCOA 4UKDA 5A04A 4YV0A 2IUFA 2WJPA 4NQZA 4FB5A 3T5PA 4H1WA 3ZE0B 3G0IA 3FWHA 1AXGA 3I1IA 3P9KA 1WXWA 2QPAA 1UXIA 1TMKA 1UPAA 5FHQA 1E3EA 1I0IA 4A15A 5G4KB 2OLEA 5I8WA 5JXIA 2Z56A 3W3AD 1ULHA 2RGDA 1U81A 2GN8A 2XUDA 3RFFA 3RAEC 2GZMA 2QG6A 2ZYWX 4YP5A 1L7NA 1ADFA 1XWIA 2QTMA 4J4HA 4EJSC 3CVXA 1JVBA 4A6XA 3LCJA 1JI0A 4DNOA 1VBMA 2C2OA 3MRTA 4PZYA 5JSZB 2HL6A 3RBVA 1W36D 1IULA 3AKCA 4K8OA 3W8NA 3BWEA 1DAFA 1E0SA 3CLSD 3HXLA 3OETA 2VYCA 3KLOA 2O8VA 4FYJA 4KE6A 4LYDA 3KQLA 4CEIB 3CISA 3X44A 2QTVA 3SOPA 1E18A 3QU9A 3ESRA 4X7MA 5F2OA 3HVJA 3NHJA 5K7SA 1CS0A 5JTUA 1YCFA 1A9QA 3PIRA 2V3WA 3GZ4A 5EXEA 2J9RA 1C0LA 1C9KA 4QPPA 4X1IB 4EB6B 4AWXA 4V1CI 3KBOA 4I1PA 3OZIA 1K68A 3DLTA 5B6JA 3S8YA 1UIRA 3BKXA 2B8TA 3DPSA 4H7DA 4Y7DA 4E08A 2DFDA 1BTOA 1IQUA 2GRAA 2J3IA 3AL3A 3CF6R 1E1RD 3DE2X 3E27A 3G02A 4G23A 4R1SA 4TMZA 4L57A 1TKCA 5JTTA 2ZBRA 1N7GA 2OAQ1 1DEXA 4ND2A 1ZSNA 2P2YA 1MJGA 2Z6VA 1I3CA 2HFJA 4KR9A 3W7BA 4BJHB 1EVKA 2HR1A 3HV2A 3GEDA 4IYRA 1S02A 5IMBA 2H5IA 1J39A 4J2OA 2H1CA 2IOQA 4PYOA 1JDSA 2LXNA 4NBSA 4BFVA 3G49A 2YQZA 1KYTA 5FULA 3SNKA 1ZIOA 3VDRA 3C43A 4YY3B 4NZOA 4AJNA 4ZAXA 3DE3X 3IBCA 3NM6B 3IJEB 5FO1A 1QU3A 3JVVA 2JGNA 5K0GA 4EG6A 3DONA 1BIFA 1JZSA 5GONB 2W6IA 4UM7A 4IJVA 5CH3A 1QYDA 4LGYA 4P4TA 2F17A 2ACVA 1RKVA 2FJPA 4P3XA 3THSA 3BSFA 4RC9A 5EWMB 1Z5UA 4RVFA 5DYIA 5KDOA 1CQWA 2JFUA 3V4SA 2BE7A 3HJAA 4H16A 2P90A 3DFIA 3ON5A 2CXXA 2WM9B 5AXBA 1WMBA 5I8ZA 4HT3B 1W5TA 5SZIA 4CL0A 1KQNA 2NMVA 4JBLA 3PWZA 1E5VA 2PH3A 2VHTA 3EVZA 3ZHOA 4GBGA 2H17A 4A6PA 1EFVA 4MUFA 1EPUA 2G09A 1JF8A 4AY2A 4HWGA 2ADOA 2QW1A 3HU1A 2FPXA 4QUAA 2HJGA 2PS0A 1T8UA 5JLAA 1Y6FA 3V8QA 3QUBA 4HZUB 5L3RA 4Z7NB 4DHEA 3N05A 4RE6A 5AVXA 3NOVA 1UC8A 4HPJB 5IT0A 3MTDA 4YASA 1RXWA 1LQTA 4BECA 3EWSA 4DV0B 1MDBA 4RVDA 4ND3A 4BFWA 1W9MA 2RHBA 2I78A 2OD9A 3F47A 4WK0B 4PWYA 1BHJA 2I3AA 1E1LA 3PI6A 5E6SB 4GZLA 4M98A 1Z3IX 5CXUA 1QHNA 1CZNA 2HO4A 3V4LA 3G6WA 3IP8A 1P1CA 4LYEA 3TGLA 3ZOZA 1S2GA 3BKWA 3D59A 3TLCA 1AKEA 2PA0A 1B15A 2ZBPA 3STVA 3QVUA 1O5TA 4XDGA 2BFWA 4XAQA 5EXXA 5D3MB 3Q7TA 1XF1A 2W6NA 2X1HA 2P9BA 2WD9A 1KMIY 3DOUA 1ZXBA 2HQBA 3ABRB 5JAUA 4YS6A 1NUTA 1T0IA 2GJ9A 2JVKA 4KPUB 3JVEA 4KQEA 5HKLA 4D9GA 1OFIA 2J30A 3EEOA 2MSDB 1YB7A 3OCWA 2ORIA 4FSDA 1JLLB 5GZ3A 2D2IA 5FI1B 4BUZA 1M1YA 1UZNA 1U02A 2FE1A 1Y8AA 3HDGA 4YJ3A 2EBWA 5EQJB 4AS2A 3PUKA 4RK0A 4J03A 2CF6A 1ECGA 3QF4A 4AD8A 3I9MA 5K03A 4GI1A 3LQKA 4LRSB 4KBGA 1RLJA 3ZCVA 4Z2AA 1VE7A 4AJEA 4ZCLA 1PK8A 1YA4A 2CUTA 3HCOA 4A0RA 1V1MA 2AEFA 2FQ1A 4URHA 5K99A 1KZ9A 2DUNA 3MMZA 2IV7A 3Q3JB 4DA9A 2ROQA 3BJMA 3OU2A 4E32A 3PC2A 3C5WP 1SD2A 4LPSA 4F1JA 3Q7RA 2HAEA 2HX1A 1FFBA 3WGHA 5JC8A 1ZWKA 3TWOA 5C0OE 3ICOA 3CU5A 5IMSA 1QHFA 4K3VA 2NIPA 4BMVA 1QTIA 3DE7X 3S1LA 1E2LA 4IZIA 1G6OA 4TV9F 2QYHA 1O96A 2VPTA 4JB3A 1AO0A 1P73A 2H7VA 1QS0A 1V7ZA 4ZVQA 2HU8A 3H6HA 2V4UA 3E03A 2X4GA 4DA8A 5KTNA 1X7WB 3FR8A 3SR4A 1HQKA 3HB5X 1P7WA 4U7JA 4PQGA 1Q14A 3R7LA 1VJGA 1XK6A 3FJ1A 5JEDA 4DMMA 5HJ2A 2DR0A 3UUEA 2IITA 4DDVA 2JCVA 2O2CA 4LZZA 3VYTB 3JTEA 4TWBA 1U0BB 2W93A 2DFVA 3VV2A 4AMGA 1Q1BA 1V3TA 2Q1TA 3NONA 3VDXA 4O8CA 1E3MA 4CN9A 3EH2A 1W8IA 1P8AA 1R7RA 2V8BA 2ZAGA 2BZ1A 3NT2A 4MPRA 4FDVA 2NXCA 2DOKA 4JASB 4KKVA 5TPZD 3C1AA 4WNIA 4X71A 3LHKA 1FMCA 3D4OA 3S99A 1G1MA 3ASUA 1HURA 2GPTA 3AHGA 3JASB 2WSIA 3JD1A 1PR0A 2AK3A 3OLYA 4L5CA 1FVOA 2J5KA 3UG7A 4M9ZA 5LM3A 3BTVA 5TE9A 3ZBUA 5KVQA 3GEPA 2GCEA 4KH1A 3IAFA 4K0KB 2BJWA 3CUTA 4RAOA 1QH8B 1XV5A 3NP9A 4MS3B 1J9GA 4Q7JB 1K06A 1BCRB 1YE5A 1CY0A 3R7WA 2H3EA 1JE0A 2QEQA 5I51A 1M66A 3ONDA 3K9NA 1Y1PA 1JG1A 4ND8B 2VHZA 3RK0A 3P97A 1MIHA 4Q7LA 1SXHA 1FBNA 2ZS7A 2A0WA 2B5WA 5LP1A 2M32A 3HKCB 4DS3A 1OT3A 2OCDA 3H2KA 2IKSA 3OT1B 2FKAA 3KVOA 1UFQA 2PZ8A 3DL0A 3S1AA 3EQ2A 4FYWA 2IEIA 1FFSA 2IZOA 3EW9A 4M49A 1TMYA 2FK7A 2QN1A 4GU5A 2CW5A 4F4DA 2CL0X 1U8YA 2P3QA 2G28A 3BSWA 1G8JA 4LWOA 3EVAA 4KR6A 1T0JB 4NS4A 5LJIA 2VT3A 5AYVA 4CMGA 1DJLA 2CHFA 2QTVB 4HFRA 4QYWA 1UK9A 1YQEA 2H07A 3JRWA 4A0HA 2J0QA 2FF7A 2JGDA 5EMNA 2Z57A 1KORA 4PNHA 3RIEA 3ZK9A 3KSMA 1JU3A 5FR2A 4D9EA 1NOJA 2H31A 2VDWB 3V00A 1JJFA 3GDFA 4MMYB 4QVIA 2OLJA 1R12A 1W30A 3WGZA 2VPXA 2F00A 4GR9A 4HB0A 2DKFA 5BMVB 3WYFA 4FEYA 4EY4A 1OX4B 4ZXPA 3HDJA 2CMHA 4NEQA 1NUAA 4DARA 2BP7A 4C29A 2H4XA 2YJGA 5KWJA 2PUFA 4IDEA 5JCJD 1JIIA 1JQJC 1ABBA 3TRIA 3D8NA 2JGIA 3IKJA 3Q3VA 1LW6E 4QDJA 4R7TA 5F4ZA 1OZAA 3AUJB 3JWJA 4L76A 3L82B 1MT0A 4Z2YA 1OR8A 3O9VA 5I6DA 1AQLA 2ZWPA 3EGWA 2O7SA 4ZO9A 5FV4A 4FS8A 2EIXA 3E8SA 2HI0A 2WZQA 3I30X 4I50A 3K9BA 3V9AA 5JJLA 4JJ4A 1CQXA 1Q16A 5DN6A 3D1JA 5K1ZA 3GFGA 3UM9A 4TM7A 5U4XA 5KSZA 1XL0A 2VCYA 1VPVA 3OLQA 2H59A 1H2YA 2EBHX 3C3PA 1E89A 4WNAA 1IHXA 3KXIA 3NALA 4E70A 4QLBA 2CV2A 3WDKA 1Z6PA 3HUDA 2H6EA 2VP4A 3T7EA 1JEAA 4TS9A 2ONJA 2PM8A 3IPAA 3PDJA 4JVNA 2GBPA 2RARA 4L2IB 4AFNA 1OFGA 5I4CA 4TTAA 4H4CA 3RARA 4DR1B 4CCAA 1KJWA 4AJIA 8ATCA 1AURA 2OZVA 1W96A 3U3MA 2FMHA 5AI4A 4YJGA 2GK3A 1IBKB 5CFOA 5BUQA 4DR7B 1W7AA 2HMUA 3RC2A 3RU3A 2FN8A 1R6DA 3AUKA 1C9NA 3GXOA 1DV1A 5IF3A 4D9HA 1YA8A 2GK4A 4HYQA 5E4TA 4W1SA 3RS2A 2OBXA 3EDQA 3QE3A 4TV8A 4IXTA 1IE3A 4O2RA 1OILA 4GPTA 4P36A 2H57A 1SBTA 2B69A 4JI8B 4RD3A 3KL4A 2R0QC 3PFFA 3K4QA 3EZXA 3OTQA 2HKIA 2PMBA 3LT1A 4ZTBA 3BH7A 3GO4A 3AOEC 3SYMA 3UB2A 4FMPA 1H1DA 1IZ9A 2V58A 3MMXA 2QVCA 1KYWA 1USWA 3LWBA 3SXUB 2DGDA 2EP8A 4PRLA 4TS1A 2PUEA 4EYOA 2XCIA 1PNRA 4S3MA 1Q7BA 4KDFA 3JY6A 1M6VA 1JP7A 1TU4A 4JBHA 4KIFA 4R6XA 3ICWA 4XGNA 1E2FA 2HHCA 4J16A 4ARAA 3MPUA 1GZVA 1FLVA 3ZQKA 1CZLA 4RD2A 4WKBA 4EA6A 3DOFA 2H16A 4JT8A 1M5TA 3Q9UA 3QU4A 4K6FA 3G68A 5DMHA 5JH7B 4HUQA 1G1AA 2W6QA 2XYVA 3U2QA 2XRMA 4TTPA 1QJ4A 1YQDA 4H0NA 3RRFA 2BSQA 3BGWA 1OU4A 1UFKA 1MKYA 1UXHA 2Q0XA 3VHLB 2GUWA 4PLHA 3VX4A 3WK4A 5LD2B 2JG3A 4ZODA 3CA8A 5HF9A 3S70A 2ZE7A 4M6WB 1ACJA 3NFRA 3AL2A 2YRXA 3NKVA 4FXPA 1BDMA 5J2UB 3RDPA 5EHXA 2FZ4A 3N9IA 1WZ2A 1PWHA 3WYEA 1WM1A 3DKRA 521PA 2LGJA 3QRWA 4LDJA 3BGDA 2C4MA 4O2AA 1KMHB 2O50A 1DMRA 2HSWA 5DSTA 1TT7A 1RC8A 1JHMA 3RVOA 2ZI7A 5EXDA 2Q9BA 5BXQC 4J1SA 4B6OA 1XRQA 5FUQA 4IOKA 1CB7A 3ZZNA 1ZY2A 4PX2A 4KSCA 4UOZA 1P1HA 4LRWA 2PL3A 1ZICA 1TGYA 2JFXA 3MPOA 1JYEA 1UJNA 4TXMA 4YDRA 1YRBA 2XUPA 3FZGA 3TZCA 5CDSA 1FJXA 3M4XA 1RE0A 2JI8A 1AQ6A 2WFAA 2X8BA 4QVKA 5BQOA 5FNVB 3PJRA 5GONA 3W06A 4E4TA 1I2MA 1E2PA 5A7FA 2IPMA 4HCJA 3O75A 1J22A 3LL4A 4LSZA 2WYVA 4JODA 2GETA 2ZWMA 4LJRA 4R0NA 3ASZA 3U09A 5LKRA 2X1MA 3CN9A 4FOOA 4P1ZA 3U6BA 2DPMA 2BR5A 4MRMB 2ZCUA 1ZGJA 1UBFA 4CF3A 3P0HA 5FWXA 5B55A 2ZSHA 4TTSA 5HNKA 3UPUA 2C3OA 4YAWA 3AUTA 1LLUA 3U4CA 4HK4A 1E2GA 5EJ7A 1XZEA 4F38A 2OHOA 3Q8LA 1U3VA 4QU8A 3GVXA 4Y30A 2BR4A 2O5VA 3Q1LA 3ZR4B 1FDVA 1DQSA 3VU9B 3NI2A 4BQIA 3SYLA 1G5HA 1W88B 3GLQA 3HFSA 3ZCQA 2DPYA 3JWIA 5MFZA 1SZCA 2QW0X 5HFAA 2BGWA 3L0CA 5L3ZA 1LF0A 2W98A 3BJZA 4AQYB 2AMLA 3IEXA 5CFQA 1J24A 1D2HA 4OIFA 4NBRA 6CHYA 1AC5A 1HORA 1RIFA 2NV2B 3TW8B 4OXIA 5THXA 2YHSA 3UWMA 2D06A 4LBZA 4LY3A 4ZV9A 4MJXA