4G4JA

Crystal structure of glucuronoyl esterase s213a mutant from sporotrichum thermophile in complex with methyl 4-o-methyl-beta-d-glucopyranuronate determined at 2.35 a resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
b'DTCSVSDNYPTVNSAKLPDPFTTASGEKVTTKDQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRVTVGSKSISFSASIRKPSGAGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSRGQGKFYDLFGRDHSAGSLTAWAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCARNGKGAFITGALVDRIALTIPQESGAGGAACWRISDQQKAAGANIQTAAQIITENPWFSRNFDPHVNSITSVPQDHHLLAALIVPRGLAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPNNMGFSLVGGHNHCQFPSSQNQDLNSYINYFLLGQGSPSGVEHSDVNVNVAEWAPWGAGAPTLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-O-methyl-glucuronoyl methylesterase
molecule tags Hydrolase
source organism Myceliophthora thermophila
publication title The structure of a novel glucuronoyl esterase from Myceliophthora thermophila gives new insights into its role as a potential biocatalyst.
pubmed doi rcsb
total genus 126
structure length 369
sequence length 369
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4jA00
3QBJA 2WJ3A 4EY6A 2I78A 5K3CA 3V1MA 5EFZA 4IH9A 3STWA 1XRPA 1MNQA 5K3FA 2JGEA 2QZPA 2OQIA 3HJUA 3G0IA 5DWDA 3CCBA 5D6OA 1QTRA 4BATA 1GZ7A 2I3ZA 2QKYA 1Q0ZA 1F6WA 2WFLB 5JAHA 2WIKA 5CH5A 4ZXFA 1MTZA 2ONCA 2CEKA 3IB3A 1UKAA 2GYVA 7YASA 4LXGA 2QVBA 1VE6A 2AJBA 2WIJA 2EDCA 2OCKA 4FKBA 1E8NA 5AK5A 4Q3LA 1E8DA 5ALGA 3FYUA 4ITVA 1QIGA 2WILA 4X6UA 3GA7A 4UBMA 3QYJA 1YASA 3G9XA 2ECFA 1JKMA 4GECA 1ODTC 1CUWA 2OGZA 1BCRA 1UKBA 1R88A 4HXGA 1QIIA 5EIEA 4FLFA 4NZZA 4EB0A 4BE4A 5K3DA 5I8PA 5JD4A 4MWTA 4CG2A 5HZGA 5LZ4A 2FJPA 4QWMA 1K5PA 5AKHA 5AM3A 4JYPA 1CPYA 4LIPD 3WWCA 5KBYA 4W63A 1JT2A 1VOTA 4D9JA 3WWPA 2OAGA 1CUZA 3W05A 3W9UA 2Y1KA 3WK5A 4AZ0A 1MPXA 4AMYA 3AIKA 4AB1A 2OQVA 1E5TA 2IITA 3IVMA 4F5ZA 4CCYB 2V96A 3IUJA 4ZV7A 2HRRA 3QPCA 1WB4A 3I6MA 3PFBA 1XZMA 2XUIA 4ARBA 4BVLA 4Q34A 5AO9A 5AIBA 3HACA 5ALNA 2XMBA 3LP5A 3EQ7A 2Z8ZA 2VEOA 5AICA 3PI6A 4AMZA 1FFEA 5KWJA 1GXSA 2VSQA 5DNWA 3D59A 3IIIA 2OPHA 1HQDA 4OU5A 3R3WA 1UK6A 2Y2UA 3I6ZA 2R8BA 4UHEA 1DX4A 1YA4A 2B61A 1M33A 4IQ4A 3JYHA 1ZD3A 4TGLA 5JATA 3SX4A 2XDWA 4B83A 3TJMA 1LBTA 4FBMA 1DT3A 2HU8A 4FHZA 5FOQA 4BDTA 3I1YA 5FP0A 1VA4A 3QITA 4J7AA 2WU4A 3DOHA 5A7HA 1ZI8A 2B9VA 3A2NA 2XE4A 1ZD4A 4H7KA 2VQ6A 1MAAA 1SC9A 1H2WA 5ALYA 1NU8A 2WSLA 3QVMA 5ALOA 1W6RA 5AOBA 1J1IA 4X97A 1DWQA 3E1GA 3HLKA 1GPNA 2VTVA 2QJWA 1FFDA 1WOMA 1UOOA 1DQYA 4BVJA 3WQHA 4HZGA 1ORVA 3WK9A 4MEAA 3ESAA 2NW6A 5A71A 4QDUA 1LPSA 1QGED 1JI3A 5A2GA 1ZGBA 4H35A 5IVKA 1HDEA 3R3ZA 5CXUA 3VDXA 1H2ZA 3C5VA 1K63A 1XQXA 5ALXA 3PUIA 3F8SA 4UFNA 1EHYA 2I3DA 1ZGCA 4K6GA 5AIAA 3H1AA 5IKXA 4E46A 4DNQA 3R0VA 1Q83A 3D5EA 3WA6A 1T4MA 3A6ZA 2BGRA 3FBWA 4HXFB 4IH4A 3O0DA 5DYWA 1Z68A 3HXKA 4AO7A 1E66A 3IURA 1CVLA 3KWJA 1ZIXA 1HPLA 4OUKX 3FSGA 5LKAA 1UK7A 3IA2A 2GBFA 2EDAA 4TPKA 1EH5A 1CLEA 3L1HA 3ILSA 5K3EA 4NS4A 2AXEA 3DL4A 1XRNA 3G7NA 3G9ZA 1EDDA 3AZOA 3WYDA 1DWOA 2GBCA 1ACJA 3O4GA 4UHDA 5BV7A 3OURA 2V98A 2WUDA 4Z49A 1A8UA 1H2XA 4PO3X 4OD0A 4KAFA 1KU6A 1LBSA 1GGVA 2XUFA 2P8SA 5AJHA 3B3QA 1EK1A 2IX9A 3C43A 4MYSA 5D3ZA 4EZIA 1SCIA 3H2KA 2CUTA 4BAUA 1U8EA 2ES4A 3C8DA 4HXEB 4F21A 5JD5A 3DLTA 2O2GA 5C8ZA 2PBLA 3G9TA 3OTQA 1LPNA 5JADA 5AH0A 5AKXA 4GEGA 1DX6A 5T4HA 4OB8A 2HFKA 1X2BA 4J0CA 1QO7A 4H18A 4BZWA 1CEXA 1F0NA 1EDEA 4X00A 2XT0A 4LYEA 5CT8A 4Y2JA 1XZIA 4X71A 1NU6A 4CG1A 3IDAA 2B20A 3D2BA 4I3FA 1THTA 5AI8A 5SYMA 3H2HA 3H04A 3RARA 2CZQA 3WJ2A 4W1PA 4PF1A 5CMLA 4LYDA 3DEAA 1XZKA 4O08A 2HM7A 1E3QA 5DLPA 1MO2A 5I9IA 3V48A 2HFJA 2VATA 1R9NA 3H18A 3DOIA 4LXHA 1WPRA 2YASA 3A2MA 2PL5A 1CUVA 2QUBA 5HK8A 5HQ3A 3EQ8A 5IVDA 1VE7A 1CR6A 4H7IA 1ZIYA 1C4XA 3PDCA 2QMQA 2XUPA 3G0BA 3KDAA 3WL5A 2PU5A 5BWCA 3F97A 2BUBA 3C6ZA 4IO0A 1R9MA 3EBLA 4P93A 4C4ZA 5HCUA 3VXKA 4LKOA 5EI5A 4G1FA 3E4DA 2DHDA 1UFOA 4WFJA 2XQJA 4C4XA 5KWIA 1T2NA 2WG1A 4I19A 5HF9A 1K4YA 3I1IA 4G8BA 2BUCA 3R40A 1MU0A 4YPVA 1NX9A 5C7YA 1P0IA 5E4YA 1J2EA 5JIBA 5AOCA 3WWDA 4BCBA 4IHAA 2WIGA 1IZ8A 3RM3A 4J0JA 4WY5A 1TRHA 1QO9A 3ZLTA 1EVQA 4KR0A 1YS2X 4YASA 2XUGA 1A8SA 4X94A 4MWSA 4QDZA 4QDXA 4H0CA 2D5LA 2DR0A 5LKRA 2C5GA 1C7JA 2PUJA 4X7BA 5EHXA 2HA0A 1UOPA 1SOMA 2VJDA 1GKLA 2JBWA 1VJ5A 1B41A 2UZ0A 4Y9SA 1CUYA 3ZPXA 3FAKA 4XJVA 1JJIA 1VXOA 4KYVA 1YR2A 3N0TA 3GBSA 1JJBA 4RE5A 2B4KA 1BN7A 3CXUA 4QEKA 3I28A 3GFFA 3ICVA 2JEZA 3FLAA 5ALIA 3O95A 4WFKA 2WG0A 3UMJA 4G9GA 4JYMA 2JEYA 4ZGBA 3H2IA 2XMQA 4K6HA 3QMVA 2C4HA 3C45A 2XMDA 3KSRA 4PW0A 2CBGA 1CUDA 5AKYA 4DM7A 4X6YA 4CG3A 3BDVA 4GBGA 4WFIA 2C58A 1YB7A 5AOAA 5HKBA 1TQHA 5CW2A 1XRMA 5BOVA 3R3YA 1RYYA 4PSUA 2XMGA 3FNBA 2O2HA 5FPPA 3A2LA 5EIHA 2GYWA 1Y7IA 3H1BA 2EEPA 5EGNA 3STUA 2DHEA 4EY7A 1MNAA 4FLMA 1ISPA 2HL6A 2DQYA 3Q0TA 4KAAA 2CB9A 4G5XA 1XZEA 1CUFA 1XROA 4K6KA 2HA5A 3V1KA 1Q84A 2X8BA 3WA7A 1TKRA 4FWBA 2VT6A 3STTA 3V1NA 1DT5A 2JGKA 2WFLA 1ZI9A 1IMJA 5ALSA 1FFCA 3F96A 4EBBA 2QXTA 2DCMA 5DJ5A 2XMCA 5AKKA 3I2FA 4MYDA 5K3FB 2H9YA 2V97A 4JUIA 4OSEA 5ESRA 4G4IA 2IIVA 3KXPA 3WK6A 4RNCA 5I7UA 1OILA 4XWGA 3HRHA 1P0PA 2I03A 1YSCA 3S8YA 2ROQA 2DQZA 2XUOA 4X93A 5FKJA 3VJKA 3WKCA 4BP8A 1QIMA 4MJ3A 1WPXA 4W9RA 1QLWA 4XX1A 1XLVA 4GDMA 5LZ5A 3ANTA 2WU3A 4FFWA 4QLAA 5SYNA 2YYSA 2R11A 3QZUA 2BUAA 2WIFA 2YXPX 3UUFA 3FLBA 3AZQA 5AM5A 1USWA 5JASA 1O6GA 4DSAA 1UXOA 2ACEA 4F0JA 1WCYA 4X95A 1XZJA 4PNZA 4QWWA 5ALWA 3FOBA 4V2IA 2VA9A 2FUKA 4H7EA 1ETHA 4N8DA 3ZWQA 5AI6A 3FLEA 2GBIA 3S2ZA 5K3AA 1AZWA 4WDQA 2PM8A 4Y7DA 5DTIA 4C4YA 2QM0A 4N8EA 3G8YA 1EVEA 4DLNA 5JAPA 4Y2YA 1VA5A 4NVRA 4B84A 1YCDA 2ZYIA 3CN9A 4GW3A 4DYHA 1MJ5A 3EIOA 4ROTA 5CT4A 1SFRA 1CUHA 2Y6UA 3IUQA 1J06A 2WUEA 2WHQA 3FVRA 3DDUA 3WI7A 3X3HA 1PFQA 2J4FA 2LIPA 1IZ7A 3WL7A 1XZFA 3GUUA 1CQZA 4QDTA 2X5XA 4PSDA 2HU7A 2JGLA 4WJLA 4UBOA 4Q82A 5JALA 4HRXA 4AZ3A 1I6WA 4Q05A 2HA7A 1MN6A 3VJLA 2WTNA 5CURA 4J0KA 4M0EA 2XUKA 4OYLA 1JU4A 1XQYA 1BU8A 5K5EA 4UBLA 3M3DA 5CT5A 2BFNA 3MGAA 1ODCA 5CH3A 1UZAA 2YH2A 4YX9A 2HU5A 5IH7A 1N5MA 5JAOA 2G5TA 4EY8A 1CUXA 3AFIA 4KRXA 1A8QA 2WHRA 1U65A 1BEEA 1CIJA 4Y2SA 5EIAA 4H77A 4B6GA 2ZJ7A 1LGYA 2XUHA 3FYTA 1X70A 4G4GA 5KREA 1YS1X 1QOZA 3BXPA 4BDSA 3WK7A 4U2DA 3WWOA 1SCKA 3VVMA 3WLAA 2WHPB 3WKEA 3O4IA 1JMKC 3M82A 4B9EA 2OCGA 3ZI7A 2ZJFA 2XMRA 2PPLA 4BAZA 3CCCA 3QMWA 1TIBA 3I2KA 4DMCA 2PSJA 4X3CA 2HA4A 1EINA 1LPBB 4B82A 5HQ3B 2O7RA 4U2CA 2H7CA 4H7FA 3IULA 4OCZA 1WHTA 5D7BA 4BZZA 3LIPA 2XQFA 3ESBA 1GT6A 1G66A 2RHTA 1G5FA 2ZSIA 1ZI6A 4OPMA 4X92A 4A5SA 3TRDA 2VAVA 5J3JA 3AILA 4OU4A 2BKLA 3ESDA 3C87A 4P92A 3DS8A 3N2ZB 1XRQA 1MX1A 5AI5A 1QFSA 1ORWA 5F4ZA 2HIHA 3SWWA 1IUPA 4OB6A 2QXUA 2OGTA 4BVKA 2ZVDA 4AQDA 2OAEA 4FTWA 3WMRA 4E15A 1QE3A 5JANA 2BJHA 4BCDA 3D0KA 1QZ3A 5LZ8A 3VJMA 3WK4A 5HKAA 5LIPA 1B6GA 5E2IA 3IUNA 4S0XA 4KE9A 3NUZA 2JGJA 5FDFA 1BRTA 2ACKA 5AM4A 1XZDA 4ETWA 5AHXA 4HVTA 1HLGA 3PICA 1EI9A 4CIBA 1EB8A 4PSCA 2PU7A 2RIPA 3P2MA 2WFMA 3O9MA 4YK7A 3B5EA 5AK3A 3A70A 3WKBA 4C89A 4INZA 3HSSA 4UFOA 1VZ3A 1CRLA 2RI6A 2G63A 3BL8A 4KJXA 3YASA 4U2EA 1TAHA 3TGLA 3STVA 4FFVA 4Q3KA 1F8UA 4QZVA 3I2IA 1WM1A 1QJ4A 5JYCA 5ALUA 5AKJA 4UHFA 3WZMA 1YAJA 3QM1A 1LPPA 5AKLA 2Z3WA 2FJ0A 4B81A 1LPMA 3T52A 3BJMA 5A62A 1E8MA 2OCIA 5LZ7A 4W1QA 4ZV9A 4CCWA 4X85A 2JIDA 2CKMA 3VVLA 3OC0A 2C7BA 4BYMA 4BC0A 1H22A 1UWCA 4RPCA 2XUAA 1BROA 4BBZA 1OCEA 1RP1A 1AURA 5A7GA 2GBGA 3LLCA 5A7FA 4UHCA 1R3DA 1EDBA 1MT3A 1THGA 4GLBA 2G5PA 1XFDA 5LP1A 4B9AA 3HABA 1FFBA 3AZPA 3BJRA 4CIAA 1L7QA 2QS9A 1QTIA 1Y37A 1XQVA 5AKGA 5DNUA 2C0QA 1UOQA 4M0FA 5EHZA 4P08A 4EY4A 2HDWA 1Y7HA 2OCLA 4U2BA 4QE3A 1QIFA 2W6CX 4UBJA 4GXNA 5FV4A 1GPKA 4F60A 4BCCA 5JZSA 2J3QA 2PSHA 3BDIA 2K2QB 1DQZA 3PF8A 4DIUA 1XZHA 3H0CA 5ALHA 3TEJA 1JMYA 1WB6A 4DTCA 3R3VA 5C8VA 2GYUA 5AM1A 4G8CA 4HAIA 1JJFA 1EX9A 3BIXA 2ZYSA 5AI4A 5JAUA 3QPDA 4Y2UA 3G0DA 1BEZA 3H2JA 2ORYA 5CXXA 5A6VA 2BAGA 2Z3ZA 1WB5A 4GWLA 1LZKA 4ZWNA 4E11A 5HK9A 2WHPA 2VJBA 4QLOA 5FXMA 2C0PA 1VZ2A 2HHAA 1YAHA 2VF2A 4PV7A 1PJAA 4EA6A 3RLIA 4G9EA 3DQZA 4DSZA 5CTAA 4HS9A 5HF8A 2ZSHA 4FBLA 1CUIA 1W4LA 4BP9A 5EHQA 2JGFA 4G8DA 3STXA 4AO6A 3ESCA 3T4UA 4UPDA 1YA8A 4DMFA 2XLCA 2GZRA 1GKKA 5LLSA 2VAXA 5DYTA 4I4CA 4J3JA 5JZBA 3DNMA 3FYUC 3GELA 4FNGA 2XLBA 4J0DA 3WL6A 4UHHA 5C81A 3IUMA 1QIJA 2Q0XA 3EQ9A 4FLEA 4KAJA 4XVCA 2WQZA 2HADA 4BC1A 3D2AA 3H17A 3JW8A 3WIBA 1GQRA 3C8HA 3V9AA 4DGQA 3H19A 3D3NA 1UK9A 1AC5A 4LXIA 2WLSA 1MAHA 4W1SA 1N8SA 1XRRA 1MX5A 3NOXA 4MQMA 2OGSA 3K9BA 4A16A 1W75A 2JGIA 5HF5A 4DNFA 3HZOA 4CFSA 2H7XA 1EA5A 1EXWA 1ACLA 3Q8WA 2WKWA 4GI1A 4LHEA 2WG2A 4J0GA 5E4JA 1ZICA 1WHSA 4TVKA 3R41A 2PX6A 3V1LA 4L3WA 3VKFA 2ZYHA 2DSNA 4B85A 5CBKA 4Y2RA 4DMHA 4B0OA 4EHBA 4B0PA 1EK2A 4G4JA 4C87A 5E4TA 4WDRA 5AM0A 5FLKA 2HA3A 1K6EA 1KU0A 3U0VA 4RGYA 1CUBA 2Z5GA 1C7IA 3C6YA 3AIMA 1QIKA 3LS2A 1XZGA 4ZREA 2DFPA 4C01A 3OG9A 5CT6A 1OXMA 3AIOA 1J07A 3O4HA 4X91A 5D3KA 1VKHA 4OYYA 3C6XA 1ZOIA 2CMFA 1A7UA 2O7VA 1XKTA 3QPAA 5JARA 4K2AA 2XB6A 4BE9A 2PUHA 1QONA 3D4LA 1D07A 1AQLA 1YB6A 3UUEA 3FCYA 4L72A 4EY5A 2PSFA 4UBIA 1LZLA 1SCQA 1ZD5A 5ALFA 4DMKA 3I6YA 4FNMA 1O6FA 4JH0A 1FFAA 1VXRA 2PVSA 5YASA 3KWFA 3MVEA 5LZ2A 2X76A 3M83A 2WFZA 4HTAA 2RHWA 1W76A 3WK8A 4X90A 5ALEA 1HL7A 3F98A 1QIDA 2ZYRA 4M0MA 5AK4A 3F67A 3FWHA 5ALLA 1QIHA 3L1IA 1MX9A 2FX5A 2Y6VA 2J3DA 1DINA 1HKHA 4AN0A 1G4HA 3PUHA 2C5FA 1XQWA 4AN1A 1LNSA 1H2YA 2RAUA 2OXEA 5H3HA 3G0GA 5AKIA 1QFMA 3HI4A 1VLQA 1TCBA 2RONA 1BE0A 4J03A 4E14A 4CI9A 5T4EA 1LPAB 3QH4A 3DKRA 3E0XA 4J0IA 4KE8A 1DWPA 4NMWA 1EB9A 1TCAA 2VJAA 2H7YA 1GQSA 1XZCA 3ICWA 5AP9A 5ALZA 2Z8XA 3KOOA 3G0CA 1ZJ5A 3U1TA 3WZLA 4BB0A 4ZI5A 1ZJ4A 3NWOA 5AK6A 1CUJA 2WUGA 1RWQA 3E3AA 2AJDA 2PSEA 1FSSA 4KRYA 1XLWA 1E89A 3EF3A 5FUMA 2HA6A 3H2GA 1A88A 1N5RA 2WJ6A 3R3XA 3DL7A 4B7ZA 1UKCA 3C6BA 4BTVA 3BF8A 3DYIA 5CRIA 4N5HX 1G42A 1N1MA 4QDOA 4Y2XA 3OOSA 5IVIA 5T4BA 2XQGA 6YASA 3G02A 4FOLA 1DU4A 1XZBA 1KEZA 2XQKA 3DKKA 4BRZA 4H7DA 2QUAA 1CUSA 1UT6A 1ODSA 2QT9A 5HF6A 3IBTA 5CT9A 3KD2A 1IVYA 4JNCA 2WTMA 1L7RA 4PQEA 2JF0A 2RGUA 3WWEA 4EUSA 4A23A 3DD5A 1H23A 3BF7A 3ZLUA 1CUCA 3QMMA 3ZLVA 1AKNA 3AUKA 3D2CA 3FSGD 1AUOA 2BGNA 2E3JA 3BWXA 5AKEA 4N5IX 1XZLA 4MQLA 1BCSA 3LIIA 3HEAA 5HFAA 4L9AA 1AX9A 1R4ZA 5ALJA 5ALVA 5ALKA 4L0CA 5ALTA 4JEIA 3RKSA 1HBJA 2D0DA 2ZJ6A 3SK0A 4P9NA 5DNVA 4N8SA 5ALRA 2OG1A 2H1IA 4X6XA 3W06A 1TK3A 1PV1A 3PF9A 3JWEA 1S8OA 4H7HA 2DHCA 3CN7A 4IH1A 2QRUA 4UHBA 3FVTA 2XUJA 3BIWA 4KEAA 4QNNA 2V9ZA 5ALMA 5BWBA 1R1DA 5JZ9A 1IUNA 3M81A 4AX4A 4Y2TA 3AJAA 1AMNA 4K5QA 5DTJA 1XKLA 3WKDA 1XLUA 3W9BA 2QJRA 2W22A 4RE6A 4KE7A 3G9UA 5HFNA 1UK8A 4KE6A 5FRDA 4Y2QA 4WCVA 1CFJA 3WIOA 2WUFA 5C8XA 4UBNA 1AGYA 2XMZA 1BN6A 1L7AA 3C5WP 3HC7A 4B80A 5JD6A 2XUDA 3RK4A 1CUAA 4OB7A 1DTEA 1CUEA 2HA2A 1U4NA 4DNPA 3MUNA 3WYNA 5ISMA 3LCRA 2HRQA 2QR5A 3DJYA 2Y2VA 3ZV7A 1P0MA 5ALQA 3WJ1A 5LYYA 2XI4A 3FYUB 3O4JA 1GPLA 4UUQA 4C6HA 3AINA 3PE6A 4KACA 3K2IA 3BE8A 4HRYA 2OLEA 2WIDA 4Y2VA 4GHWA 1R50A 2JGMA 2QTBA 3FCXA 1X2EA 4BTLA 5IVHA 1CUGA 3I2JA 3VISA 5AI9A 4CCYA 1BS9A 4H7JA 4UBKA 1LPOA 2XQIA 4C88A 4MXDA 4ARAA 4Q3OA 2PKYX 2VJCA 4W1RA 3R3UA 2VT7A 4BAGA 3I2GA 4MEBA 2PSDA 3WKAA 3ANSA 3OPMA 1F0PA 3I2HA 5FPQA 2J4CA 4FMPA 4QA9A 4BRSA 1FJ2A 3W2TA 3WL8A 5CH8A 5AM2A 1LLFA 3PFCA 4XIIA 3DCNA 1CV2A 3OM8A 4DNOA 3O9VA 3C70A 1JFRA 4UFPA 3W04A 1P0QA 1CQWA 5LZ9A 1JU3A 4AO8A 1K8QA 1Q0RA 1TCCA 3DYVA 4FDMA 5AI0A 2AJLI 3SC2A 1QIEA 4J0HA 5T4FA 2CJPA 2BCEA 3GZJA 4U2GA 3L1JA 3HYSA 3STYA 3B12A 1IUOA 2O2IA 1CUUA 1XRLA 3MUOA 2XMSA 5DYYA 1XZAA 5EHNA 3D7RA 1W1IA 4U2FA 2WM2A 4Q1VA 2XUQA 5ALPA 3F9CA 4Y2PA 2G4LA 4AXBA 2GZSA 5K3BA 5ALDA 4WY8A 5AKZA 1W52X 1U2EA 2AJCA 1ZD2P 3K6KA 4ZRDA 3NGMA 3GROA 3ED1A 2AJ8A 2QOEA 2WJ4A
chains in the Genus database with same CATH superfamily
4EF4A 2FZCA 1UF9A 1ZISA 2NUPA 1CF9A 4X65B 1TTTA 2CXHA 3CZRA 3A4TA 1CZHA 5JEDA 5JNUA 1VSUA 2CVHA 3ER6A 3KQPA 1FFYA 1EUCB 4N54A 4F6RA 1QPZA 1WDWB 4WY2A 1DJMA 4IH9A 1C9EA 1PLKA 1OWPA 1DSSG 2CLCX 2RGWA 4H4EA 4KRGA 3SS9X 2UYOA 1GXSB 3A1VA 1SUCA 3F4KA 1XRPA 2XGSA 1V48A 5L4SA 5TEVA 3IUPA 3S2EA 5K3FA 4ESHA 1C8LA 2G3YA 1A0OA 3LSYA 2GEVA 1NM5C 2Q9UA 4URFA 3ZVNA 3GXBA 3KZXA 3CCBA 2ENUA 1QTRA 2DBVO 1NE2A 2FU5C 4AJLA 1GZ7A 1N34B 3H9QA 5EUCA 1G20A 4DCOA 2HD4A 3P2JA 1JXQA 1WBJB 2QKYA 3P4UA 3QRWA 1F6WA 2ZK7A 4ND8A 2WIKA 4HAOA 5BORA 2P2LA 3B7GA 5M5BA 1QAOA 3M5DA 2VP5A 1H66A 1RIFA 1JL3A 1Z12A 4CKXA 2Y27A 2BDUA 4AUMA 3BB3A 2BD0A 1P3Y1 1NVGA 1MTZA 3QNMA 4HQ6A 4FN5A 1KGSA 1QFJA 2Q3MA 2PZAA 1JIKA 1P2SA 2I8LA 3HYCA 4RANA 1RT9A 3V9PA 4ZANA 2G04A 4ZYWA 1QXSA 3K71B 3CBGA 3H0KA 1SD2A 1G6KA 1W0JD 1RWVA 3H5AA 3PYMA 4GSKA 5DF1A 3VDNB 1VB5A 2JIOA 1JIXA 2WIJA 3RADC 3KOUA 4PINA 1P7YA 1XF9A 2OCKA 2QVYX 4FKBA 1T9GS 4UAVA 2ZRLA 1G3UA 2R25B 4X20B 3I12A 1LH0A 3BRWD 3LWDA 1MFZA 1ZXBA 4R2JA 3FYUA 4ITVA 5ALGA 5E1BA 5K8VA 3B53X 1FDVA 5IN5A 3AF6A 4K1XA 4QPCA 4DLZA 2DBYA 4RVOA 1MZVA 1AV7A 1Z5ZA 2ADMA 2PZBA 3E9NA 4M55A 3ROZA 3UH1A 1DRJA 3G9XA 2CSUA 3P1JA 1L4YA 2ECFA 2IHKA 1U7ZA 3HUEA 4GECA 4RLFA 5DT9A 3WGGA 4EDFA 1AKWA 2R5NA 3KJNA 3PX3A 1VJCA 1HNNA 2V7QA 3X1KA 4D56A 4OJKA 3F3SA 5B4VA 4FLFA 2AN5A 1MB4A 4EK9A 1IXYA 1CFZA 1C9JA 5KOHB 4YDSA 5K3DA 4AQ7A 4RDXA 3R5SA 3QEJA 5AVRA 2F43A 3D5QA 3JQFC 4G37A 3GBPA 4P31A 5KEIA 4CG2A 4TV8B 3GG9A 3GH3A 3I5AA 3IIKA 3QJYA 4WNYA 1LTHR 2XBLA 2H5LA 3SZMA 3A4MA 4TWAA 1F8FA 1CEYA 4YWHA 4A8TA 4CV0A 1RHQA 4RPJA 1KYIA 1ZK4A 1XTBA 5I4IA 4CDGA 2IQ5A 2B1IA 4CKCA 4WGFA 5KBYA 5KTSA 4NU6A 1K75A 1L5GB 4BQPA 3HYNA 4BU0A 3BRCA 4R84A 4EQ6A 3I9FA 2AG5A 1H4VB 3WWPA 1AG9A 1CUZA 2VHTA 3TL6A 1JQJC 4QBTA 3AIKA 1R4MA 4A7PA 1O58A 2IYNA 3NHSA 3GJQA 1N0WA 2IL1A 2V5UA 4EAQA 1L3CA 4RD4A 5FJJA 4ZZ0A 2FX3A 3KEFA 1ECFA 3MB8A 4F5ZA 1KWGA 3HRIA 2V96A 3IUJA 2CUNA 5B57C 3OJCA 2XKAA 3W1EA 1TRKA 4A3SA 4C3VA 3DLIA 4KMRA 3PFBA 5I7FA 1GTVA 1DQSA 1HETA 2IEAA 4ZC8A 3WLFA 1RS0A 4HGRA 4OFWA 1EX1A 4X3OA 1ELOA 2OORA 1V95A 4TQUS 1P44A 4W99A 2XGGA 5AIBA 3QU2A 3V34A 4JJGA 1C7EA 4PAGA 2ZJZA 2QUZA 5LB2A 4RJ2A 4UATA 1Z7BA 2DM6A 1ONNA 1F9EA 2RG7A 2YTZA 3I5XA 4KN5A 5CVJA 1U8XX 4HVLA 5DASA 3DZGA 4LOIA 2AFIA 2BFBB 2LIVA 3OO1A 4JI8B 4ER3A 4NDZA 1CE8A 1B93A 3VTZA 1MVLA 3KM0A 3QUQA 1FVXA 2QUKA 1U4OA 4TS3A 5KWJA 1KYQA 2FUEA 2H11A 2Q0QA 5KAMA 3R3JA 3EUEA 3TIGA 2ZB2A 3ZIAA 4YAFA 4F5EA 2JHPA 1U7UA 4CHTA 4ZAGA 3DO5A 5DNWA 1KYYA 1VHQA 5BNTA 5TF4A 3CLTD 4XLLA 5FA8A 2NTVA 2X0IA 1H0RA 1NI3A 1VGQA 4JDUA 3ID6C 1V2HE 4PLCA 1T0IA 1G60A 1J8YF 1HQDA 2JK0A 4OBEA 4QASA 5D3MB 1XMOB 4KXVA 3ZI4A 2P1DA 3R0QA 5CA1A 3E4CA 2HQRA 1AKUA 4TYMA 2ONKA 3UMBA 3UMYA 1DX4A 2C9OA 2B61A 2ZYTX 5KVQA 3UG7A 1LRLA 4IQ4A 5JRZA 3JYHA 4FE7A 3W9SA 3BGWA 1Q0LA 3SX4A 4EF5A 2X2EA 3N75A 4E5MA 1XHLA 4QBIA 4BVAA 4H27A 4KPGA 4RJJA 4CGZA 5C4MA 4AP6A 4DBZA 3RYTC 1TQ8A 3B9QA 4FHZA 1CDOA 5BY2A 4REQB 2JIQA 3LFHA 4M9QA 1SVNA 4BNDA 2VXCA 3F90A 4QOHA 4DLSA 5LWQA 3A1SA 2AKEA 2BF4A 4C3ZA 2EJWA 5K6RA 4QYXA 2H2GA 4CG0A 4G97A 1V5GA 1SVLA 2VSOA 3I5MA 3AQ4A 1KMQA 2YICA 3EW9A 3PUVA 4UJ3A 4GP9A 4L73A 2YL2A 1DRVA 5GV7A 1EFLA 3D8BA 1FEZA 1EG2A 4XFJA 2D74A 2F6RA 2B9VA 3RS4A 1U0RA 3LYLA 5A4KA 5IZCA 2ZSAA 1EDZA 3FI9A 2FFAA 2VQ6A 2WSSA 1MAAA 1XD2B 4O2AB 2RGDA 1SC9A 2CD9A 4HUQA 4OHUA 2POQX 2QRGA 3OFNA 2NVUA 2HJRA 2CFSA 1GLNA 1OQAA 1A9ZA 2XNHA 4UW9A 1W6RA 5THQA 2X5JO 3W1WA 4E3ZA 5AOBA 3Q3GE 4DQUA 4CEHB 4J7XA 2EJVA 4A8JA 4ZRNA 3DFKA 3SP1A 1DWQA 3EE6A 1YQUA 1R0WA 2RH4A 1M67A 1H1DA 4XR9A 3ZZTA 3FPGA 4C07A 4UQLA 5K6TA 1G6OA 3QLVC 4BZPA 2VTVA 3LNCA 4PTYA 3MSCA 1DQYA 3A6EA 4CM9D 3R7DA 3LVFO 3RIXA 4OP1A 1VE5A 1MJFA 2ODWA 1T3LA 5DLEA 2LR0A 2YXBA 1WO8A 1UC4B 5WRFA 4B3TB 1YZFA 3VNUA 3ZR4B 3K7EA 3C3EA 3NBKA 4J7UA 3VH1A 5KHAA 2ARKA 1UBLS 3LLMA 4GOXA 4MVJI 6CHYA 3IO5A 1G5PA 4QDUA 4DDHA 2XNKA 1NAIA 1QGED 3HL4A 4B3SB 4BLPA 3SZRA 1U0LA 2O2CA 2FI1A 1XVAA 3H97A 3L0OA 1N2IA 4H35A 5TEWA 2OYSA 3R3ZA 3PNQA 1U3UA 1D2EA 4ONEA 5CXUA 3LBAA 3VZQA 4NP6A 4KO8A 1CD5A 1IBCA 3GG2A 3CZQA 1ENPA 5I3ZA 4YHBA 4TYWA 4W7SA 1YQGA 1XQXA 2ZIGA 3FCSB 1LEHA 4C20A 4YYZA 1IY0A 4F3RA 3THXA 1V1RA 2CHQA 4PWZA 5A1JA 4R2KA 3I9NA 1GOTA 3L5KA 3PUIA 1PX2A 1EHYA 2I3DA 3TI7A 5KYXA 2KLBA 1QZUA 1NF9A 1XYYA 3L41A 4C04A 1N0VC 5B3KA 4GPBA 3D4PA 1D4AA 3II6X 1DUVG 1X1BA 1JG1A 3DVSX 3L8YA 2Y99A 4R8RA 4IWXA 3ZZUA 4BQFA 3BSFA 1ZIPA 1QWSA 2BFPA 4E46A 5JPDA 4IHKA 2LDBA 1CR0A 5DTMA 3A04A 3DBVO 4V1CI 5H80A 4KHZA 5TS3A 4H08A 4MMZB 4DMGA 3D5EA 5C1PA 2Y93A 3A6ZA 3W0LB 2VNJA 5KUTA 1I5RA 4BNVA 4RTKA 3O0DA 3TK1A 4P5PA 1VGRA 1KEEB 2P9EA 2AMFA 5CGZA 5DYWA 1IUKA 1W30A 1Y7LA 5HDQA 1R0RE 1E66A 5FEUA 1Z5VA 4R9VA 2J07A 1DCKA 3BFPA 3IO3A 4V3BA 2OORC 4URUR 4X1YB 1CS4C 3FSGA 1JAHA 2D1FA 3OUUA 1ZZEA 3CLTC 1I0LA 2W2VA 4BJHB 1XALA 3A9VA 4C4PA 1IPEA 3L8EA 1YJBA 1PVOA 3RJZA 1X42A 3LOQA 1Z5GA 5JLAA 2GBFA 4DA7A 1U9ZA 4QJ4A 5B1YA 2J3MA 2IEGA 2VP4A 2PD3A 4TPKA 5JQGA 2QLTA 3QELA 1LQ2A 4GOLD 1XWIA 2DFNA 3DO6A 3DKVA 3GJ5A 4TL9A 4BLSA 2EKDA 1IXZA 3UFXA 1ENZA 1Q0SA 4NS4A 3FJ1A 4R81A 4PYJA 4TKZA 3UMGA 1RZ3A 3KYDB 3A6PC 2EARA 1GARA 1EFUA 1M1YB 2ZJBA 3AZOA 5A0FA 1P4AA 1DWOA 4BBAA 3ZCXA 2JJ2D 2RHDA 1ACJA 3HB5X 5CNMA 3DE2X 2XTNA 2O8VA 3RB8A 4YFVA 2VYNA 5PGMA 3HYLA 1MXHA 2CHVA 1M0EA 2EAUA 3K5HA 3P9QA 4MKZA 3SFZA 1C2TA 2D7CA 3QKIA 3QPVA 4YJHB 1A8UA 3WFZA 5CDHA 5BUSA 2XTMA 3CPJB 1OF1A 4LI3X 2BLLA 3KKKA 2NO1A 4IMRA 5GPBA 3QBVA 2QUHA 3QOWA 4TXJA 2AI3A 5F21A 1B8PA 3S2IA 2O0HA 2O6HA 3T3HA 3PL1A 1AQYA 1G3MA 2W6ID 4C5BA 2J3EA 5AJHA 3IV6A 2ZZKA 4UREA 1CQIB 2AKYA 3S6JA 4C5CA 1WZUA 4MYSA 1TCVA 2QZJA 2VBCA 3O8NA 4EZIA 1SCIA 3H2KA 5EMMA 4EB3A 3OBBA 4GBED 4YV0A 2ES4A 3SPXA 1RR6A 5DNDA 3EUWA 3LXRA 1YMUA 4XIYA 3BBPA 4HXEB 3B52X 1GDHA 1LB1B 2BHNA 2HPVA 2F1OA 2O2GA 2OZLB 3KHSA 5E9WA 3ZNNA 5C8ZA 1EVIA 3G9TA 3WLRA 4BP1A 3HO6A 3DXXA 3OTQA 3TR5A 5CB0A 1Y8QB 4AICA 2FK7A 3OE4A 4HNQA 1CNEA 3QXSA 4V39A 5JADA 1SHKA 3V8BA 5EXXA 4GEGA 3ZUPA 2RHGB 4Y1GA 1Z6QA 2P5TB 2C5AA 3AOGA 4IP0A 2BI7A 4BJ3A 2HFKA 2O2EA 3L06A 3L93A 5LVAA 3PFHA 4JBXA 4N39A 4DQ0A 4DDTA 1OFUA 2HWXA 3CEPB 1FLDA 1EBFA 1FY2A 2LGJA 1CEXA 4U0JA 5LMCA 2HLNA 2E5LB 1EDEA 3WMGA 2F8TA 3N76A 1U0GA 4Y2JA 4X71A 1VPWA 3HCOA 4DQVA 5JJKA 4J1TC 4OQYA 4C4AA 5LQAA 2XZLA 2PDAA 2Q0HA 4A0GA 5EJEA 4DCTA 5TQ0B 3U5ZB 1RXEA 2Z4RA 1E1YA 1U5AA 2GZMA 2QTCA 5CLLA 4PGAA 5IYZA 2GM9A 4O4IA 4HTFA 2YJZA 3H2HA 3N1UA 3GOHA 3H04A 4WJZA 3GLVA 3R5HA 1OWOA 2WWTA 3ESZA 2Q6OA 5K0ZA 3AEYA 1R4AA 4PF1A 2RGNC 1C80A 3FB4A 5HJ7A 4AF7A 3M4XA 4LYDA 4CTOA 1M9NA 1O03A 4MR7B 4QD3A 4B44A 2GXSA 4MUHA 2I65A 4EO7A 3U0BA 5JH7F 2JLZA 2GK6A 1UJ5A 1SC3A 1WULS 3ABRB 1PR4A 1C3OB 3ANYB 2JDIA 3CPEA 1PGJA 4MICA 5K1ZA 4CLEA 4QRIA 9ATCA 1UWVA 4U6QA 5I9IA 1A2QA 2PX2A 4HBGA 1GPJA 2HFJA 2VATA 1RPZA 2P77A 2YV3A 3K2QA 4PWYA 5G0SA 2P78A 4OX9B 1DBVO 4O29A 3EXEB 5FNVB 5HMMA 4WBNF 5CHYA 1U2SA 1E61A 5LBTA 2YASA 4PIPA 1FTSA 1KI9A 1NQOA 4R1UA 3A2MA 2WDZA 3B1XA 2ZQZA 2JDID 2Y77A 3PRHA 5K20A 1SZDA 1M83A 5CDFE 5ERGB 1CUVA 5DHTA 2CV1A 2HHHB 2NV2B 3DPSA 2P9GA 3KSZO 1H42A 1JHXA 3VSDA 4QOIA 2A4MA 2PXXA 3C74A 3LF2A 4J8PA 3KB1A 5ENDA 4EKYA 3I0ZA 2I4TA 3BKWA 4N3BA 1QH8B 4AYTA 5HK8A 5HQ3A 2JLUA 3NTQA 3PWTA 3EQ8A 3HDVA 5IVDA 1G17A 2R7NA 1VE7A 5PNTA 4C2AA 3MRVA 1ZIYA 3DB2A 1CNMA 1A7JA 1C4XA 1L1EA 1VJRA 2JAPA 2JA2A 2PMKA 2QMQA 1V4VA 4XSHA 5DBHX 4R8VA 4R7GA 4NEHB 3OT4A 1T15A 2QL9A 4Q19A 4ALIA 3OZ7A 2GOYA 4HGNA 3G0BA 1Z3CA 4FKMA 4OYRA 1RIIA 2RHMA 5FAXA 1BDIA 1V3TA 1SXGA 2A5JA 2D5CA 4FI3F 3S2FA 3N8NA 3SE7A 1ZK1A 2OD9A 5BXQC 3HM2A 2N1BA 1C0KA 3Q6MA 2BUBA 3QSGA 2QTAA 3DQPA 3RSZA 3F4BA 4KLNA 1CT9A 4S2EA 2AFRA 3UB3A 4D5EA 4RZQA 2Q4RA 1J9EA 1SCUB 2WJIA 4LOLA 3ZCQA 1T0BA 5TSDA 2C7QA 5HCUA 3LVBA 3S4YA 3JCZA 3N28A 4Y2GA 3KKPA 1L4LA 3UJ7A 1SO8A 4G1FA 3QF4A 5LJIA 4WLUA 3TFOA 4PQGA 2MIIA 4RPKA 2DHDA 4CF7A 2Y1FA 3TOVA 3BIOA 1UFOA 4OKSA 4IG4A 1PJ8A 2J7PA 2I1QA 2CFCA 4UU7A 4IG9A 4FVTA 4AKEA 4QXAA 2PQMA 3HUUA 3GF4A 3LA8A 5CD1A 3MJVA 3A3PA 4I19A 3BEDA 4D0SA 3DYBA 3W5UA 1A7AA 1CZKA 4G8BA 3ZCVA 5BWMA 1I0IA 3KCNA 4KZPA 3ZWVA 4ZAYA 2QNRA 1FRFS 4XD7D 2GAOA 3GV0A 2HLHA 1NC3A 3VTKA 2ZJ5A 3R23A 5ER6A 2IU6A 3M89A 1GV0A 4TV9A 1O6BA 3EQ2A 1UDAA 3C3YA 5FJIA 3U2QA 5KOIA 4U9UA 5EY5B 1FMCA 4XEHA 3OM9A 1PJCA 3FDZB 1DRKA 1OOEA 5CFPA 3VKUA 2NGRA 1E1LA 4WK0B 1EFAA 5J9FA 1T6NA 3BFXA 2ZCUA 4UTNA 1TF2A 4QPNA 4QTUB 3RTEA 5DTRA 2GDJA 1QO9A 1Y1PA 1EVQA 5IUNC 3UMMA 3TDMA 1MIHA 4YASA 2WZCA 2CNWA 4IDEA 3VSAA 1PJTA 2JHGA 3H13A 4MUEA 3OF3A 4NWIA 3E15A 4FR0A 4E3WA 4B5LA 3OX2A 4QUIA 3KQKA 1UBMS 1CDDA 3A36A 3NJ4A 2QYSA 4QDZA 1B7GO 2MSKA 1LDBA 3L7BA 4ALLA 1ULSA 1M6WA 1AXRA 3L4SO 3MT7A 3LCJA 4N6OA 2AE2A 4WIAA 4YJKA 5E2AA 5GJCA 2H4FA 3SLGA 4P0PB 3RRFA 2PVPA 3N70A 4MQBA 4YN3A 2PUJA 5BUCA 4X7BA 3N05A 4DVGA 5EHXA 4X66B 3D9QX 2HA0A 2PXCA 3AY6A 1C3XA 4QOJA 1R66A 2NSDA 3KVRA 4OQDA 3TIVA 1WCIB 4J4HA 4PQFA 1EXVA 5IJXA 2I29A 3ZLJA 4DLPA 1P17A 1PQWA 2B6HA 4DWJA 4NPCA 4PFJA 4RD6A 3WXMA 2BHRA 4E21A 3VSBA 5AW8A 4EZBA 1CUYA 3CVXA 1T4CB 3RE1A 3EY4A 2ZATA 3FAKA 4TL6A 4ZI7F 2EHDA 3JTEA 4RK7A 3IDFA 1KS9A 1XRSB 1Y3FE 3KK0A 2CNBA 3EVFA 4KYVA 3UKJA 1YR2A 1KGDA 1XA3A 2BP7A 3A3NA 1OPXA 4M86A 3ITNA 3LQYA 3O6VA 3RS3A 3ZK9A 1XLTC 3DAFA 4IIHA 1WV0A 2G08A 2JEOA 3NYWA 4FSHA 4JU9A 5JAMA 3KSMA 4KXXA 1EK0A 3LNTA 4ACBA 3RSGA 3RRJA 3UV7A 3X1YA 4P1ZA 3NEJA 4PLTA 3FDFA 2IPMA 4NCHA 5L3ZA 3T3EA 3FMPB 4A0FA 3O3NB 4G0PA 1IATA 1JYFA 2JI4A 2BISA 3MXOA 4XQEA 4YMSA 5H02A 4BKPA 2J9GA 1Z0SA 4J2HA 3E5RA 3PEUA 2RI1A 2IVFA 3O95A 4FMDF 5CJJA 1USIA 3N2NA 4POAA 2EL7A 2ONYA 4BLQA 2IYFA 1UIMA 4OLJA 3GLUA 5F1PA 2YR0A 1N2JA 4JYMA 1V3VA 4ZEOA 4BB6A 4QTYA 1LDGA 4ZGBA 1D0VA 4TRRA 3EC7A 2IBSA 3JASB 4XUEA 5EWMB 3S1AB 3FIJA 3DG9A 5HIIA 1OYVA 1S2NA 3BE6A 2C4HA 3QMVA 4IVRA 3UN1A 5NLLA 2LCIA 5AUPB 1CRZA 3KSRA 2QN8A 3OCWA 1QYDA 3NIDB 4CKYA 4RDIA 3Q9UA 4PW0A 4HS4A 2ZVPX 4BYGA 1JEYB 4JSTA 3IMCA 4X6YA 4CG3A 3CA8A 3Q2KA 3TBHA 5JS6A 2PLFA 4BNIA 1D3AA 4YXFA 1LVGA 1KY4A 3WQQA 4WFIA 1JLMA 1NFRA 4R51A 1EUQA 2OD2A 1YB4A 3IAM6 2HOQA 2ZUEA 5AOAA 2APJA 1JPNA 1L7NA 1PVVA 1GT91 1R64A 2Q4DA 4W9MC 4WZAE 1UBNA 1DUIA 2IY9A 1SHLA 3R3YA 5TPWA 4OUDB 5C31A 1TA4A 3O2NA 1RYYA 4XARA 4D8UA 1GNSA 4O2RA 1U9JA 2ZSUA 4AJ2A 1TT7A 2PBRA 3FNBA 3OSUA 1IEVA 4DLBA 4Z9BA 3AEQA 4IS2A 4E4RA 4PZ9A 5EIHA 1ULUA 4CF5A 1SG0A 1R2QA 1THZA 4Z86A 3PNYA 4P36A 3L8CA 4G67A 4OHOA 2HJ9A 3JQ6A 3RFFA 4Q3AA 3MINB 4GX1A 3SSMA 5L95A 1SKYE 1AQ6A 2P30A 4PC3A 5HE9A 4QICA 3TLAA 3ESQA 2UZAA 2RGBA 3FVWA 1DDOA 2AHRA 2YKGA 2Q5IA 1FYDA 3GFSA 5AFSA 1PNQA 2DQYA 4MP6A 4AJOA 1OAKA 4OHPA 3GNSA 5TPZD 2V8BA 4A0QA 5B6JA 4Y3UA 4DCPA 3UPDA 1WOYA 3R44A 3EPPA 5ICEA 5JAIA 2EQ5A 1XZEA 1CUFA 1FC0A 1K89A 2PFGA 1U3CA 521PA 2ODQA 1A9PA 3VI3B 1RQNA 3V1KA 5CIYA 1FB5A 3ADKA 5HJ5A 1IJFA 3QXJA 2BEWA 3OA0A 2H1SA 4KFSA 3SFVA 2FW8A 5K4HA 3PX7A 3E9YA 5GINE 4YRZA 3V1NA 3KX2A 4CIXA 4ER7A 3AEZA 3BL5A 4XWAA 3CU5A 3MMSA 2ZUWA 4G41A 2B25A 5FYDA 4EELA 4JC5A 3W5JA 3IIMA 3NP7A 1EM6A 2QORA 4FDAA 4QGFA 1IEXA 3AJEA 4CF6A 1BS1A 2XMCA 1WR8A 5AKKA 3NDPA 3EXEA 5FNVA 1UBOS 5JC1A 2BRUA 3N74A 3GVPA 1OV6A 2ZJ8A 3OTWA 1G3QA 1MMFB 3QVSA 2VJYA 1T5SA 1KJYA 3VR5D 1OZGA 1K5DA 1Q7TA 1WTAA 2XRMA 2A9RA 4HPXB 4RFLA 4OSEA 4L6AA 5B5SA 1BXRB 1Y6GA 2E1PA 4PLGA 4Q03A 5DYGA 2QTTA 4WLFA 5A5EA 1AGNA 4RNCA 5THXA 5GZ6A 5B12A 1JUDA 2EKLA 3FSEA 4LZLA 4X3PA 3WGHA 5I7UA 3EWAA 3ILVA 1PHRA 1Z4MA 1J2YA 1TZBA 1P77A 2DJIA 2EATA 2RBGA 4XWGA 3S70A 1VQ1A 4EVSA 2PQ0A 1WQ4A 1HDXA 1P0PA 2QRMA 1EAYA 3A9UA 1OX5A 4HUTA 1OU4A 1E3TA 1FU4A 4GOKA 4DRZA 3ER8A 3EOBI 2H18A 1PG0A 2IOFK 2W8BB 3LUBA 2DQZA 2XUOA 4GMDA 2LKCA 4MARA 2PNFA 1PFKA 4BP8A 3H4VA 4ZXPA 3GJ6A 3PC6A 3ZIAD 1DKUA 2JI9A 1D6MA 2PLAA 2YVQA 4W9RA 4EJSC 4IDAA 1XCGB 3K31A 1FYEA 3EXG1 2AKAB 2Q1SA 1TEZA 4FR5A 4GDMA 5LZ5A 3ANTA 2J0VA 1JB9A 3DE3X 4FYWA 3QZUA 4GPZA 1YA6A 2XCUA 1SA0A 2QM7A 3OICA 4DPKA 2QX6A 3TM4A 4K6FA 2EKZA 3FLBA 3OQ1A 5DKFA 2ZXFA 4JUAA 4C6RA 5ARDA 4Z7JA 1SBIA 4CQNA 1USWA 1KJZA 1KR2A 1WWKA 2VRBA 4JLWA 5FADA 1EWYA 2FN7A 2J9RA 1K2WA 1WXHA 4IIBA 3Q3CA 4UE6A 3N59A 1A1VA 2ACEA 4BV9A 5ADUS 2QPOA 2QHXA 3OY2A 1XTPA 3LUKA 2M6SA 3M34A 3R2JA 2PRYA 1SJ9A 1F5SA 3ZHTA 4QIHA 2QV0A 2NNLD 1RFGE 3VO1A 1XZJA 1E2IA 2V5AA 3V97A 4IXWA 1DQPA 3SBOA 1HG0A 4V2IA 2FQ1A 2WW8A 3L0IB 3IV9A 2ZM6B 5FPYA 1E3EA 3ELUA 1ETHA 1E2QA 2GO7A 1KFJB 3EGWA 1DBQA 4KN9S 4EHJA 4YUAA 1QGUB 3VZDA 1MB0A 3LDUA 4GI5A 2ID9A 5A06A 1NF2A 4JEMA 5IH3A 1UMBA 2VDQB 3GFGA 4KV9A 1VLMA 2IDMA 3ZBPA 1ZEJA 2ECQA 3FLEA 3X1JA 1Z06A 4ZI7A 2ZAYA 1GITA 2B5VA 1AZWA 3WLMA 3P94A 4GKKB 1D9XA 2GILA 3SIRA 4ZKDA 1UBCA 3I58A 3OJ0A 1B2LA 2EJUA 2ZUVA 3UJ3X 3QVXA 4E5VA 1SEPA 1I2AA 2WM3A 4KO1S 4AG5A 3LKDA 4FFOA 1DG1G 3UXHA 4NONA 4S3MA 5FLEX 1RC1A 3FUTA 4UVIA 5AXDA 1OA0A 1CU1A 3IOYA 1K8XB 3ZVLA 5TLSA 4ZVNA 3QVJA 4PYOA 4S1TA 4KIFA 3IJ5A 2ZXUA 3E7PA 3G5TA 1KBQA 3PHHA 4MLDA 3PD1A 1Y7PA 3ZE8A 1MA0A 2ZTUA 1VA5A 4KQ6A 3FI0A 4EPXA 4E31A 1NVFA 1Y42X 2Y4OA 5BW6B 1UJCA 1EUCA 1IK6A 1NVKA 2A33A 1OPRA 1MAVA 1OI3A 1TF5A 2I0FA 2QNBA 3ACBA 3B36A 3C48A 4ZOLF 5AUQA 1O9GA 4RU1A 5FTLA 3QKTA 4GW3A 3DE4X 2HU2A 3WBBA 5A6SB 4QGSA 3CNHA 5LOVF 2C03A 2F8MA 3VO9A 5I9NA 3EIOA 5JQGB 1MOQA 3G0HA 1L5FA 3QJ5A 1GL9B 4IIJF 3BRWA 4KLZA 3D54D 3BG5A 4WXYB 3HJNA 3ZD7A 3EOAI 4GRAA 3R74A 4JKYA 2BT4A 2MOKA 3EIXA 2D0PB 4G2NA 4L85A 4UNNA 4UEOA 1J06A 3M6IA 3X1WA 2Y8EA 1JQKA 3CZAA 4Y6PA 1FS4A 1SD5A 4OH7A 2WICA 1UJ4A 2ZS9A 2P2NA 3OP1A 2YYYA 4PVCA 5BR8B 2Q6IA 4I1YA 1CHDA 4ACAA 3V4SA 3DDUA 3WI7A 4PC1A 4RX1A 1IG3A 1BOOA 3TLJA 4AW9A 2PGOA 1QQAA 4UZEA 3KZVA 2VRCD 4S35A 1B73A 1RABA 3BVPA 5TY0A 2CGEA 3C97A 3BHMA 5EMLA 5B3JA 3EVBA 3VNRA 4DCUA 3MT8A 3WL7A 5KMGA 2XYRA 2FPIA 4LZZA 4LCEA 2X6RA 3P4XA 3RAGA 4D96A 6REQA 4EHKA 5DIZA 1D1QA 3HCWA 4NZNA 3W2GA 1K88A 1UPXA 3KJZA 4ZPJA 5KWEA 13PKA 3PXDA 1PQYA 2Z4SA 3EW7A 4P5DA 3HB1A 2RSLA 3UGKA 5C9ZA 4CMJA 2JS7A 4B34A 4D98A 5JNWA 1VJ1A 4DJDC 1MRSA 4HC4A 4AZ3A 2PEYA 3AETB 2UUBB 2JFFA 4Q05A 5DHQA 1ZO8A 4C0AC 1IN8A 1KHTA 1QBKC 2AX3A 2BE9A 2AEEA 2DBQA 4LOHA 1JZSA 5C46F 3QGMA 1Z2CA 1SOWA 4R4JA 1VPTA 2WTNA 3VJLA 1WSAA 4AUNA 5CURA 1JR3D 2VP9A 1ZIOA 1PK7A 3JWIA 4YVFA 2R2AA 2DEUA 3FTQA 1K8RA 1SU4A 4WQMA 4W5WA 5T8KC 3LC7O 1JHPA 2VUHB 3UW1A 5K5EA 2UZ4A 2I7TA 5I7HA 4QXQA 3H75A 2YFYA 4EG4A 3TJRA 1EEHA 4JFAA 2MSCB 1P1JA 3I04A 4NNPA 5JMTA 2PH5A 2RK4A 5CT5A 4MWEA 2BFNA 2GASA 3C39A 2V7PA 3ZHZA 1SBYA 4CKBA 5REQB 4EL0A 1HRKA 4BNNA 5FI5A 4UD6A 3V8PA 4O6VA 4CFYA 2P7IA 5BSEA 3H8SA 1P74A 1ILEA 5FUYA 5JAOA 2G5TA 5CA0B 4EY8A 4FYMA 5IRCD 1AU9A 2R8XA 3AFIA 4L4XA 3PEVA 3VTAA 5CDGA 3IT2A 3BXZA 4LOKA 4ZAWA 1BEEA 4KPYA 2QIPA 3L6DA 3OX1A 1YI1A 3L7NA 2JZNA 4NK5A 1M34B 3RFUA 5IEBA 3TQOA 5IM4F 4UC0A 3KB8A 4C05A 4E6PA 1N9ZA 3NHBA 3LUJA 2V6FA 4GP7A 4ADSG 4FX5A 4DPMA 2CVPA 3EWIA 5AUNB 1QUFA 3HYRA 3FY4A 3NPAA 3LC2O 3B85A 1NXWA 1G8SA 1NYTA 4EWLA 3JD4A 3E2MA 3RGWS 1NUUA 1Y81A 2I4RA 4CMHA 3PQ8A 5L7YA 2QTWB 1AB5A 5LSAA 3GIWA 4G4GA 1ZUIA 3UOAB 1O08A 1XTJA 3IV7A 2JC3A 3WFIA 1KOJA 1MJGM 5ELMA 1PV4A 3MJ4A 1KEKA 1GHTA 5FAKA 3Q11A 3LTNC 3MRSA 3FKQA 3HMQA 3PTLA 1DC3A 2G09A 4XUDA 1TLLA 3EEYA 1ZNZA 3WWOA 4BFSA 1Y98A 5GM1A 5JXWA 2Z83A 4MAMA 5M04A 3UICA 1JWLA 3H83A 3PITA 3SHFA 4WH0A 4NCNA 1PSZA 2O14A 3EXFA 3U61B 2Q6LA 1FLAA 4CL2A 3CV3A 1TTPB 2JLSA 2GXUA 3QA3E 2VHCA 2XXAA 3M82A 4B9EA 2QN9A 3E3MA 1JYSA 1WCXA 2BOVA 4QUBA 3DV0A 1GDTA 3FZYA 1XXLA 3U9LA 3N6XA 3U7JA 2XMRA 4TT8A 2DECA 2QG4A 3MJHA 4LK2A 4EUHA 1G21A 3N2KB 1Y80A 4ZT5A 4YTEA 1R74A 2C84A 1KARA 2C96A 2TSYB 2Z58A 1CDZA 3NC4A 1QFZA 4LE1A 5D5HA 5HOQA 2QW1A 1C4OA 4URYR 4JGIA 3ZKAA 1GA1A 5HIJA 3I2KA 2IYOA 2MR6A 3Q1KA 4XCVA 4DAEA 4DMCA 2REBA 3NT5A 1IQRA 3O8RA 2YY7A 4GUDA 2N42A 3TRKA 5KWSA 1J8DA 1PBTA 1XKXA 2H2DA 2HA4A 2XB9A 1OVMA 4KR9A 4GQAA 3I6BA 1QMGA 1OTYA 4TXNA 2OCXA 2XCOA 4DRXA 4B82A 2LVBA 3K9FC 2H7CA 1Y4DE 3CUYA 2YWEA 5EA2A 3Q7SA 2D8MA 4Q15A 2PLWA 3RK0A 4BZZA 2V7XA 3EG9B 2CUKA 3FCUB 1NY6A 3TS1A 3LIPA 2NUTA 2BM9A 1GQOA 1BD4A 2EFEB 1HH4A 3ESBA 4RFSB 3D3KA 4IJ6A 4OXNA 3SBXA 1I4OA 5LMNB 2QLNA 4IX1A 4YO7A 3VO8A 1TB4A 3BL6A 5ESWA 5I47A 2ILTA 5EYPA 1JHRA 3KLPX 5TDHA 2FY8A 3ZE1B 1SXHA 2Z8YA 5J2TF 3LT4A 5K8LA 5JNSA 1DXQA 1DG9A 2YJ3A 3NR2A 3WG9A 4OXIA 1O6ZA 3H9GA 5SY6A 3RRMA 4URZR 4EPRA 5JYBA 3Q8MA 4OQZA 4KR6A 2BKLA 2O2YA 3B6JA 1ZW1A 1AZTA 4P92A 4DEYA 4RHCA 3ZIDA 3DS8A 2LZ0A 4ETIA 3IQGX 3TN7A 4HRAA 1U2TA 2R6AA 3A9TA 1MX1A 1GVNB 4U4AA 5BSHA 2BMWA 2J5XA 4U0KA 2FPSA 4X1KB 2EWMA 3HP4A 4IDNA 3QUTA 4U7HA 1ORWA 3SOZA 1V11A 4E30A 1MRNA 4QPZA 1POXA 4F8EA 3R76A 2NU9B 2IHBA 3SEFA 8ABPA 1I4LD 4KO2S 1SWWA 1L0BA 2VHWA 2ZZMA 2VN8A 4I2NA 1G8FA 4E08A 2QXUA 1W0CA 3OZWA 4DKXA 4GPIB 2OGTA 3TZQA 3G13A 3MD0A 3VC1A 1NW8A 4AQDA 2NT4A 3LQQA 5HZHA 4FMBB 4M7WA 4MWDA 1YR8A 2BFCA 4CLOB 3WMRA 5KVSA 1ZUD1 4D3SA 1T2AA 1UQUA 2G8NA 1QE3A 3FJOA 4PAOA 5JRJA 1C1DA 5JANA 4ZOLB 3JQ8B 4EJ6A 4BCDA 3ZQJA 5LZ8A 5HKAA 4PZPA 2I6SA 5LIPA 4E22A 2XQVA 1DV1A 5FWDA 2BEKA 2B8TA 4HLUC 4RKEA 3W7BA 3ONFA 1M6EX 1WKCA 1ZGJA 2ZETA 5E2IA 1IVNA 4B6OA 5A1TA 5J2UF 1NDUA 4L16A 3OH8A 4YFYA 1AMUA 3UJBA 1UZLA 1S8FA 1QTQA 4WEOA 1GYQA 1NF8A 2I2WA 2IZ5A 2JGJA 2CV2A 1NVEA 1UODA 2ACKA 4R9NA 1T9HA 2VDWB 1J5XA 2QVZX 1U1GA 5EYPB 4X1YA 5E3HA 2R84A 3TEMA 3TRFA 1J5PA 2I2CA 4IJMA 3CVUA 1QZZA 4DCJA 4RHFA 4M9RA 4OBXA 4FSXA 1OLXB 2FCAA 3PICA 1VE3A 2C9MA 1G18A 2DBZA 4Z99A 5J4LA 3OZTA 1NVVR 4CIBA 3FKSD 3U1BA 1DKNA 1QWOA 4LXYA 3ONEA 4UDYX 3JAMA 3USZA 3OMLA 4U39A 4E5YA 4AKIA 4D9EA 1PS8A 3I9V6 1KJJA 2WD9A 1L1QA 1P2BA 4WN3A 4C89A 2E4UA 1TVKA 4ARCA 3B7PA 4F96A 2FPUA 1VZ3A 3PIDA 5JC8A 1N2GA 3ZCRA 4HGOA 4J9VA 3C24A 1AGPA 4RA9A 3LK6A 3JQFA 1GNRA 4BKOA 1U1EA 1D8AA 2W83A 3CCFA 3TYXA 5IHPA 3TGLA 1IHUA 3S68A 821PA 3IL2A 1YFJA 1HT1E 4FFVA 1WM1A 1QJ4A 2QTRA 3KJHA 3R09A 3FNFA 4ZALA 2I55A 1RWMA 3QM1A 1LPPA 4TWBA 4UVGA 3K72B 4FW9A 5KYTA 2CXOA 2VZ0A 4KVFA 2WJGA 4EEKA 4YCMA 4G1MB 3T52A 1NTOA 5A9TA 4M46A 2GEUA 4MRSA 4JGGA 3VR3A 4MDEA 4DOMA 3PC8C 3FWKA 1PDWA 3X2FA 3ZU6A 4ZVUA 3HU2A 5LUBA 1VCOA 2BEWB 5U4QA 2PZEA 4UTPA 1G20B 3B2QA 4GM4A 4D82A 3FMFA 3QFTA 1FOEB 5HOEA 2G1PA 1QYCA 3HK2A 2JIDA 4JXZA 1UM8A 2AJTA 4JKIA 3ROXA 4DWVA 4FT4A 3ZZ1A 1NYLA 2HTEA 1ADFA 1WU8A 4P3XA 3U13A 3VVLA 4PYMA 1Z37A 4I46A 2ZWOA 1P39A 3QUSA 5FLYA 3ZWAA 1NASA 3Q7EA 2PK3A 4EMBA 3O91A 2EP5A 4Y6SA 4ARVA 2HLPA 4BBZA 2H1WA 1H93A 1WXDA 4U2KA 4WXMA 2OLJA 4ZT2A 3GJYA 4MYTA 3VO2A 3MTQA 4HNUA 4DMUB 2EGHA 2O2SA 5ER9A 1NQ5A 3AHGA 1OLUB 1UQRA 3ITEA 3HWSA 1AURA 2W2KB 1X80A 5I9SA 3VZPA 4ZIRA 5JTTA 1H6BA 2R6CA 1JR2A 1FBTA 1U28A 4XPIB 3B9BA 1FFGA 2D5AA 3LBFA 5I8ZA 1Z63A 3ENWA 4OA5A 4UARA 3HSYA 5DCLA 2OBNA 2IKSA 3RQIA 3BJRA 4UU0A 5EKUA 1L7QA 4PYQA 4WECA 5EINA 1WCWA 5H3CA 1AXEA 1Q19A 1QTIA 2NSHA 2YNMD 3B6ZA 1XQVA 4R8LA 4WK2B 3SC3A 3T6KA 8LDHA 4IUCS 5DNUA 4AYXA 2W6JD 2WV7A 2ZPTX 2ZWMA 5EJFA 5L45A 5EJ2A 3ZHQA 4X8OA 1TMYA 4X45A 5B1SA 1C5KA 2HDWA 4G0UA 1NBAA 2OCLA 1N7GA 4U2BA 1IXSB 1YKFA 3E35A 3Q1LA 4DA8A 3GCZA 5LQKA 4D81A 2QBYA 5FV4A 5HQTA 1KAHA 1E0SA 1K66A 4D42A 2WVAA 5JZSA 2WJAA 2Z5LA 4ZP1A 3UA3A 5BURA 5LOVB 4G26A 1G2OA 2ISSD 5HWSA 4MP3A 3BDIA 2A1UA 1T8UA 2BTQA 3CG4A 3OZRA 3ZHRA 3KLBA 4E5SA 3F6RA 5AW3A 3FCCA 1H65A 2P11A 4TMZA 1FL9A 1NQAO 2YIJA 1XCJA 1Z4LA 2XCTB 2FR8A 3RQSA 3R3VA 3DE5X 4JC8A 4DLKA 3IE1A 5C8VA 4K86A 3TD2A 3FGNA 1EFKA 1GUDA 1N9GA 4G8CA 1OKKA 1W5TA 1X7ZB 3QENA 3W8RA 2DKFA 2XWBF 2PCJA 3QG1A 1WS6A 3K8YA 4IFEA 4XGNA 2C2KA 2YIMA 4YB8A 1QR2A 3HE3A 1J97A 1T2FA 1A2KC 1NZDA 2VHUA 5AI4A 1V41E 4KR7A 2R9VA 2G28A 3WYBA 1HE4A 2EEZA 3M4YA 1JWBB 4W4TA 4BVHA 3QPDA 1TMOA 2GCPA 3DC7A 2FPPB 3FHLA 4M3NA 3RK1A 3H2JA 2ORYA 3OT1A 1MW8X 4CM8A 3JQ9A 4GLOA 5IG2A 5JT1A 1EHCA 3UQYS 2BAGA 4G36A 5A6VA 3OUTA 1UKYA 1H5UA 1GKIA 5D6NA 4ASUD 4BECA 4DJJA 5LP6F 3QX3A 4MHTA 3K2EA 1KZ9A 3WHLA 3RDPA 1XQ1A 2RHOA 3OQHA 4NZ9A 2RAVA 3HEBA 2G0NA 2F9FA 2FSSA 5E1MA 3VKVA 1RYEA 4K87A 3DEIA 2H8KA 2HUNA 5C37A 2JBHA 4AVYA 4QLOA 1P4SA 2IE8A 1BQEA 3AFNA 1X1SA 3K73O 4GI7A 3AR4A 4FB5A 2CVFA 1GPUA 4REMA 2VF2A 3WB0A 5EKSA 4XW2A 4K1LA 4PV7A 4ZHQF 3UGJA 3WL4A 4L4SA 4EA6A 1MC5A 3H5IA 3HCEA 4Q24A 3AW9A 2PX4A 1FP2A 2AC7A 4MW4A 4OV6B 5CTAA 4CQMA 3SJCA 5ADHA 2PS0A 3KEQA 4FC7A 1LI5A 2FMHA 3JZAA 3KTAA 4YXWA 3OEWA 3AUAA 3P7MA 4BMZA 2A8YA 4RKWA 1PTJA 1W4LA 5DP1A 4IDOA 2Q3HA 4CTMA 2JGFA 3M1YA 4GQIA 4O4HF 3STXA 5J4HA 2CUZA 4MV0A 4AO6A 3MLEA 5M29A 1XEXB 1X7GA 2I2AA 2BN4A 4UPDA 5JNTA 3B1YA 1JRLA 1RLOA 1AO0A 1U7WA 1VKOA 2W6IA 2XLCA 1C8BA 2GZRA 3EISA 3F8WA 2ZYAA 4MAAA 1NKSA 1XL0A 4B6FA 5CB8A 1BA2A 2IF2A 1NSTA 2PUWA 3MPOA 2FF7A 3AEXA 5CM2Z 1JHQA 2FN3A 1E92A 1Z18A 2C20A 1X1DA 4BO1A 3GELA 4J0DA 1E2EA 3OQBA 2V7EA 4DM4A 3SNHA 1LK7A 4QBHA 2WE7A 1QHIA 3MTBA 2C1EA 4JCOA 3QKRA 4N7JA 5C81A 1KI1A 3GAAA 1ENYA 3QX9A 2HV9A 4C0QC 2JJ2A 3TI9A 3QBEA 2VDWA 4KAJA 2C7OA 3MAJA 2TECE 4FFMA 1NDQA 4RVDA 3U39A 4BKQA 3D8NA 4RTQA 2P4EA 3H17A 5HILA 1VI6A 5E6SA 4A2WA 1ABFA 4L1KA 1XDSA 2AOWA 2HSGA 4BNHA 1E1DA 1IM8A 3CVJA 3I9LA 4DGQA 2EFJA 1F12A 1MCZA 3HBFA 3L4EA 1W4RA 1N0UA 3DDWA 4TZ6A 1G8JA 4GOOD 1N8SA 4IM7A 1IJEA 2J6BA 2GLTA 2C3MA 2HN9A 2Q4EA 1GSAA 3CEAA 3EOZA 1GAEO 4J1TA 4PHTA 1MX5A 3U7GA 2ID7A 3OT1B 4DYDA 4JLMA 2GKOA 2XDAA 1PWEA 5EUBA 4Z4FA 2A6PA 2DPMA 2RHRA 3PVCA 4WERA 3BE4A 3M0EA 1TECE 3OLZA 4JLUA 2NMVA 4U5XA 3ZDEA 3LDHA 2P75A 2B7LA 1B3BA 1Q95A 1SIOA 1U94A 1T1EA 2VPQA 2WTAA 3K15A 4YREA 3ZVKA 4FFPA 4LSMA 2DWOA 3AI2A 3FB1A 4ITUA 3HZOA 3JVUA 1AKTA 1YRAA 1MR3F 4CFSA 3DDSA 4K3UA 1JXOA 3GGJA 1RHJA 5CA0A 5JDIC 3EXHB 4TTVA 3W3ZB 4XWOA 3PQ6A 2QN2A 4MKXA 3TD6A 1G6HA 1A1SA 2DTEA 3GJ8A 4J0GA 5F2KA 4CKCB 1WZ2A 1NATA 1ZICA 3R41A 4ENPA 2ZG6A 1YR1A 1ZN7A 3KELA 2OZEA 2J5RA 4YAKA 2J3LA 4F3KA 1T4GA 3L5OA 4AN4A 3IS3A 2CCJA 5H68A 3EVAA 3VPDA 4OHKA 2X2PA 4GZ6A 3BGOS 4QAQA 2DY1A 2AZMA 4CEIB 3BFJA 2A57A 4QUAA 4YP5A 3ZN2A 5CG2A 1G8GA 2P3QA 4P7JA 4TS1A 3DFFA 3AVYA 4LJLA 3S2UA 5CBKA 3CZCA 4Y2RA 4MVJM 4OOEA 2V4UA 3EIEA 4IJVA 4BX3A 3Q0EA 2O2JA 2OB1A 2NUAB 5E4TA 1N0IA 1PI3A 1JLKA 1PNRA 1YZTA 1Z6GA 2IDJA 4N6NA 4O0MA 4QU8A 5HPYB 1NVBA 4CL0A 5CBPA 4JBNA 4I5DA 4CM3A 1C7IA 2E5FA 1X1RA 1JECA 1QIKA 1RBQA 3IUYA 4TM8A 1Y0BA 1XZGA 4ZREA 4C01A 1YDEA 1QQBA 1XMQB 1OXMA 4KFUA 1WAMA 4YRSA 4ZI3A 2NYUA 2KJQA 2R6R1 1SG9A 3ZV3A 5F51A 4AJIA 4WBNB 3LH5A 2R2GA 1LSUA 4RNDB 3CXRA 2IV7A 1NLYA 4F1JA 2H2HA 4D9BA 2QE6A 3D6AA 3L6UA 1W9HA 5A4IS 2ZWIA 2YN4A 3KYDA 4DRYA 2Q5HA 4P82A 5SZJA 4R3WA 4E12A 1VJDA 2YVKA 4ZYYA 5EZYB 1HV8A 2WMYA 3QTBA 2AXNA 3UUEA 3FCYA 2PGLA 4L72A 4LJYA 3JPWA 2P35A 1G21E 2Q4OA 3NKVA 4EY5A 5KC8A 1F2UB 3L7KA 2D1YA 5ALFA 3A1DA 4FNMA 1CDEA 4DIEA 1I1HA 5KYKA 2RKBA 1SXQA 1O6FA 3ZXIA 2IEZA 1A4IA 5L3QA 2UVQA 3OFND 3V4LA 2GK3A 2VFAA 4JMLA 3MVEA 3OCJA 1DJNA 3N2EA 1VCMA 4D0RA 4Q18A 4DF3A 5AJWA 5LZ2A 4NCBA 2Q8NA 2XZPA 1X7XB 1PJZA 2OV3A 3GUCA 3IHKA 3ZGNA 2G17A 1P8AA 3JQBC 2OL4A 3T1TA 2J09A 4IINA 2I7DA 4NCJA 1W34A 4TLAA 1QV6A 4Y2HA 3N0WA 2PS9A 4U6NA 5EE1A 1NR5A 1OGIA 2G0AA 2RHWA 1SXJE 5BOSB 2OZVA 3T1VA 2F00A 3LW8A 2IV2X 1DBSA 1U8AA 2VC2B 4JLPA 1IOLA 4URVR 5HEKA 4F4IA 2QRZA 4UNRA 4UU8A 1A5BB 3LU1A 1JNXX 2Y4NA 2VZ9A 4CM6A 1L8XA 3G2KA 4QXPA 4BVEA 4JZYA 4KIGA 3DM9B 3IOMA 4LJ7A 3RTGA 1O77A 3F98A 2JZCA 2N46A 4YMVA 3W2HA 6NULA 3KT3A 4M0MA 5AK4A 1Q14A 4NCKA 3EGDA 3QVLA 3UENA 1FDOA 2Y71A 4P3OA 3GRVA 1B2RA 4GMXA 3RU3A 1H5NA 2X1HA 1SZPA 1ZHFA 2IEIA 5FBRB 3AERA 2NSLA 2NXCA 2FQYA 2B5WA 4RPHA 3H5OA 1DO0A 2JFWA 2E0IA 3T4UA 4EGAA 2GEDA 3KL2A 2DMRA 1FUKA 3WX0A 3SN6A 1L3IA 3L7JA 2E4VA 4F8YA 5FO0A 4BPRA 3RSOA 4YRIA 1HLDA 1JIJA 3I83A 1XQWA 2PWYA 3WXBA 2QPTA 3ET5A 4EMUA 3I39X 3W6NA 1Y8RB 4J2OA 1DOAA 1WEKA 2V6GA 5EHGA 3BERA 2QN1A 1IDOA 3KLNA 3VR4D 2WNSA 3NMUF 2VNKA 3K09C 4HB3A 3HQ4O 4GPAA 1FFXA 1PYOA 5GTDA 3NTOA 2BSXA 2PX3A 4QQFA 5C8DA 4OQEA 2FW7A 4A6XA 2Q3EA 1SCJA 5C7LO 3A0UA 2ZBRA 3KXIA 4BMPB 4JQCA 5T4EA 3N53A 5D51S 3TKLA 5ENVA 1TZJA 2EQBA 2FGKA 3UBMA 4CQLA 5K6AA 3WLKX 1PR2A 2IU3A 1I7PA 3E0XA 3MF4A 4HYQA 2SKCA 2WAOA 1L5NA 1DWPA 5DRYA 1WUJS 3NWJA 4PRKA 3ROQA 1TCAA 4R1SA 2DWQA 3IDOA 4CT5A 4D8YA 1BGXT 1L4FA 3D8TA 2GCEA 1PFVA 1V5WA 1XELA 1XVLA 3QF4B 1XDUA 4WZZA 1EM8B 2W2LA 1E2DA 3ICWA 4GNKA 1U7OA 1BKYA 4ZTBA 3M6FA 5I7AA 1DRUA 4GXRA 5AP9A 2Z8XA 1CXZA 2DG2A 2YWBA 2J9FB 1ZESA 4TUYF 5HKLA 4P53A 4RZIA 4UZSA 3U7HB 1Q1QA 1T91A 2RH9B 3R7FA 3WZLA 5IZCC 4YACA 4V24A 2P8JA 1FDUA 1K4KA 4G1VA 5B55A 3ZHYA 1Z13A 2B83A 3RKRA 3ZOZA 3I0MA 4F3YA 2A7QA 4A0HA 3E3AA 5HBGA 1YI8A 2BLNA 2PL9A 1CQXA 4L4UA 1GUYA 4HDQB 5F2EA 1SGWA 3N7AA 1YNOA 4WVFA 3KTOA 4KPUB 3DDOA 1K7CA 4HN4B 4B7UA 4IIUA 4KGVA 4KRYA 4N3CA 1BMDA 1W0KA 4RXMA 4RW0A 3A58B 4UUOA 4OLBA 1WVMA 5LA6A 4V0KA 4YJHA 4E07A 2OC4A 4MTLA 5DBEX 3GJ4A 2ECPA 1GZ4A 1ZRNA 3V7YA 5DN6A 5LJLA 1BC5A 3NNDA 2R48A 1IQPA 4CNQA 4B3DA 1XXHB 4MV9A 1JAXA 1SHUX 1QKIA 1YI0A 2QQ5A 3FNGA 3QXCA 2E87A 1IK4A 2NACA 4J1NA 4BTVA 4G63A 4LC9A 2CB0A 3QE4A 3W8EA 3HFSA 5EC8A 2X8AA 1M3SA 3OE7D 1K1EA 1G7TA 1O89A 2XA1A 4UCXA 4KX5A 1PIWA 5L7TA 2V7QD 2PJRA 3ZE6A 3IKTA 4FOLA 2P68A 3KTFA 5ITWA 3MLBA 5I8WA 2Z3VA 1Q11A 5MGBA 3GVCA 4JX8A 3VQTA 3O75A 2HAEA 4ZCLA 4DBLE 4EGCB 5A9SB 1UMCB 3L4BC 4JP1A 4H7DA 2QUAA 2VWQA 5FQOA 3WIUA 3H05A 4DLRA 4F06A 1M72A 5JO9A 1ISJA 3RASA 3QKSB 2WP0A 2NVBA 3CNNA 3RVPA 3IDQA 1UT6A 2FW9A 4LPSA 1U0JA 1V3UA 1M8KA 2QT9A 2IXGA 2WF9A 4MYUA 5HF6A 2Z30A 3TTTA 4H3VA 4ED9A 3ETCA 1WSBA 1OB5A 3DLHA 1SPBS 1E9CA 4B3MB 2F1IA 1I9CA 2QQFA 4HATA 1D4OA 3GLGB 3BJEA 1COZA 4F9FA 1BVRA 4XQGA 2Y1XA 3I64A 3OPYB 1IC6A 1N33B 1PR5A 1OHHD 1S3SA 2A0XA 2J0SA 5HRCA 3Q6IA 3D6JA 2M1XA 2VDKB 3L0ZA 4R05A 3RRXA 3L7YA 1VYTA 2ATVA 4RCVA 4ZVSA 3DD5A 4XB1A 1E7MA 2GJKA 1H23A 4A23A 4F4JA 5CITA 1CUCA 2XAUA 3QE9Y 4ZPXA 1N1GA 1T1RA 4QOGA 3QMMA 3GRRA 3OCUA 4J49A 3ZLVA 4BMNA 1Y5NA 3LGSA 1AKNA 1HWYA 1UBJS 2GPBA 3HJGA 1ZM9A 4QOSA 2Y92A 2JCYA 3AUKA 4DGSA 1G41A 2JVKA 4BNMA 1IZ0A 4BO8A 1Z47A 1GNTA 2VK2A 1OFVA 4BLOA 5AKEA 5DSZA 3RR2A 4YRGA 2ID4A 1XZLA 4MQLA 1DKOA 1BCSA 1MIOA 1JFTA 4HZIA 2LW7A 1SIWA 3WB2A 5FPSA 5FR1A 1C1YA 4GBMA 4O4LF 5HFAA 4L9AA 2VKQA 1C7QA 2BY4A 2ZS8A 1XMXA 2ILVA 3SR3A 2X19A 3OCYA 4OL9A 5ALTA 1QQ5A 3WLNA 3ASVA 1Z0KA 3RUIA 3TLXA 1P7PA 2TMGA 3PWKA 5K0EA 3RVMA 2BRUC 2D0DA 4I8XA 4C0XA 4BFLA 3PQEA 2ZJ6A 3SK0A 1JG4A 2Y76A 2Y68A 5CFRA 4A8PA 3CE9A 3IPAA 2XITA 2A9JA 3H5WA 2D2EA 3DTVA 1GDDA 5L9AA 1ZMOA 2F1KA 1AHIA 1M2OB 1CRQA 1LBHA 2H1IA 2YW9A 1D0SA 3ET4A 3UG6A 4DR1B 4RA6B 2QLBA 3B8HA 4TQAA 3FR7A 2YBDA 1GTRA 3FNHA 4JI1B 3TL2A 5FO1A 4TLLB 3JWEA 1AHPA 3PC3A 1G8HA 3EGXB 4P98A 1KXZA 1CY6A 2X4IA 4IH1A 1NLMA 1XGKA 4XA8A 3DULA 2OO7A 4E2ZA 2QRUA 2JGRA 3CRZA 4RZ3A 1QHYA 3ADBA 1Z5NA 3O26A 3EDOA 3WB9A 3CKMA 3GJ7A 1KRWA 1VHWA 3AYZB 3EA4A 4V03A 3DW3X 1YH3A 1C7RA 3TTSA 4DSNA 3H5RA 4IX9A 1I1NA 4M88A 4RV4A 3G49A 4V02A 4YCAA 3THWB 1JKIA 1JIIA 1E60A 4NI5A 5SYNA 5JZ9A 4F92B 5JTUA 2VQ3A 1DJPA 2JH3A 2A59A 4GZMA 1V7ZA 1T1JA 3JPYA 2F7SA 3E8MA 3M81A 4AX4A 4BV3A 4N5NA 3GP3A 1R0BA 3DT6A 1QNFA 1YDHA 1NGSA 3QUBA 1XIVA 4LQDA 4NRDA 3DL2A 5E6UB 2WKSA 4RTRA 3AR6A 2RGRA 2WSBA 3KVYA 1I2BA 3EDQA 1AHHA 2ZI7A 3W6ZA 1WMBA 3WKDA 3A3OA 1V71A 5FTWA 5CEJA 3EPHA 1M73E 3SYNA 4BNTA 5EVCA 3ZNOA 1DJOA 1U2PA 3TKAA 1W2HA 3KT8A 3PI7A 3B1ZA 4W8HA 2WYOA 1TYDE 2A9PA 1Y7TA 2JFHA 1EFRD 5G3ZA 1QVWA 4M87A 3H6KA 2FJUA 4MGIR 5AMXA 1LLUA 5EMHA 4W5TA 5JS1A 2G9VA 3IBGA 5L51A 1HRDA 1K3UB 2PVCA 2B5OA 4GMHA 3KSDO 5ESDA 5IM5A 4H16A 1QUEA 4YRDA 4A15A 1AGYA 2MMCA 3AL3A 3CF6R 2ZAMA 3WV5A 1UWLA 1KQPA 3LHDA 4FPXA 4MLCA 5JWHA 1IIBA 4ZYXA 2OHFA 2XUDA 5JD6A 1LKZA 3UANA 2FPRA 4R3UC 3WGZA 1H8HA 1U2GA 2ZSFA 1R6AA 4CYMA 1WJGA 2O5EA 1CUEA 2HA2A 4ZYLA 1Y1KE 2X58A 2RK3A 2HJVA 4EEXA 4NESA 1US8B 4KMSA 3Q12A 4JI0B 5D1HA 3B48A 3TSCA 3ZV7A 1W36D 3HVUA 3MJTA 1P0MA 1XTKA 3HA2A 3KLMX 3FOCA 3E1SA 3WJ1A 4NAUA 1XP5A 4H2DA 1EX6A 2OV2A 3QWBA 4QFMA 5F9FA 2JW5A 1PLLA 1SQSA 1Z5WA 1DUSA 3IQZA 4OI4A 1GCGA 1PAUA 2GQ0A 2H48A 2HH9A 4K46A 4M0LA 2V1XA 4TMKA 3S1AA 1PZXA 1RAGA 4BHTA 1T5LA 4C0JA 1K7SN 1AM4D 4XYEA 2I67A 4RBNA 1UFVA 3K05A 4CM1A 2R79A 4IR7A 4JJIA 3BE8A 2ETXA 3H4TA 4LMRA 3D3EA 2I1WA 2X0RA 4H6WA 5HX7A 2KHZA 4JKOA 2O2XA 1ORRA 5FA6A 2IUEA 1G59A 4HGQA 1R50A 3IOCA 2V59A 6GPBA 4O2BB 2I9PA 1O9BA 3REGA 2YS6A 4C14A 1NJGA 2H16A 4BTLA 1CUGA 1XRJA 3M8KA 1E9RA 4XGKA 3VISA 4MRAA 1WW8A 4EG3A 4I6EA 3DLCA 2OO3A 3ONNA 5CFOA 3ZJUA 1DAFA 1WVGA 3BD8A 4D9KA 4H7JA 5UKDA 2X22A 2I9KA 1YQEA 3GO4A 4I6JA 4QO7A 1L7MA 1AV6A 1M0WA 2HWKA 4O5AA 3B3FA 2QMEA 4FWIB 1G3IA 2Q3DA 3SXPA 1UDBA 1GNLA 5I6DA 1SOVA 4Q3OA 2O8DB 4D3ZA 1KJQA 4MZXA 4N9QA 2SBTA 1D5WA 3H5LA 3IODA 3R3UA 1E4YA 3IJEB 4KDRA 3VR6D 4BX0A 2O0KA 4TSKA 4ZOCA 5G1NA 4JXXA 1S3FA 2FMKA 2IZ1A 3MUFA 3NHLA 4BAGA 4CNBA 3BTOA 3WGQA 5AW0A 4MKIA 4G0YA 2YMLA 2RB5A 1O96B 3ANSA 3LLUA 1P6UA 4MQ6A 2Y0PA 1JLSA 1F0PA 2P4UA 3Q87B 4LW8A 3HN2A 4NOJA 1W85B 2PRSA 3CF4G 3LK7A 2L2QA 2JFZA 3K6SB 4BRSA 4C0WA 4QG3A 2X9QA 1XCPA 1FJ2A 3W2TA 4FFRA 3WL8A 4D41A 4D8WA 4KXWA 4TRJA 4RACA 2XNDA 4LX0A 5FOVA 5JSHA 5K05A 1QRRA 2ZIZA 3LTEA 3OQNA 3PFCA 1WHSB 3H9UA 3TAHA 1HKUA 4Q7LA 2J6CA 1FTWA 4HQRA 2JI6A 3DCNA 2Y05A 2VL7A 4IIGA 3FBTA 4MIKA 5EMNA 4DNOA 1WW3A 1QLJA 3O9VA 3GFVA 3OHPA 3ST7A 3BWCA 3OLYA 2FPOA 1FMTA 1FP1D 2VJNA 3V2HA 4BN0A 3NALA 3R7AA 4HWSA 4JLJA 4U1RA 2V0CA 4FFDA 4GICA 3W04A 3LVQE 3ZWMA 1SBTA 4IS3A 5KTMA 4BP3A 1U0HC 1RYFA 4BGDA 1B16A 5DBOA 4V1CB 3DAHA 4YRFA 1Q0RA 1TCCA 2G1KA 4A1OA 1BGWA 4L4ZA 4A8JB 1PJLA 2R62A 3RAFC 2GEKA 4QFBA 1NDHA 3SC2A 1T5IA 4J0HA 4NEGA 2B7BA 3DOUA 3LX4A 5T4FA 4QBFA 3SS7X 2VPXA 5K8TA 1EK6A 1I7LA 2FSHA 3GZJA 2AK3A 3L1JA 4KWIA 4ND5A 4WW0A 3HYSA 5FORA 3R0IA 2DPLA 3R5KA 4PSKA 5IJZA 1LQUA 1V9LA 1YL6A 1KPGA 3EAQA 2EG5A 5L7WA 3TIFA 2JG3A 3SAJA 5DYYA 1FRQA 3E22A 3UWSA 2AMVA 3ZWBA 1XZAA 2ZYGA 3H3JA 4AJ1A 2PAAA 1GG9A 2QLMA 3JWGA 4QELA 4MRMB 4U2FA 3U7EB 1A9SA 4DDKA 1U0BB 2WAAA 4WXRA 3L7AA 5MN6A 3ERCA 4JS0A 1VIYA 3VR2A 1WNFA 4NZOA 2ORED 1UKEA 3RVRA 3EXIB 1DAPA 5ALDA 1K86A 2VXBA 4IPTA 1Y5MA 2NUBA 1NP7A 2BL4A 3A11A 4B40A