4G4JA

Crystal structure of glucuronoyl esterase s213a mutant from sporotrichum thermophile in complex with methyl 4-o-methyl-beta-d-glucopyranuronate determined at 2.35 a resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
DTCSVSDNYPTVNSAKLPDPFTTASGEKVTTKDQFECRRAEINKILQQYELGEYPGPPDSVEASLSGNSITVRVTVGSKSISFSASIRKPSGAGPFPAIIGIGGASIPIPSNVATITFNNDEFGAQMGSGSRGQGKFYDLFGRDHSAGSLTAWAWGVDRLIDGLEQVGAQASGIDTKRLGVTGCARNGKGAFITGALVDRIALTIPQESGAGGAACWRISDQQKAAGANIQTAAQIITENPWFSRNFDPHVNSITSVPQDHHLLAALIVPRGLAVFENNIDWLGPVSTTGCMAAGRLIYKAYGVPNNMGFSLVGGHNHCQFPSSQNQDLNSYINYFLLGQGSPSGVEHSDVNVNVAEWAPWGAGAPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a novel glucuronoyl esterase from Myceliophthora thermophila gives new insights into its role as a potential biocatalyst.
pubmed doi rcsb
source organism Myceliophthora thermophila
molecule tags Hydrolase
molecule keywords 4-O-methyl-glucuronoyl methylesterase
total genus 126
structure length 369
sequence length 369
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4jA00
4AMYA 4QLOA 1E5TA 3PUHA 4AN0A 3V1KA 4MQMA 4BP8A 2C0QA 4BBZA 2RAUA 2O2HA 1CIJA 3IUNA 2V9ZA 4CCYB 2Z3WA 1ISPA 1TIBA 3F67A 1X2EA 1ZOIA 4I3FA 5AI9A 2HA6A 1IUOA 3A2NA 3BDIA 5HQ3A 2RI6A 5AOCA 4EBBA 2OQIA 4FBMA 5HF9A 1XRLA 2WUDA 3DCNA 4BVLA 1QIGA 3FBWA 4X90A 3G0IA 2YYSA 3WL7A 1L7QA 1FFDA 5KBYA 4OSEA 4WFIA 3MVEA 1UK6A 4AO6A 4FWBA 2BGNA 3M82A 5ALEA 3R3YA 4CIBA 4U2BA 3AILA 4I19A 4XJVA 2WIJA 3HYSA 5LZ5A 2XQIA 5JZ9A 3HRHA 4Y2XA 4C89A 3A70A 3JW8A 1M33A 4BRSA 5CXUA 1QFSA 2QUBA 2OCKA 2QXTA 4GBGA 5CXXA 2OAEA 5AKJA 4WY5A 1YAHA 3BIWA 4QDUA 3FAKA 4X85A 4LXGA 2OG1A 2QJRA 2WJ3A 3DKKA 2WJ4A 1AC5A 3U1TA 2VAVA 4CI9A 1J1IA 1YASA 3IUJA 4P08A 3O95A 4JH0A 1XZKA 5H3HA 2ZYSA 2WIGA 3VXKA 4QLAA 3G02A 3D0KA 3H17A 2QRUA 1MAHA 2GBIA 2JGLA 1YAJA 4DSZA 3DOHA 4QDOA 3WL6A 2WIDA 3C6ZA 4GEGA 4L9AA 1CUZA 3CN9A 3SX4A 2XMRA 2GBGA 4G8BA 3KDAA 5ALYA 5I7UA 1XRQA 4I4CA 3AZPA 1FFCA 4KR0A 3W9BA 4G4GA 1E8MA 3C87A 2HU7A 2H7CA 2O7VA 3G9XA 4X3CA 2ONCA 1ZI8A 5ALSA 2PPLA 5ALWA 5A7GA 1CQZA 1LPBB 1THTA 3G0GA 1X70A 1CQWA 1YA8A 4ZWNA 3PICA 2CMFA 2XUQA 2GBFA 3T4UA 3I6ZA 1KU0A 1FFEA 5HCUA 4CG3A 2CBGA 3H1AA 4J03A 5C81A 3DL7A 4G9GA 3OOSA 1EI9A 5K3CA 1VOTA 2ZJ6A 5AIBA 3F98A 3QPDA 4M0EA 5CRIA 3I2GA 3IUMA 1GGVA 1BROA 2I3DA 5BWBA 4P92A 2I03A 1YS1X 3UUEA 5K3FA 3C6XA 1NU8A 4X71A 4F5ZA 2PL5A 1JMYA 4L0CA 4PV7A 5AKHA 1UT6A 5HKBA 5AKIA 3X3HA 3E1GA 3R3XA 2WU3A 4CCWA 5FOQA 4N5IX 4OPMA 3QMWA 2XUIA 3H04A 5ALOA 1ZGBA 4C6HA 4CG2A 1FFAA 4B7ZA 1SOMA 2PSEA 2CB9A 4PQEA 2P8SA 3ILSA 2WUGA 5JYCA 4EA6A 5DJ5A 4WFKA 5YASA 4E46A 4F60A 1DWOA 5HK9A 5AK4A 5ESRA 3A6ZA 3WKEA 2WFLB 5AOBA 3IVMA 2VJCA 4DNOA 1JMKC 3MUOA 1QIMA 2H9YA 2QTBA 1CUJA 4J3JA 4GHWA 2JGMA 1DINA 1YS2X 1QONA 2ZYIA 2E3JA 5LZ8A 3TRDA 1JT2A 1CUVA 2RHWA 3N2ZB 2BAGA 4IH1A 4PSDA 1MN6A 4C87A 5LIPA 1XZMA 5AM5A 4AN1A 3RLIA 2XQJA 3H1BA 5EI5A 4K6KA 4AO7A 5I9IA 1Y7HA 2HADA 2WHQA 4LXIA 1BN7A 1X2BA 3U0VA 5HF6A 1YSCA 5FP0A 4GXNA 3QPCA 2V98A 4BP9A 3HI4A 3WWEA 1QZ3A 4BCCA 2ZJ7A 5HQ3B 2VJAA 5HK8A 1Y37A 4KRYA 3KWFA 2J4FA 5DYWA 4EZIA 2XQFA 4AZ0A 3OURA 3RKSA 5DNVA 2H7YA 4LIPD 3WL8A 1U4NA 2DFPA 5CW2A 1NU6A 5FUMA 4MYDA 3C5VA 1NX9A 5LZ9A 2FJ0A 1L7AA 1OCEA 5I8PA 4JUIA 1K4YA 4QDZA 2FJPA 3VVMA 5DWDA 3I2KA 3HSSA 2V96A 2WKWA 4AMZA 1JFRA 4QEKA 3ZI7A 3BJMA 2O2IA 3IURA 4K5QA 5FKJA 2EEPA 3TGLA 2W22A 2XQGA 1EDEA 5JADA 3NUZA 2IITA 1UWCA 4ZGBA 1JI3A 4TPKA 3H2HA 5JAOA 1QIJA 1TK3A 4BB0A 5EFZA 2PKYX 2XB6A 3NWOA 3V48A 5EIEA 4YASA 1WB5A 4ITVA 1WHSA 1XLVA 4UFPA 3BF8A 1GZ7A 3DYIA 2ZVDA 1VXRA 4XWGA 4ROTA 3VISA 3WKAA 1N5RA 1VJ5A 1SC9A 3WK6A 4PF1A 3YASA 4KAJA 1SCIA 5CT5A 2YASA 2B61A 1ZIXA 4B83A 3ZLTA 1VKHA 2VTVA 2QR5A 1E3QA 2GZRA 1OXMA 1CUIA 2WIKA 4LYDA 2ORYA 3DDUA 2WSLA 5LZ2A 1QO7A 4HXEB 3JYHA 2HA4A 2HFKA 4W1PA 2VQ6A 3JWEA 3AZQA 3IDAA 4OB6A 1R3DA 2WG1A 2YXPX 4EHBA 5T4FA 3ESAA 2Z8ZA 4PNZA 5AP9A 1XKTA 2RIPA 2WU4A 1ZD5A 1P0QA 4WCVA 5E4TA 4FBLA 4BE4A 4U2FA 5JATA 2QT9A 4RE6A 2JEZA 3S2ZA 2HA7A 5AK3A 2QJWA 5JANA 3PFBA 3CN7A 1GPKA 3STVA 5D3ZA 4X95A 5C8ZA 4J0HA 4QWMA 1GXSA 1QFMA 5EHNA 2XMBA 1A8UA 1EA5A 2XUFA 4MYSA 4DNFA 2JGFA 1CRLA 4HXFB 3B12A 2I3ZA 4XIIA 1R9MA 1QIHA 3H2KA 3FLBA 5HF8A 4B85A 4MEBA 4J0KA 1Q0ZA 1GKLA 3RARA 1GKKA 1MTZA 4UHHA 4KRXA 5AO9A 4ZI5A 2WUEA 3ESDA 1W75A 3IA2A 3S8YA 1HDEA 4B82A 5ALMA 2EDAA 1F8UA 1A8SA 2DSNA 2WHRA 4C4ZA 3V1NA 2X76A 3CCCA 1U8EA 4OYLA 1EINA 2G63A 2DHCA 2G4LA 2Y2UA 5ALDA 1SCQA 5FLKA 2D5LA 2AJ8A 4U2EA 1MX5A 1E8DA 4BYMA 5CH8A 1XZJA 1BS9A 3E3AA 4X6UA 3KOOA 1CUCA 1USWA 5A7FA 1QJ4A 5AI8A 4AQDA 1WHTA 1F0NA 3G0BA 3LIPA 3BXPA 1CR6A 2XMQA 4MWTA 1C4XA 2J3DA 4GDMA 3ICWA 4Y2YA 1EVQA 4FTWA 4KACA 2HL6A 1ZJ5A 2ZSIA 3WIBA 1QO9A 2PSDA 5LKRA 5JAUA 3STWA 3EBLA 3PUIA 1UK9A 3D5EA 4H7KA 2ACKA 1XRNA 2HRRA 1CFJA 1RYYA 4HRYA 4UUQA 1ODCA 4U2GA 2ES4A 4AZ3A 3BJRA 4QZVA 3O4HA 1J2EA 4DMKA 1YA4A 3WZMA 5T4HA 4ARBA 3EIOA 3I6YA 3I28A 2XE4A 4KYVA 5FXMA 5FPQA 3W06A 4J0GA 3UUFA 2C5GA 3ZV7A 4BRZA 1EB8A 3W05A 2XUGA 3WLAA 2Y6VA 1EX9A 1XQVA 1ZGCA 5DNUA 1VE6A 2XUKA 2CEKA 2G5PA 3G0CA 4NS4A 1UKAA 4WY8A 1R1DA 4Q05A 1LPMA 1VA4A 4Q34A 3QPAA 4YPVA 3CXUA 4WJLA 3K2IA 4G8CA 5CT6A 3B5EA 1MO2A 4Z49A 1TCAA 4UHEA 4DSAA 5AK6A 5AKXA 4ZREA 1UOQA 3C70A 4KAFA 2PSFA 4MQLA 3ZPXA 3Q8WA 1CUYA 1D07A 2Q0XA 3W2TA 4UHBA 3QBJA 4DMFA 1H23A 1XFDA 1OILA 1A88A 2OCIA 2GZSA 3BL8A 4MJ3A 2ZJFA 4INZA 2PX6A 4X93A 5E4JA 3EQ9A 4Y2UA 5FPPA 1ORVA 2WIFA 3WA7A 2QKYA 1XRRA 2ECFA 3DEAA 3L1HA 1CUAA 5LKAA 1THGA 4DMCA 3VJMA 1EB9A 2HFJA 5AM3A 5JZSA 2HU5A 5AKZA 3ESBA 5E2IA 1XRPA 5JAPA 2AJLI 3PFCA 3RK4A 5AHXA 4EY7A 5AI5A 1EXWA 1CUBA 4W1QA 2VJBA 1HLGA 5C8XA 5HF5A 1VA5A 2PUJA 4EB0A 4HVTA 1XZDA 4AO8A 3V1LA 4G8DA 5A62A 3HXKA 4A16A 3DL4A 4QDTA 5AI6A 3L1IA 4Y2RA 2ZYHA 5LYYA 1UXOA 3O4GA 3FYUB 4HXGA 4OU5A 3VKFA 4NVRA 1UOPA 2DCMA 2WHPB 3E0XA 3QM1A 5SYNA 1TQHA 1XZFA 1MX9A 5J3JA 2JGJA 4FLFA 1VLQA 3CCBA 5K3BA 4UBJA 2AJDA 4UBLA 4TVKA 4BC1A 3FNBA 4FFVA 1DTEA 3C8HA 2VA9A 5KREA 1CUHA 2WTNA 1VZ3A 2WLSA 5CT9A 5AI0A 2QVBA 1B6GA 4X91A 2DR0A 5HKAA 4BVJA 3R41A 1WPXA 4GI1A 2JGEA 1YB6A 3RM3A 4B9EA 3WWDA 4XVCA 2QS9A 4RPCA 4UBIA 5CTAA 4UBKA 2JEYA 1XZLA 1BRTA 4A5SA 3N0TA 4JEIA 1CUXA 3M3DA 2G5TA 2V97A 2XUHA 1R88A 1CUGA 4UHCA 3ZLVA 4FHZA 2Z3ZA 2B4KA 3OM8A 4FNGA 4G4JA 2B20A 4V2IA 2WUFA 1P0MA 3V9AA 2FX5A 3VVLA 3E4DA 4DLNA 1UKCA 4MEAA 3LS2A 4J0JA 5CT4A 5ALXA 1CUSA 3F96A 5D6OA 2B9VA 2WFZA 1XZAA 3GA7A 2PBLA 5JALA 3D4LA 1N1MA 1XZBA 1UZAA 2OGZA 1RP1A 3H2IA 1Q83A 3GBSA 1LPAB 1H2YA 5DTJA 4FLEA 5IH7A 5AM1A 5LP1A 1LBTA 3WQHA 3UMJA 2O2GA 2WILA 4G4IA 4FDMA 3WMRA 1CEXA 1DQZA 3LLCA 1DWPA 3QITA 3C45A 3C8DA 4OUKX 2DQZA 3IBTA 1U65A 3FVRA 4FLMA 1IMJA 1BU8A 5ALPA 5AKEA 3SK0A 4QA9A 3O0DA 3PF8A 1IZ7A 5C8VA 1TCCA 3O4JA 2WM2A 2WG0A 4KE9A 2FUKA 1G42A 1XZGA 5EIAA 3PF9A 4YK7A 1MPXA 5ALTA 3WKCA 3HACA 3FSGD 3C5WP 3G9UA 2XLCA 3IUQA 1CLEA 4AX4A 4UHFA 1R9NA 2WQZA 1G66A 4NZZA 4B80A 2XUOA 3R3UA 3WWPA 3QH4A 2WJ6A 1BCSA 4BE9A 3DQZA 2BCEA 3WIOA 4CG1A 1QIDA 1WB6A 3LIIA 4ARAA 1UOOA 4ETWA 1JJFA 3WYNA 1EDBA 2H1IA 1ZIYA 4X92A 5LLSA 3QZUA 5ISMA 3AINA 4W9RA 1C7IA 4L3WA 5DTIA 1EK1A 4W1SA 1P0PA 4OCZA 1TAHA 2Y2VA 1IVYA 3IULA 5FRDA 5A2GA 1EHYA 3AJAA 3G0DA 2OPHA 1LLFA 4NMWA 3WZLA 1A8QA 4HTAA 4BDTA 2BUBA 1AMNA 3ICVA 5A6VA 5ALGA 4OYYA 3HLKA 2HA2A 1WCYA 4Y9SA 5AKLA 2Z5GA 4X7BA 3P2MA 2JF0A 4O08A 2QMQA 1AGYA 2HHAA 3K9BA 4Q3OA 1E8NA 3R3ZA 4Y2SA 1Q84A 5JIBA 5ALRA 5F4ZA 5JD4A 2QOEA 4DMHA 1XZEA 3I2HA 1E89A 3O9VA 2WTMA 4WDQA 1JU3A 1LZLA 2RONA 1AX9A 1H2WA 1Z68A 3BE8A 3F8SA 4BAGA 1RWQA 4ZRDA 2R11A 4J0DA 2IIVA 3DLTA 2J4CA 4KE6A 1CUFA 4LHEA 3ZLUA 7YASA 5T4EA 2WG2A 3WKDA 2XMDA 5ALKA 5DYTA 3KWJA 2CJPA 2Y1KA 5HZGA 5CT8A 1ZD2P 1AUOA 2PSJA 3AIKA 3I1YA 4N8EA 3D7RA 4DM7A 4D9JA 4IH9A 3DS8A 4JYPA 5ALIA 5AOAA 3WL5A 1JU4A 3WK8A 3Q0TA 5D7BA 5CURA 4B9AA 2HA3A 1LPNA 1JJIA 4KE8A 3PDCA 3SWWA 1AQLA 1BEZA 2HA0A 3KD2A 4Y2QA 1IUNA 2GYWA 4ZV9A 4J0CA 2EDCA 4YX9A 2C0PA 1CV2A 4DNPA 2PU7A 2BKLA 2XMGA 4H0CA 3WWOA 4LKOA 4UFNA 1CVLA 3SC2A 3VJLA 1QTRA 1ZD4A 3BWXA 3GUUA 2XUJA 1IZ8A 5ALFA 5LZ7A 5K3FB 1DX4A 1S8OA 3ANSA 4Y2JA 3TJMA 1MU0A 3GROA 4M0FA 1PFQA 5BWCA 4OB7A 1H2XA 5AKYA 4TGLA 4B0PA 4QDXA 4KJXA 5JARA 1K6EA 5AICA 1W76A 2YH2A 5FDFA 4RNCA 1GPLA 4IO0A 1GQSA 3DYVA 4IHAA 2HU8A 5BV7A 3VDXA 2ZYRA 1ZI6A 4H7HA 3QYJA 4C88A 1VZ2A 2VF2A 1W52X 4E15A 3AFIA 5ALVA 1IUPA 1LPPA 3FYUC 4Q3LA 4F21A 4H35A 1AKNA 2GYVA 3ANTA 4BZWA 1TCBA 2DHEA 2RGUA 3FCXA 5JD5A 2QUAA 1HQDA 2HA5A 5AKGA 5AKKA 3K6KA 4Q82A 4G9EA 1HKHA 3I2IA 3F9CA 1TRHA 3TEJA 2XUDA 1ZI9A 5E4YA 3WJ1A 1KEZA 3QMMA 1CUDA 1WM1A 4W1RA 4K6HA 4Y2TA 1WPRA 2LIPA 3STYA 4JNCA 4PO3X 2BJHA 3HJUA 4MXDA 4Q1VA 3T52A 1UK8A 2PUHA 1E66A 3FYUA 3IB3A 4DTCA 3NGMA 3QMVA 1CUWA 3FOBA 4W63A 5K5EA 3G7NA 4C01A 5AH0A 4WDRA 4X94A 1GQRA 3EF3A 3R3WA 4WFJA 1ZJ4A 4KAAA 1HPLA 2VSQA 4AXBA 5BOVA 1SCKA 5ALJA 5HFAA 3I1IA 3O9MA 3LP5A 5IKXA 5CMLA 1QTIA 1QLWA 4B84A 1SFRA 5D3KA 4PW0A 1JJBA 5ALUA 2J3QA 4UBMA 3DOIA 5JASA 1AZWA 2H7XA 2XMCA 3D2BA 3H18A 2C5FA 4H7FA 1K8QA 4BZZA 3WJ2A 4MWSA 1LBSA 3D59A 1C7JA 1YCDA 2WHPA 2X8BA 4CFSA 4P9NA 4GECA 4UFOA 1R50A 2DQYA 5EHZA 1ETHA 2OLEA 1UFOA 4UHDA 4ZV7A 5IVKA 1J06A 3WK4A 2C58A 1L7RA 1ACLA 3C6YA 3HC7A 3NOXA 3DD5A 3GFFA 3W04A 4BC0A 1W6RA 2DHDA 2QM0A 3OTQA 3WKBA 5IVDA 1DQYA 3WA6A 4P93A 4PSUA 3ED1A 1W1IA 1T4MA 5KWJA 3MUNA 1CUUA 4BTVA 2QZPA 1K63A 5ALHA 4UBNA 2I78A 2JBWA 3ESCA 1XRMA 2GBCA 4OD0A 5JAHA 1YB7A 5K3EA 2CKMA 1GPNA 5T4BA 1LPSA 1T2NA 1DWQA 4DGQA 4QE3A 3QVMA 5FV4A 1VXOA 2OGTA 1O6GA 3WI7A 3DNMA 1MX1A 5IVIA 3STTA 1QIIA 4DYHA 1ODSA 4J7AA 4QNNA 3GZJA 4H7JA 5AI4A 4LYEA 3F97A 4GWLA 2HM7A 5SYMA 3I2FA 4FMPA 4EY6A 4IQ4A 2BFNA 4DNQA 2RHTA 1F0PA 2OCGA 1ZD3A 3FLAA 1PV1A 2HRQA 1WOMA 1XLUA 3OC0A 2PSHA 4L72A 2XUPA 2WFMA 2VAXA 4Q3KA 4HZGA 4BAUA 2ROQA 1DT5A 1XQYA 3GELA 3DJYA 2QXUA 3A2LA 4X6YA 1GT6A 1FFBA 1FJ2A 4UBOA 1N5MA 4F0JA 3R40A 3D3NA 1K5PA 4N5HX 2O7RA 4ZXFA 1CPYA 1HBJA 1ORWA 3KXPA 2OAGA 2UZ0A 1XZCA 1I6WA 1Q0RA 1QGED 2C7BA 3M83A 1LPOA 2JGIA 2OQVA 5DNWA 5ALNA 3IIIA 5AM4A 1G5FA 1MT3A 3FWHA 3G9ZA 4OU4A 5DLPA 3WK9A 2XQKA 4BTLA 1HL7A 4FOLA 1DT3A 1UKBA 4XX1A 5HFNA 3O4IA 3FLEA 1TKRA 1XKLA 3OPMA 3R0VA 4HAIA 3STUA 3C43A 2AJBA 4FKBA 1VE7A 4X00A 5C7YA 4HRXA 1P0IA 1XZHA 5CBKA 4OB8A 4Y7DA 5EHQA 4AB1A 3H19A 2HDWA 2VT6A 4GLBA 1F6WA 2XUAA 2XMZA 5AIAA 6YASA 4RE5A 4BATA 3BF7A 4C4XA 1MNQA 4B81A 2K2QB 4EY4A 4N8SA 2XMSA 4X6XA 4GW3A 2XLBA 4BCBA 1BCRA 2NW6A 4UPDA 4Y2VA 2VATA 3EQ8A 4FNMA 1QIKA 1W4LA 4B6GA 5A7HA 1QIFA 3H2GA 1EVEA 3V1MA 3DKRA 2OCLA 4G5XA 1H22A 3AIMA 5DYYA 2IX9A 2HIHA 3AZOA 4H77A 1MJ5A 1WB4A 4A23A 4U2DA 3HZOA 2WFLA 4LXHA 2VT7A 5EGNA 4EUSA 3FYTA 3C6BA 1QE3A 1EDDA 1A7UA 3PE6A 5IVHA 4B0OA 3I2JA 4S0XA 5EIHA 1QOZA 1KU6A 1PJAA 5EHXA 4DIUA 3A2MA 4K2AA 4PSCA 4H18A 3STXA 1LGYA 3WYDA 4E11A 4RGYA 5A71A 1ODTC 1O6FA 5KWIA 4M0MA 1J07A 3D2CA 5ALLA 2ACEA 3LCRA 4HS9A 5CH5A 1B41A 3M81A 5ALQA 3BDVA 3BIXA 1G4HA 3D2AA 3G9TA 3I6MA 3R3VA 1YR2A 4E14A 5LZ4A 3AIOA 2VJDA 4N8DA 2C4HA 1XROA 2Z8XA 3HEAA 2Y6UA 3VJKA 1FSSA 4X97A 1Y7IA 2OXEA 2PU5A 1H2ZA 3B3QA 4FFWA 3ZWQA 3H0CA 5JD6A 1LNSA 3WK5A 3PI6A 4IH4A 4JYMA 5CH3A 2CZQA 2OGSA 4Y2PA 2XDWA 4EY5A 3FSGA 4K6GA 4C4YA 1DU4A 2PM8A 5AK5A 2X5XA 4BVKA 4H7IA 5K3DA 1R4ZA 3WK7A 1EH5A 1JKMA 1DX6A 1UK7A 1MAAA 4G1FA 2BGRA 4H7EA 4H7DA 2BUCA 2VEOA 2JIDA 3WWCA 2D0DA 2PVSA 3MGAA 3HABA 4BAZA 1BE0A 1XQWA 1CUEA 1MNAA 5ALZA 1BEEA 2CUTA 3H2JA 2XI4A 3G8YA 1AURA 1ZICA 5JZBA 2BUAA 3FCYA 2AJCA 1XLWA 4U2CA 3OG9A 4EY8A 1N8SA 2R8BA 2AXEA 5K3AA 4KEAA 4BDSA 4CIAA 3W9UA 3FVTA 4CCYA 1EK2A 2ZSHA 4QWWA 3L1JA 5AM2A 4J0IA 1XQXA 2XT0A 1QIEA 1U2EA 4BCDA 5AM0A 1XZIA 5AJHA 1BN6A 1ACJA 1LZKA 2JGKA 4KE7A 2W6CX 3AUKA 2GYUA 3KSRA 3EQ7A
chains in the Genus database with same CATH superfamily
1JIIA 3RSOA 4KX5A 3DM5A 1BVRA 3E2MA 3EFOB 4KKVA 4L8YA 1XELA 2GPBA 3OEHA 5DOZA 3ZHSA 3D7MA 4DJ5X 4NMHA 3QP9A 3V1KA 1KYQA 2EFJA 3TOVA 3WY9A 5ENZA 5EWJA 4XD7A 1OC4A 2C0QA 2P9QA 2RAUA 1KDOA 2IYOA 2VUTA 3SOPA 2NTVA 4Q3BA 5K2MA 3ZWKA 5KNBA 2V9ZA 1XIVA 3B9BA 2Z3WA 4RVOA 4DQVA 1MIHA 1GZ4A 1Z6QA 2PZGA 4MQ5A 3RYHB 3MMNA 1TZ2A 5GONB 1L8LA 3MFYA 2PX0A 2BFDB 4P3KA 3GJ3A 4PRYA 4D96A 5CLLA 4WZBB 2VTBA 1ZM7A 1J56A 5H1YA 4QG3A 1DAGA 2A30A 2QVZX 4JT4A 4Z4FA 4BRWA 2BJWA 3RYIA 2J4DA 3QELA 4CNBA 2OK7A 3HKCA 5CG1A 4XPIB 2OQIA 1XRLA 4N0PA 3DCNA 4PXSA 3W2GA 2BGLA 1LQ2A 3FBWA 1GAQA 3HUEA 5TPZD 2IZZA 3SQOA 2F1HA 4XWKA 4U7PB 3QUBA 1E6WA 3KR2A 3KSDO 3KVOA 4RELA 3WMXA 3ICEA 1GPBA 2CXSA 4TTSA 3C14C 4XAQA 2Y1CA 2PCJA 3DBVO 2HV8A 4FMCF 1DV1A 2AJTA 4AG3A 1UMBB 1VQ1A 2EZTA 2XB2A 4DA7A 2X6QA 1M1YE 6NULA 2QLTA 4LV5B 3HXLA 3E27A 5SZHB 2ZWOA 4NHEA 5FYDA 4FWBA 1GARA 1RM3A 3A05A 5LA6A 2QDKA 4PSAA 1EP3B 2LUOA 4OH1A 5DRYA 2X9GA 4A7PA 4BQOA 4U2BA 3AJDA 1HMPA 5F1KA 5FHRA 1LK5A 4HDMB 2HUPA 3HYSA 4LXYA 3AXTA 2OO3A 3OKPA 4MWOA 1V6CA 1M73E 2IRWA 3TLKA 3TM5A 4TYWA 2X9VA 4O8ZA 4C89A 5A5VA 1J2TA 1W85B 2PTGA 3PXBA 3MILA 3G23A 1RXVA 1M33A 3KKEA 4BRSA 1JFVA 2EW2A 2KX7A 2JZCA 2P69A 3MCAA 2OCKA 5AUQA 4PS0A 4CL2A 2CVOA 1DEXA 3AXSA 4PYOA 1BGXT 3GNQA 4WY5A 2B36A 3DE4X 4QDUA 4L9SA 4ZC1A 1P8AA 1R5BA 2ZRLA 4DPMA 1F0YA 4LXGA 4F4FA 5EJGA 3K8YA 2FEAA 2V6MA 5E7MA 5F5NA 3U4QB 4P0PB 5IK2D 2FEOA 4HRVA 4PC6A 5B3JA 1P7YA 1TLFA 3OVMA 5CD9A 2ID9A 4QBFA 3SXJA 2ZAYA 3FFTA 1Z7EA 2D3WA 3QXHA 2XVMA 4URVR 3ED5A 5DPMA 5K3SA 1TZJA 1WSBA 5TR9A 5JSKA 1RLJA 4BQNA 4HN2A 5HCNA 5IAKA 1EX6A 2IY7A 5E6SA 1M34B 4D8VA 4X65B 4ERNA 3ZQUA 1D8TA 3DBLA 4P08A 1E1CB 1KMHA 3O95A 3Q8MA 5H3HA 3AO0B 3LF1A 4IYJA 2VR1A 2B4QA 4E13A 1RQRA 1AZTA 1V48A 2YDYA 3HYRA 4QLAA 4YP5A 1GLVA 1EFHA 4RVFA 4A73A 3WLRA 3HXPA 1RPJA 4BB5A 4GI2A 4AD8A 2EOAA 5CAEB 4CUKA 3RS5A 1AB5A 3N8IA 4W5NA 3ECSA 1UM9A 1XD2B 4DSZA 4NZYA 2FUEA 3D2LA 5GJWC 5K8LA 3DOHA 2PA0A 4LHSA 1JR3D 4D82A 4JVSB 5EMKA 2D8AA 1I1OA 3PHLA 1P2UA 2PLAA 4C06A 3G5LA 3K53A 5DGXA 4IFEA 5FR1A 2AXQA 1EVKA 4MVJI 2PUCA 1K7CA 1L8AA 2MSLA 4G8BA 5E0KB 4TV9B 1NQXA 3U44A 3BL5A 4F7WA 5ALYA 4HG2A 5I7UA 3OC6A 2FUCA 2HKIA 5DNDA 2AR7A 4C2BA 4F12A 1OR8A 3KSMA 3DYBA 1EK0A 3AZPA 1PGNA 1FFCA 1N5DA 2FPLA 3W9BA 2P78A 3H9EO 3X43A 1S6YA 3W7AA 1E8MA 2R6JA 3C87A 5JS8A 4C20A 2O7VA 2DBZA 1IWPB 2GLTA 1UUFA 3E3LA 4ENPA 5C7IO 1WX1A 2HCTA 1PWXA 1UL1X 5FI5A 4AG6A 2SKEA 4HXYA 3P0FA 5SZIA 4MAAA 4U6NA 3E3OA 1CU1A 4QPPA 1XRJA 3EMBA 1Z4IA 3WYFA 5KQPA 5ALWA 2A67A 1DG3A 1H69A 3N39C 2JZOA 4RMNA 1Y1SA 3VR4H 1J2UA 4ZWNA 2X9LA 1RRMA 1T36B 3AY3A 3H16A 2CMFA 2ISSD 1D6SA 1AUVA 4K9DA 2NZWA 1T3SA 3FOWA 4REQA 4IEEA 2OORA 4PGMA 2XIJA 4J9VA 1LTHR 1S4QA 2J31A 3JU3A 2IUTA 3D7LA 4BPBA 4QOSA 4WBNB 2OKCA 4M9XA 2E5WA 3GX1A 4LE1A 1YOVB 3UXMA 2XT6A 3ABIA 1T34A 3OAAD 4WQMA 5HDBB 4XLTA 4RQBA 4YT4A 1EUCB 3F98A 1P1KA 3MHPA 3QPDA 1L5YA 1NMQA 3D8BA 4OGFA 2JCSA 1WCWA 4P53A 4M0EA 3RO7A 4AAYA 4C21A 2ERCA 2OPBA 1C0IA 2PFSA 4LOJA 1MC8A 3OFSA 3PYMA 4WX2B 1X1QA 5B57C 4NXNB 3W2FA 1WF3A 3F2VA 1BROA 5JROA 5C9ZA 2ZTVA 3CV3A 1YS1X 3KEQA 3BB1A 3NBYC 4COOA 2KS6A 2RGAA 3M2PA 3KSAC 3QHQA 1XPUA 5IAJA 3TTYA 1U3TA 3P2KA 3PFWO 1NATA 5FD8A 3K1TA 1MHTA 1UBOS 1KR5A 1G3UA 3K7EA 3V1TC 3BSWA 1W87A 2QIPA 3F6YA 3G2QA 2CYAA 3AERB 3UHPA 3HJGA 4QEZA 2HF2A 3PNBA 3VHRA 4MRAA 2ZB3A 3WLPA 4CQMA 5CDTA 1FMCA 1E5LA 3GVCA 4E88A 5K8CA 4ZT6A 2PO7A 3KKMA 4GKJB 3MUEA 4OJMX 2Z5VA 4KW7A 3KDSE 4W7IA 3I76A 2JGDB 2O2CA 4TYPA 2IYRA 4CCWA 5FOQA 2C8LA 2H17A 2Z2KA 3CKYA 4L5CA 3QMWA 4JP2A 3ANYB 2HRDA 1W73A 3H04A 3X2SA 3CF6R 4ZJZA 5ALOA 1YRWA 3QKUA 1ID8A 1CY6A 1VIAA 2GTIA 4CG2A 1FFAA 4TMWA 1SOMA 1ENOA 2PSEA 3C1TA 4TSFD 4EZEA 2YXLA 1NJ5A 1GL6A 3CUYA 3P32A 4IOMA 5ARDA 3ONFA 4HLCA 3WQQA 3CPSA 1CCWA 2L69A 4F71A 3CVYA 4BO0A 3E1SA 2HR1A 1GL3A 2WUGA 2FEPA 1RJGA 5CTJA 3PC7A 3EA4A 4JI3B 3F8WA 4B34A 3IMFA 4XUDA 3F6CA 3FCAA 4N39A 5C80A 7MHTA 1IC6A 3FWPA 3G2LA 2R86A 2A9JA 5DMXA 4NESA 2QRVB 3L1UA 1QGOA 1DSSG 3L8MA 4BO2A 2FZLA 1MA0A 1KFBB 2PGLA 4QTUB 2VJCA 3RAJA 1GRNA 1B8VA 1SH7A 5JFGA 1XPJA 3EEQA 3MUOA 1Y1LA 5I9LA 4JYCA 2FMFA 1UJ5A 2EGHA 3DEZA 4H27A 3SSNA 4AJLA 1SQ5A 2NXJA 2DPYA 2QTBA 4HO1X 3SKYA 1WTAA 2P11A 3I61A 2HJRA 5SZKB 4FYHA 1YS2X 4NMMA 4DDTA 5CDSA 5ARBA 4YQFA 3FROA 3DKVA 5JJ5A 2ZYIA 2E3JA 3AHCA 4KZKA 3TRDA 2RHWA 4MW5A 1SUCA 1ZX1A 3QW2A 4PWZA 3M3HA 1MN6A 4PSDA 3NBFA 3KPWA 4R6WA 2GXQA 4CLRB 1YRHA 4GX1A 1JKFA 2HRZA 4YDSA 5LIPA 5DSZA 3DH0A 3O38A 4JVOA 3TSAA 1EZZA 2J87A 4DDHA 5KOHA 1V8BA 4Y7CA 1I7PA 3SC2B 4AO7A 2LWIA 1CY4A 5I9IA 5F77A 5EIFA 2VOJA 3UGQA 5T3YA 3ROZA 1BWQA 1Y7HA 2LDBA 1FYEA 2WHQA 3JSXA 2HJHA 1CYEA 2WY2D 2RC6A 1BN7A 1M8KA 1MGOA 2BFPA 2X0NA 3C98A 3L46A 4OAQA 3ZOZA 2E37A 2IC5A 2PMKA 2COKA 3OZUA 5HF6A 3WQRA 3B36A 3EODA 2BGGA 2V98A 3RVRA 3PYLA 2CHUA 3CGGA 1RJEA 1SBNE 5TJ9A 4CF6A 2WSIA 4JLUA 1NBME 4IYRA 3KOMA 3EY4A 2YW9A 1R12A 5HQ3B 2GN6A 1T9BA 3PR3A 2H4JA 1WZ2A 1JDBB 1T5IA 2R44A 1I7LA 1KTIA 3W8EA 1FE8A 3KWFA 2J4FA 4JJ7A 1XYGA 3TCNA 5KKCA 5KWSA 2WPDD 4P5EA 3ME5A 4QUDA 4U7FA 3TOZA 3QXCA 2Z5LA 5LDGA 1D7AA 4J7XA 4L08A 3CRW1 2F67A 3KOXA 1WMSA 2FN3A 2IF0A 2LPMA 3C6QA 4H2DA 4MW6A 4ZARA 5I9NA 1X1AA 3DGEC 5DNVA 3DCYA 4D0LB 5FQOA 4DQDA 3L7IA 4LIPD 2Z0MA 1MV5A 3R0XA 4OGKA 2DFPA 1OXTA 1NU6A 2ODWA 4HB2A 4EKIA 4V1CA 3KQMA 3PP8A 1A9YA 1PBNA 5LZ9A 4AY6A 2VNAA 3KYDB 3H5WA 3RYTC 5LR6A 1MQ9A 4OHKA 5EKTA 5I8PA 3DNFA 3SG0A 1KQFA 4O8CA 2AT1A 2ZT8A 4IHKA 4F3RA 4DJJA 2JLCA 3IAHA 4R16A 1DV2A 3I2KA 3O1IC 4Q01A 5DWDA 3GEEA 4E70A 5HVNA 4E3WA 1Y48E 3JQCA 3HSSA 3WXBA 1L9XA 1R8QA 1UODA 3SXUA 1PR6A 2WKWA 4BMZA 2J0VA 1JFRA 1HKUA 4QEKA 1KP2A 3ELWA 3TQQA 3C15C 1TJPB 4EZBA 1NW3A 3LRXA 3M6IA 4P4SB 2O2IA 2EEPA 3W5IA 3GMTA 1V3TA 1OWPA 2XQGA 2Y71A 3FFAA 2PT9A 4QVKA 4GR5A 2RKBA 4HNQA 4C0SA 2RBEA 3A4IA 1R8SA 1Y82A 4C1BA 1GNRA 4TPKA 4X20A 1KJNA 4LN1A 2I3BA 3PUZA 1RBMA 4X45A 3AR6A 2WMNB 5JAOA 3RVJA 5KYWB 1QIJA 4URWR 4XQEA 1TK3A 5HWSA 2AZXA 1ZH2A 1OZGA 3LLSA 1QDUA 4MICA 4ZO7A 1VCNA 1J9EA 3WLSA 4CF3A 4HDMA 1AXGA 2BKAA 2IHBA 4X8OA 2E4YA 1AV6A 2VSFA 2Z1MA 3IQWA 1PAUA 2N46A 2I8CA 1G5RA 1G6Q1 1BGWA 3ZV6A 3P96A 5EIEA 3EXAA 1K9VF 2I3GA 3KQTA 1PG2A 1WB5A 4JBNA 2I6UA 5C0OE 5LUAA 1N2JA 3EJ6A 3MBKA 4NG5A 3QBDA 4UFPA 2JNWA 3DYIA 4M37A 1KEEA 2H92A 2ZVDA 3DXFA 1S2MA 1IPHA 3BXGA 1YS9A 4PICA 4P36A 4YCJA 5LIRA 1VXRA 5C52B 3LTNC 1W9HA 3FZGA 4U7TB 2ALJA 2NPOA 1JZQA 3LBNA 5EIBC 4HVLA 3WK6A 4CGZA 1IMOA 2HXYA 3WLFA 4BVGA 2F3QA 4EFDA 1KA9H 1RS0A 1XEXA 4IIFA 4B40A 1E2NA 4DV7B 1A9PA 3TLGB 3B20A 4CV0A 5CT5A 3P9SA 2B61A 1E2PA 2E18A 1ZIXA 3CNOA 3A6HA 3PDHA 4BNIA 5F21A 2HHCA 3GDWA 3HYTA 3N7UA 1RXEA 3FUVA 2ZSEA 4S12A 2Q3EA 4W8HA 1QFZA 4WZBA 2QPAA 1U7ZA 4QUJA 4EKNB 1QORA 1OXMA 1X6VA 2WBLC 1O95D 3H84A 3INGA 5CB6A 3VNUA 3E7XA 5LWQA 2I2XB 4EG1A 2A2ZA 3J81k 3ILXA 3TCXB 4JSYA 4YO8A 2ORYA 3VU3A 1SAYA 2NZYA 5LCXA 3DM9B 2VK2A 3K5IA 3DHVA 3DMFA 3NOOA 2CDCA 2WSMA 3UN1A 2VP9A 5LZ2A 5EMJA 2WU0A 1FF9A 4BV8A 2NZ2A 3LV8A 1CD5A 1DKNA 1GYRA 1Y1KE 2HFKA 2WEKA 2O0LA 3GCWA 3L6DA 1RZ3A 1IQRA 2VQ6A 1JTVA 3O8QA 3QKRA 4NOKA 4QOIA 2NYVA 5DBHX 3F7NA 3K05A 4WKBA 3SX2A 4OB6A 2RHLA 3TDNA 2PGIA 2JB9A 2FQWA 3HE3A 5CA0B 3U13A 4F4HA 1YWGO 1DEHA 3BK7A 1Y8RB 2NT4A 1KK1A 1VYHA 4YAJA 2Y9MB 2VUSA 4Q1EA 4X1IA 1JFFA 1UT5A 2JFVA 2YZGA 2Z8ZA 4QOFA 1AGNA 2FCRA 2F3UA 1KKMA 2W4MA 3DHWC 5C1OA 1ZD5A 4GC5A 2C2KA 3VNBA 4R1SA 2P65A 2ZTMA 4QJBA 1EFRA 2C2GA 4FBLA 1CQIB 4JJKA 2V6JA 4PPGA 4U2FA 4TL6A 3RVQA 2BFCB 1JDSA 4GXRA 3W6ZA 1HFEL 3WBFA 1HZZA 3BD6A 3HFSA 2JEZA 4ZZ3A 1F5NA 3AFHA 4U3JA 2A9OA 3HKCB 1HNZB 3PFBA 1D7OA 3PXXA 1Q0UA 1C3XA 3CN7A 2I99A 3ZZMA 3P9KA 5CNIA 3VR6D 1HQKA 3STVA 4TL7A 5KI6A 5K1ZA 1DC4A 1JE0A 2B99A 2Y0CA 3FDZA 2C04A 2V7PA 4M8SA 4X95A 4EFMA 1URPA 3KX2A 1M2WA 2FH5B 4QWMA 2JLXA 4B3TB 3RSSA 4IP0A 3IV9A 1XZNA 1A3CA 5EJFA 4LVNA 1PJRA 2OXRA 2DJ5A 4GLOA 3VTKA 1R10A 5HRAA 1JJAA 2F1KA 4X60A 5K0SA 5BOSB 4CUJA 3DQQA 3PPYA 2PKRA 1EA5A 2N42A 2ZBEA 1BMQA 1L5WA 3AW8A 1JN0A 4GL4A 4E2WA 3EZFA 1O95C 3PNMA 3IAAA 3Q72A 4HH3C 1HDZA 1U1CA 3KL4A 4HXFB 1BRMA 2H48A 4EBFA 4Z5XA 2VL7A 4DRYA 5CB8A 1UEIA 4FMBB 1FW6A 1MHPA 2GJAA 4MQUA 1ZUNB 2WOOA 3L8FA 4REQB 1S3IA 3PGKA 4YUWA 3B6EA 5JRZA 2AMVA 1FP1D 3H2KA 4KH1A 3VOAA 1JEQA 2ODNA 2Q1YA 1IWOA 3JS5A 4MEBA 4C0KA 3JQEA 2CFTA 4EL5A 2P5SA 3U7HB 1QU3A 3W5SA 4JQOA 1V6SA 1PT6A 3AUXA 4CT0A 3ZJVA 3DW3X 4CBVA 3RARA 1IRXA 1GKKA 1ZJZA 4MKGA 3SKVA 1L4GA 5K7SA 3FUTA 4QPJC 5AO9A 13PKA 2C96A 1UJ6A 2FWJA 3HV2A 4N5NA 1VCOA 4QOHA 4TN5A 2CCJA 4RNDB 1M67A 5G3ZA 2WUEA 3S2IA 3DP9A 1ZXBA 1W75A 3AF2A 3AVYA 3AEXA 3ZZ1A 4GXQA 3V8PA 4B82A 2CLDX 1JSCA 1HE5A 4YALA 3U6KA 1N7IA 4ZAXA 1P9NA 2DSNA 4TKUB 2WHRA 4DZRA 2QJOA 5REQB 4LFBB 1CJSA 3PX2A 2IZ6A 2JAPA 2BGMA 1D6MA 2X76A 3CCCA 2GWHA 1G20A 4EO4A 1INLA 2G4LA 4PC3A 1OQAA 3MWFA 2BF4A 1D03A 1M2GA 1W19A 2QRJA 5JPIA 3HUFA 4M9ZA 2D5LA 5FLKA 2AJ8A 1YR9A 3FN4A 1GTG1 2UU9B 2WJZB 4KU4A 2IIPA 2NO9A 3PYXA 4J91A 5ICEA 5KUTA 3I9JA 2WD9A 3W3ZB 3KOUA 5BYBA 1Y1RA 4QKQA 3U7GA 3CGWA 4JELA 1M75A 4X6UA 1AA9A 3GLVA 1EFPA 2Q9CA 1WSDA 4R81A 1H05A 3R0JA 5A7FA 4BO8A 2CDNA 4FIZA 4G56A 3BWDD 5D51S 1QG2A 5F76A 2A1TR 2Z30A 1MDFA 3V8RA 4DR3B 1WHTA 4BX2A 1AA6A 3FTPA 1JIJA 4OQ4A 3J81A 5CVTA 1PD0A 1YB2A 4U3JB 1SCAA 4QD3A 4FOOA 2XMQA 2W2OA 4RPLA 3MLEA 1P4HA 4MWTA 4EGFA 3Q0IA 4DLVA 5KHOC 1O94A 2X15A 2ZYVX 4LC0A 3GGPA 3AESA 3FSEA 3EEOA 4D9GA 3IODA 4FTWA 2HSJA 3OIVA 1JIVA 2QZZA 3T7CA 1N3BA 4MDYA 3LCJA 1XYVA 4M98A 2HL6A 2DTEA 1Z25A 3I64A 4JX8A 3EIFA 3WIBA 2PSDA 1L4YA 3ZTTA 4UUAA 3UHFA 4RKQA 1GEGA 2CD9A 5FYQA 4HNRA 1M7BA 1NTRA 5FBHA 1UK9A 2CXPA 4K0RA 3OPVA 3FSRA 4IWYA 4RBNA 3TLMA 1XRNA 2WC1A 1V1RA 1YB1A 4YYEA 2HRRA 1T3HA 2BLNA 2YVKA 3A6EA 1H5UA 3B48A 3PG5A 1PZMA 2CL6X 5KYXA 3G2HA 1YDWA 4JGBA 4JVMA 3DBRB 4Y30A 3X1WA 4QQ8A 2W2PA 2YICA 3KFVA 4D6XA 2QQ0A 4UUQA 2RGGA 4MI9A 1HLPA 4BNFA 2CXRA 1FLNA 3OIUA 2W2XA 4U9IS 2BFEB 1K8ZB 1Q14A 4GMDA 4G0MA 1BFDA 2PL1A 2XAUA 4QZVA 3GRPA 4EUNA 1FUIA 2H29A 3IQFA 2GGSA 3KQPA 5EVCA 3FTCA 2FG7C 1U9IC 1YACA 2WMDA 3QPVA 1VPWA 4RKRA 1UCFA 1E2BA 4M7OA 4ZEXA 1L5LA 1YA4A 1ZHFA 3KTDA 4DMKA 5CLJA 3WZMA 2OESA 4ARBA 2C9BA 2ATVA 2C3YA 3IAS1 5EC8A 5JSZA 2A6PA 3QXSA 1W36B 2IBSA 4Z99A 4CFYA 2DAPA 5FXMA 2XDAA 4ZDKA 3B52X 4IZIA 4J1TA 5BN4B 3LUAA 1VLVA 4HBGA 1K6MA 1WAMA 1TGYA 1EFVA 1PRYA 1EB8A 1SXJD 3FWKA 3IEMA 1PGOA 4QT0A 3QU4A 4HMQA 3W05A 4C7JA 2OHVA 2I8AA 2NX2A 2RI0A 3SZOA 3QHPA 4FI3C 3GJZA 4N82A 4P3OA 4R8SA 4RXUA 5F5LA 5BYJA 3WLNA 2FZ4A 2IZ1A 3I72A 4UVDA 5JLAA 4D4MA 5BR8B 4MWDA 4WLEA 3B7WA 3EQZA 1VE6A 4G5OA 3C3BA 3W4IA 1H8HA 5AD1A 3L0BA 3SEAA 4I46A 4FEYA 2G5PA 3SS7X 2BI8A 1GGKA 2EZUA 2DFTA 2WZDA 4HLDA 2J9ZB 1A8HA 3HNOA 3T5MA 3BXZA 1EWRA 3F7MA 5THXA 1LW6E 2P6UA 4RDHA 4Q34A 5FBWB 3KJEA 2HW8A 1NKVA 3RS0A 1QX4A 2YYYA 1H4VB 2Z1DA 3HP7A 3QPAA 4YPVA 4J0QA 3M4NA 3CXUA 1A71A 3K2IA 3O4FA 1KXJA 1NF9A 4Q4CA 2X5JO 3HKDB 3VPSA 4ZXPA 4F4DA 3S81A 3I5UA 3ZVMA 3AY0A 5LJLA 4PR0A 1BS1A 1LI7A 3MRXA 5CNKA 5TC4A 4DUZB 4DSAA 3LT2A 5AK6A 5AKXA 4N12A 4EJFA 1KJ9A 4HX2A 4F9FA 4QRIA 4YREA 3VO1A 5CYGA 2VPZA 3OSUA 2BTOA 4UE2A 3Q8WA 4IIVA 1R0WA 3SEFA 1D07A 3WJ7A 2EIXA 1T35A 4FDLA 2Q2NA 1Q1ZA 5FI0B 1ULZA 4D6YA 5L3SA 2YHUA 5JS2A 2ZP1A 3PEFA 4Y18A 1AKWA 4UHBA 3QBJA 4YT2A 4R8MA 1ULBA 2W83A 4FS8A 3LNCA 4X8MA 3X1ZA 1N2ZA 1XQ6A 3IUEA 2VT3A 4NC9A 4QBKA 5M34A 2OCIA 2BFFA 2HV9A 1KERA 1OJLA 2YIDA 1UF9A 3BL8A 3GNLA 1W34A 3AF5A 4LFCB 2FDXA 2VLBA 3VKWA 1E1LA 4D80A 1YZGA 2ZWIA 1NP6A 2QTRA 2NXNA 4YQZA 4ZVNA 1Z22A 4INZA 3VAAA 1EMDA 1NI4A 4FFBA 3REQA 3O03A 1MVOA 4Q3NA 4F11A 3LH5A 1Y3BE 3OHSX 1WEKA 3O2SB 4X93A 4I66A 4KVGA 1Z35A 2QF7A 3FDIA 1N8KA 1IY8A 5E4JA 1Q50A 4BB6A 3JQ7B 3MXTA 1G7TA 2P79A 2VHXA 2VPQA 4ZQCB 3THYB 3LWBA 1BMFA 5FPPA 3JVEA 4TV9F 4RTKA 3KKZA 1WMDA 4PLGA 2WIFA 4RACA 5TX7A 5DNYB 2OXTA 4IV5A 3BDAA 2IYNA 5EP4A 5K0NA 1ULSA 3HDYA 5FWAA 3MOGA 3O47A 2AEJA 5EE5B 1DCFA 3EOBI 1X7WA 2ETXA 2W6MA 1ORRA 1PK8A 4DMCA 4S0ZA 1C4WA 1IK4A 5KC8A 2QRPA 5CFNA 2VAMA 3LSYA 4ASUD 2VJQA 1RYHA 3KC2A 3LDFA 4YRCA 2EATA 3A3NA 1H2FA 4M7PA 3SEZA 4JOBA 4ENRA 2DXIA 3T7TA 3R09A 3KT3A 4B43A 1XU9A 2ZIEA 3R77A 3AFGA 4NHOA 1E9CA 4UDXX 4DA0A 1XRPA 1V5EA 1ORIA 2PSSA 3FCUB 3HZHA 1NAIA 1VYTA 2WWXA 3HA7A 3NHYA 1UDWA 5AJVB 3RJZA 4MVJA 5DWQA 2EFYA 2YQZA 2HK6A 3ZNNA 4MUKA 1K8XB 4MZXA 3UPTA 3GH3A 3OU2A 1GXSB 2V4MA 5E6RA 5ESDA 1U7PA 5TPWA 2ETVA 3WL6A 3IC5A 1RAHA 5AI5A 4GRIA 1QRTA 1PZXA 2ZYDA 1ADGA 5DHFA 1NF3A 2D7DA 2QRMA 4ECAA 3H5TA 1GGJA 1W581 2C4WA 4DVJA 5HF5A 1E9VA 2AH5A 2O3RA 1FQWA 2ECQA 1O03A 1WQ3A 1TX4B 2GLXA 3JQBA 1Y5RA 3PHHA 2F1IA 4E2YA 3OEWA 5IZCC 3IT3A 2PEZA 4KIGA 3UT5A 5BT8A 3AEYA 4YHBA 1S9HA 3T8YA 3V2IA 4ZN6A 1YHZA 3AVTA 3V1LA 4C29A 3GAAA 1GDTA 4A16A 1F6BA 2VYND 2Q1WA 1OAOC 4F45A 4QDTA 5AI6A 1JR4A 1T3GA 3C3PA 2IXEA 1KXZA 2FOIA 3OF3A 5B4UA 4EP1A 5LQJA 2ZYHA 5LYYA 3UQZA 5ICCA 2GCPA 4MPRA 2O06A 5A4IS 4E51A 2Z8YM 1Y34E 1P5JA 1MCZA 3ZD7A 1T43A 4HXGA 1JEDA 2C03A 4WZBE 1QSGA 3R0IA 4O63O 2VZEA 3HU3A 3F9RA 4IDCA 4JOCA 4Q6WA 5L3QB 2DCMA 3CSDA 2WHPB 1XAJA 1M8JA 2RGRA 3FGPA 3ZU3A 4FYYA 4YDHB 4ZYYA 5SYNA 4WVFA 1MABA 1MX9A 2A0FA 4LDRA 4FLFA 4LCBA 4M6WA 4QFMA 4UBJA 2HLDD 3OOWA 4BC1A 3ZE7A 4DV0B 5FB3A 3FNBA 4MVJP 4NIMA 3PUJA 2VDJA 5D7NA 4QO7A 5JWRA 1CR1A 2Z9DA 1Z38A 2Z6AA 1Z5PA 1CUHA 1CZHA 1EPUA 1AK2A 5BMVF 4KGDA 4MVJG 4LZPA 2O2YA 1Z5NA 2Z6VA 1OFUX 2LRHA 1A76A 4TQAA 5CT9A 1IE3A 1NN5A 4EM6A 2NNWB 2V7TA 2GHQA 5G1NA 1N33B 5C4MA 3BVPA 1GZSA 1CRWG 1W1UA 2VYNA 2P9FA 2YWJA 1FPQA 4NL4H 2NWQA 3IPLA 1H9CA 2NVWA 3M5PA 3B38A 4MV5A 1XCJA 1XG5A 3NHZA 4GWKA 1WPXA 1O3YA 4MDHA 4Q19A 4TMTA 5TQ2B 2C4VA 3A28A 3NG1A 1EGAA 2DOKA 2OG2A 1THMA 2WSYB 2YY5A 3E5HA 3T12A 3L7MA 2WQ7A 3E03A 4KO8A 1PT9A 3I3SR 5KTOA 3SSAA 1SUSA 4ODIA 1Y80A 1XTKA 1RM0A 3M70A 4N7JA 2D00A 2F4NA 2BEVA 5IVPA 4MV4A 4QQNA 3IH5A 1CUXA 1YB5A 1D2HA 2OV8A 2G5TA 3KTAB 4WGFA 4AY5A 2XUHA 3QEMB 3Q8KA 1ID1A 1KRXA 1N7GA 4FZ3A 1W5SA 4FHZA 3NALA 3IEIA 2Z3ZA 1DIRA 1FLDA 1N2HA 2MHCA 2OAP1 1D2AA 2Q5HA 1JTEA 4G4JA 3TPCA 4AUEA 1T8UA 3KQLA 2WUFA 2Z4TA 4FQ7A 3RHSA 3RV3A 1A2QA 5F12A 3EGXA 3UJNA 2DP4E 3T4XA 4U00A 4OG2A 4TTVA 1QAMA 3IVXA 3CZ5A 1L4NA 2GZ2A 4TV8B 3ZNQA 4BGVA 1WOYA 5FTMA 1ZKDA 3RJ9A 3VVLA 2J9RA 3OHPA 1N4AA 1MTOA 2HSWA 1V1JA 2IY9A 1CQPA 4NAHA 2LR0A 5JCJA 1E63A 1VKOA 1N6PA 3VR5A 3C1OA 4J94A 1ABBA 3LD9A 3WYEA 3VV2A 3OE1A 2OV3A 2JLUA 1JAHA 2O3TA 5B1YA 1W5AA 3VPFA 2UVPB 1XMOB 4KYUA 5E1BA 5CT4A 2O5EA 3I8SA 1YR1A 5BVHA 2ZSFA 3R9XA 1KJJA 5I3CA 3F96A 1Z2EA 2B9VA 2GN8A 4IPTA 3H9BA 3AOEC 4G97A 1D0IA 5AK0A 2IEAA 5BWNA 3TDKA 1J23A 1XZAA 1VBNA 1F1JA 3I04A 4ZTZB 2AI1A 5J2TA 2ZT7A 2YWEA 1M6WA 4NZPA 3EPPA 1DBIA 1N2BA 3EVEA 4EELA 2NV0A 3NRBA 4JBIA 2Q3LA 3K2QA 1P2DA 1NSFA 2ZTHA 1X7XB 3D4LA 3QV1A 1R6UA 1R6DA 5KYTA 1XMQB 1SVMA 1GSIA 4MPJA 4GD3Q 4PEVA 4CHGA 1KEUA 1UOEA 4LDAA 1E2HA 4Y6RA 5ESXA 5F98A 4CIXA 2OGZA 2H0RA 5HUHA 1ZMTA 2Z4SA 4QHSA 1Z16A 3ODPA 4MR8A 1Q83A 5HXAA 1FVHA 1XU7A 2IHZA 3ABQB 2D7JA 4KYIB 5EUBA 2VJNA 4P7JA 4OXNA 4OJQA 3TW4A 4YJGB 1FUYB 3V46A 2VRCA 2GKSA 4N6OA 1H2YA 3HJCA 4FLEA 5CM8B 3A0UA 2XRYA 3C7CB 3O6VA 3X2EA 1U02A 5FOVA 3WQHA 3AGPA 2DTXA 1T2EA 2EG9A 2FW9A 3GLHE 4IMIB 5FBVB 1OZAA 1I7QB 1WBDA 1TVCA 4ISBA 4I9UA 1XTTA 2FV8A 3ELDA 4KUHA 3IX7A 4IJMA 3H8JA 3PTLA 2OT3B 2WILA 1XQ1A 3P4YA 4RVHA 1CEXA 3WDLA 4H15A 1N0UA 1T2VA 2GAIA 1N77A 4KC0A 1AKQA 1HZJA 2VZLA 2WWFA 2FFQA 3H3JA 3PFGA 4QSMA 2RAPA 4EA8A 2FDRA 1YULA 3C8DA 5IJ9A 2DQZA 4X0EA 3UAXA 4ZP1A 4JJZA 2Q8QA 3IBTA 1W94A 3EGCA 3FVRA 4G2TA 3Q6MA 1MZVA 4EK9A 3MJ4A 4G37A 2I1LA 4M60A 4RK1A 2VHUA 5FO0A 1OFIA 4C5BA 5IG2A 1P77A 3NRCA 3O94A 4G0UA 4R4JA 3QLUC 3KAPA 1FFXA 2V55B 3AUUA 5C7LO 3SK0A 3O75A 1JHXA 1E1QD 1NLZA 1NVTA 3O0DA 3Q5EA 1J7JA 5DB4A 5LMUB 1G21B 2UUAB 1YE3A 1TUGA 3K9HA 1YT5A 5LU9A 4KQ6A 1DAFA 3O82A 1PK9A 1XK6A 4WXHA 4LX8A 2ZI6A 4JUBA 4DCNA 1R37A 1T4CB 1TU0A 1AO3A 2WE8A 4JWKA 4R0MA 1KL7A 3HJTA 2NIPA 1EESA 1Q3HA 4QUAA 2HQOA 1BJTA 3ENVA 2FUKA 2H52A 1COWD 1G42A 4JU9A 4R8VA 4FYJA 4JVNA 1W46A 4HNAA 4WZZA 1CEEA 4JA2A 4JHLA 1QBGA 1ZRMA 1GPH1 1T0HB 4IR7A 4WUVA 3WKCA 2B2XA 2PMFA 4Q9NA 3FSGD 1GUZA 3GJYA 1XKQA 2ZE5A 3LXRA 4OJTA 4R2LA 3GCXA 1FJHA 1HDGO 2VEDA 3G9UA 4XX0A 4TQGA 4YRQA 3EZ7A 4O29A 2B8NA 3ETCA 3IUQA 5DOVA 1QFXA 4QG7A 1F8GA 1Y89A 4AX4A 3K0BA 4WH0A 1JLSA 2XT9A 4KUEA 4XW2A 4JENA 5DLEA 3RTCA 1Q1BA 2UUPA 3JARB 3KXDA 5IJXA 3CBGA 1GUFA 1R9NA 5DHTA 1Q7TA 4TYMA 5L45A 4NZZA 1G7SA 2EFEB 4Q7KA 2BH2A 3UAGA 2XUOA 3UGTA 3PKZA 2VNKA 3SDZA 5ERGB 1VSVA 4YRBA 4OX9B 4M87A 1M5RA 3QH4A 2ZVJA 3L4SO 2ATIA 1DJOA 3OTIA 1GPDG 4FW9A 3G8AA 4BE9A 4Z4IA 2J46A 4UTXA 3LXUX 2FZGA 2YFHA 1OB5A 4NENB 3NIGB 1WABA 1JQAA 3R4VA 3NVDA 3GL9A 4CG1A 1V8ZA 2PUEA 1WB6A 4B7UA 4F2DA 3LIIA 3M5CA 1NOKA 1DE0A 2ZIGA 4IHJB 2LKCA 4TWRA 5ITWA 2Y8EA 1WL8A 4GKAA 2Q5OA 2ZITA 4PZ9A 3WYNA 4ALJA 1DAOA 2CF5A 1ZIYA 2H1IA 1DIAA 4WEOA 1KDZA 4XIFA 3ZHTA 5ADUS 4B48A 1C7IA 2J3EA 2OZEA 4Z9BA 2Q4BA 4G8JA 4UEJA 1A7JA 5D00A 2IUFA 4P33A 2XX3A 1GPJA 1X92A 3LWNA 5IBPA 3RPEA 1WR8A 5K4GA 3GZ4A 2O8BB 1W59A 4LECA 2C2XA 2Y2VA 3IT0A 1T2CA 1IPFA 3UWSA 2Q2OA 2V8OA 3F47A 5KX5F 1CJTC 1WO8A 1PG0A 2PXAA 3ND5A 4IJQA 4K87A 1EHYA 4LJ8A 4QXPA 5ECYA 4YMTA 4DR1B 2ZXUA 3THWB 1RU3A 3B6JA 3AR9A 2RK6A 2G0NA 4UMDA 1ECJA 4OKIA 5K99A 1A9OA 3CVUA 5ELMA 3VR3D 2QZ4A 2CHGA 4C7VA 2PRIA 3Q3CA 1CP3A 1XD9A 1Z12A 2ZRHA 4BX0A 3E84A 1CZLA 1M2JA 3FPLA 1JU9A 3DB2A 3HLKA 1T5SA 2HA2A 4JBXA 4JL8A 2NSJA 4C0JA 2WF9A 4Y9SA 1UBMS 3JQFC 1GZDA 3EASA 1XVVA 5AVKA 1BU5A 1R6BX 2O0JA 3EZNA 5FLYA 5KDDA 1DB3A 4LJAA 4P1ZA 4FM9A 3P2MA 2NYUA 4L75A 3W0LB 1L4HA 3SZRA 5K03A 4KR3A 3L1KA 2LCFA 4O08A 1GA6A 1KZ1A 1CBUA 1KETA 1VL1A 2EKLA 1JHDA 2OHJA 5IRCD 1AGYA 2HHAA 1KAQA 2FPKA 3R4CA 3P2OA 3K9BA 2SKDA 2XJ9A 3WOHA 3X1KA 2VF5X 2H1HA 2BF7A 2I33A 4B6JA 1LXCA 2GF9A 3TL3A 3T5PA 2QPOA 3M9LA 4QXQA 3D6NB 3LQQA 3L8EA 4Z54A 1RBZA 4YC7A 3UEOA 5I4IA 5JD4A 1LV7A 2QOEA 4BN0A 2QROA 4MUBA 1BYIA 3QLEA 1P80A 1XZEA 3AR3A 5FPTA 4ZVQA 3RDPA 5FJJA 3DE0X 2NTJA 3NO4A 3I1FA 2YXDA 1YMQA 5FULA 4OQLA 1GNPA 1NC3A 4EMSA 3BMNB 1RCTE 2QN7A 3OZ7A 3OLVA 4NYMQ 2QD1A 1LZLA 2CLMB 2H51A 3LT0A 5IZ4A 2CVZA 2MJLA 5CFPA 4BMOB 3BE8A 4U02A 1Y3CE 1Y8AA 1QC5A 4L8LA 1DFGA 3EWNA 4BAGA 4BOYA 2R25B 3RTEA 3T7KA 1RWQA 3OPQA 3PXCX 1HE2A 2R11A 2IIVA 3D6HA 3EDMA 3FDZB 1EFVB 4HEQA 4WK6A 3WTBA 5BQXA 1D5WA 2FEMA 5L4NA 4LI0A 1L1RA 1P19A 4KE6A 3T4PA 3M1YA 5LFAA 3G6KA 3LY8A 2UVPA 3M6VA 5FEUA 2I76A 1I4TD 1ZIPA 2YZNA 4ZHSA 2FMXA 5CB0A 3AU8A 1KI6B 3FH0A 4OKNA 4DT1B 3PNKA 2GM3A 1FRZA 2WG2A 3FE2A 4TTQA 5CB4A 5H9VA 1KYWA 1YCHA 1ZGJA 3JD2A 4N6GA 1TM2A 2TS1A 5BSHA 4FBGA 5DYTA 3ZCSA 3A25A 2CJPA 5CW1A 2ZLBA 4DIEA 1ZD2P 4Y0AA 2BC9A 2R96A 4R71A 1AUOA 1JQ3A 3KVYA 1BDJA 4ARSA 2C2ZA 5B1SA 2PD6A 2GFQA 4RANA 3AIKA 5FQNA 4S05A 4PG8A 3I1YA 5DHRA 4M0CA 1KF0A 5KNLA 4DM7A 4KQJA 1VSUA 4LQDA 1DIBA 2QL5A 5A4FS 3WL5A 5ALIA 4CUZA 5AUNB 5CURA 1N8NA 2PXHA 1V11A 2HA3A 4NU6A 3JALB 3U17A 4Y1RB 3EG9A 3SJZA 1Y63A 4RPGA 5CFMA 2WSSD 1JJIA 2OQRA 1SIOA 1NUAA 1MOQA 3K0FA 4KE8A 1Q11A 3HMQA 5COAA 1PEDA 1Q2UA 1P29A 3SWWA 4XFJA 3DFZA 2AA3A 3KOWA 1KARA 2AVDA 4RHCA 1XCGB 2O05A 3B78A 3BZBA 2XBLA 4Y2QA 4ZT4A 4RDCA 2ZBGA 1G8PA 2ZWMA 3VM6A 1Q0TA 3AJ8A 4NYIQ 3G3EA 4BU1A 3V8MA 1SUFA 1U8FO 3LKBA 2JGAA 2I55A 1R16A 2NVUA 4WCFB 4K0KB 2HQBA 2PLWA 3E6AA 3ZJUA 4H0CA 2QMEA 2O2SA 3WWOA 3DXZA 5T6MA 1FB5A 3EDOA 5ENDA 3SC2A 1JAYA 3HUUA 4YWJA 5DGHA 1H5QA 1X77A 4QYIA 4DWVA 1CQIA 2IJGX 4EHNA 2ZYTX 3W5JA 5AW8A 3LP8A 5KNDA 4KN9S 2ODBA 3BWXA 3ROMA 1U2DC 3M5WA 5DHAA 5ECGC 4E33A 3H6GA 5KTMA 4XM1A 1ZESA 3AG6A 4PHGA 2CXOA 4B73A 1ODKA 3E9NA 3CZAA 1OZ0A 1E0KA 4I9FA 2OB1A 3A7EA 3HGMA 1YR8A 2A5YB 1Y8RA 3A6LA 5H16A 3KRTA 5K3FB 5LZ7A 1DX4A 4DA8A 2F55A 3I45A 5DHSA 3TJMA 3TTWA 2CUKA 5HQJA 1DRVA 3HCEA 3PIDA 4KXWA 1PFQA 4I1VA 4P38A 1QS0A 4B71A 2CZCA 4AKIA 1O94D 4ITRC 1UDCA 3HCAA 4RPKA 4RLSA 1JHVA 1FBNA 4KLAA 4WNIA 1ADJA 1U28C 1V2GA 2GEVA 2G9QA 4IXWA 5JLJA 4JBGA 1KR2A 2P75A 4R01A 3COZA 4E07A 4X44A 4BO5A 2ZPAA 3OJEA 3QU2A 4P7KA 3C8MA 1GN9A 1PFVA 4RNCA 3UFXA 1XJ0A 4ILEA 1NNSA 1EE2A 1M1NB 3DYVA 3NV9A 2CLHB 4MGYR 2Q99A 4RYDA 4V39A 3Q9LA 5FV7A 4DWWA 1DBQA 3H5LA 1A5TA 1SCDA 2JJ2D 1U0OC 2J1LA 4D3ZA 4ZOLB 1XQ9A 5CFZA 4K86A 2QSYA 1N5IA 1NOJA 2AF4C 5F73A 3ZE8A 1EX1A 4ZTUB 3BMNA 5DF1A 1OBCA 3H3FA 3BIFA 1Q1QA 2I7VA 3QYJA 2R8RA 4EG7A 1TO1E 2NQ8A 2L18A 4BMSA 1IBRA 3E58A 1CZRA 3L41A 1ELOA 1UDRA 4CTKA 4GOMD 1KFJB 3V4VB 1D2NA 1E4EA 1YOBA 3T0IA 4Z2YA 5JE8A 1BGVA 2BRUC 4NBLA 4TT3A 1NXWA 5LYJB 2M6SA 1YUNA 3RASA 3AW9A 4GYJA 1TQDA 1ZGAA 2O7QA 1ZUNA 5E9AA 1YTLA 4HADA 1TKAA 3TR0A 5DBIA 4RPJA 2WTUA 1P7WA 3D7KA 3DAOA 3AHEA 5AXCA 5TB5A 3EPLA 2IYSA 2AFIA 1NI5A 3AMVA 3MB5A 1HQDA 5AKGA 4ABTA 1Q7CA 1QXSA 2ZEJA 3AY6A 2Q3JA 4Q37A 5F7JA 2HF8A 2X2OA 1Q5PA 3LVQE 3FJYA 3QJYA 3NI2A 3N59A 4ILKA 4R1MA 1U0LA 1F8XA 2AMLA 4QNRA 4G9EA 2D2VA 5TQVA 4MQFB 1S3FA 2FZVA 2Q4OA 3FOAA 3IHWA 2VPTA 4V02A 1KBQA 4HC4A 4XQGA 1QHIA 2A5GA 2DFKB 2CHQA 2UZ1A 3E2PA 3GEHA 3IIEA 1ISMA 4JBYA 3BFVA 4EHIA 1GN8A 2XUDA 3QXGA 4Q4AA 4FONA 1U63A 2DKOA 3WJ1A 1OA1A 5TJHA 1EEHA 3A36A 4KRGA 5CFOA 2YHAA 3MYYA 4YRGA 3BG5A 3QMMA 2A9VA 5B6IA 3CA8A 4E31A 5IXSA 4EUFA 2AXPA 2GPAA 3MWKA 2APJA 3QVOA 1WM1A 3UZUA 1E1NA 2H08A 4AWXA 1I3CA 4Y2TA 4A0RA 5JQWA 1XZQA 4J49A 4R69A 5FOWA 5HM6A 1ABEA 1FX0A 5B12A 2Z6UA 4DQKA 3CNEA 2LIPA 1V8OA 3QENA 3QOYA 4C14A 3RC3A 5FNZA 2AOVA 4IBOA 4LXXA 2IZOA 4QUEA 1PS0A 1NX6A 3HUDA 3ND6A 4HDRA 4JNCA 4C6TA 4XDZA 1X7YA 4TMFA 2BJHA 3OQNA 3LECA 1IBKB 2QJTA 4JUFA 2VBGA 5IYZB 1Z3IX 1DWUA 2ONZA 2ZZKA 3GLQA 4F6RA 2J3KA 1TA4A 1NKSA 3B6MA 3RV4A 2WUVA 5CM2Z 3T52A 1SVNA 1PR1A 3GJ5A 1UK8A 2PUHA 3MWEB 1E66A 2H4XA 3GT3A 2I4NA 4MW7A 1L2TA 3ZDBA 3GFSA 5IXJA 4H7PA 3QMVA 3QKRB 4UD2A 5FOTA 4GX2A 4TMXA 3R8CA 4C0BA 2QWXA 2BRUA 1KZ9A 2RKOA 4L4ZA 4ZODA 2X3YA 3VC3A 3W6NA 4G0OA 3K3PA 3VO9A 2FI1A 2JFPA 4DJTA 4RY0A 3TQIA 3IJ5A 1GQRA 3IEXA 4FYVA 1EWKA 3R3SA 4TXMA 5LQAA 3O9ZA 1N34B 2JDIA 1Q77A 2XZOA 4QBIA 2H5EA 1T2FA 1ZJ4A 2XNCA 4TROA 6Q21A 4C7OA 5KWEA 3TK1A 4QRHA 5D3MA 1XPOA 4PVCA 4K81B 2I2WA 3EPHA 2JFBA 3AYZB 3DFUA 3TLCA 3ADDA 3KCNA 2ZSAA 5HIIA 4UUNA 1FUKA 4BKUA 5L6LB 4QPDA 2ZSBA 3GLKA 4EFLA 5HJEA 3MJRA 1VMEA 5IN5A 1CZUA 5JXGA 1O5TA 5FPSA 2O8VA 2WB2A 4ML3A 1LUAA 1NMSA 1ECGA 1ZVMA 2ODAA 3AQ4A 4MRPA 2EFCB 3A9VA 2IS2A 4ZQHA 5E38A 3N1UA 2FFAA 3TQRA 2WZCA 4YCSA 5MGBA 4CM6A 3H3XA 4LBZA 5E1DA 2Q1TA 3VPHA 2E0IA 1MH9A 4DQLA 2EX0A 1AHHA 1QLWA 3VSEA 1AD2A 3NKVA 3P9IA 3KLMX 3VGPA 4B76A 1SFRA 2AOTA 2XDQB 2AWOA 2PUAA 1E3IA 1OU4A 2GK7A 2J6HA 3UMRA 1M2VB 1A1VA 2OECA 2J3QA 4M86A 1RKUA 2IGTA 5EXPA 1YK1A 2EHDA 2GT1A 3HR4A 3ULKA 3MBOA 3LCMA 4CM3A 4RHUA 1J39A 3GLIA 1AZWA 1N5KA 1RQ7A 2GM5A 4FOTA 3KTFA 2XMCA 1Z8DA 1K06A 1V37A 1HFKA 4UUOA 2FWPA 5FOSA 1SGWA 1W7AA 4OLAA 3LHFA 1L4MA 1T9GS 4TVBA 3SQDA 2FPXA 2O6LA 2B92A 5C2JB 5BV7A 3B3GA 2YJ4A 2B8JA 2B8WA 4V0RA 3DBIA 5SV2A 1FFXB 1GEEA 1I8TA 4FXOA 3UK6A 3WJ2A 2QZSA 3PQ8A 3OOEA 5HKKA 1O5OA 1B4DA 4EB6A 1RJ9B 3E8SA 3CR8A 5CEEA 2IYYA 1NRXA 3LGXA 4RTSA 4EHAA 2W70A 1KVRA 4YR9A 4YBRA 4B3FX 1I6MA 4LJ7A 3PX3A 3NC0C 4ZT2A 4NLLA 3T15A 5KOJA 4UKDA 3O3MB 1N7HA 4HDNB 3CB2A 4GECA 1R50A 4J7CA 1X8KA 2I6FA 1ETHA 4R0NA 4ZKEA 4M2LA 1J22A 1LBEA 2F8MA 3U7QA 2RMKA 4GGPA 5BVHB 3MQ2A 3EPKA 2FMIA 2YHIB 4OL0A 1J06A 1GG9A 5H02A 3OE7D 3WK4A 1VPTA 3WRWA 4BUCA 2AZMA 1I5EA 4DCUA 1CVRA 1V7PC 3C6YA 1Z0SA 3OHMA 2WAAA 4M1WA 2CV1A 3HRKA 4P3XA 3D1VA 4GE0A 3HK2A 3HN6A 2WKSA 1JHAA 3ILYA 3W79A 3BXEA 5B3KA 1VCIA 3OQMA 3CG0A 3HXOA 2YKGA 4P93A 1WNTA 3EA0A 1XDBA 2X6RA 2VJMB 3FLMA 1JG7A 1JXOA 1Z4LA 3QJGA 3VI3B 3A32A 1CJKC 3QA9A 3PA6A 5E1MA 1T9DA 3DLPX 3MUNA 1Z6XA 1D2MA 3MRSA 1I4OA 4M1SA 2PD3A 3AUJB 4DSUA 4MW0A 5MF6A 4LJRA 2RHOA 5AESA 5K0TA 2WPNA 3CINA 3KLNA 1ZNXA 2WM8A 2CXUA 2X7XA 4MNTA 3WB9A 4KNYA 2IYPA 1FDTA 2HNBA 2NUPA 5HKLA 3ZTWA 5FLXA 1SQFA 1E96A 1QO0A 5KNCH 1TAGA 4I81A 1O8BA 2XVYA 4LX0A 3LC7O 1Y5IA 1F8YA 4RHTA 4UQOA 1RRFA 1GCGA 1P9WA 2VJYA 3BFPA 1ADFA 1P9OA 1U3DA 3HKBB 4DMMA 3FHTA 1I1QB 4UDNA 1YB7A 4I9GA 3A1SA 1C29B 5T4BA 1MW8X 3CLSD 3M34A 3L8DA 1LPSA 1XD2A 3KZXA 2NU8A 5BR7A 4GRDA 4JAVC 1DWQA 1FU8A 3P5SA 3GP5A 3ROEA 4DGQA 1KAMA 2VF4X 3QVMA 1GDDA 721PA 3QVXA 1MB2A 3MWDB 2OWEA 4GMGA 3RROA 3V1UA 1E9BA 3ZBPA 1EK5A 2HH9A 4M0DA 2AQKA 2VXOA 2ZYAA 1YC5A 3P97A 1GFIA 1SBIA 5ED4A 2YX1A 2M1ZA 3CT4A 4TV8A 3OQIB 1E79D 1QIIA 1ZOLA 3FW1A 4WUTA 5IUNC 4UE6A 4AT1A 4FFPA 1XKXA 2J9FB 5HNKA 1T15A 1PL0A 3N6RA 4Q93A 3I92A 3INRA 3GZJA 3T3EA 2ZJ2A 3L7YA 4BO6A 1Z5VA 1DEOA 1GFWA 5GJVC 4WXRA 3SCZA 2O54A 4OXXA 1C41A 4ZPXA 1IHOA 5ERXA 2R7LA 5SYMA 3UC5A 3TLXA 1V9CA 3SQWA 4AKGA 4M1ZA 4S1OA 3SM9A 2Z58A 1QHFA 4OYHA 4RV9A 3HA3A 4K1XA 1H4SA 1JDJA 2RH9B 2Y92A 3RTDA 5CA1B 4CKZA 4M7RA 4F6RB 3ZW8A 2OCGA 1ZD3A 4R54A 1AIPA 1FNBA 3CISA 1UBSB 1Z0FA 3FLAA 4BEWA 3SSMA 3QU7A 2MSEB 2F3TA 3DKIA 1Z2CA 3BSSA 3VOTA 4IDDA 3OC0A 4WI1A 2R5NA 3MSXA 2K5UA 3PC3A 3W1WA 2QLLA 2KSQA 2W6OA 2WFMA 1Z2NX 4PIVA 2WWYA 3NBXX 4PCAA 4QQRA 2E55A 2ZS9A 2XYGA 1AS2A 1DT5A 3IAM1 2P4UA 3E7DA 4TTRA 3R5JA 2Y1GA 5DBEX 2OZLA 3JYLA 2QX6A 4KO2S 4HH4A 1AKYA 2SICE 1RSZA 2H63A 3RSFA 5C18A 3CMCO 4YP1A 2FGKA 2H2GA 4Y67A 5ECWA 2D3TA 4YRDA 1FJ2A 4LE2A 3CRZA 1N5MA 1WCV1 2IX3A 4KFSA 2AFIE 1U2QA 2FP3A 2PL9A 2X58A 5T3UA 2P7HA 4DMRA 5DM0A 5A9SB 2RH5A 2OVFA 3DE1X 1EWQA 3D3NA 1K5DA 1E7MA 1K5PA 2HT6A 3PK0A 4FDUA 3I37X 3TNFA 4UM9B 5JH7F 2G5CA 1HBJA 2FFBA 3AWIA 1YQDA 4WK0B 2PUGA 4XVQA 3K70B 1ORWA 2BFOA 2FB9A 2GN4A 3QQ5A 4R9UC 1F2UA 3BRQA 1NG9A 3AVXA 3FF1A 1IJKA 3MAJA 2XJ4A 5I7VA 3G5UA 2MTBA 2PRZA 1UPUA 4GM4A 4U6SA 3T9CA 1CR4A 3EEFA 4IVQA 2K2WA 2ZK7A 3MMXA 1J5XA 3N2IA 4DDMA 4LGMA 1QH8B 3HVHA 4R3WA 3M83A 2AUTA 3BMQA 1PX0A 1OPRA 2JGIA 4BKMA 1SB9A 2GARA 3D4BA 4P7BA 1GYPA 3ZDYB 1BNCA 1SIBE 1SXJB 3IIIA 3NDPA 2DSTA 4BX8A 1Z4QA 4HD8A 4P86A 5JEEA 3AVVA 2LCQA 1G5FA 1MT3A 1LSJA 2OHGA 5I8WA 1F2DA 3RYHA 4OU4A 5DN6A 3PS9A 5DLPA 3WK9A 5ER6A 3IRUA 2P9BA 4COKA 5LVAA 2NU6A 4QYWA 1T9KA 3PPIA 4RO0A 2WF8A 4BTLA 1NBHA 2RGCA 1HL7A 1GSOA 1EX7A 3PZRA 1C80A 1XTRA 2D54A 1KZGB 3FNIA 2JD2A 2MR6A 2RGDA 5DZSA 4UTRA 4B74A 2PPVA 4PU0A 2B7LA 2VQEB 3OPMA 1KNQA 1NP3A 4FE3A 4HL6A 1J0AA 1J9ZA 2XNKA 3AU9A 3KYBA 3LVFO 4I6JA 4EB3A 4P4GA 5EUMA 4ENVA 2OMKA 2NP6A 3Q6IA 1QG6A 3T3PB 4P54A 5D1HA 2ZRDA 4AKHA 2GM9A 1OXVA 2AJBA 2O52A 3ZWYA 1VE7A 5C7YA 5BSTA 4I9NA 3NHAA 1I51A 3JD3A 5AW9A 5FWNA 4OQYA 1NMYA 1W9MA 3RFTA 4D0NA 2CT8A 5CBKA 2WE7A 3PGMA 5IAOA 3ON5A 3MW8A 4DC1A 3CE6A 4EB8A 4Y7DA 4BWGA 5BUCA 4D92A 4L95C 2GXUA 4AB1A 4QAQA 4JT8A 5FWDA 5JWOA 2R00A 5KQRA 1X39A 2ADMA 1MW9X 2JZNA 2QQFA 1BYUA 1VFNA 3DMGA 3H6KA 2OBMA 3HKDA 5LP6B 3NWPA 3KYJB 6YASA 1KMCA 2Q9BA 3CIFA 4RF5A 5H8WA 1AK1A 2NUAA 1EM6A 3K0HA 4GPD1 5G1PA 2FSGA 1MX3A 4C4XA 1CDEA 2IZ0A 1PFKA 3VU8A 3H5RA 6AT1A 3PXDA 3GOHA 2JJ2A 1PU2A 4GT1A 4X6XA 1ZN7A 1GHTA 3FVWA 5B30A 1TUBA 4GW3A 1KVSA 4L4UA 2C7RA 2XLBA 2QTCA 3KKKA 4W82A 1RWKA 5JECA 2JJ1A 1IAQA 3OPYB 3OJXA 3BJIC 4FJ2A 1YJCA 5HOQA 3L6UA 4LF8B 2Z83A 2EF1A 2H2IA 2NW6A 3KVNA 4RK5A 5P21A 1O4VA 2R97A 2BHRA 2EL7A 1W4LA 3HB4X 5F64A 1M74A 3FRHA 2H1SA 2J5QA 3H2GA 3ZQ6A 3C1UA 4XDHA 2BM1A 2PUDA 2FXIA 3L0ZA 4UNSA 5H3LA 1VL6A 2OCLA 4C4OA 1G3RA 2XGGA 2ZBRA 1TF5A 3PXUA 1H22A 4B6RA 2J9YB 3GLSA 2P3QA 4Q9HA 3HHEA 3H9QA 4UAUA 3BT7A 1EVJA 3IGFA 2FYTA 3LQRA 4JQYA 1KBOA 1XTIA 1YR7A 2HIHA 2WJIA 1H8ED 2QRLA 3ESRA 4NYJQ 4OYRA 2VYFA 2JIRA 5CD1A 2ZUDA 4YJHA 4GLLA 1ZSVA 3FCSB 3OU6A 4XYMA 4B6SA 4F92B 1RYNA 5BN3A 4NICA 2YIMA 4U2DA 1IL0A 3FAZA 4A10A 1RBYA 2Z08A 4KSBA 5FBQB 5TVKA 3WLQA 1CR0A 2BFEA 3GFTA 1OGIA 1JEQB 3PJGA 4LXHA 2V5VA 4RA9A 1CDDA 3U4AA 4KVFA 3NOVA 4YRRA 5EHGA 3QSYA 4Z7JA 1KP3A 1WMAA 2R1UA 1F2VA 3FYTA 1VB5A 3UJCA 3C3EA 1W2HA 2QD5A 4FC7A 1KJYA 3PEVA 3CNNA 4YRSA 1EDDA 3PCXA 1K3UB 4PG4A 1A7UA 1ISGA 1DZIA 1HETA 3PE6A 4A8PA 4RZUA 2EF0A 1O1YA 4CLOA 5TIIA 1GLNA 2FF5A 1JHQA 4IOJA 2GESA 3UB2A 1TNDA 3RQIA 4ETIA 4BFZA 4EI8A 1Z6ZA 2QTFA 4NCJA 2GX6A 3GPDG 2EV9A 3NX4A 4NH4A 4S0XA 4BWYA 5JS7A 5BVGB 2I2FA 1YVDA 3GR6A 2ZZMA 3J7TA 3G68A 3GLIE 5CHEA 4ACAA 3R24A 4J3NA 4FEGA 2R8PA 3K0KA 2IYVA 4BWVA 3A2MA 5TLSA 2FQQA 4G36A 2OYCA 1ECCA 4PSCA 4HJRA 1XWFA 3ACBA 4US1R 3I58A 1FUUA 1XNQB 4CF7A 1LGYA 3WYDA 5A6SB 1R5JA 4F5WA 3W2IA 3TB6A 3NVAA 5A71A 2EP8A 2QG6A 1VI5A 4KWIA 5A3SA 5DHPA 1ODTC 3OZDA 1Z82A 4GVXA 2F3SA 2JJMA 4J1NA 3RB8A 3UOWA 3L93A 5KWIA 5LQRA 3Q10A 2J45A 3AR4A 3MGKA 3D2CA 4QGFA 1GLGA 1E9AA 4U8HA 1AN0A 5EOVA 3OQOA 4DABA 2JVKA 1UC9A 4DOMA 2Q1XA 2QTLA 4BYGA 1DTWA 4V0NA 2YNMA 3JV7A 2B6HA 3JALA 4R1UA 2QN6A 2XTZA 3LE8A 2VOEA 1B41A 1J5PA 1U9CA 2I6TA 2W98A 3K9WA 4YWHA 5A9SA 1RNLA 4RL6A 3P71T 2E6UX 3GLHB 1H2RS 1F9EA 5K51A 1PO7A 3NHRA 4C76A 3U7FB 4H6VA 4Q03A 2BGKA 1YR2A 1N2EA 3AIOA 4QGAA 4YRFA 4Q66C 3LYAA 1W0JD 4D0GA 2ENUA 4N54A 4ZICA 2Y6UA 1K86A 4RJTA 1PL7A 1KGDA 2QP9X 3ASZA 1Q17A 1ZOSA 2O6HA 2X4GA 3T7SA 4EVSA 4QX6A 2EJWA 2OXEA 4QECA 4UM9D 4GOJA 5AJZA 2Q4DA 2Q7OE 4FFWA 5DU2A 2Q1UA 1J7KA 4LDPA 1V45E 3NLLA 3WK5A 3FNEA 1A82A 3T9AA 3WLMA 1IJFA 3GPBA 4PZZA 4BFLA 4EECA 1IPEA 4EI9A 2HUNA 3JWHA 4ON9A 3RUFA 2XDWA 4H3VA 4Q5IA 1X1BA 7MDHA 1RYFA 2GUGA 3AB8A 2ZCVA 3O5AA 3OJWA 2Q45A 5CR9A 1NVBA 4OQNA 1KI2A 4WERA 4ZOLF 5BQPA 3AF3A 4FWTA 2YY7A 4C4YA 2IIQA 2QGNA 2PM8A 1QC5B 1VRVA 2X5XA 2EWMA 5AK5A 821PA 1R4ZA 4P3NA 4Q47A 2HRBA 3UC9A 3QVTA 4IS2A 2VT2A 1P4RA 1JKMA 2BDEA 3OFNA 4JQCA 4LMBA 5FADA 3U2QA 3ZGVA 4AJIA 4KPYA 3HGQA 2GH1A 3FMIA 2FSPA 2DY0A 4DIOA 1X0VA 1MAAA 1B8OA 4L4XA 1LDMA 2ZROA 3SY8A 2BGRA 4D5GA 2UKDA 4KV7A 2WFAA 1TDJA 3Q12A 1GKIA 1MVLA 2JIDA 2O5RA 2XPCA 2HO4A 2PVSA 3MGAA 2MIIA 3UB3A 1BE0A 3IMCA 3KSUA 2UYGA 1OTYA 3LOPA 1KOFA 3A14A 5IPFA 1PN3A 2YVQA 5BOSA 1VIVA 4LAFA 2EG5A 5KEIA 5MDHA 1F5SA 1MAUA 1VG1A 2Q5EA 1SVLA 5ULLA 4Q9LA 2H4WA 2P5YA 1MNAA 5ALZA 4RMJA 1H3EA 2CUTA 3F6PA 1Y6JA 2XI4A 4PYKA 3CVWA 3ZWDA 2R7KA 5JZBA 1BQEA 4CCSA 3IKJA 4OUDA 1QP0A 3GJ4A 3FCYA 1ZRHA 2I5PO 1VPLA 4K3VA 2DPGA 4C7XA 4H0NA 1H42A 1SOVA 3RU3A 2QL6A 4Q0MA 4U2CA 4YXWA 2MSCB