4G4PA

Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
235
Chain Sequence
b'HHGENLYFQGMEGKKYTIGTDLTFAPFEFQDSKGKYIGIDVDLLDAIAKDQDFEVDLKPLGFDSAVQAIQSKQIDGMIAGMSITDERKKSFDFSDPYFDSGLQLAVKKGNDKIKSYDDLKGKTVAAKVGTESANFLEKNKEKYDYTIKNFDDATGLYKALENGEADAIVDDYPVLGYAVKNGQKLQLVGDKETGSSYGFAVKKGQNPELIKKFNAGLKNLKDNGTYDKILNNYLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid ABC transporter, amino acid-binding/permease prot
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transport protein
total genus 77
structure length 235
sequence length 235
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g4pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g4pA02
3MC2A 2Z8DA 1TT1A 4Q5TA 1MPCA 3PUYE 2ANJA 3ILTB 5I57A 2XXIA 1MXZA 2B65A 3S9MC 2E1SA 4ISUA 4PFTA 1PDAA 1SBPA 1JETA 4NEDA 4QFPA 4QRZA 4HCWA 3O6IA 5I56A 1PB8A 2Z22A 1MXUA 4TLLB 3OO8A 1B7ZA 3ILUB 3KOTA 5BUUA 5H8QB 2YLNA 4OVJA 1EZPA 1Y1ZA 1TXFA 5A5XA 3FVOA 5CMMA 4JSDA 3IX1A 5FTHA 2F8DA 1FQDA 1D4NA 4PFWA 4WXJA 4NF4B 1N3WA 4RYAA 2RCBA 2XXHA 3EN3A 1TFAA 1SW1A 2DOJA 4TLMB 1YAEA 1Y3PA 4MFIA 3G3FA 3UP9A 3I3VA 5JTYB 2PT1A 5ELVA 2F5XA 1FQEA 5AA1A 2HQ0A 3E4RA 3SEYA 4LUBA 2DE4A 4U4SA 4GD5A 2H4IA 1VSOA 4YKJA 1LLSA 4F31B 3U92A 3K1NA 4G2ZA 3TELA 4OFOA 4LVQA 4F19A 4H0WA 4R2BA 4H1XA 3I6VA 5HM4B 2XHDA 3PUXE 1LAXA 4OFLA 2F34A 3Q26A 3VLWA 1TWYA 3BFTA 1D9VA 1WODA 3A3UA 3FUZA 4ESWA 1DSNA 2KLFA 1XHYA 4NF4A 5H8FB 1LAGE 3IORA 4ELOA 4IO3A 4JWXA 1OLAA 4UA8A 3R7XA 3EF7A 3SETA 1YTVA 4OETA 4DCYA 2RINA 5JTYA 1XVYA 1B3EA 2D5WA 2Y7KA 3CFLA 4R73A 4U2RA 3KFMA 1B3LA 4F29A 5CBSA 4ZE9A 3Q29A 5ICTA 1H76A 3GLBA 3S2VA 3SKPA 3QAXA 5JK4A 4GQOA 5AA2A 4I62A 2XXXA 4QFLA 2DP8A 2A5TA 2CZLA 5CMBA 2XX7A 4ZE8A 1ZKBA 1XOCA 1H45A 4EQ9A 3SEVA 3CG3A 3HCQA 2DWJA 4QSEA 3QYTA 3C36A 1LB9A 4GF8A 3PMWA 4AB6A 2V3QA 1M5DA 3KG2A 1MM7A 1SW5A 2ABHA 4PQJA 4U23A 2XXTA 1M5CA 4QFOA 3OMBA 4JWYA 4GL0A 2HZKA 1SW4A 4ZZEA 4IO5A 3N6TA 3TYHA 1HSJA 3VDFA 5I59A 3RT8A 2Q9TA 4RY1A 2UVIA 5TPAA 1P1UA 1UTBB 3IOWA 2GRVA 1FTJA 2V93A 3EHUA 5J1DA 1FTOA 3USDA 5L9MA 1H43A 3G3IA 3M8UA 4DXUA 1FCKA 4OWDA 1D9YA 2HFBA 3JYRA 2OWSA 2O68A 1AOVA 4OEVA 2QS2A 2HAUA 4K3FA 3LSWA 4G68C 3OELA 1MY4A 2PBWA 2IEEA 3T22A 4H5FA 4DCXA 3TEPA 3VVFA 1ZJLA 3LUYA 3K0VA 3TAJA 3OOAA 4ZEDA 3T93B 1SVXB 4KQPA 2ZNTA 2W7YA 4PFYA 4X1DA 2Z23A 1N04A 5DYHA 2XXWA 3TPAA 1A99A 2VP1A 1I6QA 3T96B 3QUJA 3KSXA 4ZEKA 5H8HB 2X7PA 4R6HA 3CVGA 1MG1A 2P2AA 2QJEA 3CSGA 5I2KB 3FXUA 4BDRA 2I3WA 3N5LA 2F7CA 1J1NA 5ITOA 1B52A 1Y1MA 1Y4TA 4YICA 1A7LA 3U72A 1FQCA 1MQJA 3OEMA 4MLVA 2V25A 2O84X 2LAOA 1MXYA 4Z0IA 1HSEA 1MH4A 4O3AA 3UGWA 4Q30B 1LCFA 4ZS9A 1B3HA 3C34A 1A55A 4NF8A 2HCAA 4OHNA 4BDMA 1PBPA 3VXCA 1UIVA 3IR1A 3E13X 3ECRA 2O6AA 1US5A 3HV1A 3VE1B 4EF2A 1LSTA 3C4MA 1NKXA 4NE4A 4KFQA 4F39A 4IY5A 4QSCA 3T9XB 4EF1A 3RGYA 2Z8FA 4IO2A 4U1OA 4G4PA 1BKAA 3RTFB 3JZJA 3KGCA 2H99A 1P99A 3DP8A 4R75A 3V83A 5I57B 5DEXA 2ZYKA 1B4HA 5AA2D 3TQLA 4IO7A 2O7UA 2AL5A 5HBCA 4X1BA 4R6KA 3MVXA 2I3VA 1FW0A 2B3FA 4XTCQ 4NWDA 4F2OA 4R74A 1IZ1A 3OO6A 5ISUA 3S9EA 1QW0A 2Q2AA 4C1TA 1MY3A 4R9GA 3O6HA 3CR9A 3PUWE 3FD3A 4ZEIA 1EH3A 1QKBA 3G3GA 1S50A 2YJPA 2I4BA 3F11A 4YKIA 2DXRA 2OWTA 1B6HA 5IAIA 1JEVA 1Z7ME 4KR5A 2DQVA 1KWHA 3UN6A 1NNPA 2H25A 4R6YA 5L8DA 4MLQA 3S9NC 1B7HA 3VVDA 1A54A 1UTHA 4FAJA 1XT8A 2B3BA 5AE4A 3RUMA 3C9HA 4F1UA 2O1LA 3EHSA 1O64A 1YCJA 2Y7PA 5KDTB 1URDA 2UYFA 1QVSA 3MW0A 2M8CA 5I2NA 3KOSA 3N6UA 2DE3A 1USYH 2R71A 4H67A 1RYXA 1B1XA 1WVJA 1IQ7A 1JQFA 3S4UA 5I58A 3FASA 3H3GA 5KZTA 3RT6B 4DIGA 1DOTA 1DTGA 2ONSA 3MVZA 3MJNA 3MVWA 3TFLA 2XXQA 3V5AA 4LZ5A 1JW1A 1URSA 3KJ7A 2UYEA 4KI0E 4BDLA 1Y20A 1AMFA 4P11A 3LBSA 3K1MA 3UIFA 4QSDA 1S7YA 4RK2A 4IY6A 3OXNA 1B05A 2Y7WA 2DE2A 2FYIA 3CFZA 3K00A 2HAVA 1Y3QA 3IB1A 4FORA 3HPIA 5FHNA 1ZTYA 3CRBA 1NNTA 3C35A 4FE8A 5KDTA 2VD3A 4O3BA 2PYYA 3SEXA 4RNSA 4JB7A 3FJ7A 4GRKA 3FJGA 1R9QA 3AXFA 4YU0A 1A40A 1NMUA 4H6DA 5AA2B 3BKIB 4DXBA 3HO7A 1GV8A 5HPQA 1QUIA 2A5TB 1OMPA 3VVEA 2VGQA 4G8NA 5F1QA 4DZ1A 4DDDA 4BDOA 3OSRA 1MPDA 4EUOA 4U22A 3QK6A 1MQHA 3K1PA 4LP2B 1T0KA 3OSQA 3R6UA 2H9BA 4FIMA 1N84A 5TP9A 2WKYA 3N26A 4OEUA 3MZ1A 4YZZA 2G93A 1QUKA 3TTKA 4O3CA 4LONB 1PC3A 3CI8A 1Q35A 1SQYA 4KCDA 4OQOA 2Y7IA 4KYEA 3M3KA 4I1DA 4HCYA 1EZOA 1ZLQA 3BBRA 1JVXA 3RN8A 3ZSFA 1MXXA 1PB7A 5I59B 2REGA 5TPAB 2PT2A 4N13A 5B70A 1ELJA 4AQ4A 4XKNA 4F1YA 4E0XA 4GIZA 3B7DA 3OO7A 3W9WA 1BTJA 2F78A 3S9LC 4THIA 3IJOB 3MPLA 1MY1A 3IO6A 3OO9A 1QJMA 1A8EA 2XD2A 4MF3A 1MH3A 3O2AA 2DYXA 3PGFA 1EZ9A 1B58A 1FQBA 1VR5A 4PP0A 5FTIA 3ZKKA 2PMSA 1LGBC 3M3LA 1B2HA 4P0GA 3O29A 4M1VA 5JEIA 1MS7A 2RF1A 3TCFA 4GFRA 3DLNA 2V3TA 2I58A 2HEUA 1SYIA 3MP8A 5DVFA 3LC8A 3U1OA 2NXOA 4ND9A 4AB5A 3PU5A 3TZAA 3KBRA 3V8XB 5K2YA 4U21A 3U8QA 4LA9A 1P1QA 5DVJA 2Q2CA 1F9BA 1GTKA 2R6GE 3D4GA 1OLCA 4IO4A 1SDXA 4WEDA 4NTLA 4ZZAA 1O63A 5K2XA 3U94A 1TFDA 2RCAA 4NF8B 5AA4A 1NL5A 4NWCA 2UXAA 3MWBA 1IXGA 2NVUB 3FIRA 4QHQA 2OZZA 2O1MA 2ZNUA 4GXSB 4MBPA 3TCHA 3D4CA 1POTA 2OJTA 3EPEA 5H8NA 1D3KA 4UACA 2VD2A 2F7AA 4JXIA 2RC7A 4G77A 1S9TA 5M2VA 3PUZE 1N7WA 3FJMA 5F7VA 4N07A 3FVGA 3H6TA 1B3GA 1LAHE 4OMBA 4U4XA 5DEXB 2F97A 2XXPA 5ITPA 1OIBA 3K6WA 1QULA 3TUSA 3O66A 1ZIUA 3QSLA 1UQWA 3V89B 1PBQA 3SEWA 2E0SA 3FXQA 1MXVA 2ZXTA 2R9JA 3B6QA 1SD3A 3FZVA 2DXYA 3C33A 1FQAA 2Q88A 1N76A 4YB5A 3VLUA 4GVOA 4G8HA 4RJZA 4EDPA 1RYOA 1JEUA 3MPKA 1N3XA 1R9LA 1VFEA 1MY0A 3K2DA 4YB7A 3HHFA 2OBGA 2O51A 3T9HB 4HTGA 3BFUA 1UTHB 3PUVE 3TTNA 2UVGA 5DT6A 1AL3A 3CG1A 4DLDA 3H6VA 1B46A 3MVYA 5BWJA 3FVNA 4GOTA 2XXUA 3SERA 3PPNA 5I2NB 1MPBA 2QMWA 4NF6A 1BP5A 3FGSA 3IO4A 1MY2A 3K6VA 1R1NA 3ODBA 3U93A 4EXKA 2Y7RA 2HXWA 3JV9A 1XS5A 1LCTA 5I58B 1Y4CA 5CM6A 4GXAA 4G68A 2DWIA 4FEBA 3N94A 4DE8A 4U1ZA 1B51A 2I0CA 2I49A 1GGGA 3UA8A 1H44A 2DSFA 3GBAA 1NNFA 1L5TA 2REJA 2QS4A 3TODA 4H8JA 1B0LA 1RKMA 2THIA 2Z8EA 4GL8A 4OTEA 2P1SA 4RPNA 3K02A 2ONRA 3SESA 1ATGA 3VFJA 4GLIA 1N7XA 2I4CA 4I9DA 3RTWB 2UVHA 2G29A 5DVIA 2X26A 3KSJA 1Y9UA 1VFDA 3H6WA 3QIMA 1IIWA 3FVKA 1BLFA 1MQDA 3GXAA 3LSLA 4JDFA 3SEUA 1CE2A 1IUDA 3IAZA 5CI5A 4FECA 1PB9A 1MDP1 4X9TA 2D21A 3MAMA 4F3GA 2O69A 1B40A 4H8IA 1GR2A 3H03A 1P1OA 1ZU0A 2AYSA 1IITA 3LSFB 3FXRA 2BJJX 3Q27A 1WDNA 4Z7EA 3MQ9A 4QFNA 1B1HA 2XXVA 3TTLA 4YMAA 3LSXA 2QSXA 1LFHA 4NF5A 5KCJA 1B5HA 4I8CA 5AA3A 2AL4A 3PD9A 2XX8A 5TP9B 4EQBA 3A3CA 3MZ9A 5ICQA 4KYDA 3H06B 3TTMA 5FHOA 2D3IA 3DM0A 4OESA 2ONKE 3RLFE 1ZBMA 2RKMA 3IJXB 3M3FA 4LQ5A 3FV1A 3MP6A 3MZBA 2IA4A 3IK6B 5LOMA 1PEBA 2FNCA 2GH9A 3IB0A 2XXYA 4POXA 3RNNA 1AIVA 3K4UA 4G8MA 4WKMA 1NNKA 3MUQA 3KN8A 1DPPA 2ZNSA 3PPRA 4XKQA 3G3JA 2Q8JA 4X48A 2PVUA 4IGRA 4LZ8A 1GVCA 3TCGA 1YPNA 3MBPA 3PMVA 2ZMBA 3HHGA 1FQFA 2NOOA 4OXVA 5EHSA 1SI1A 4OFJA 1B9JA 2XX9A 3ONMA 3PMXA 2GHBA 1SI0A 3O9PA 2OCUA 3E3KA 4E0WA 2VOZA 4KHZE 3IOUA 5H8QA 1LAFE 4NMYA 1FTLA 1R6ZA 2F6PA 3HN0A 1I6AA 1B4ZA 5I84A 4M4GA 2P0SA 4KPTA 3L6GA 3WAFA 1IXCA 3O28A 5B7DA 4IB2A 3FATA 3T9UA 4OZ9A 5CMCA 5IKBA 1B0HA 3G3KA 4XXUA 4QFKA 3ZKLA 2OK2A 4FJPA 2DWHA 4H5GA 4YKKA 5H8SA 4BDQA 3H6UA 3T66A 4BDNA 3TDJA 3CSBA 2GFEA 2H98A 3G3HA 4TOZA 2QL3A 4KD5A 2Y84A 3G7WA 2F6GA 4IO6A 5AA4B 2DWAA 4WEPA 3I5OA 4MH5A 1N0TA 4ECFA 1MQIA 3KZGA 1IEJA 3K6UA 2ZYMA 2ZYNA 3C32A 4JSOA 4F1VA 1B3FA 3IB2A 2F35A 1B7UA 3KN3A 1USYE 2FA7A 3K6XA 5H8NB 2XXRA 4BLAA 1Q1KA 3HSTA 3DELB 1LBBA 4ONYA 2DVCA 3H7MA 4R9FA 1XC1A 5H8FA 4OERA 1EU8A 4R72A 3Q25A 3DP6A 5FHMA 1ANFA 1IXHA 4JBZA 3O97A 3RQTA 3OEKA 1ZMGA 3VLVA 1OQGA 4YB6A 3H4ZA 2PX1A 1JW4A 5CRYA 1BIYA 2O7IA 1OVTA 4XKRA 2V3UA 1QUJA 4L17A 5DTBA 3KN7A 3SDFA 1LFIA 5CMKA 4GWOA 3Q28A 3CIJA 4YKPA 3RY3A 3OD7A 3PPPA 4FEDA 3W15C 3C31A 3IOTA 1NFTA 4FATA 4P0IA 2F7BA 3KJTA 4N6PA 3T9VA 1QKAA 4RK9A 2H5YA 4KCCA 1P1WA 5CC2A 5CBRA 4PFUA 3WAEA 4ZDMA 4F22A 3IOVA 2HZLA 4ELRA 2DS9A 5EHMA 4OYVA 5EYFA 2NUVA 1NH8A 1HSLA 3QUFA 2Q89A 4ELPA 3THIA 1FTMA 4JWOA 4DXCA 4EQ7A 1LFGA 1FTKA 3RPWA 3QXMA 1MM6A 1OVBA 1UIUA 3L6HA 4NF6B 1IXIA 4PETA 4PE5B 3O6GA 1AH5A 3UORA 1UTBA 1A8FA 3PD8A 3LR1A 3MP1A 4RA1A 1M5BA 2XD3A 1MDQA 2X7QA 4G68B 1Y3NA 1DPEA 2DVZA 3FV2A 2ESNA 1OQHA 4RXLA 1B32A 3GZGA 4HS7A 1CB6A 1I69A 2RC8A 4TQUQ 1P1NA 4ZECA 2YPNA 3VXBA 4F2QA 2QMXA 4ZEFA 1MQGA 1URGA 4F18A 1B5IA 1H3DA 3KEIA 4QF9A 4XKPA 2NWJA 3EHTA 3R26A 3PPOA 4F3BA 4YMBA 2GHAA 4LZ7A 1Z7NE 1M5EA 1MRPA 4RPOA 3B6WA 4XIGQ 1MXWA 4LQ2A 4HW8A 1M5FA 3DP4A 3TTRA 4EXLA 3CFXA 4Q8RA 1LB8A 5H8HA 2ALUA 1US4A 1II5A 2CMOA 5I2KA 2I6EA 1VE4A 5TU0A 3PPQA 4F3PA 2A5SA 2ZYOA 3IL1B 3GBBA 2I0BA 4ESXA 4ZEBA 3E9XA 2RC9A 4YAHX 2QRYA 1XVXA 1JNFA 1SW2A 2QS1A 4R2FA 2QS3A 4NF5B 5KCJB 4C0RA 2AIXA 5I56B 1B5JA 4C1UA 4Q0CA 1SYHA 3B6TA 1NH7A 2QPQA 1O7TA 2F36A 3TQWA 3PV0E 3EQ1A 2VHAA 3TKDA 2UVJA 5L9OA 1LBCA 1JW5A 5A5XB 3TMGA 3VV5A 3K01A 5L9SA 3W9VA 2OLBA 3OENA 2I48A 1POY1 3P7IA 4H65A 3A09A 2V84A 4KYSA 4OENA 4ELQA 3UK4A 1DTZA 3ZS6A 1I6BA 4POWA 4F3SA 4LATA 4IGTA 1DMBA 1JVYA
chains in the Genus database with same CATH superfamily
3MC2A 2Z8DA 1TT1A 4Q5TA 1MPCA 3PUYE 2ANJA 4GBWA 3ILTB 5I57A 2XXIA 1MXZA 2B65A 3S9MC 2E1SA 4ISUA 4PFTA 1PDAA 1SBPA 1LBXA 1JETA 4XEQA 2CEYA 4NEDA 4QFPA 4QRZA 4HCWA 3O6IA 1FJ9A 1IMBA 4GWYA 5I56A 1PB8A 2Z22A 1YYZA 1MXUA 4TLLB 3OO8A 1B7ZA 3ILUB 3KOTA 5BUUA 5H8QB 2YLNA 1NV4A 1NV6A 4OVJA 1EZPA 2XA5A 1Y1ZA 1TXFA 5A5XA 3FVOA 5CMMA 4JSDA 3IX1A 5FTHA 2F8DA 1FBCA 1FQDA 1D4NA 4PFWA 4WXJA 4NF4B 1N3WA 4RYAA 2RCBA 2HHMA 2XXHA 4P56A 3EN3A 1TFAA 1SW1A 2DOJA 4TLMB 1Y3PA 1YAEA 4MFIA 3G3FA 3UP9A 2FBPA 3I3VA 5JTYB 2PT1A 5ELVA 2F5XA 1FQEA 5AA1A 2HQ0A 3E4RA 3SEYA 4LUBA 2DE4A 4U4SA 4GD5A 2H4IA 1VSOA 4PC9A 4YKJA 1LLSA 3MSTA 4F31B 3U92A 4O7IA 3K1NA 4G2ZA 3TELA 4OFOA 4LVQA 4F19A 1EYIA 4H0WA 4R2BA 4H1XA 3I6VA 5HM4B 2XHDA 3PUXE 1LAXA 4OFLA 2F34A 3Q26A 3VLWA 1TWYA 3BFTA 1D9VA 1XI6A 1WODA 3A3UA 3FUZA 4ESWA 1DSNA 2KLFA 3GYYA 1XHYA 4NF4A 4KXPA 5H8FB 5LDZA 1LAGE 3IORA 2Q8MA 4ELOA 4IO3A 4JWXA 1OLAA 1FPBA 3E78A 4UA8A 3R7XA 3EF7A 1LEVA 3SETA 1YTVA 4OETA 4DCYA 2RINA 5JTYA 1XVYA 1B3EA 2D5WA 2Y7KA 3CFLA 4R73A 4U2RA 3KFMA 1B3LA 4F29A 5CBSA 4ZE9A 2ZZWA 5I5PA 3Q29A 5IZZA 5I7IA 5ICTA 1H76A 3GLBA 3S2VA 3SKPA 3QAXA 5JK4A 4GQOA 5AA2A 4I62A 2XXXA 4QFLA 2DP8A 2A5TA 2CZLA 5CMBA 2XX7A 4P47A 3T0JA 4ZE8A 1ZKBA 1XOCA 2CEXA 1H45A 4EQ9A 3SEVA 3CG3A 3HCQA 2CZHA 2DWJA 4QSEA 3QYTA 3C36A 1LB9A 2QFLA 4GF8A 3PMWA 4AB6A 2V3QA 4PTKA 1M5DA 2ZZXA 3KG2A 5IM2A 1MM7A 1SW5A 2ABHA 3IFAA 4PQJA 4U23A 2XXTA 1M5CA 4QFOA 3OMBA 4JWYA 3IFCA 4GL0A 2HZKA 5IGAA 4NF0A 1IMEA 3MYUA 1SW4A 2QVRA 4ZZEA 4GX3A 4IO5A 3N6TA 3TYHA 1HSJA 3VDFA 1NV2A 5I59A 3RT8A 2Q9TA 4RY1A 2UVIA 2WEFA 1P1UA 5TPAA 1UTBB 3IOWA 2GRVA 1FTJA 2V93A 3EHUA 5J1DA 1FTOA 3USDA 5L9MA 1H43A 3G3IA 3M8UA 4DXUA 1FCKA 4OWDA 1D9YA 2HFBA 3JYRA 2OWSA 2O68A 1AOVA 2F3DA 4OEVA 2QS2A 2HAUA 4K3FA 3LSWA 3LV0A 4G68C 3OELA 1MY4A 2PBWA 2IEEA 4GWSA 1DBZA 3T22A 4H5FA 4DCXA 3TEPA 3VVFA 1ZJLA 3LUYA 3K0VA 3TAJA 3OOAA 4ZEDA 3T93B 1SVXB 4KQPA 2ZNTA 3BIGA 2W7YA 4PFYA 4X1DA 2Z23A 1N04A 2XWIA 5DYHA 2XXWA 3TPAA 1A99A 2VP1A 1I6QA 3T96B 3QUJA 3KSXA 4ZEKA 4NHBA 3KBZA 5H8HB 2X7PA 4R6HA 3CVGA 1MG1A 2P2AA 4H46A 2QJEA 4OVPA 3CSGA 5I2KB 3FXUA 4BDRA 2I3WA 3N5LA 4N6KA 2F7CA 1J1NA 1Y1MA 1B52A 1Y4TA 5ITOA 4YICA 1A7LA 1DK4A 1LBWA 3U72A 1FQCA 1MQJA 3OEMA 4MLVA 2V25A 2O84X 2LAOA 1MXYA 4Z0IA 1HSEA 1MH4A 1NV0A 4O3AA 3UGWA 4Q30B 4N6DA 1LCFA 4ZS9A 1LBZA 4N91A 1B3HA 1K9YA 3C34A 1A55A 4NF8A 1FJ6A 2HCAA 4OHNA 4MAGA 1PBPA 4BDMA 3VXCA 5ET5A 1UIVA 3IR1A 3E13X 3ECRA 2O6AA 1US5A 3HV1A 5ET7A 3VE1B 4EF2A 1LSTA 3C4MA 1NKXA 4NE4A 4KFQA 4F39A 4IY5A 4NQ8A 2P3VA 4QSCA 3T9XB 4EF1A 3RGYA 2Z8FA 4IO2A 4PFRA 1RDZA 1FPKA 5IZ1A 3NOHA 4U1OA 4G4PA 2QVUA 1BKAA 3RTFB 3JZJA 3KGCA 2H99A 1P99A 3DP8A 4R75A 3V83A 2PCRA 5I57B 5DEXA 4P3LA 2ZYKA 3SZPA 1B4HA 1FBDA 5AA2D 3TQLA 4IO7A 2O7UA 2AL5A 5HBCA 4X1BA 4R6KA 3MVXA 2I3VA 1FW0A 2B3FA 1RDXA 4XTCQ 4MX6A 1JP4A 4NWDA 4F2OA 4R74A 1IZ1A 3OO6A 5ISUA 3S9EA 1QW0A 2Q2AA 4N17A 2Q74A 4PFIA 4C1TA 1MY3A 4DI3D 4R9GA 3O6HA 4PGNA 3CR9A 3PUWE 3FD3A 4ZEIA 1EH3A 4PBQA 1QKBA 4PGPA 3G3GA 1S50A 2YJPA 2I4BA 3F11A 4YKIA 2DXRA 2OWTA 1B6HA 5IAIA 1JEVA 1Z7ME 4KR5A 5EQ9A 2DQVA 1FRPA 1G0HA 1KWHA 2L5VA 3UN6A 1NNPA 2H25A 4R6YA 5L8DA 4MLQA 3S9NC 1B7HA 3VVDA 1A54A 1UTHA 3EKIA 4FAJA 3ISPA 1XT8A 2B3BA 5AE4A 3RUMA 3C9HA 4F1UA 1LBYA 4P1LA 2O1LA 3EHSA 1O64A 1YCJA 2Y7PA 3HFUA 5KDTB 4OVRA 1URDA 2UYFA 1QVSA 3MW0A 2M8CA 5I2NA 3KOSA 3N6UA 2DE3A 1USYH 2R71A 4H67A 1RYXA 1B1XA 1WVJA 1IQ7A 1JQFA 4MEVA 3S4UA 1YXIA 5I58A 3FASA 3H3GA 5KZTA 3RT6B 4DIGA 1DOTA 1FPFA 1DTGA 2CZIA 2ONSA 3MVZA 3MJNA 3MVWA 3TFLA 2XXQA 3V5AA 4LZ5A 1LBVA 1JW1A 1URSA 2B4LA 3KJ7A 5IZ3A 2UYEA 4KI0E 4BDLA 1Y20A 1AMFA 4MNCA 4P11A 4PF6A 3LBSA 3K1MA 3A29A 3UIFA 4QSDA 1S7YA 4RK2A 2CZKA 4IY6A 3OXNA 1B05A 2Y7WA 2DE2A 2FIXA 2FYIA 3CFZA 3K00A 2HAVA 1Y3QA 3IB1A 4FORA 3HPIA 5FHNA 1ZTYA 3CRBA 1NNTA 3C35A 4FE8A 5KDTA 2VD3A 4O3BA 2PYYA 3SEXA 4RNSA 4JB7A 3FJ7A 4GRKA 3FJGA 1R9QA 3AXFA 4YU0A 2Y5KA 1A40A 4FBPA 1NMUA 4H6DA 5AA2B 3BKIB 4DXBA 3HO7A 1GV8A 5HPQA 1QUIA 2A5TB 1OMPA 3VVEA 2VGQA 4G8NA 5F1QA 4DZ1A 4DDDA 4BDOA 3OSRA 1MPDA 4EUOA 4U22A 4GX4A 3QK6A 1MQHA 3K1PA 1NI9A 4LP2B 1T0KA 3OSQA 3R6UA 2H9BA 5EQ7A 4FIMA 1N84A 5TP9A 2WKYA 3N26A 4OEUA 3MZ1A 4YZZA 2G93A 1NV1A 1QUKA 3FBPA 3TTKA 1FSAA 4O3CA 4LONB 1PC3A 3CI8A 1Q35A 1SQYA 4KCDA 4OQOA 2Y7IA 4KYEA 4I1DA 3M3KA 1FBFA 4HCYA 1EZOA 1ZLQA 3BBRA 1JVXA 3RN8A 5J16A 3ZSFA 1MXXA 1PB7A 5I59B 2REGA 5TPAB 2PT2A 4N13A 5B70A 5ESYA 3RPLA 2WBDA 1ELJA 4AQ4A 4XKNA 4F1YA 4E0XA 4GIZA 1KZ8A 3B7DA 3OO7A 4GBVA 4PCDA 3W9WA 1BTJA 2F78A 4DI4B 3S9LC 4THIA 1VDWA 3IJOB 3MPLA 1MY1A 1FBHA 3IO6A 3OO9A 1QJMA 1A8EA 2XD2A 4MF3A 1MH3A 1RDYA 3O2AA 2DYXA 3PGFA 4N81A 1EZ9A 1B58A 1FQBA 1VR5A 4PP0A 5FTIA 3ZKKA 1NV5A 2PMSA 1LGBC 3M3LA 1B2HA 4P0GA 3O29A 4M1VA 5JEIA 5T3JA 1MS7A 5I3SA 2RF1A 3TCFA 4GFRA 3DLNA 2FIEA 3B50A 4PDDA 2V3TA 2I58A 1IMCA 2HEUA 2XWVA 1SYIA 3MP8A 5DVFA 1DCUA 3LC8A 3U1OA 3KC0A 4I3YA 2NXOA 4ND9A 4AB5A 3PU5A 3TZAA 3KBRA 3V8XB 5K2YA 4U21A 3U8QA 4LA9A 2WYKA 1P1QA 1IMDA 5EQAA 5DVJA 2Q2CA 1F9BA 1GTKA 2R6GE 3D4GA 1OLCA 4I3EA 4IO4A 2Y5LA 1SDXA 4WEDA 4NTLA 2WBBA 4ZZAA 1O63A 4LN5A 5K2XA 4QBAA 3U94A 1TFDA 2RCAA 4NF8B 5AA4A 2WX9A 4O7MA 1NL5A 4NWCA 4PAIA 2UXAA 3MWBA 4O94A 2XWKA 1IXGA 2NVUB 3FIRA 4QHQA 2OZZA 4P1EA 2O1MA 2ZNUA 4GXSB 4MBPA 3TCHA 3D4CA 5A5LA 1POTA 2OJTA 3EPEA 5H8NA 4AS4A 3U65A 2R8TA 1D3KA 4P9KA 4UACA 2VD2A 2F7AA 4JXIA 2RC7A 4G77A 1S9TA 5M2VA 3PUZE 1N7WA 3FJMA 5F7VA 2QVVA 4GWUA 4N07A 3T1BA 3FVGA 3H6TA 1B3GA 1LAHE 1FBEA 4GX6A 4OMBA 4U4XA 5DEXB 4MNPA 2F97A 2XXPA 5ITPA 1OIBA 3K6WA 4MMPA 1QULA 3TUSA 3O66A 3FXBA 1ZIUA 3QSLA 1FPGA 1UQWA 3V89B 1PBQA 3SEWA 2E0SA 3FXQA 1MXVA 2ZXTA 2R9JA 3B6QA 1SD3A 2VPNA 4OVSA 3FZVA 2DXYA 3C33A 1FQAA 2Q88A 1FBPA 1N76A 4YB5A 3VLUA 4OA4A 4GVOA 4G8HA 4RJZA 1INPA 4EDPA 1NUYA 1RYOA 1JEUA 3MPKA 1N3XA 1R9LA 1VFEA 1MY0A 3K2DA 4YB7A 3HHFA 2ZZVA 2OBGA 2O51A 3T9HB 4HTGA 3B8BA 3BFUA 1UTHB 2KR0A 3PUVE 3TTNA 2UVGA 5DT6A 1AL3A 4PFBA 3CG1A 4DLDA 3H6VA 1B46A 1EYKA 3ROJA 3MVYA 5BWJA 2OX3A 3FVNA 4GOTA 2XXUA 3SERA 4I40A 3PPNA 5I2NB 1MPBA 2QMWA 4NF6A 4HE0A 1BP5A 3FGSA 3IO4A 3E79A 1MY2A 3K6VA 1R1NA 3ODBA 3U93A 4EXKA 2Y7RA 2HXWA 3JV9A 1XS5A 1LCTA 5I58B 1Y4CA 5CM6A 4GXAA 4G68A 2DWIA 4FEBA 3N94A 4DE8A 4U1ZA 1B51A 2I0CA 2I49A 1GGGA 1H44A 2DSFA 3UA8A 3GBAA 5EYHA 1NNFA 1L5TA 2REJA 2QS4A 3TODA 4H8JA 1B0LA 5IZ3B 2OWZA 1RKMA 2THIA 2Z8EA 4GL8A 4PAFA 4OTEA 2P1SA 4RPNA 4MCOA 3K02A 2ONRA 3SESA 1ATGA 3VFJA 4GLIA 1N7XA 2I4CA 4I9DA 3BIHA 3RTWB 2UVHA 2G29A 2VT5A 5DVIA 2X26A 3KSJA 1Y9UA 1VFDA 4GWXA 3H6WA 3QIMA 1IIWA 3FVKA 1BLFA 1MQDA 1Q9DA 3GXAA 2JJKA 1NV7A 3LSLA 4JDFA 3SEUA 1CE2A 1KA0A 1IUDA 3IAZA 1FPDA 5CI5A 4FECA 4PE3A 1PB9A 1MDP1 4X9TA 2D21A 3MAMA 4F3GA 2O69A 1B40A 4H8IA 1GR2A 3H03A 1FPEA 2XXKA 1P1OA 1ZU0A 2AYSA 1IITA 3LSFB 3FXRA 2BJJX 3Q27A 4MHFA 1WDNA 4Z7EA 3MQ9A 4QFNA 1B1HA 1FTAA 2XXVA 1KA1A 3TTLA 4YMAA 2FHYA 3LSXA 2QSXA 4MNIA 1LFHA 1G0IA 4NF5A 5KCJA 1B5HA 4I8CA 5AA3A 2AL4A 3PD9A 2XX8A 5TP9B 1SPIA 4EQBA 3A3CA 4IR8A 5DW8A 3KC1A 3MZ9A 5ICQA 4KYDA 3H06B 3TTMA 5FHOA 2D3IA 3DM0A 4OESA 2ONKE 2P3NA 3RLFE 1ZBMA 2RKMA 3IJXB 3M3FA 4LQ5A 4JVCA 4PAKA 3FV1A 3MP6A 4H45A 3MZBA 2MKZA 2IA4A 3IK6B 5LOMA 1PEBA 2FNCA 2GH9A 3IB0A 2HPGA 2XXYA 4POXA 3RNNA 1AIVA 3K4UA 4G8MA 4WKMA 1NNKA 3MUQA 1NUWA 3KN8A 3RPLB 4GWWA 1DPPA 2F3BA 2ZNSA 2KQZA 3PPRA 2VPOA 4XKQA 4OVQA 3G3JA 3QMFA 2Q8JA 4X48A 2PVUA 4IGRA 4LZ8A 4HE2A 1GVCA 3TCGA 1YPNA 5EYGA 3MBPA 3PMVA 2ZMBA 3HHGA 1FQFA 2NOOA 4OXVA 5EHSA 1SI1A 4OFJA 1B9JA 2XX9A 3ONMA 3PMXA 4XF5A 2GHBA 1SI0A 3O9PA 2OCUA 2FVZA 3E3KA 1FPLA 4E0WA 2VOZA 4KHZE 3IOUA 5H8QA 1LAFE 1YZ0A 4NMYA 1FTLA 1R6ZA 2B4MA 4HE1A 2F6PA 3HN0A 1I6AA 1B4ZA 5I84A 4M4GA 2P0SA 4KPTA 3L6GA 3WAFA 1IXCA 3O28A 5B7DA 4IB2A 3FATA 3T9UA 4OZ9A 4P8BA 5CMCA 5IKBA 1B0HA 1NV3A 3G3KA 4XXUA 4QFKA 3ZKLA 2OK2A 4FJPA 4N8YA 4XFEA 4G61A 2DWHA 4H5GA 4O8MA 4YKKA 5H8SA 2GQ1A 4BDQA 3H6UA 3T66A 4BDNA 3TDJA 3CSBA 2GFEA 2H98A 3G3HA 5LTCA 4TOZA 2QL3A 4OVTA 4KD5A 2Y84A 3G7WA 2F6GA 4IO6A 5AA4B 2DWAA 4WEPA 3I5OA 4MH5A 1N0TA 4ECFA 1MQIA 3KZGA 4X8RA 1IEJA 3K6UA 2ZYMA 2ZYNA 3C32A 4PF8A 4JSOA 4F1VA 5FBPA 1B3FA 3IB2A 2F35A 1B7UA 3KN3A 1USYE 2FA7A 1CNQA 3K6XA 5H8NB 2XXRA 4BLAA 1Q1KA 3HSTA 4JVIA 3DELB 1LBBA 4ONYA 2DVCA 2HXRA 3CHGA 3H7MA 4R9FA 1XC1A 1EYJA 5H8FA 4OERA 1EU8A 4R72A 3Q25A 3DP6A 5FHMA 1NUZA 1ANFA 1IXHA 4JBZA 3O97A 4MJOA 3RQTA 3OEKA 1ZMGA 3VLVA 1OQGA 4YB6A 2WYPA 3H4ZA 2PX1A 1JW4A 5CRYA 1BIYA 2O7IA 1OVTA 4XKRA 2V3UA 1QUJA 4L17A 5DTBA 3KN7A 5EQ8A 1LFIA 3SDFA 5CMKA 4GWOA 3Q28A 3CIJA 4YKPA 3RY3A 3OD7A 4QXDA 3PPPA 4FEDA 3W15C 3C31A 3IOTA 1NFTA 4MIJA 4FATA 4P0IA 2F7BA 4N4UA 3KJTA 4N6PA 3T9VA 1QKAA 4RK9A 2H5YA 4KCCA 1P1WA 5CC2A 5CBRA 4PFUA 3WAEA 4ZDMA 3D1RA 4F22A 3IOVA 4JVDA 2HZLA 2XWOA 2BJIA 4ELRA 2DS9A 5EHMA 4OYVA 5EYFA 2NUVA 4HXVA 1NH8A 1HSLA 3QUFA 2Q89A 4ELPA 4PDHA 3THIA 1FTMA 4JWOA 4DXCA 4EQ7A 1LFGA 1FTKA 3RPWA 3QXMA 1MM6A 1OVBA 1UIUA 3L6HA 4NF6B 1IXIA 4PETA 4PE5B 3O6GA 1AH5A 5ET8A 3UORA 1UTBA 1A8FA 3PD8A 3LR1A 3MP1A 4RA1A 1M5BA 2XD3A 1MDQA 4X04A 2X7QA 4G68B 1Y3NA 1DPEA 2DVZA 3FV2A 2ESNA 2PFYA 1OQHA 4RXLA 1B32A 3GZGA 4HS7A 1CB6A 3LUZA 1I69A 2RC8A 4TQUQ 1P1NA 4ZECA 2YPNA 3VXBA 4F2QA 2QMXA 1MQGA 1URGA 4ZEFA 4F18A 1B5IA 1H3DA 3KEIA 4QF9A 4UABA 4XKPA 2NWJA 3EHTA 3R26A 1FPIA 1BK4A 4NN3A 3PPOA 4F3BA 4YMBA 1IMFA 2GHAA 4LZ7A 3RYDA 1Z7NE 1M5EA 1MRPA 4RPOA 3B6WA 1FPJA 4XIGQ 1QGXA 1MXWA 4LQ2A 4HW8A 1M5FA 3DP4A 3TTRA 4EXLA 2V4CA 3CFXA 5F24A 4Q8RA 1LB8A 5H8HA 2ALUA 1US4A 1II5A 2CMOA 5I2KA 2I6EA 1VE4A 5TU0A 1IMAA 4GWZA 3PPQA 4NGUA 4F3PA 2A5SA 4AS5A 2ZYOA 3IL1B 3GBBA 2I0BA 4ESXA 4N15A 1FBGA 4ZEBA 3E9XA 4NAPA 2RC9A 4YAHX 2QRYA 1XVXA 1JNFA 1SW2A 2DDKA 2QS1A 4NX1A 4R2FA 2QS3A 4NF5B 5KCJB 4C0RA 2AIXA 5I56B 1B5JA 4C1UA 4Q0CA 1SYHA 3B6TA 1NH7A 2QPQA 1O7TA 2F36A 3TQWA 3PV0E 4NG7A 3EQ1A 5ET6A 1D9QA 2VHAA 3TKDA 2UVJA 4PBHA 5L9OA 1LBCA 1JW5A 5A5XB 3TMGA 3VV5A 3K01A 5L9SA 4N8GA 3W9VA 2OLBA 3OENA 2I48A 1POY1 3P7IA 4OANA 4H65A 3A09A 2V84A 4KYSA 1NUXA 4OENA 1AWBA 4ELQA 3UK4A 1DTZA 3ZS6A 1I6BA 4POWA 4F3SA 1K9ZA 3PTYA 4LATA 4IGTA 1DMBA 2PFZA 1JVYA
chains in the Genus database with same CATH topology
3MC2A 2Z8DA 1TT1A 4Q5TA 1MPCA 3PUYE 2ANJA 3ILTB 5I57A 2XXIA 1MXZA 2B65A 3S9MC 2E1SA 4ISUA 4PFTA 1PDAA 1SBPA 1JETA 4NEDA 4QFPA 4QRZA 4HCWA 3O6IA 5I56A 1PB8A 2Z22A 1MXUA 4TLLB 3OO8A 1B7ZA 3ILUB 3KOTA 5BUUA 5H8QB 2YLNA 4OVJA 1EZPA 1Y1ZA 1TXFA 5A5XA 3FVOA 5CMMA 4JSDA 3IX1A 5FTHA 2F8DA 1FQDA 1D4NA 4PFWA 4WXJA 4NF4B 1N3WA 4RYAA 2RCBA 2XXHA 3EN3A 1TFAA 1SW1A 2DOJA 4TLMB 1YAEA 1Y3PA 4MFIA 3G3FA 3UP9A 3I3VA 5JTYB 2PT1A 5ELVA 2F5XA 1FQEA 5AA1A 2HQ0A 3E4RA 3SEYA 4LUBA 2DE4A 4U4SA 4GD5A 2H4IA 1VSOA 4YKJA 1LLSA 4F31B 3U92A 3K1NA 4G2ZA 3TELA 4OFOA 4LVQA 4F19A 4H0WA 4R2BA 4H1XA 3I6VA 5HM4B 2XHDA 3PUXE 1LAXA 4OFLA 2F34A 3Q26A 3VLWA 1TWYA 3BFTA 1D9VA 1WODA 3A3UA 3FUZA 4ESWA 1DSNA 2KLFA 1XHYA 4NF4A 5H8FB 1LAGE 3IORA 4ELOA 4IO3A 4JWXA 1OLAA 4UA8A 3R7XA 3EF7A 3SETA 1YTVA 4OETA 4DCYA 2RINA 5JTYA 1XVYA 1B3EA 2D5WA 2Y7KA 3CFLA 4R73A 4U2RA 3KFMA 1B3LA 4F29A 5CBSA 4ZE9A 3Q29A 5ICTA 1H76A 3GLBA 3S2VA 3SKPA 3QAXA 5JK4A 4GQOA 5AA2A 4I62A 2XXXA 4QFLA 2DP8A 2A5TA 2CZLA 5CMBA 2XX7A 4ZE8A 1ZKBA 1XOCA 1H45A 4EQ9A 3SEVA 3CG3A 3HCQA 2DWJA 4QSEA 3QYTA 3C36A 1LB9A 4GF8A 3PMWA 4AB6A 2V3QA 1M5DA 3KG2A 1MM7A 1SW5A 2ABHA 4PQJA 4U23A 2XXTA 1M5CA 4QFOA 3OMBA 4JWYA 4GL0A 2HZKA 1SW4A 4ZZEA 4IO5A 3N6TA 3TYHA 1HSJA 3VDFA 5I59A 3RT8A 2Q9TA 4RY1A 2UVIA 5TPAA 1P1UA 1UTBB 3IOWA 2GRVA 1FTJA 2V93A 3EHUA 5J1DA 1FTOA 3USDA 5L9MA 1H43A 3G3IA 3M8UA 4DXUA 1FCKA 4OWDA 1D9YA 2HFBA 3JYRA 2OWSA 2O68A 1AOVA 4OEVA 2QS2A 2HAUA 4K3FA 3LSWA 4G68C 3OELA 1MY4A 2PBWA 2IEEA 3T22A 4H5FA 4DCXA 3TEPA 3VVFA 1ZJLA 3LUYA 3K0VA 3TAJA 3OOAA 4ZEDA 3T93B 1SVXB 4KQPA 2ZNTA 2W7YA 4PFYA 4X1DA 2Z23A 1N04A 5DYHA 2XXWA 3TPAA 1A99A 2VP1A 1I6QA 3T96B 3QUJA 3KSXA 4ZEKA 5H8HB 2X7PA 4R6HA 3CVGA 1MG1A 2P2AA 2QJEA 3CSGA 5I2KB 3FXUA 4BDRA 2I3WA 3N5LA 2F7CA 1J1NA 5ITOA 1B52A 1Y1MA 1Y4TA 4YICA 1A7LA 3U72A 1FQCA 1MQJA 3OEMA 4MLVA 2V25A 2O84X 2LAOA 1MXYA 4Z0IA 1HSEA 1MH4A 4O3AA 3UGWA 4Q30B 1LCFA 4ZS9A 1B3HA 3C34A 1A55A 4NF8A 2HCAA 4OHNA 4BDMA 1PBPA 3VXCA 1UIVA 3IR1A 3E13X 3ECRA 2O6AA 1US5A 3HV1A 3VE1B 4EF2A 1LSTA 3C4MA 1NKXA 4NE4A 4KFQA 4F39A 4IY5A 4QSCA 3T9XB 4EF1A 3RGYA 2Z8FA 4IO2A 4U1OA 4G4PA 1BKAA 3RTFB 3JZJA 3KGCA 2H99A 1P99A 3DP8A 4R75A 3V83A 5I57B 5DEXA 2ZYKA 1B4HA 5AA2D 3TQLA 4IO7A 2O7UA 2AL5A 5HBCA 4X1BA 4R6KA 3MVXA 2I3VA 1FW0A 2B3FA 4XTCQ 4NWDA 4F2OA 4R74A 1IZ1A 3OO6A 5ISUA 3S9EA 1QW0A 2Q2AA 4C1TA 1MY3A 4R9GA 3O6HA 3CR9A 3PUWE 3FD3A 4ZEIA 1EH3A 1QKBA 3G3GA 1S50A 2YJPA 2I4BA 3F11A 4YKIA 2DXRA 2OWTA 1B6HA 5IAIA 1JEVA 1Z7ME 4KR5A 2DQVA 1KWHA 3UN6A 1NNPA 2H25A 4R6YA 5L8DA 4MLQA 3S9NC 1B7HA 3VVDA 1A54A 1UTHA 4FAJA 1XT8A 2B3BA 5AE4A 3RUMA 3C9HA 4F1UA 2O1LA 3EHSA 1O64A 1YCJA 2Y7PA 5KDTB 1URDA 2UYFA 1QVSA 3MW0A 2M8CA 5I2NA 3KOSA 3N6UA 2DE3A 1USYH 2R71A 4H67A 1RYXA 1B1XA 1WVJA 1IQ7A 1JQFA 3S4UA 5I58A 3FASA 3H3GA 5KZTA 3RT6B 4DIGA 1DOTA 1DTGA 2ONSA 3MVZA 3MJNA 3MVWA 3TFLA 2XXQA 3V5AA 4LZ5A 1JW1A 1URSA 3KJ7A 2UYEA 4KI0E 4BDLA 1Y20A 1AMFA 4P11A 3LBSA 3K1MA 3UIFA 4QSDA 1S7YA 4RK2A 4IY6A 3OXNA 1B05A 2Y7WA 2DE2A 2FYIA 3CFZA 3K00A 2HAVA 1Y3QA 3IB1A 4FORA 3HPIA 5FHNA 1ZTYA 3CRBA 1NNTA 3C35A 4FE8A 5KDTA 2VD3A 4O3BA 2PYYA 3SEXA 4RNSA 4JB7A 3FJ7A 4GRKA 3FJGA 1R9QA 3AXFA 4YU0A 1A40A 1NMUA 4H6DA 5AA2B 3BKIB 4DXBA 3HO7A 1GV8A 5HPQA 1QUIA 2A5TB 1OMPA 3VVEA 2VGQA 4G8NA 5F1QA 4DZ1A 4DDDA 4BDOA 3OSRA 1MPDA 4EUOA 4U22A 3QK6A 1MQHA 3K1PA 4LP2B 1T0KA 3OSQA 3R6UA 2H9BA 4FIMA 1N84A 5TP9A 2WKYA 3N26A 4OEUA 3MZ1A 4YZZA 2G93A 1QUKA 3TTKA 4O3CA 4LONB 1PC3A 3CI8A 1Q35A 1SQYA 4KCDA 4OQOA 2Y7IA 4KYEA 3M3KA 4I1DA 4HCYA 1EZOA 1ZLQA 3BBRA 1JVXA 3RN8A 3ZSFA 1MXXA 1PB7A 5I59B 2REGA 5TPAB 2PT2A 4N13A 5B70A 1ELJA 4AQ4A 4XKNA 4F1YA 4E0XA 4GIZA 3B7DA 3OO7A 3W9WA 1BTJA 2F78A 3S9LC 4THIA 3IJOB 3MPLA 1MY1A 3IO6A 3OO9A 1QJMA 1A8EA 2XD2A 4MF3A 1MH3A 3O2AA 2DYXA 3PGFA 1EZ9A 1B58A 1FQBA 1VR5A 4PP0A 5FTIA 3ZKKA 2PMSA 1LGBC 3M3LA 1B2HA 4P0GA 3O29A 4M1VA 5JEIA 1MS7A 2RF1A 3TCFA 4GFRA 3DLNA 2V3TA 2I58A 2HEUA 1SYIA 3MP8A 5DVFA 3LC8A 3U1OA 2NXOA 4ND9A 4AB5A 3PU5A 3TZAA 3KBRA 3V8XB 5K2YA 4U21A 3U8QA 4LA9A 1P1QA 5DVJA 2Q2CA 1F9BA 1GTKA 2R6GE 3D4GA 1OLCA 4IO4A 1SDXA 4WEDA 4NTLA 4ZZAA 1O63A 5K2XA 3U94A 1TFDA 2RCAA 4NF8B 5AA4A 1NL5A 4NWCA 2UXAA 3MWBA 1IXGA 2NVUB 3FIRA 4QHQA 2OZZA 2O1MA 2ZNUA 4GXSB 4MBPA 3TCHA 3D4CA 1POTA 2OJTA 3EPEA 5H8NA 1D3KA 4UACA 2VD2A 2F7AA 4JXIA 2RC7A 4G77A 1S9TA 5M2VA 3PUZE 1N7WA 3FJMA 5F7VA 4N07A 3FVGA 3H6TA 1B3GA 1LAHE 4OMBA 4U4XA 5DEXB 2F97A 2XXPA 5ITPA 1OIBA 3K6WA 1QULA 3TUSA 3O66A 1ZIUA 3QSLA 1UQWA 3V89B 1PBQA 3SEWA 2E0SA 3FXQA 1MXVA 2ZXTA 2R9JA 3B6QA 1SD3A 3FZVA 2DXYA 3C33A 1FQAA 2Q88A 1N76A 4YB5A 3VLUA 4GVOA 4G8HA 4RJZA 4EDPA 1RYOA 1JEUA 3MPKA 1N3XA 1R9LA 1VFEA 1MY0A 3K2DA 4YB7A 3HHFA 2OBGA 2O51A 3T9HB 4HTGA 3BFUA 1UTHB 3PUVE 3TTNA 2UVGA 5DT6A 1AL3A 3CG1A 4DLDA 3H6VA 1B46A 3MVYA 5BWJA 3FVNA 4GOTA 2XXUA 3SERA 3PPNA 5I2NB 1MPBA 2QMWA 4NF6A 1BP5A 3FGSA 3IO4A 1MY2A 3K6VA 1R1NA 3ODBA 3U93A 4EXKA 2Y7RA 2HXWA 3JV9A 1XS5A 1LCTA 5I58B 1Y4CA 5CM6A 4GXAA 4G68A 2DWIA 4FEBA 3N94A 4DE8A 4U1ZA 1B51A 2I0CA 2I49A 1GGGA 3UA8A 1H44A 2DSFA 3GBAA 1NNFA 1L5TA 2REJA 2QS4A 3TODA 4H8JA 1B0LA 1RKMA 2THIA 2Z8EA 4GL8A 4OTEA 2P1SA 4RPNA 3K02A 2ONRA 3SESA 1ATGA 3VFJA 4GLIA 1N7XA 2I4CA 4I9DA 3RTWB 2UVHA 2G29A 5DVIA 2X26A 3KSJA 1Y9UA 1VFDA 3H6WA 3QIMA 1IIWA 3FVKA 1BLFA 1MQDA 3GXAA 3LSLA 4JDFA 3SEUA 1CE2A 1IUDA 3IAZA 5CI5A 4FECA 1PB9A 1MDP1 4X9TA 2D21A 3MAMA 4F3GA 2O69A 1B40A 4H8IA 1GR2A 3H03A 1P1OA 1ZU0A 2AYSA 1IITA 3LSFB 3FXRA 2BJJX 3Q27A 1WDNA 4Z7EA 3MQ9A 4QFNA 1B1HA 2XXVA 3TTLA 4YMAA 3LSXA 2QSXA 1LFHA 4NF5A 5KCJA 1B5HA 4I8CA 5AA3A 2AL4A 3PD9A 2XX8A 5TP9B 4EQBA 3A3CA 3MZ9A 5ICQA 4KYDA 3H06B 3TTMA 5FHOA 2D3IA 3DM0A 4OESA 2ONKE 3RLFE 1ZBMA 2RKMA 3IJXB 3M3FA 4LQ5A 3FV1A 3MP6A 3MZBA 2IA4A 3IK6B 5LOMA 1PEBA 2FNCA 2GH9A 3IB0A 2XXYA 4POXA 3RNNA 1AIVA 3K4UA 4G8MA 4WKMA 1NNKA 3MUQA 3KN8A 1DPPA 2ZNSA 3PPRA 4XKQA 3G3JA 2Q8JA 4X48A 2PVUA 4IGRA 4LZ8A 1GVCA 3TCGA 1YPNA 3MBPA 3PMVA 2ZMBA 3HHGA 1FQFA 2NOOA 4OXVA 5EHSA 1SI1A 4OFJA 1B9JA 2XX9A 3ONMA 3PMXA 2GHBA 1SI0A 3O9PA 2OCUA 3E3KA 4E0WA 2VOZA 4KHZE 3IOUA 5H8QA 1LAFE 4NMYA 1FTLA 1R6ZA 2F6PA 3HN0A 1I6AA 1B4ZA 5I84A 4M4GA 2P0SA 4KPTA 3L6GA 3WAFA 1IXCA 3O28A 5B7DA 4IB2A 3FATA 3T9UA 4OZ9A 5CMCA 5IKBA 1B0HA 3G3KA 4XXUA 4QFKA 3ZKLA 2OK2A 4FJPA 2DWHA 4H5GA 4YKKA 5H8SA 4BDQA 3H6UA 3T66A 4BDNA 3TDJA 3CSBA 2GFEA 2H98A 3G3HA 4TOZA 2QL3A 4KD5A 2Y84A 3G7WA 2F6GA 4IO6A 5AA4B 2DWAA 4WEPA 3I5OA 4MH5A 1N0TA 4ECFA 1MQIA 3KZGA 1IEJA 3K6UA 2ZYMA 2ZYNA 3C32A 4JSOA 4F1VA 1B3FA 3IB2A 2F35A 1B7UA 3KN3A 1USYE 2FA7A 3K6XA 5H8NB 2XXRA 4BLAA 1Q1KA 3HSTA 3DELB 1LBBA 4ONYA 2DVCA 3H7MA 4R9FA 1XC1A 5H8FA 4OERA 1EU8A 4R72A 3Q25A 3DP6A 5FHMA 1ANFA 1IXHA 4JBZA 3O97A 3RQTA 3OEKA 1ZMGA 3VLVA 1OQGA 4YB6A 3H4ZA 2PX1A 1JW4A 5CRYA 1BIYA 2O7IA 1OVTA 4XKRA 2V3UA 1QUJA 4L17A 5DTBA 3KN7A 3SDFA 1LFIA 5CMKA 4GWOA 3Q28A 3CIJA 4YKPA 3RY3A 3OD7A 3PPPA 4FEDA 3W15C 3C31A 3IOTA 1NFTA 4FATA 4P0IA 2F7BA 3KJTA 4N6PA 3T9VA 1QKAA 4RK9A 2H5YA 4KCCA 1P1WA 5CC2A 5CBRA 4PFUA 3WAEA 4ZDMA 4F22A 3IOVA 2HZLA 4ELRA 2DS9A 5EHMA 4OYVA 5EYFA 2NUVA 1NH8A 1HSLA 3QUFA 2Q89A 4ELPA 3THIA 1FTMA 4JWOA 4DXCA 4EQ7A 1LFGA 1FTKA 3RPWA 3QXMA 1MM6A 1OVBA 1UIUA 3L6HA 4NF6B 1IXIA 4PETA 4PE5B 3O6GA 1AH5A 3UORA 1UTBA 1A8FA 3PD8A 3LR1A 3MP1A 4RA1A 1M5BA 2XD3A 1MDQA 2X7QA 4G68B 1Y3NA 1DPEA 2DVZA 3FV2A 2ESNA 1OQHA 4RXLA 1B32A 3GZGA 4HS7A 1CB6A 1I69A 2RC8A 4TQUQ 1P1NA 4ZECA 2YPNA 3VXBA 4F2QA 2QMXA 4ZEFA 1MQGA 1URGA 4F18A 1B5IA 1H3DA 3KEIA 4QF9A 4XKPA 2NWJA 3EHTA 3R26A 3PPOA 4F3BA 4YMBA 2GHAA 4LZ7A 1Z7NE 1M5EA 1MRPA 4RPOA 3B6WA 4XIGQ 1MXWA 4LQ2A 4HW8A 1M5FA 3DP4A 3TTRA 4EXLA 3CFXA 4Q8RA 1LB8A 5H8HA 2ALUA 1US4A 1II5A 2CMOA 5I2KA 2I6EA 1VE4A 5TU0A 3PPQA 4F3PA 2A5SA 2ZYOA 3IL1B 3GBBA 2I0BA 4ESXA 4ZEBA 3E9XA 2RC9A 4YAHX 2QRYA 1XVXA 1JNFA 1SW2A 2QS1A 4R2FA 2QS3A 4NF5B 5KCJB 4C0RA 2AIXA 5I56B 1B5JA 4C1UA 4Q0CA 1SYHA 3B6TA 1NH7A 2QPQA 1O7TA 2F36A 3TQWA 3PV0E 3EQ1A 2VHAA 3TKDA 2UVJA 5L9OA 1LBCA 1JW5A 5A5XB 3TMGA 3VV5A 3K01A 5L9SA 3W9VA 2OLBA 3OENA 2I48A 1POY1 3P7IA 4H65A 3A09A 2V84A 4KYSA 4OENA 4ELQA 3UK4A 1DTZA 3ZS6A 1I6BA 4POWA 4F3SA 4LATA 4IGTA 1DMBA 1JVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MC2 A;  2Z8D A;  1TT1 A;  4Q5T A;  1MPC A;  3PUY E;  2ANJ A;  3ILT B;  5I57 A;  2XXI A;  1MXZ A;  2B65 A;  3S9M C;  2E1S A;  4ISU A;  4PFT A;  1PDA A;  1SBP A;  1JET A;  4NED A;  4QFP A;  4QRZ A;  4HCW A;  3O6I A;  5I56 A;  1PB8 A;  2Z22 A;  1MXU A;  4TLL B;  3OO8 A;  1B7Z A;  3ILU B;  3KOT A;  5BUU A;  5H8Q B;  2YLN A;  4OVJ A;  1EZP A;  1Y1Z A;  1TXF A;  5A5X A;  3FVO A;  5CMM A;  4JSD A;  3IX1 A;  5FTH A;  2F8D A;  1FQD A;  1D4N A;  4PFW A;  4WXJ A;  4NF4 B;  1N3W A;  4RYA A;  2RCB A;  2XXH A;  3EN3 A;  1TFA A;  1SW1 A;  2DOJ A;  4TLM B;  1YAE A;  1Y3P A;  4MFI A;  3G3F A;  3UP9 A;  3I3V A;  5JTY B;  2PT1 A;  5ELV A;  2F5X A;  1FQE A;  5AA1 A;  2HQ0 A;  3E4R A;  3SEY A;  4LUB A;  2DE4 A;  4U4S A;  4GD5 A;  2H4I A;  1VSO A;  4YKJ A;  1LLS A;  4F31 B;  3U92 A;  3K1N A;  4G2Z A;  3TEL A;  4OFO A;  4LVQ A;  4F19 A;  4H0W A;  4R2B A;  4H1X A;  3I6V A;  5HM4 B;  2XHD A;  3PUX E;  1LAX A;  4OFL A;  2F34 A;  3Q26 A;  3VLW A;  1TWY A;  3BFT A;  1D9V A;  1WOD A;  3A3U A;  3FUZ A;  4ESW A;  1DSN A;  2KLF A;  1XHY A;  4NF4 A;  5H8F B;  1LAG E;  3IOR A;  4ELO A;  4IO3 A;  4JWX A;  1OLA A;  4UA8 A;  3R7X A;  3EF7 A;  3SET A;  1YTV A;  4OET A;  4DCY A;  2RIN A;  5JTY A;  1XVY A;  1B3E A;  2D5W A;  2Y7K A;  3CFL A;  4R73 A;  4U2R A;  3KFM A;  1B3L A;  4F29 A;  5CBS A;  4ZE9 A;  3Q29 A;  5ICT A;  1H76 A;  3GLB A;  3S2V A;  3SKP A;  3QAX A;  5JK4 A;  4GQO A;  5AA2 A;  4I62 A;  2XXX A;  4QFL A;  2DP8 A;  2A5T A;  2CZL A;  5CMB A;  2XX7 A;  4ZE8 A;  1ZKB A;  1XOC A;  1H45 A;  4EQ9 A;  3SEV A;  3CG3 A;  3HCQ A;  2DWJ A;  4QSE A;  3QYT A;  3C36 A;  1LB9 A;  4GF8 A;  3PMW A;  4AB6 A;  2V3Q A;  1M5D A;  3KG2 A;  1MM7 A;  1SW5 A;  2ABH A;  4PQJ A;  4U23 A;  2XXT A;  1M5C A;  4QFO A;  3OMB A;  4JWY A;  4GL0 A;  2HZK A;  1SW4 A;  4ZZE A;  4IO5 A;  3N6T A;  3TYH A;  1HSJ A;  3VDF A;  5I59 A;  3RT8 A;  2Q9T A;  4RY1 A;  2UVI A;  5TPA A;  1P1U A;  1UTB B;  3IOW A;  2GRV A;  1FTJ A;  2V93 A;  3EHU A;  5J1D A;  1FTO A;  3USD A;  5L9M A;  1H43 A;  3G3I A;  3M8U A;  4DXU A;  1FCK A;  4OWD A;  1D9Y A;  2HFB A;  3JYR A;  2OWS A;  2O68 A;  1AOV A;  4OEV A;  2QS2 A;  2HAU A;  4K3F A;  3LSW A;  4G68 C;  3OEL A;  1MY4 A;  2PBW A;  2IEE A;  3T22 A;  4H5F A;  4DCX A;  3TEP A;  3VVF A;  1ZJL A;  3LUY A;  3K0V A;  3TAJ A;  3OOA A;  4ZED A;  3T93 B;  1SVX B;  4KQP A;  2ZNT A;  2W7Y A;  4PFY A;  4X1D A;  2Z23 A;  1N04 A;  5DYH A;  2XXW A;  3TPA A;  1A99 A;  2VP1 A;  1I6Q A;  3T96 B;  3QUJ A;  3KSX A;  4ZEK A;  5H8H B;  2X7P A;  4R6H A;  3CVG A;  1MG1 A;  2P2A A;  2QJE A;  3CSG A;  5I2K B;  3FXU A;  4BDR A;  2I3W A;  3N5L A;  2F7C A;  1J1N A;  5ITO A;  1B52 A;  1Y1M A;  1Y4T A;  4YIC A;  1A7L A;  3U72 A;  1FQC A;  1MQJ A;  3OEM A;  4MLV A;  2V25 A;  2O84 X;  2LAO A;  1MXY A;  4Z0I A;  1HSE A;  1MH4 A;  4O3A A;  3UGW A;  4Q30 B;  1LCF A;  4ZS9 A;  1B3H A;  3C34 A;  1A55 A;  4NF8 A;  2HCA A;  4OHN A;  4BDM A;  1PBP A;  3VXC A;  1UIV A;  3IR1 A;  3E13 X;  3ECR A;  2O6A A;  1US5 A;  3HV1 A;  3VE1 B;  4EF2 A;  1LST A;  3C4M A;  1NKX A;  4NE4 A;  4KFQ A;  4F39 A;  4IY5 A;  4QSC A;  3T9X B;  4EF1 A;  3RGY A;  2Z8F A;  4IO2 A;  4U1O A;  4G4P A;  1BKA A;  3RTF B;  3JZJ A;  3KGC A;  2H99 A;  1P99 A;  3DP8 A;  4R75 A;  3V83 A;  5I57 B;  5DEX A;  2ZYK A;  1B4H A;  5AA2 D;  3TQL A;  4IO7 A;  2O7U A;  2AL5 A;  5HBC A;  4X1B A;  4R6K A;  3MVX A;  2I3V A;  1FW0 A;  2B3F A;  4XTC Q;  4NWD A;  4F2O A;  4R74 A;  1IZ1 A;  3OO6 A;  5ISU A;  3S9E A;  1QW0 A;  2Q2A A;  4C1T A;  1MY3 A;  4R9G A;  3O6H A;  3CR9 A;  3PUW E;  3FD3 A;  4ZEI A;  1EH3 A;  1QKB A;  3G3G A;  1S50 A;  2YJP A;  2I4B A;  3F11 A;  4YKI A;  2DXR A;  2OWT A;  1B6H A;  5IAI A;  1JEV A;  1Z7M E;  4KR5 A;  2DQV A;  1KWH A;  3UN6 A;  1NNP A;  2H25 A;  4R6Y A;  5L8D A;  4MLQ A;  3S9N C;  1B7H A;  3VVD A;  1A54 A;  1UTH A;  4FAJ A;  1XT8 A;  2B3B A;  5AE4 A;  3RUM A;  3C9H A;  4F1U A;  2O1L A;  3EHS A;  1O64 A;  1YCJ A;  2Y7P A;  5KDT B;  1URD A;  2UYF A;  1QVS A;  3MW0 A;  2M8C A;  5I2N A;  3KOS A;  3N6U A;  2DE3 A;  1USY H;  2R71 A;  4H67 A;  1RYX A;  1B1X A;  1WVJ A;  1IQ7 A;  1JQF A;  3S4U A;  5I58 A;  3FAS A;  3H3G A;  5KZT A;  3RT6 B;  4DIG A;  1DOT A;  1DTG A;  2ONS A;  3MVZ A;  3MJN A;  3MVW A;  3TFL A;  2XXQ A;  3V5A A;  4LZ5 A;  1JW1 A;  1URS A;  3KJ7 A;  2UYE A;  4KI0 E;  4BDL A;  1Y20 A;  1AMF A;  4P11 A;  3LBS A;  3K1M A;  3UIF A;  4QSD A;  1S7Y A;  4RK2 A;  4IY6 A;  3OXN A;  1B05 A;  2Y7W A;  2DE2 A;  2FYI A;  3CFZ A;  3K00 A;  2HAV A;  1Y3Q A;  3IB1 A;  4FOR A;  3HPI A;  5FHN A;  1ZTY A;  3CRB A;  1NNT A;  3C35 A;  4FE8 A;  5KDT A;  2VD3 A;  4O3B A;  2PYY A;  3SEX A;  4RNS A;  4JB7 A;  3FJ7 A;  4GRK A;  3FJG A;  1R9Q A;  3AXF A;  4YU0 A;  1A40 A;  1NMU A;  4H6D A;  5AA2 B;  3BKI B;  4DXB A;  3HO7 A;  1GV8 A;  5HPQ A;  1QUI A;  2A5T B;  1OMP A;  3VVE A;  2VGQ A;  4G8N A;  5F1Q A;  4DZ1 A;  4DDD A;  4BDO A;  3OSR A;  1MPD A;  4EUO A;  4U22 A;  3QK6 A;  1MQH A;  3K1P A;  4LP2 B;  1T0K A;  3OSQ A;  3R6U A;  2H9B A;  4FIM A;  1N84 A;  5TP9 A;  2WKY A;  3N26 A;  4OEU A;  3MZ1 A;  4YZZ A;  2G93 A;  1QUK A;  3TTK A;  4O3C A;  4LON B;  1PC3 A;  3CI8 A;  1Q35 A;  1SQY A;  4KCD A;  4OQO A;  2Y7I A;  4KYE A;  3M3K A;  4I1D A;  4HCY A;  1EZO A;  1ZLQ A;  3BBR A;  1JVX A;  3RN8 A;  3ZSF A;  1MXX A;  1PB7 A;  5I59 B;  2REG A;  5TPA B;  2PT2 A;  4N13 A;  5B70 A;  1ELJ A;  4AQ4 A;  4XKN A;  4F1Y A;  4E0X A;  4GIZ A;  3B7D A;  3OO7 A;  3W9W A;  1BTJ A;  2F78 A;  3S9L C;  4THI A;  3IJO B;  3MPL A;  1MY1 A;  3IO6 A;  3OO9 A;  1QJM A;  1A8E A;  2XD2 A;  4MF3 A;  1MH3 A;  3O2A A;  2DYX A;  3PGF A;  1EZ9 A;  1B58 A;  1FQB A;  1VR5 A;  4PP0 A;  5FTI A;  3ZKK A;  2PMS A;  1LGB C;  3M3L A;  1B2H A;  4P0G A;  3O29 A;  4M1V A;  5JEI A;  1MS7 A;  2RF1 A;  3TCF A;  4GFR A;  3DLN A;  2V3T A;  2I58 A;  2HEU A;  1SYI A;  3MP8 A;  5DVF A;  3LC8 A;  3U1O A;  2NXO A;  4ND9 A;  4AB5 A;  3PU5 A;  3TZA A;  3KBR A;  3V8X B;  5K2Y A;  4U21 A;  3U8Q A;  4LA9 A;  1P1Q A;  5DVJ A;  2Q2C A;  1F9B A;  1GTK A;  2R6G E;  3D4G A;  1OLC A;  4IO4 A;  1SDX A;  4WED A;  4NTL A;  4ZZA A;  1O63 A;  5K2X A;  3U94 A;  1TFD A;  2RCA A;  4NF8 B;  5AA4 A;  1NL5 A;  4NWC A;  2UXA A;  3MWB A;  1IXG A;  2NVU B;  3FIR A;  4QHQ A;  2OZZ A;  2O1M A;  2ZNU A;  4GXS B;  4MBP A;  3TCH A;  3D4C A;  1POT A;  2OJT A;  3EPE A;  5H8N A;  1D3K A;  4UAC A;  2VD2 A;  2F7A A;  4JXI A;  2RC7 A;  4G77 A;  1S9T A;  5M2V A;  3PUZ E;  1N7W A;  3FJM A;  5F7V A;  4N07 A;  3FVG A;  3H6T A;  1B3G A;  1LAH E;  4OMB A;  4U4X A;  5DEX B;  2F97 A;  2XXP A;  5ITP A;  1OIB A;  3K6W A;  1QUL A;  3TUS A;  3O66 A;  1ZIU A;  3QSL A;  1UQW A;  3V89 B;  1PBQ A;  3SEW A;  2E0S A;  3FXQ A;  1MXV A;  2ZXT A;  2R9J A;  3B6Q A;  1SD3 A;  3FZV A;  2DXY A;  3C33 A;  1FQA A;  2Q88 A;  1N76 A;  4YB5 A;  3VLU A;  4GVO A;  4G8H A;  4RJZ A;  4EDP A;  1RYO A;  1JEU A;  3MPK A;  1N3X A;  1R9L A;  1VFE A;  1MY0 A;  3K2D A;  4YB7 A;  3HHF A;  2OBG A;  2O51 A;  3T9H B;  4HTG A;  3BFU A;  1UTH B;  3PUV E;  3TTN A;  2UVG A;  5DT6 A;  1AL3 A;  3CG1 A;  4DLD A;  3H6V A;  1B46 A;  3MVY A;  5BWJ A;  3FVN A;  4GOT A;  2XXU A;  3SER A;  3PPN A;  5I2N B;  1MPB A;  2QMW A;  4NF6 A;  1BP5 A;  3FGS A;  3IO4 A;  1MY2 A;  3K6V A;  1R1N A;  3ODB A;  3U93 A;  4EXK A;  2Y7R A;  2HXW A;  3JV9 A;  1XS5 A;  1LCT A;  5I58 B;  1Y4C A;  5CM6 A;  4GXA A;  4G68 A;  2DWI A;  4FEB A;  3N94 A;  4DE8 A;  4U1Z A;  1B51 A;  2I0C A;  2I49 A;  1GGG A;  3UA8 A;  1H44 A;  2DSF A;  3GBA A;  1NNF A;  1L5T A;  2REJ A;  2QS4 A;  3TOD A;  4H8J A;  1B0L A;  1RKM A;  2THI A;  2Z8E A;  4GL8 A;  4OTE A;  2P1S A;  4RPN A;  3K02 A;  2ONR A;  3SES A;  1ATG A;  3VFJ A;  4GLI A;  1N7X A;  2I4C A;  4I9D A;  3RTW B;  2UVH A;  2G29 A;  5DVI A;  2X26 A;  3KSJ A;  1Y9U A;  1VFD A;  3H6W A;  3QIM A;  1IIW A;  3FVK A;  1BLF A;  1MQD A;  3GXA A;  3LSL A;  4JDF A;  3SEU A;  1CE2 A;  1IUD A;  3IAZ A;  5CI5 A;  4FEC A;  1PB9 A;  1MDP 1;  4X9T A;  2D21 A;  3MAM A;  4F3G A;  2O69 A;  1B40 A;  4H8I A;  1GR2 A;  3H03 A;  1P1O A;  1ZU0 A;  2AYS A;  1IIT A;  3LSF B;  3FXR A;  2BJJ X;  3Q27 A;  1WDN A;  4Z7E A;  3MQ9 A;  4QFN A;  1B1H A;  2XXV A;  3TTL A;  4YMA A;  3LSX A;  2QSX A;  1LFH A;  4NF5 A;  5KCJ A;  1B5H A;  4I8C A;  5AA3 A;  2AL4 A;  3PD9 A;  2XX8 A;  5TP9 B;  4EQB A;  3A3C A;  3MZ9 A;  5ICQ A;  4KYD A;  3H06 B;  3TTM A;  5FHO A;  2D3I A;  3DM0 A;  4OES A;  2ONK E;  3RLF E;  1ZBM A;  2RKM A;  3IJX B;  3M3F A;  4LQ5 A;  3FV1 A;  3MP6 A;  3MZB A;  2IA4 A;  3IK6 B;  5LOM A;  1PEB A;  2FNC A;  2GH9 A;  3IB0 A;  2XXY A;  4POX A;  3RNN A;  1AIV A;  3K4U A;  4G8M A;  4WKM A;  1NNK A;  3MUQ A;  3KN8 A;  1DPP A;  2ZNS A;  3PPR A;  4XKQ A;  3G3J A;  2Q8J A;  4X48 A;  2PVU A;  4IGR A;  4LZ8 A;  1GVC A;  3TCG A;  1YPN A;  3MBP A;  3PMV A;  2ZMB A;  3HHG A;  1FQF A;  2NOO A;  4OXV A;  5EHS A;  1SI1 A;  4OFJ A;  1B9J A;  2XX9 A;  3ONM A;  3PMX A;  2GHB A;  1SI0 A;  3O9P A;  2OCU A;  3E3K A;  4E0W A;  2VOZ A;  4KHZ E;  3IOU A;  5H8Q A;  1LAF E;  4NMY A;  1FTL A;  1R6Z A;  2F6P A;  3HN0 A;  1I6A A;  1B4Z A;  5I84 A;  4M4G A;  2P0S A;  4KPT A;  3L6G A;  3WAF A;  1IXC A;  3O28 A;  5B7D A;  4IB2 A;  3FAT A;  3T9U A;  4OZ9 A;  5CMC A;  5IKB A;  1B0H A;  3G3K A;  4XXU A;  4QFK A;  3ZKL A;  2OK2 A;  4FJP A;  2DWH A;  4H5G A;  4YKK A;  5H8S A;  4BDQ A;  3H6U A;  3T66 A;  4BDN A;  3TDJ A;  3CSB A;  2GFE A;  2H98 A;  3G3H A;  4TOZ A;  2QL3 A;  4KD5 A;  2Y84 A;  3G7W A;  2F6G A;  4IO6 A;  5AA4 B;  2DWA A;  4WEP A;  3I5O A;  4MH5 A;  1N0T A;  4ECF A;  1MQI A;  3KZG A;  1IEJ A;  3K6U A;  2ZYM A;  2ZYN A;  3C32 A;  4JSO A;  4F1V A;  1B3F A;  3IB2 A;  2F35 A;  1B7U A;  3KN3 A;  1USY E;  2FA7 A;  3K6X A;  5H8N B;  2XXR A;  4BLA A;  1Q1K A;  3HST A;  3DEL B;  1LBB A;  4ONY A;  2DVC A;  3H7M A;  4R9F A;  1XC1 A;  5H8F A;  4OER A;  1EU8 A;  4R72 A;  3Q25 A;  3DP6 A;  5FHM A;  1ANF A;  1IXH A;  4JBZ A;  3O97 A;  3RQT A;  3OEK A;  1ZMG A;  3VLV A;  1OQG A;  4YB6 A;  3H4Z A;  2PX1 A;  1JW4 A;  5CRY A;  1BIY A;  2O7I A;  1OVT A;  4XKR A;  2V3U A;  1QUJ A;  4L17 A;  5DTB A;  3KN7 A;  3SDF A;  1LFI A;  5CMK A;  4GWO A;  3Q28 A;  3CIJ A;  4YKP A;  3RY3 A;  3OD7 A;  3PPP A;  4FED A;  3W15 C;  3C31 A;  3IOT A;  1NFT A;  4FAT A;  4P0I A;  2F7B A;  3KJT A;  4N6P A;  3T9V A;  1QKA A;  4RK9 A;  2H5Y A;  4KCC A;  1P1W A;  5CC2 A;  5CBR A;  4PFU A;  3WAE A;  4ZDM A;  4F22 A;  3IOV A;  2HZL A;  4ELR A;  2DS9 A;  5EHM A;  4OYV A;  5EYF A;  2NUV A;  1NH8 A;  1HSL A;  3QUF A;  2Q89 A;  4ELP A;  3THI A;  1FTM A;  4JWO A;  4DXC A;  4EQ7 A;  1LFG A;  1FTK A;  3RPW A;  3QXM A;  1MM6 A;  1OVB A;  1UIU A;  3L6H A;  4NF6 B;  1IXI A;  4PET A;  4PE5 B;  3O6G A;  1AH5 A;  3UOR A;  1UTB A;  1A8F A;  3PD8 A;  3LR1 A;  3MP1 A;  4RA1 A;  1M5B A;  2XD3 A;  1MDQ A;  2X7Q A;  4G68 B;  1Y3N A;  1DPE A;  2DVZ A;  3FV2 A;  2ESN A;  1OQH A;  4RXL A;  1B32 A;  3GZG A;  4HS7 A;  1CB6 A;  1I69 A;  2RC8 A;  4TQU Q;  1P1N A;  4ZEC A;  2YPN A;  3VXB A;  4F2Q A;  2QMX A;  4ZEF A;  1MQG A;  1URG A;  4F18 A;  1B5I A;  1H3D A;  3KEI A;  4QF9 A;  4XKP A;  2NWJ A;  3EHT A;  3R26 A;  3PPO A;  4F3B A;  4YMB A;  2GHA A;  4LZ7 A;  1Z7N E;  1M5E A;  1MRP A;  4RPO A;  3B6W A;  4XIG Q;  1MXW A;  4LQ2 A;  4HW8 A;  1M5F A;  3DP4 A;  3TTR A;  4EXL A;  3CFX A;  4Q8R A;  1LB8 A;  5H8H A;  2ALU A;  1US4 A;  1II5 A;  2CMO A;  5I2K A;  2I6E A;  1VE4 A;  5TU0 A;  3PPQ A;  4F3P A;  2A5S A;  2ZYO A;  3IL1 B;  3GBB A;  2I0B A;  4ESX A;  4ZEB A;  3E9X A;  2RC9 A;  4YAH X;  2QRY A;  1XVX A;  1JNF A;  1SW2 A;  2QS1 A;  4R2F A;  2QS3 A;  4NF5 B;  5KCJ B;  4C0R A;  2AIX A;  5I56 B;  1B5J A;  4C1U A;  4Q0C A;  1SYH A;  3B6T A;  1NH7 A;  2QPQ A;  1O7T A;  2F36 A;  3TQW A;  3PV0 E;  3EQ1 A;  2VHA A;  3TKD A;  2UVJ A;  5L9O A;  1LBC A;  1JW5 A;  5A5X B;  3TMG A;  3VV5 A;  3K01 A;  5L9S A;  3W9V A;  2OLB A;  3OEN A;  2I48 A;  1POY 1;  3P7I A;  4H65 A;  3A09 A;  2V84 A;  4KYS A;  4OEN A;  4ELQ A;  3UK4 A;  1DTZ A;  3ZS6 A;  1I6B A;  4POW A;  4F3S A;  4LAT A;  4IGT A;  1DMB A;  1JVY A; 
#chains in the Genus database with same CATH topology
 3MC2 A;  2Z8D A;  1TT1 A;  4Q5T A;  1MPC A;  3PUY E;  2ANJ A;  4GBW A;  3ILT B;  5I57 A;  2XXI A;  1MXZ A;  2B65 A;  3S9M C;  2E1S A;  4ISU A;  4PFT A;  1PDA A;  1SBP A;  1LBX A;  1JET A;  4XEQ A;  2CEY A;  4NED A;  4QFP A;  4QRZ A;  4HCW A;  3O6I A;  1FJ9 A;  1IMB A;  4GWY A;  5I56 A;  1PB8 A;  2Z22 A;  1YYZ A;  1MXU A;  4TLL B;  3OO8 A;  1B7Z A;  3ILU B;  3KOT A;  5BUU A;  5H8Q B;  2YLN A;  1NV4 A;  1NV6 A;  4OVJ A;  1EZP A;  2XA5 A;  1Y1Z A;  1TXF A;  5A5X A;  3FVO A;  5CMM A;  4JSD A;  3IX1 A;  5FTH A;  2F8D A;  1FBC A;  1FQD A;  1D4N A;  4PFW A;  4WXJ A;  4NF4 B;  1N3W A;  4RYA A;  2RCB A;  2HHM A;  2XXH A;  4P56 A;  3EN3 A;  1TFA A;  1SW1 A;  2DOJ A;  4TLM B;  1Y3P A;  1YAE A;  4MFI A;  3G3F A;  3UP9 A;  2FBP A;  3I3V A;  5JTY B;  2PT1 A;  5ELV A;  2F5X A;  1FQE A;  5AA1 A;  2HQ0 A;  3E4R A;  3SEY A;  4LUB A;  2DE4 A;  4U4S A;  4GD5 A;  2H4I A;  1VSO A;  4PC9 A;  4YKJ A;  1LLS A;  3MST A;  4F31 B;  3U92 A;  4O7I A;  3K1N A;  4G2Z A;  3TEL A;  4OFO A;  4LVQ A;  4F19 A;  1EYI A;  4H0W A;  4R2B A;  4H1X A;  3I6V A;  5HM4 B;  2XHD A;  3PUX E;  1LAX A;  4OFL A;  2F34 A;  3Q26 A;  3VLW A;  1TWY A;  3BFT A;  1D9V A;  1XI6 A;  1WOD A;  3A3U A;  3FUZ A;  4ESW A;  1DSN A;  2KLF A;  3GYY A;  1XHY A;  4NF4 A;  4KXP A;  5H8F B;  5LDZ A;  1LAG E;  3IOR A;  2Q8M A;  4ELO A;  4IO3 A;  4JWX A;  1OLA A;  1FPB A;  3E78 A;  4UA8 A;  3R7X A;  3EF7 A;  1LEV A;  3SET A;  1YTV A;  4OET A;  4DCY A;  2RIN A;  5JTY A;  1XVY A;  1B3E A;  2D5W A;  2Y7K A;  3CFL A;  4R73 A;  4U2R A;  3KFM A;  1B3L A;  4F29 A;  5CBS A;  4ZE9 A;  2ZZW A;  5I5P A;  3Q29 A;  5IZZ A;  5I7I A;  5ICT A;  1H76 A;  3GLB A;  3S2V A;  3SKP A;  3QAX A;  5JK4 A;  4GQO A;  5AA2 A;  4I62 A;  2XXX A;  4QFL A;  2DP8 A;  2A5T A;  2CZL A;  5CMB A;  2XX7 A;  4P47 A;  3T0J A;  4ZE8 A;  1ZKB A;  1XOC A;  2CEX A;  1H45 A;  4EQ9 A;  3SEV A;  3CG3 A;  3HCQ A;  2CZH A;  2DWJ A;  4QSE A;  3QYT A;  3C36 A;  1LB9 A;  2QFL A;  4GF8 A;  3PMW A;  4AB6 A;  2V3Q A;  4PTK A;  1M5D A;  2ZZX A;  3KG2 A;  5IM2 A;  1MM7 A;  1SW5 A;  2ABH A;  3IFA A;  4PQJ A;  4U23 A;  2XXT A;  1M5C A;  4QFO A;  3OMB A;  4JWY A;  3IFC A;  4GL0 A;  2HZK A;  5IGA A;  4NF0 A;  1IME A;  3MYU A;  1SW4 A;  2QVR A;  4ZZE A;  4GX3 A;  4IO5 A;  3N6T A;  3TYH A;  1HSJ A;  3VDF A;  1NV2 A;  5I59 A;  3RT8 A;  2Q9T A;  4RY1 A;  2UVI A;  2WEF A;  1P1U A;  5TPA A;  1UTB B;  3IOW A;  2GRV A;  1FTJ A;  2V93 A;  3EHU A;  5J1D A;  1FTO A;  3USD A;  5L9M A;  1H43 A;  3G3I A;  3M8U A;  4DXU A;  1FCK A;  4OWD A;  1D9Y A;  2HFB A;  3JYR A;  2OWS A;  2O68 A;  1AOV A;  2F3D A;  4OEV A;  2QS2 A;  2HAU A;  4K3F A;  3LSW A;  3LV0 A;  4G68 C;  3OEL A;  1MY4 A;  2PBW A;  2IEE A;  4GWS A;  1DBZ A;  3T22 A;  4H5F A;  4DCX A;  3TEP A;  3VVF A;  1ZJL A;  3LUY A;  3K0V A;  3TAJ A;  3OOA A;  4ZED A;  3T93 B;  1SVX B;  4KQP A;  2ZNT A;  3BIG A;  2W7Y A;  4PFY A;  4X1D A;  2Z23 A;  1N04 A;  2XWI A;  5DYH A;  2XXW A;  3TPA A;  1A99 A;  2VP1 A;  1I6Q A;  3T96 B;  3QUJ A;  3KSX A;  4ZEK A;  4NHB A;  3KBZ A;  5H8H B;  2X7P A;  4R6H A;  3CVG A;  1MG1 A;  2P2A A;  4H46 A;  2QJE A;  4OVP A;  3CSG A;  5I2K B;  3FXU A;  4BDR A;  2I3W A;  3N5L A;  4N6K A;  2F7C A;  1J1N A;  1Y1M A;  1B52 A;  1Y4T A;  5ITO A;  4YIC A;  1A7L A;  1DK4 A;  1LBW A;  3U72 A;  1FQC A;  1MQJ A;  3OEM A;  4MLV A;  2V25 A;  2O84 X;  2LAO A;  1MXY A;  4Z0I A;  1HSE A;  1MH4 A;  1NV0 A;  4O3A A;  3UGW A;  4Q30 B;  4N6D A;  1LCF A;  4ZS9 A;  1LBZ A;  4N91 A;  1B3H A;  1K9Y A;  3C34 A;  1A55 A;  4NF8 A;  1FJ6 A;  2HCA A;  4OHN A;  4MAG A;  1PBP A;  4BDM A;  3VXC A;  5ET5 A;  1UIV A;  3IR1 A;  3E13 X;  3ECR A;  2O6A A;  1US5 A;  3HV1 A;  5ET7 A;  3VE1 B;  4EF2 A;  1LST A;  3C4M A;  1NKX A;  4NE4 A;  4KFQ A;  4F39 A;  4IY5 A;  4NQ8 A;  2P3V A;  4QSC A;  3T9X B;  4EF1 A;  3RGY A;  2Z8F A;  4IO2 A;  4PFR A;  1RDZ A;  1FPK A;  5IZ1 A;  3NOH A;  4U1O A;  4G4P A;  2QVU A;  1BKA A;  3RTF B;  3JZJ A;  3KGC A;  2H99 A;  1P99 A;  3DP8 A;  4R75 A;  3V83 A;  2PCR A;  5I57 B;  5DEX A;  4P3L A;  2ZYK A;  3SZP A;  1B4H A;  1FBD A;  5AA2 D;  3TQL A;  4IO7 A;  2O7U A;  2AL5 A;  5HBC A;  4X1B A;  4R6K A;  3MVX A;  2I3V A;  1FW0 A;  2B3F A;  1RDX A;  4XTC Q;  4MX6 A;  1JP4 A;  4NWD A;  4F2O A;  4R74 A;  1IZ1 A;  3OO6 A;  5ISU A;  3S9E A;  1QW0 A;  2Q2A A;  4N17 A;  2Q74 A;  4PFI A;  4C1T A;  1MY3 A;  4DI3 D;  4R9G A;  3O6H A;  4PGN A;  3CR9 A;  3PUW E;  3FD3 A;  4ZEI A;  1EH3 A;  4PBQ A;  1QKB A;  4PGP A;  3G3G A;  1S50 A;  2YJP A;  2I4B A;  3F11 A;  4YKI A;  2DXR A;  2OWT A;  1B6H A;  5IAI A;  1JEV A;  1Z7M E;  4KR5 A;  5EQ9 A;  2DQV A;  1FRP A;  1G0H A;  1KWH A;  2L5V A;  3UN6 A;  1NNP A;  2H25 A;  4R6Y A;  5L8D A;  4MLQ A;  3S9N C;  1B7H A;  3VVD A;  1A54 A;  1UTH A;  3EKI A;  4FAJ A;  3ISP A;  1XT8 A;  2B3B A;  5AE4 A;  3RUM A;  3C9H A;  4F1U A;  1LBY A;  4P1L A;  2O1L A;  3EHS A;  1O64 A;  1YCJ A;  2Y7P A;  3HFU A;  5KDT B;  4OVR A;  1URD A;  2UYF A;  1QVS A;  3MW0 A;  2M8C A;  5I2N A;  3KOS A;  3N6U A;  2DE3 A;  1USY H;  2R71 A;  4H67 A;  1RYX A;  1B1X A;  1WVJ A;  1IQ7 A;  1JQF A;  4MEV A;  3S4U A;  1YXI A;  5I58 A;  3FAS A;  3H3G A;  5KZT A;  3RT6 B;  4DIG A;  1DOT A;  1FPF A;  1DTG A;  2CZI A;  2ONS A;  3MVZ A;  3MJN A;  3MVW A;  3TFL A;  2XXQ A;  3V5A A;  4LZ5 A;  1LBV A;  1JW1 A;  1URS A;  2B4L A;  3KJ7 A;  5IZ3 A;  2UYE A;  4KI0 E;  4BDL A;  1Y20 A;  1AMF A;  4MNC A;  4P11 A;  4PF6 A;  3LBS A;  3K1M A;  3A29 A;  3UIF A;  4QSD A;  1S7Y A;  4RK2 A;  2CZK A;  4IY6 A;  3OXN A;  1B05 A;  2Y7W A;  2DE2 A;  2FIX A;  2FYI A;  3CFZ A;  3K00 A;  2HAV A;  1Y3Q A;  3IB1 A;  4FOR A;  3HPI A;  5FHN A;  1ZTY A;  3CRB A;  1NNT A;  3C35 A;  4FE8 A;  5KDT A;  2VD3 A;  4O3B A;  2PYY A;  3SEX A;  4RNS A;  4JB7 A;  3FJ7 A;  4GRK A;  3FJG A;  1R9Q A;  3AXF A;  4YU0 A;  2Y5K A;  1A40 A;  4FBP A;  1NMU A;  4H6D A;  5AA2 B;  3BKI B;  4DXB A;  3HO7 A;  1GV8 A;  5HPQ A;  1QUI A;  2A5T B;  1OMP A;  3VVE A;  2VGQ A;  4G8N A;  5F1Q A;  4DZ1 A;  4DDD A;  4BDO A;  3OSR A;  1MPD A;  4EUO A;  4U22 A;  4GX4 A;  3QK6 A;  1MQH A;  3K1P A;  1NI9 A;  4LP2 B;  1T0K A;  3OSQ A;  3R6U A;  2H9B A;  5EQ7 A;  4FIM A;  1N84 A;  5TP9 A;  2WKY A;  3N26 A;  4OEU A;  3MZ1 A;  4YZZ A;  2G93 A;  1NV1 A;  1QUK A;  3FBP A;  3TTK A;  1FSA A;  4O3C A;  4LON B;  1PC3 A;  3CI8 A;  1Q35 A;  1SQY A;  4KCD A;  4OQO A;  2Y7I A;  4KYE A;  4I1D A;  3M3K A;  1FBF A;  4HCY A;  1EZO A;  1ZLQ A;  3BBR A;  1JVX A;  3RN8 A;  5J16 A;  3ZSF A;  1MXX A;  1PB7 A;  5I59 B;  2REG A;  5TPA B;  2PT2 A;  4N13 A;  5B70 A;  5ESY A;  3RPL A;  2WBD A;  1ELJ A;  4AQ4 A;  4XKN A;  4F1Y A;  4E0X A;  4GIZ A;  1KZ8 A;  3B7D A;  3OO7 A;  4GBV A;  4PCD A;  3W9W A;  1BTJ A;  2F78 A;  4DI4 B;  3S9L C;  4THI A;  1VDW A;  3IJO B;  3MPL A;  1MY1 A;  1FBH A;  3IO6 A;  3OO9 A;  1QJM A;  1A8E A;  2XD2 A;  4MF3 A;  1MH3 A;  1RDY A;  3O2A A;  2DYX A;  3PGF A;  4N81 A;  1EZ9 A;  1B58 A;  1FQB A;  1VR5 A;  4PP0 A;  5FTI A;  3ZKK A;  1NV5 A;  2PMS A;  1LGB C;  3M3L A;  1B2H A;  4P0G A;  3O29 A;  4M1V A;  5JEI A;  5T3J A;  1MS7 A;  5I3S A;  2RF1 A;  3TCF A;  4GFR A;  3DLN A;  2FIE A;  3B50 A;  4PDD A;  2V3T A;  2I58 A;  1IMC A;  2HEU A;  2XWV A;  1SYI A;  3MP8 A;  5DVF A;  1DCU A;  3LC8 A;  3U1O A;  3KC0 A;  4I3Y A;  2NXO A;  4ND9 A;  4AB5 A;  3PU5 A;  3TZA A;  3KBR A;  3V8X B;  5K2Y A;  4U21 A;  3U8Q A;  4LA9 A;  2WYK A;  1P1Q A;  1IMD A;  5EQA A;  5DVJ A;  2Q2C A;  1F9B A;  1GTK A;  2R6G E;  3D4G A;  1OLC A;  4I3E A;  4IO4 A;  2Y5L A;  1SDX A;  4WED A;  4NTL A;  2WBB A;  4ZZA A;  1O63 A;  4LN5 A;  5K2X A;  4QBA A;  3U94 A;  1TFD A;  2RCA A;  4NF8 B;  5AA4 A;  2WX9 A;  4O7M A;  1NL5 A;  4NWC A;  4PAI A;  2UXA A;  3MWB A;  4O94 A;  2XWK A;  1IXG A;  2NVU B;  3FIR A;  4QHQ A;  2OZZ A;  4P1E A;  2O1M A;  2ZNU A;  4GXS B;  4MBP A;  3TCH A;  3D4C A;  5A5L A;  1POT A;  2OJT A;  3EPE A;  5H8N A;  4AS4 A;  3U65 A;  2R8T A;  1D3K A;  4P9K A;  4UAC A;  2VD2 A;  2F7A A;  4JXI A;  2RC7 A;  4G77 A;  1S9T A;  5M2V A;  3PUZ E;  1N7W A;  3FJM A;  5F7V A;  2QVV A;  4GWU A;  4N07 A;  3T1B A;  3FVG A;  3H6T A;  1B3G A;  1LAH E;  1FBE A;  4GX6 A;  4OMB A;  4U4X A;  5DEX B;  4MNP A;  2F97 A;  2XXP A;  5ITP A;  1OIB A;  3K6W A;  4MMP A;  1QUL A;  3TUS A;  3O66 A;  3FXB A;  1ZIU A;  3QSL A;  1FPG A;  1UQW A;  3V89 B;  1PBQ A;  3SEW A;  2E0S A;  3FXQ A;  1MXV A;  2ZXT A;  2R9J A;  3B6Q A;  1SD3 A;  2VPN A;  4OVS A;  3FZV A;  2DXY A;  3C33 A;  1FQA A;  2Q88 A;  1FBP A;  1N76 A;  4YB5 A;  3VLU A;  4OA4 A;  4GVO A;  4G8H A;  4RJZ A;  1INP A;  4EDP A;  1NUY A;  1RYO A;  1JEU A;  3MPK A;  1N3X A;  1R9L A;  1VFE A;  1MY0 A;  3K2D A;  4YB7 A;  3HHF A;  2ZZV A;  2OBG A;  2O51 A;  3T9H B;  4HTG A;  3B8B A;  3BFU A;  1UTH B;  2KR0 A;  3PUV E;  3TTN A;  2UVG A;  5DT6 A;  1AL3 A;  4PFB A;  3CG1 A;  4DLD A;  3H6V A;  1B46 A;  1EYK A;  3ROJ A;  3MVY A;  5BWJ A;  2OX3 A;  3FVN A;  4GOT A;  2XXU A;  3SER A;  4I40 A;  3PPN A;  5I2N B;  1MPB A;  2QMW A;  4NF6 A;  4HE0 A;  1BP5 A;  3FGS A;  3IO4 A;  3E79 A;  1MY2 A;  3K6V A;  1R1N A;  3ODB A;  3U93 A;  4EXK A;  2Y7R A;  2HXW A;  3JV9 A;  1XS5 A;  1LCT A;  5I58 B;  1Y4C A;  5CM6 A;  4GXA A;  4G68 A;  2DWI A;  4FEB A;  3N94 A;  4DE8 A;  4U1Z A;  1B51 A;  2I0C A;  2I49 A;  1GGG A;  1H44 A;  2DSF A;  3UA8 A;  3GBA A;  5EYH A;  1NNF A;  1L5T A;  2REJ A;  2QS4 A;  3TOD A;  4H8J A;  1B0L A;  5IZ3 B;  2OWZ A;  1RKM A;  2THI A;  2Z8E A;  4GL8 A;  4PAF A;  4OTE A;  2P1S A;  4RPN A;  4MCO A;  3K02 A;  2ONR A;  3SES A;  1ATG A;  3VFJ A;  4GLI A;  1N7X A;  2I4C A;  4I9D A;  3BIH A;  3RTW B;  2UVH A;  2G29 A;  2VT5 A;  5DVI A;  2X26 A;  3KSJ A;  1Y9U A;  1VFD A;  4GWX A;  3H6W A;  3QIM A;  1IIW A;  3FVK A;  1BLF A;  1MQD A;  1Q9D A;  3GXA A;  2JJK A;  1NV7 A;  3LSL A;  4JDF A;  3SEU A;  1CE2 A;  1KA0 A;  1IUD A;  3IAZ A;  1FPD A;  5CI5 A;  4FEC A;  4PE3 A;  1PB9 A;  1MDP 1;  4X9T A;  2D21 A;  3MAM A;  4F3G A;  2O69 A;  1B40 A;  4H8I A;  1GR2 A;  3H03 A;  1FPE A;  2XXK A;  1P1O A;  1ZU0 A;  2AYS A;  1IIT A;  3LSF B;  3FXR A;  2BJJ X;  3Q27 A;  4MHF A;  1WDN A;  4Z7E A;  3MQ9 A;  4QFN A;  1B1H A;  1FTA A;  2XXV A;  1KA1 A;  3TTL A;  4YMA A;  2FHY A;  3LSX A;  2QSX A;  4MNI A;  1LFH A;  1G0I A;  4NF5 A;  5KCJ A;  1B5H A;  4I8C A;  5AA3 A;  2AL4 A;  3PD9 A;  2XX8 A;  5TP9 B;  1SPI A;  4EQB A;  3A3C A;  4IR8 A;  5DW8 A;  3KC1 A;  3MZ9 A;  5ICQ A;  4KYD A;  3H06 B;  3TTM A;  5FHO A;  2D3I A;  3DM0 A;  4OES A;  2ONK E;  2P3N A;  3RLF E;  1ZBM A;  2RKM A;  3IJX B;  3M3F A;  4LQ5 A;  4JVC A;  4PAK A;  3FV1 A;  3MP6 A;  4H45 A;  3MZB A;  2MKZ A;  2IA4 A;  3IK6 B;  5LOM A;  1PEB A;  2FNC A;  2GH9 A;  3IB0 A;  2HPG A;  2XXY A;  4POX A;  3RNN A;  1AIV A;  3K4U A;  4G8M A;  4WKM A;  1NNK A;  3MUQ A;  1NUW A;  3KN8 A;  3RPL B;  4GWW A;  1DPP A;  2F3B A;  2ZNS A;  2KQZ A;  3PPR A;  2VPO A;  4XKQ A;  4OVQ A;  3G3J A;  3QMF A;  2Q8J A;  4X48 A;  2PVU A;  4IGR A;  4LZ8 A;  4HE2 A;  1GVC A;  3TCG A;  1YPN A;  5EYG A;  3MBP A;  3PMV A;  2ZMB A;  3HHG A;  1FQF A;  2NOO A;  4OXV A;  5EHS A;  1SI1 A;  4OFJ A;  1B9J A;  2XX9 A;  3ONM A;  3PMX A;  4XF5 A;  2GHB A;  1SI0 A;  3O9P A;  2OCU A;  2FVZ A;  3E3K A;  1FPL A;  4E0W A;  2VOZ A;  4KHZ E;  3IOU A;  5H8Q A;  1LAF E;  1YZ0 A;  4NMY A;  1FTL A;  1R6Z A;  2B4M A;  4HE1 A;  2F6P A;  3HN0 A;  1I6A A;  1B4Z A;  5I84 A;  4M4G A;  2P0S A;  4KPT A;  3L6G A;  3WAF A;  1IXC A;  3O28 A;  5B7D A;  4IB2 A;  3FAT A;  3T9U A;  4OZ9 A;  4P8B A;  5CMC A;  5IKB A;  1B0H A;  1NV3 A;  3G3K A;  4XXU A;  4QFK A;  3ZKL A;  2OK2 A;  4FJP A;  4N8Y A;  4XFE A;  4G61 A;  2DWH A;  4H5G A;  4O8M A;  4YKK A;  5H8S A;  2GQ1 A;  4BDQ A;  3H6U A;  3T66 A;  4BDN A;  3TDJ A;  3CSB A;  2GFE A;  2H98 A;  3G3H A;  5LTC A;  4TOZ A;  2QL3 A;  4OVT A;  4KD5 A;  2Y84 A;  3G7W A;  2F6G A;  4IO6 A;  5AA4 B;  2DWA A;  4WEP A;  3I5O A;  4MH5 A;  1N0T A;  4ECF A;  1MQI A;  3KZG A;  4X8R A;  1IEJ A;  3K6U A;  2ZYM A;  2ZYN A;  3C32 A;  4PF8 A;  4JSO A;  4F1V A;  5FBP A;  1B3F A;  3IB2 A;  2F35 A;  1B7U A;  3KN3 A;  1USY E;  2FA7 A;  1CNQ A;  3K6X A;  5H8N B;  2XXR A;  4BLA A;  1Q1K A;  3HST A;  4JVI A;  3DEL B;  1LBB A;  4ONY A;  2DVC A;  2HXR A;  3CHG A;  3H7M A;  4R9F A;  1XC1 A;  1EYJ A;  5H8F A;  4OER A;  1EU8 A;  4R72 A;  3Q25 A;  3DP6 A;  5FHM A;  1NUZ A;  1ANF A;  1IXH A;  4JBZ A;  3O97 A;  4MJO A;  3RQT A;  3OEK A;  1ZMG A;  3VLV A;  1OQG A;  4YB6 A;  2WYP A;  3H4Z A;  2PX1 A;  1JW4 A;  5CRY A;  1BIY A;  2O7I A;  1OVT A;  4XKR A;  2V3U A;  1QUJ A;  4L17 A;  5DTB A;  3KN7 A;  5EQ8 A;  1LFI A;  3SDF A;  5CMK A;  4GWO A;  3Q28 A;  3CIJ A;  4YKP A;  3RY3 A;  3OD7 A;  4QXD A;  3PPP A;  4FED A;  3W15 C;  3C31 A;  3IOT A;  1NFT A;  4MIJ A;  4FAT A;  4P0I A;  2F7B A;  4N4U A;  3KJT A;  4N6P A;  3T9V A;  1QKA A;  4RK9 A;  2H5Y A;  4KCC A;  1P1W A;  5CC2 A;  5CBR A;  4PFU A;  3WAE A;  4ZDM A;  3D1R A;  4F22 A;  3IOV A;  4JVD A;  2HZL A;  2XWO A;  2BJI A;  4ELR A;  2DS9 A;  5EHM A;  4OYV A;  5EYF A;  2NUV A;  4HXV A;  1NH8 A;  1HSL A;  3QUF A;  2Q89 A;  4ELP A;  4PDH A;  3THI A;  1FTM A;  4JWO A;  4DXC A;  4EQ7 A;  1LFG A;  1FTK A;  3RPW A;  3QXM A;  1MM6 A;  1OVB A;  1UIU A;  3L6H A;  4NF6 B;  1IXI A;  4PET A;  4PE5 B;  3O6G A;  1AH5 A;  5ET8 A;  3UOR A;  1UTB A;  1A8F A;  3PD8 A;  3LR1 A;  3MP1 A;  4RA1 A;  1M5B A;  2XD3 A;  1MDQ A;  4X04 A;  2X7Q A;  4G68 B;  1Y3N A;  1DPE A;  2DVZ A;  3FV2 A;  2ESN A;  2PFY A;  1OQH A;  4RXL A;  1B32 A;  3GZG A;  4HS7 A;  1CB6 A;  3LUZ A;  1I69 A;  2RC8 A;  4TQU Q;  1P1N A;  4ZEC A;  2YPN A;  3VXB A;  4F2Q A;  2QMX A;  1MQG A;  1URG A;  4ZEF A;  4F18 A;  1B5I A;  1H3D A;  3KEI A;  4QF9 A;  4UAB A;  4XKP A;  2NWJ A;  3EHT A;  3R26 A;  1FPI A;  1BK4 A;  4NN3 A;  3PPO A;  4F3B A;  4YMB A;  1IMF A;  2GHA A;  4LZ7 A;  3RYD A;  1Z7N E;  1M5E A;  1MRP A;  4RPO A;  3B6W A;  1FPJ A;  4XIG Q;  1QGX A;  1MXW A;  4LQ2 A;  4HW8 A;  1M5F A;  3DP4 A;  3TTR A;  4EXL A;  2V4C A;  3CFX A;  5F24 A;  4Q8R A;  1LB8 A;  5H8H A;  2ALU A;  1US4 A;  1II5 A;  2CMO A;  5I2K A;  2I6E A;  1VE4 A;  5TU0 A;  1IMA A;  4GWZ A;  3PPQ A;  4NGU A;  4F3P A;  2A5S A;  4AS5 A;  2ZYO A;  3IL1 B;  3GBB A;  2I0B A;  4ESX A;  4N15 A;  1FBG A;  4ZEB A;  3E9X A;  4NAP A;  2RC9 A;  4YAH X;  2QRY A;  1XVX A;  1JNF A;  1SW2 A;  2DDK A;  2QS1 A;  4NX1 A;  4R2F A;  2QS3 A;  4NF5 B;  5KCJ B;  4C0R A;  2AIX A;  5I56 B;  1B5J A;  4C1U A;  4Q0C A;  1SYH A;  3B6T A;  1NH7 A;  2QPQ A;  1O7T A;  2F36 A;  3TQW A;  3PV0 E;  4NG7 A;  3EQ1 A;  5ET6 A;  1D9Q A;  2VHA A;  3TKD A;  2UVJ A;  4PBH A;  5L9O A;  1LBC A;  1JW5 A;  5A5X B;  3TMG A;  3VV5 A;  3K01 A;  5L9S A;  4N8G A;  3W9V A;  2OLB A;  3OEN A;  2I48 A;  1POY 1;  3P7I A;  4OAN A;  4H65 A;  3A09 A;  2V84 A;  4KYS A;  1NUX A;  4OEN A;  1AWB A;  4ELQ A;  3UK4 A;  1DTZ A;  3ZS6 A;  1I6B A;  4POW A;  4F3S A;  1K9Z A;  3PTY A;  4LAT A;  4IGT A;  1DMB A;  2PFZ A;  1JVY A; 
#chains in the Genus database with same CATH homology
 3MC2 A;  2Z8D A;  1TT1 A;  4Q5T A;  1MPC A;  3PUY E;  2ANJ A;  3ILT B;  5I57 A;  2XXI A;  1MXZ A;  2B65 A;  3S9M C;  2E1S A;  4ISU A;  4PFT A;  1PDA A;  1SBP A;  1JET A;  4NED A;  4QFP A;  4QRZ A;  4HCW A;  3O6I A;  5I56 A;  1PB8 A;  2Z22 A;  1MXU A;  4TLL B;  3OO8 A;  1B7Z A;  3ILU B;  3KOT A;  5BUU A;  5H8Q B;  2YLN A;  4OVJ A;  1EZP A;  1Y1Z A;  1TXF A;  5A5X A;  3FVO A;  5CMM A;  4JSD A;  3IX1 A;  5FTH A;  2F8D A;  1FQD A;  1D4N A;  4PFW A;  4WXJ A;  4NF4 B;  1N3W A;  4RYA A;  2RCB A;  2XXH A;  3EN3 A;  1TFA A;  1SW1 A;  2DOJ A;  4TLM B;  1YAE A;  1Y3P A;  4MFI A;  3G3F A;  3UP9 A;  3I3V A;  5JTY B;  2PT1 A;  5ELV A;  2F5X A;  1FQE A;  5AA1 A;  2HQ0 A;  3E4R A;  3SEY A;  4LUB A;  2DE4 A;  4U4S A;  4GD5 A;  2H4I A;  1VSO A;  4YKJ A;  1LLS A;  4F31 B;  3U92 A;  3K1N A;  4G2Z A;  3TEL A;  4OFO A;  4LVQ A;  4F19 A;  4H0W A;  4R2B A;  4H1X A;  3I6V A;  5HM4 B;  2XHD A;  3PUX E;  1LAX A;  4OFL A;  2F34 A;  3Q26 A;  3VLW A;  1TWY A;  3BFT A;  1D9V A;  1WOD A;  3A3U A;  3FUZ A;  4ESW A;  1DSN A;  2KLF A;  1XHY A;  4NF4 A;  5H8F B;  1LAG E;  3IOR A;  4ELO A;  4IO3 A;  4JWX A;  1OLA A;  4UA8 A;  3R7X A;  3EF7 A;  3SET A;  1YTV A;  4OET A;  4DCY A;  2RIN A;  5JTY A;  1XVY A;  1B3E A;  2D5W A;  2Y7K A;  3CFL A;  4R73 A;  4U2R A;  3KFM A;  1B3L A;  4F29 A;  5CBS A;  4ZE9 A;  3Q29 A;  5ICT A;  1H76 A;  3GLB A;  3S2V A;  3SKP A;  3QAX A;  5JK4 A;  4GQO A;  5AA2 A;  4I62 A;  2XXX A;  4QFL A;  2DP8 A;  2A5T A;  2CZL A;  5CMB A;  2XX7 A;  4ZE8 A;  1ZKB A;  1XOC A;  1H45 A;  4EQ9 A;  3SEV A;  3CG3 A;  3HCQ A;  2DWJ A;  4QSE A;  3QYT A;  3C36 A;  1LB9 A;  4GF8 A;  3PMW A;  4AB6 A;  2V3Q A;  1M5D A;  3KG2 A;  1MM7 A;  1SW5 A;  2ABH A;  4PQJ A;  4U23 A;  2XXT A;  1M5C A;  4QFO A;  3OMB A;  4JWY A;  4GL0 A;  2HZK A;  1SW4 A;  4ZZE A;  4IO5 A;  3N6T A;  3TYH A;  1HSJ A;  3VDF A;  5I59 A;  3RT8 A;  2Q9T A;  4RY1 A;  2UVI A;  5TPA A;  1P1U A;  1UTB B;  3IOW A;  2GRV A;  1FTJ A;  2V93 A;  3EHU A;  5J1D A;  1FTO A;  3USD A;  5L9M A;  1H43 A;  3G3I A;  3M8U A;  4DXU A;  1FCK A;  4OWD A;  1D9Y A;  2HFB A;  3JYR A;  2OWS A;  2O68 A;  1AOV A;  4OEV A;  2QS2 A;  2HAU A;  4K3F A;  3LSW A;  4G68 C;  3OEL A;  1MY4 A;  2PBW A;  2IEE A;  3T22 A;  4H5F A;  4DCX A;  3TEP A;  3VVF A;  1ZJL A;  3LUY A;  3K0V A;  3TAJ A;  3OOA A;  4ZED A;  3T93 B;  1SVX B;  4KQP A;  2ZNT A;  2W7Y A;  4PFY A;  4X1D A;  2Z23 A;  1N04 A;  5DYH A;  2XXW A;  3TPA A;  1A99 A;  2VP1 A;  1I6Q A;  3T96 B;  3QUJ A;  3KSX A;  4ZEK A;  5H8H B;  2X7P A;  4R6H A;  3CVG A;  1MG1 A;  2P2A A;  2QJE A;  3CSG A;  5I2K B;  3FXU A;  4BDR A;  2I3W A;  3N5L A;  2F7C A;  1J1N A;  5ITO A;  1B52 A;  1Y1M A;  1Y4T A;  4YIC A;  1A7L A;  3U72 A;  1FQC A;  1MQJ A;  3OEM A;  4MLV A;  2V25 A;  2O84 X;  2LAO A;  1MXY A;  4Z0I A;  1HSE A;  1MH4 A;  4O3A A;  3UGW A;  4Q30 B;  1LCF A;  4ZS9 A;  1B3H A;  3C34 A;  1A55 A;  4NF8 A;  2HCA A;  4OHN A;  4BDM A;  1PBP A;  3VXC A;  1UIV A;  3IR1 A;  3E13 X;  3ECR A;  2O6A A;  1US5 A;  3HV1 A;  3VE1 B;  4EF2 A;  1LST A;  3C4M A;  1NKX A;  4NE4 A;  4KFQ A;  4F39 A;  4IY5 A;  4QSC A;  3T9X B;  4EF1 A;  3RGY A;  2Z8F A;  4IO2 A;  4U1O A;  4G4P A;  1BKA A;  3RTF B;  3JZJ A;  3KGC A;  2H99 A;  1P99 A;  3DP8 A;  4R75 A;  3V83 A;  5I57 B;  5DEX A;  2ZYK A;  1B4H A;  5AA2 D;  3TQL A;  4IO7 A;  2O7U A;  2AL5 A;  5HBC A;  4X1B A;  4R6K A;  3MVX A;  2I3V A;  1FW0 A;  2B3F A;  4XTC Q;  4NWD A;  4F2O A;  4R74 A;  1IZ1 A;  3OO6 A;  5ISU A;  3S9E A;  1QW0 A;  2Q2A A;  4C1T A;  1MY3 A;  4R9G A;  3O6H A;  3CR9 A;  3PUW E;  3FD3 A;  4ZEI A;  1EH3 A;  1QKB A;  3G3G A;  1S50 A;  2YJP A;  2I4B A;  3F11 A;  4YKI A;  2DXR A;  2OWT A;  1B6H A;  5IAI A;  1JEV A;  1Z7M E;  4KR5 A;  2DQV A;  1KWH A;  3UN6 A;  1NNP A;  2H25 A;  4R6Y A;  5L8D A;  4MLQ A;  3S9N C;  1B7H A;  3VVD A;  1A54 A;  1UTH A;  4FAJ A;  1XT8 A;  2B3B A;  5AE4 A;  3RUM A;  3C9H A;  4F1U A;  2O1L A;  3EHS A;  1O64 A;  1YCJ A;  2Y7P A;  5KDT B;  1URD A;  2UYF A;  1QVS A;  3MW0 A;  2M8C A;  5I2N A;  3KOS A;  3N6U A;  2DE3 A;  1USY H;  2R71 A;  4H67 A;  1RYX A;  1B1X A;  1WVJ A;  1IQ7 A;  1JQF A;  3S4U A;  5I58 A;  3FAS A;  3H3G A;  5KZT A;  3RT6 B;  4DIG A;  1DOT A;  1DTG A;  2ONS A;  3MVZ A;  3MJN A;  3MVW A;  3TFL A;  2XXQ A;  3V5A A;  4LZ5 A;  1JW1 A;  1URS A;  3KJ7 A;  2UYE A;  4KI0 E;  4BDL A;  1Y20 A;  1AMF A;  4P11 A;  3LBS A;  3K1M A;  3UIF A;  4QSD A;  1S7Y A;  4RK2 A;  4IY6 A;  3OXN A;  1B05 A;  2Y7W A;  2DE2 A;  2FYI A;  3CFZ A;  3K00 A;  2HAV A;  1Y3Q A;  3IB1 A;  4FOR A;  3HPI A;  5FHN A;  1ZTY A;  3CRB A;  1NNT A;  3C35 A;  4FE8 A;  5KDT A;  2VD3 A;  4O3B A;  2PYY A;  3SEX A;  4RNS A;  4JB7 A;  3FJ7 A;  4GRK A;  3FJG A;  1R9Q A;  3AXF A;  4YU0 A;  1A40 A;  1NMU A;  4H6D A;  5AA2 B;  3BKI B;  4DXB A;  3HO7 A;  1GV8 A;  5HPQ A;  1QUI A;  2A5T B;  1OMP A;  3VVE A;  2VGQ A;  4G8N A;  5F1Q A;  4DZ1 A;  4DDD A;  4BDO A;  3OSR A;  1MPD A;  4EUO A;  4U22 A;  3QK6 A;  1MQH A;  3K1P A;  4LP2 B;  1T0K A;  3OSQ A;  3R6U A;  2H9B A;  4FIM A;  1N84 A;  5TP9 A;  2WKY A;  3N26 A;  4OEU A;  3MZ1 A;  4YZZ A;  2G93 A;  1QUK A;  3TTK A;  4O3C A;  4LON B;  1PC3 A;  3CI8 A;  1Q35 A;  1SQY A;  4KCD A;  4OQO A;  2Y7I A;  4KYE A;  3M3K A;  4I1D A;  4HCY A;  1EZO A;  1ZLQ A;  3BBR A;  1JVX A;  3RN8 A;  3ZSF A;  1MXX A;  1PB7 A;  5I59 B;  2REG A;  5TPA B;  2PT2 A;  4N13 A;  5B70 A;  1ELJ A;  4AQ4 A;  4XKN A;  4F1Y A;  4E0X A;  4GIZ A;  3B7D A;  3OO7 A;  3W9W A;  1BTJ A;  2F78 A;  3S9L C;  4THI A;  3IJO B;  3MPL A;  1MY1 A;  3IO6 A;  3OO9 A;  1QJM A;  1A8E A;  2XD2 A;  4MF3 A;  1MH3 A;  3O2A A;  2DYX A;  3PGF A;  1EZ9 A;  1B58 A;  1FQB A;  1VR5 A;  4PP0 A;  5FTI A;  3ZKK A;  2PMS A;  1LGB C;  3M3L A;  1B2H A;  4P0G A;  3O29 A;  4M1V A;  5JEI A;  1MS7 A;  2RF1 A;  3TCF A;  4GFR A;  3DLN A;  2V3T A;  2I58 A;  2HEU A;  1SYI A;  3MP8 A;  5DVF A;  3LC8 A;  3U1O A;  2NXO A;  4ND9 A;  4AB5 A;  3PU5 A;  3TZA A;  3KBR A;  3V8X B;  5K2Y A;  4U21 A;  3U8Q A;  4LA9 A;  1P1Q A;  5DVJ A;  2Q2C A;  1F9B A;  1GTK A;  2R6G E;  3D4G A;  1OLC A;  4IO4 A;  1SDX A;  4WED A;  4NTL A;  4ZZA A;  1O63 A;  5K2X A;  3U94 A;  1TFD A;  2RCA A;  4NF8 B;  5AA4 A;  1NL5 A;  4NWC A;  2UXA A;  3MWB A;  1IXG A;  2NVU B;  3FIR A;  4QHQ A;  2OZZ A;  2O1M A;  2ZNU A;  4GXS B;  4MBP A;  3TCH A;  3D4C A;  1POT A;  2OJT A;  3EPE A;  5H8N A;  1D3K A;  4UAC A;  2VD2 A;  2F7A A;  4JXI A;  2RC7 A;  4G77 A;  1S9T A;  5M2V A;  3PUZ E;  1N7W A;  3FJM A;  5F7V A;  4N07 A;  3FVG A;  3H6T A;  1B3G A;  1LAH E;  4OMB A;  4U4X A;  5DEX B;  2F97 A;  2XXP A;  5ITP A;  1OIB A;  3K6W A;  1QUL A;  3TUS A;  3O66 A;  1ZIU A;  3QSL A;  1UQW A;  3V89 B;  1PBQ A;  3SEW A;  2E0S A;  3FXQ A;  1MXV A;  2ZXT A;  2R9J A;  3B6Q A;  1SD3 A;  3FZV A;  2DXY A;  3C33 A;  1FQA A;  2Q88 A;  1N76 A;  4YB5 A;  3VLU A;  4GVO A;  4G8H A;  4RJZ A;  4EDP A;  1RYO A;  1JEU A;  3MPK A;  1N3X A;  1R9L A;  1VFE A;  1MY0 A;  3K2D A;  4YB7 A;  3HHF A;  2OBG A;  2O51 A;  3T9H B;  4HTG A;  3BFU A;  1UTH B;  3PUV E;  3TTN A;  2UVG A;  5DT6 A;  1AL3 A;  3CG1 A;  4DLD A;  3H6V A;  1B46 A;  3MVY A;  5BWJ A;  3FVN A;  4GOT A;  2XXU A;  3SER A;  3PPN A;  5I2N B;  1MPB A;  2QMW A;  4NF6 A;  1BP5 A;  3FGS A;  3IO4 A;  1MY2 A;  3K6V A;  1R1N A;  3ODB A;  3U93 A;  4EXK A;  2Y7R A;  2HXW A;  3JV9 A;  1XS5 A;  1LCT A;  5I58 B;  1Y4C A;  5CM6 A;  4GXA A;  4G68 A;  2DWI A;  4FEB A;  3N94 A;  4DE8 A;  4U1Z A;  1B51 A;  2I0C A;  2I49 A;  1GGG A;  3UA8 A;  1H44 A;  2DSF A;  3GBA A;  1NNF A;  1L5T A;  2REJ A;  2QS4 A;  3TOD A;  4H8J A;  1B0L A;  1RKM A;  2THI A;  2Z8E A;  4GL8 A;  4OTE A;  2P1S A;  4RPN A;  3K02 A;  2ONR A;  3SES A;  1ATG A;  3VFJ A;  4GLI A;  1N7X A;  2I4C A;  4I9D A;  3RTW B;  2UVH A;  2G29 A;  5DVI A;  2X26 A;  3KSJ A;  1Y9U A;  1VFD A;  3H6W A;  3QIM A;  1IIW A;  3FVK A;  1BLF A;  1MQD A;  3GXA A;  3LSL A;  4JDF A;  3SEU A;  1CE2 A;  1IUD A;  3IAZ A;  5CI5 A;  4FEC A;  1PB9 A;  1MDP 1;  4X9T A;  2D21 A;  3MAM A;  4F3G A;  2O69 A;  1B40 A;  4H8I A;  1GR2 A;  3H03 A;  1P1O A;  1ZU0 A;  2AYS A;  1IIT A;  3LSF B;  3FXR A;  2BJJ X;  3Q27 A;  1WDN A;  4Z7E A;  3MQ9 A;  4QFN A;  1B1H A;  2XXV A;  3TTL A;  4YMA A;  3LSX A;  2QSX A;  1LFH A;  4NF5 A;  5KCJ A;  1B5H A;  4I8C A;  5AA3 A;  2AL4 A;  3PD9 A;  2XX8 A;  5TP9 B;  4EQB A;  3A3C A;  3MZ9 A;  5ICQ A;  4KYD A;  3H06 B;  3TTM A;  5FHO A;  2D3I A;  3DM0 A;  4OES A;  2ONK E;  3RLF E;  1ZBM A;  2RKM A;  3IJX B;  3M3F A;  4LQ5 A;  3FV1 A;  3MP6 A;  3MZB A;  2IA4 A;  3IK6 B;  5LOM A;  1PEB A;  2FNC A;  2GH9 A;  3IB0 A;  2XXY A;  4POX A;  3RNN A;  1AIV A;  3K4U A;  4G8M A;  4WKM A;  1NNK A;  3MUQ A;  3KN8 A;  1DPP A;  2ZNS A;  3PPR A;  4XKQ A;  3G3J A;  2Q8J A;  4X48 A;  2PVU A;  4IGR A;  4LZ8 A;  1GVC A;  3TCG A;  1YPN A;  3MBP A;  3PMV A;  2ZMB A;  3HHG A;  1FQF A;  2NOO A;  4OXV A;  5EHS A;  1SI1 A;  4OFJ A;  1B9J A;  2XX9 A;  3ONM A;  3PMX A;  2GHB A;  1SI0 A;  3O9P A;  2OCU A;  3E3K A;  4E0W A;  2VOZ A;  4KHZ E;  3IOU A;  5H8Q A;  1LAF E;  4NMY A;  1FTL A;  1R6Z A;  2F6P A;  3HN0 A;  1I6A A;  1B4Z A;  5I84 A;  4M4G A;  2P0S A;  4KPT A;  3L6G A;  3WAF A;  1IXC A;  3O28 A;  5B7D A;  4IB2 A;  3FAT A;  3T9U A;  4OZ9 A;  5CMC A;  5IKB A;  1B0H A;  3G3K A;  4XXU A;  4QFK A;  3ZKL A;  2OK2 A;  4FJP A;  2DWH A;  4H5G A;  4YKK A;  5H8S A;  4BDQ A;  3H6U A;  3T66 A;  4BDN A;  3TDJ A;  3CSB A;  2GFE A;  2H98 A;  3G3H A;  4TOZ A;  2QL3 A;  4KD5 A;  2Y84 A;  3G7W A;  2F6G A;  4IO6 A;  5AA4 B;  2DWA A;  4WEP A;  3I5O A;  4MH5 A;  1N0T A;  4ECF A;  1MQI A;  3KZG A;  1IEJ A;  3K6U A;  2ZYM A;  2ZYN A;  3C32 A;  4JSO A;  4F1V A;  1B3F A;  3IB2 A;  2F35 A;  1B7U A;  3KN3 A;  1USY E;  2FA7 A;  3K6X A;  5H8N B;  2XXR A;  4BLA A;  1Q1K A;  3HST A;  3DEL B;  1LBB A;  4ONY A;  2DVC A;  3H7M A;  4R9F A;  1XC1 A;  5H8F A;  4OER A;  1EU8 A;  4R72 A;  3Q25 A;  3DP6 A;  5FHM A;  1ANF A;  1IXH A;  4JBZ A;  3O97 A;  3RQT A;  3OEK A;  1ZMG A;  3VLV A;  1OQG A;  4YB6 A;  3H4Z A;  2PX1 A;  1JW4 A;  5CRY A;  1BIY A;  2O7I A;  1OVT A;  4XKR A;  2V3U A;  1QUJ A;  4L17 A;  5DTB A;  3KN7 A;  3SDF A;  1LFI A;  5CMK A;  4GWO A;  3Q28 A;  3CIJ A;  4YKP A;  3RY3 A;  3OD7 A;  3PPP A;  4FED A;  3W15 C;  3C31 A;  3IOT A;  1NFT A;  4FAT A;  4P0I A;  2F7B A;  3KJT A;  4N6P A;  3T9V A;  1QKA A;  4RK9 A;  2H5Y A;  4KCC A;  1P1W A;  5CC2 A;  5CBR A;  4PFU A;  3WAE A;  4ZDM A;  4F22 A;  3IOV A;  2HZL A;  4ELR A;  2DS9 A;  5EHM A;  4OYV A;  5EYF A;  2NUV A;  1NH8 A;  1HSL A;  3QUF A;  2Q89 A;  4ELP A;  3THI A;  1FTM A;  4JWO A;  4DXC A;  4EQ7 A;  1LFG A;  1FTK A;  3RPW A;  3QXM A;  1MM6 A;  1OVB A;  1UIU A;  3L6H A;  4NF6 B;  1IXI A;  4PET A;  4PE5 B;  3O6G A;  1AH5 A;  3UOR A;  1UTB A;  1A8F A;  3PD8 A;  3LR1 A;  3MP1 A;  4RA1 A;  1M5B A;  2XD3 A;  1MDQ A;  2X7Q A;  4G68 B;  1Y3N A;  1DPE A;  2DVZ A;  3FV2 A;  2ESN A;  1OQH A;  4RXL A;  1B32 A;  3GZG A;  4HS7 A;  1CB6 A;  1I69 A;  2RC8 A;  4TQU Q;  1P1N A;  4ZEC A;  2YPN A;  3VXB A;  4F2Q A;  2QMX A;  4ZEF A;  1MQG A;  1URG A;  4F18 A;  1B5I A;  1H3D A;  3KEI A;  4QF9 A;  4XKP A;  2NWJ A;  3EHT A;  3R26 A;  3PPO A;  4F3B A;  4YMB A;  2GHA A;  4LZ7 A;  1Z7N E;  1M5E A;  1MRP A;  4RPO A;  3B6W A;  4XIG Q;  1MXW A;  4LQ2 A;  4HW8 A;  1M5F A;  3DP4 A;  3TTR A;  4EXL A;  3CFX A;  4Q8R A;  1LB8 A;  5H8H A;  2ALU A;  1US4 A;  1II5 A;  2CMO A;  5I2K A;  2I6E A;  1VE4 A;  5TU0 A;  3PPQ A;  4F3P A;  2A5S A;  2ZYO A;  3IL1 B;  3GBB A;  2I0B A;  4ESX A;  4ZEB A;  3E9X A;  2RC9 A;  4YAH X;  2QRY A;  1XVX A;  1JNF A;  1SW2 A;  2QS1 A;  4R2F A;  2QS3 A;  4NF5 B;  5KCJ B;  4C0R A;  2AIX A;  5I56 B;  1B5J A;  4C1U A;  4Q0C A;  1SYH A;  3B6T A;  1NH7 A;  2QPQ A;  1O7T A;  2F36 A;  3TQW A;  3PV0 E;  3EQ1 A;  2VHA A;  3TKD A;  2UVJ A;  5L9O A;  1LBC A;  1JW5 A;  5A5X B;  3TMG A;  3VV5 A;  3K01 A;  5L9S A;  3W9V A;  2OLB A;  3OEN A;  2I48 A;  1POY 1;  3P7I A;  4H65 A;  3A09 A;  2V84 A;  4KYS A;  4OEN A;  4ELQ A;  3UK4 A;  1DTZ A;  3ZS6 A;  1I6B A;  4POW A;  4F3S A;  4LAT A;  4IGT A;  1DMB A;  1JVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...