4G4PA

Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
235
Chain Sequence
HHGENLYFQGMEGKKYTIGTDLTFAPFEFQDSKGKYIGIDVDLLDAIAKDQDFEVDLKPLGFDSAVQAIQSKQIDGMIAGMSITDERKKSFDFSDPYFDSGLQLAVKKGNDKIKSYDDLKGKTVAAKVGTESANFLEKNKEKYDYTIKNFDDATGLYKALENGEADAIVDDYPVLGYAVKNGQKLQLVGDKETGSSYGFAVKKGQNPELIKKFNAGLKNLKDNGTYDKILNNYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, amino acid-binding/permease prot
total genus 77
structure length 235
sequence length 235
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g4pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g4pA02
1SW2A 2DWJA 3OO7A 3G7WA 5TPAB 4QFOA 3LSWA 5CI5A 3TTNA 5JEIA 1IIWA 1DSNA 4KHZE 4F31B 3KN7A 1B3HA 3DLNA 3T9HB 2O69A 1MXYA 2AYSA 1B7HA 3OO6A 1WODA 4O3AA 1URDA 3LR1A 3N6TA 4RYAA 4EQ9A 4ZEDA 3R6UA 2UYFA 1MG1A 4ZEKA 3G3GA 4IY5A 4X1DA 5DEXA 3TELA 3GBBA 5L9MA 1B9JA 2Z23A 3KEIA 1XVXA 1JNFA 2GHAA 3IJOB 3VLUA 1EZPA 2I6EA 1NNPA 4OWDA 3D4GA 3IOVA 3P7IA 3O66A 4HCYA 1AOVA 1IITA 1NKXA 2RINA 3DP6A 3G3JA 5F7VA 3PPQA 1N3WA 1Y20A 2A5TA 3RPWA 1P1UA 4F3GA 2UVGA 2Y7RA 5TU0A 1FQFA 2V25A 3SDFA 5CBRA 2QS1A 2PT2A 1B3EA 3CRBA 3CR9A 4QFKA 4NF5B 4R75A 2DSFA 3GZGA 4YAHX 3K6WA 2F6GA 1DPEA 4ZS9A 1UIVA 3TUSA 1B58A 2HAUA 4EUOA 2DVZA 1A7LA 1RYOA 1QULA 1SW1A 1POY1 4G2ZA 3K1MA 5CRYA 4AB5A 5BUUA 1NFTA 3Q28A 3AXFA 1P1OA 4GWOA 1BIYA 3L6HA 3RLFE 2UVJA 4IB2A 2ZNTA 4IO2A 4RA1A 4ZEIA 5TP9A 2X7QA 5IKBA 1FW0A 1M5CA 1PC3A 4KCDA 2X7PA 4BDQA 5A5XA 5CM6A 4OFJA 4O3CA 5ISUA 3FXQA 1FQBA 2GHBA 2HZKA 3A3UA 4I1DA 2ZYNA 2UVHA 1JW5A 1US4A 4POXA 1JVYA 1JW1A 2REGA 4PFTA 3OO8A 5I2NB 3C4MA 1SW5A 3E3KA 4Z0IA 3CI8A 3FATA 3EPEA 3WAEA 2XXHA 2V3TA 1SBPA 3LBSA 4F3PA 2IA4A 3DELB 2Y7WA 3K00A 3N26A 2XXIA 5A5XB 4NEDA 4MF3A 1YTVA 2O1LA 3PD8A 3ZS6A 3E9XA 4ESWA 4TQUQ 1GR2A 4F22A 4POWA 1LCFA 4ESXA 3L6GA 1LAGE 1GTKA 2XX9A 3EHTA 4OMBA 2IEEA 4N6PA 4LVQA 1PDAA 3IAZA 2HQ0A 3H6WA 1Y4CA 2F34A 4KPTA 4YKPA 2XXPA 1A54A 3OO9A 4GL8A 4U4SA 1UIUA 2OWSA 1XHYA 4GXSB 3SEUA 3RTWB 3VV5A 4FJPA 3FV2A 3K1PA 4ELRA 1GGGA 3IR1A 3HV1A 3UORA 4R6KA 3CG3A 2QMXA 4EDPA 2E1SA 1ZMGA 1A40A 1Y4TA 1I69A 4QF9A 3VE1B 4ND9A 3LUYA 1MY1A 3M8UA 2Y7PA 1JW4A 3FASA 2RC9A 1M5EA 3PV0E 2F7BA 4H1XA 3FVNA 2REJA 4IO7A 5FTHA 3TTLA 4H0WA 1NH7A 3TYHA 2O7UA 5F1QA 2Q88A 2XXWA 2P2AA 4U2RA 1SYIA 3QYTA 5AA3A 3K1NA 3JZJA 2XXQA 4F3SA 5AA4B 4KYSA 1DMBA 3K6UA 3ONMA 5DVJA 2F35A 2H25A 3T96B 2ANJA 1JQFA 5TPAA 2BJJX 1B40A 3C33A 3MPLA 1Y3PA 2ESNA 4G77A 2QPQA 2P1SA 3KOTA 3TODA 4GQOA 4DE8A 2VD2A 3C32A 3G3HA 1URSA 3K02A 2OZZA 3BKIB 3ILTB 3M3KA 4H8IA 4H5GA 1USYE 3TKDA 4DZ1A 1MQGA 4XKQA 2R71A 3PPNA 3JYRA 4OVJA 1PBPA 4EF2A 1FTMA 2HZLA 4YB7A 2F7AA 1LSTA 3CSGA 2XD3A 3FJGA 4MH5A 4YZZA 2H99A 1QJMA 1SI0A 5ICQA 4JWXA 3S9LC 4Q30B 4YKJA 4QRZA 1POTA 1J1NA 1FTOA 1YCJA 1EH3A 1B46A 2XXXA 5H8NA 3V89B 4WEPA 4EQBA 1B51A 3MJNA 4ELQA 2CMOA 2Y7KA 3IB0A 4GRKA 5H8HA 3QAXA 5HM4B 5I59B 4U1OA 3RNNA 1MXVA 1OLAA 2I0BA 3T93B 1AMFA 4EF1A 1NNTA 1SVXB 1I6AA 3LSXA 2DOJA 4X9TA 5DYHA 5FHNA 4TOZA 3T66A 1Z7NE 1SD3A 3PPPA 2I0CA 1MY0A 2YJPA 4M4GA 5DT6A 3IO6A 1EZOA 4IY6A 3SKPA 3QK6A 2F8DA 3JV9A 3TTRA 4GLIA 4FE8A 3VLVA 1HSEA 4EXLA 3E4RA 4YU0A 4G4PA 2QJEA 4BDRA 3EHUA 3QIMA 4BDLA 1DTZA 3E13X 3WAFA 1PEBA 2UVIA 4PETA 4FIMA 1LFGA 2HCAA 3T22A 3S9NC 3I6VA 3HSTA 2DWHA 1B1XA 3GBAA 2H4IA 2VOZA 5ITPA 3RGYA 1N0TA 3MWBA 4JDFA 4LA9A 4ZE9A 4LONB 4ONYA 1IXCA 1O7TA 1ZU0A 3T9XB 2XX7A 4QFPA 2HEUA 2ZNSA 4YICA 1P99A 2YPNA 3THIA 3TQWA 1B2HA 3QUJA 1MXUA 1B0LA 1M5DA 1TT1A 3B7DA 4RK2A 4RPNA 1JEUA 3MP8A 4X48A 4PP0A 3G3FA 5FTIA 2RF1A 2XXRA 3R26A 3KN8A 5H8QB 5ITOA 3OD7A 2PT1A 5EYFA 1B0HA 3PUVE 3TMGA 3MVWA 1Q1KA 1XC1A 5CMCA 1QUIA 3C31A 5K2YA 1Y3NA 3IB2A 4JXIA 3W9VA 1B3GA 3K6VA 3PMVA 3D4CA 1UTBA 3IORA 4LUBA 4R73A 3SERA 1N04A 1P1WA 3O9PA 4IO6A 3I5OA 2ONSA 4OQOA 1AIVA 1LFIA 2ZYMA 1P1QA 1MH4A 1JVXA 4LQ2A 4OXVA 2RCAA 1D3KA 3MC2A 2O1MA 3O6IA 3CIJA 3N94A 4Z7EA 2O84X 1ATGA 3PU5A 3DM0A 5JTYB 3KSXA 1JETA 2ZYKA 1B3LA 4LZ5A 1MQHA 3RT8A 1MPBA 2A5SA 3PD9A 4F2OA 1M5BA 5I58B 1MPDA 3K2DA 4MBPA 1LB8A 1Z7ME 4KFQA 4XKPA 4H67A 5B70A 3A09A 3H3GA 2QRYA 3IJXB 2VP1A 2XXTA 4YMAA 3VXCA 4BDMA 4KR5A 1WVJA 1MQJA 1S7YA 3FVKA 4IO5A 4P11A 5DEXB 3QUFA 5KCJB 1N7XA 1OLCA 2QS2A 3DP8A 4O3BA 4PFWA 1URGA 5J1DA 3PMWA 1D9YA 1MY4A 2O6AA 4KYEA 4PFUA 3TDJA 4HCWA 3PGFA 1II5A 3PUZE 3KG2A 3MW0A 4KQPA 3S9EA 4DIGA 5L8DA 1MQDA 4OZ9A 3CFZA 3LC8A 3B6WA 3C35A 3IB1A 1WDNA 4K3FA 5CC2A 3QXMA 4GOTA 4QHQA 2XXVA 3CVGA 4ZEBA 1OQHA 4GD5A 3VXBA 2Q9TA 3RQTA 3PPOA 5LOMA 1B52A 3TCFA 4KYDA 4XXUA 2AL4A 5H8NB 3GLBA 1OIBA 4JSOA 1IQ7A 3K4UA 4G68A 4YKKA 4IO4A 2F78A 3HN0A 4U22A 3U94A 1MRPA 2GH9A 4RK9A 4DDDA 1CE2A 2D3IA 4MLVA 1RYXA 1Y3QA 3UA8A 4G8MA 3TFLA 3MVXA 5AA2D 1PBQA 1OMPA 3PMXA 2ZMBA 4MLQA 4NF6A 5H8QA 3DP4A 4JB7A 1MQIA 2YLNA 2FNCA 5KZTA 3ODBA 4LZ8A 1IZ1A 2NVUB 1MM6A 1QUKA 2GFEA 2H98A 4FORA 5H8FB 1L5TA 1USYH 4EQ7A 1FTLA 4NF4A 5EHMA 3U1OA 3SESA 1SI1A 4L17A 2DWIA 3U72A 5I2NA 4DXCA 3TAJA 1N84A 4OEVA 3KBRA 4R9GA 3OEMA 5I2KA 1VFEA 5L9SA 1VR5A 1VE4A 4OHNA 2I4BA 2OBGA 4DCXA 2NWJA 3V83A 1DOTA 3T9VA 3ILUB 4FATA 1LAHE 1R6ZA 1B7ZA 1HSJA 1IXIA 3C9HA 4NF4B 4U4XA 3RUMA 4N07A 3U8QA 5I58A 3EHSA 3MQ9A 2B3BA 1RKMA 3TCHA 1Y1ZA 3LSFB 2ALUA 1R1NA 4GIZA 4JSDA 1BP5A 1TWYA 3FUZA 5I59A 2VD3A 1A99A 2DYXA 4XKRA 2I49A 3GXAA 2A5TB 2H5YA 2KLFA 3IK6B 3O6HA 3U93A 1EZ9A 2OK2A 4OFLA 1YAEA 2V84A 1YPNA 4PFYA 2Z22A 4Q8RA 4XIGQ 5JK4A 3FV1A 1O64A 3A3CA 4YMBA 5ICTA 1XS5A 3MVYA 1B4HA 3OEKA 4IO3A 4R2BA 3TZAA 2I4CA 5I56B 2R6GE 4F1YA 4WXJA 4WEDA 2QL3A 2VGQA 3ECRA 2Z8EA 3KOSA 4FEBA 4NTLA 1ZBMA 4WKMA 5H8HB 1QKBA 2ZXTA 2DE4A 3KJTA 1LBBA 2OWTA 3BFUA 1LLSA 4TLLB 1AH5A 2ABHA 3HCQA 4LP2B 4KI0E 4RPOA 1SDXA 1XVYA 3ZSFA 2FA7A 4I8CA 3MZBA 4NMYA 4OENA 3VVDA 2F6PA 4H8JA 1A8EA 4HTGA 2RKMA 3PUWE 4OERA 4F18A 1MXZA 3M3FA 3MBPA 3BFTA 2XXYA 4LATA 4QFNA 1LB9A 4G68C 4XKNA 2DXRA 4G68B 3SEYA 1BKAA 5B7DA 1ANFA 3FXRA 2Z8DA 3MP6A 1MM7A 3MZ1A 3MZ9A 2HXWA 4GFRA 2DE2A 4ZZEA 3V5AA 1UTHB 1N3XA 2XXUA 2ONKE 4GL0A 4R9FA 3FVGA 2XX8A 3H06B 3O2AA 2WKYA 3B6TA 1I6BA 1SQYA 3FJMA 3UIFA 5H8FA 4H6DA 5CBSA 5I84A 2X26A 4MFIA 4PE5B 1MH3A 3EN3A 4M1VA 4ZZAA 3O28A 3G3IA 1B5IA 2XHDA 1B32A 4LZ7A 3FGSA 4IGTA 1QUJA 4Q5TA 4G8HA 1T0KA 1MDQA 2G29A 3MVZA 1IXGA 3H4ZA 1FTKA 4F3BA 4ZECA 4HW8A 3RTFB 2ONRA 1ZJLA 4JWYA 1FQAA 1CB6A 1S50A 4GXAA 5I2KB 4ECFA 5CMKA 2D21A 1P1NA 2DQVA 2I3WA 3CFXA 3O29A 1FTJA 1TFDA 3Q27A 4RXLA 3MPKA 3MAMA 2QMWA 4ISUA 3ZKKA 3S9MC 2F97A 5HBCA 4UACA 5BWJA 4G8NA 1VFDA 3C34A 4NF6B 2PMSA 3HHGA 4ELOA 4F1VA 2G93A 4RJZA 1LGBC 2W7YA 3H03A 5H8SA 5KDTB 1EU8A 4NWCA 3H6UA 1B4ZA 2THIA 3LSLA 5DVIA 4DLDA 2QS3A 3VFJA 4GF8A 4F29A 4BLAA 3IO4A 4RNSA 5FHOA 3RN8A 4QSCA 2Q8JA 4R6YA 1H45A 3IOUA 3ZKLA 4BDNA 5I56A 2H9BA 2P0SA 4X1BA 3IL1B 1DPPA 1NNKA 4BDOA 1NNFA 1HSLA 1H76A 2O7IA 4FEDA 4OESA 4P0IA 5I57B 2D5WA 3V8XB 4ZEFA 2NXOA 3SETA 4E0WA 2I48A 3UN6A 3S4UA 2B3FA 1OQGA 1NH8A 1NL5A 4QFLA 5AA2B 1GV8A 2V3UA 5EHSA 1FQCA 3TEPA 4KD5A 3H7MA 3OOAA 4UA8A 1UQWA 1LAXA 4FAJA 2RC7A 2UYEA 3N5LA 2PX1A 3F11A 1B7UA 3EF7A 5IAIA 4QSEA 3N6UA 2I58A 3VVFA 1H44A 4U21A 3KN3A 2V3QA 1D4NA 1R9LA 4R6HA 4YB5A 1IEJA 3Q29A 3VLWA 1H43A 1B5JA 4N13A 2OJTA 1MXWA 3H6TA 3IOTA 3Q26A 4DCYA 1UTHA 1B6HA 5FHMA 1I6QA 1OVBA 2Q2CA 1XOCA 2E0SA 2M8CA 3K01A 4R2FA 3TTKA 5AA4A 2HAVA 4P0GA 1FQEA 1H3DA 4H65A 1D9VA 4DXBA 1BLFA 3K6XA 1KWHA 3C36A 3OENA 4H5FA 3RY3A 1OVTA 4AB6A 4F39A 1LAFE 1DTGA 3BBRA 3TCGA 3UK4A 4YKIA 3VDFA 2QSXA 2Y84A 3Q25A 2OLBA 5K2XA 1Y1MA 2F36A 3SEVA 1S9TA 3M3LA 1B3FA 4THIA 3O6GA 5M2VA 2Z8FA 2ZYOA 3T9UA 4OTEA 5DTBA 3FVOA 4ZE8A 1SW4A 2O68A 4NWDA 3W9WA 1VSOA 3HHFA 1B1HA 2LAOA 1N76A 3MP1A 1UTBB 3OXNA 4OETA 4IGRA 1MY2A 5AE4A 2DVCA 1ZIUA 4YB6A 1PB7A 2DXYA 1NMUA 3CG1A 3USDA 1US5A 3KGCA 3KSJA 4R74A 5KDTA 3S2VA 1MDP1 2XD2A 2V93A 2RC8A 3CFLA 4RY1A 4U1ZA 3FIRA 3K0VA 2QS4A 3SEWA 3SEXA 1A55A 5HPQA 2PYYA 1B5HA 2DP8A 1MXXA 3OELA 4I9DA 3HO7A 4EXKA 1IUDA 2ZNUA 3OMBA 3FXUA 3PUYE 5TP9B 1TXFA 1MY3A 3QSLA 4JBZA 3I3VA 4QSDA 1A8FA 1PB8A 1MS7A 3PPRA 3KJ7A 1Y9UA 3IOWA 1FCKA 3IX1A 4DXUA 2NOOA 2AL5A 2AIXA 4NF5A 1QKAA 1O63A 2PBWA 4OFOA 3B6QA 5KCJA 5L9OA 4LQ5A 3PUXE 4OYVA 4GVOA 3HPIA 3OSRA 4Q0CA 4I62A 1AL3A 2CZLA 1PB9A 1SYHA 5CMBA 3TPAA 2F7CA 4E0XA 5JTYA 2HFBA 1JEVA 3U92A 1B05A 4C1UA 2RCBA 3KZGA 1LCTA 4PQJA 3TQLA 1F9BA 1N7WA 1XT8A 2B65A 2I3VA 3UP9A 4C0RA 1LFHA 1QW0A 2PVUA 2R9JA 3FD3A 3H6VA 4NF8B 3R7XA 2VHAA 1GVCA 1IXHA 4JWOA 3CSBA 5ELVA 3OSQA 4KCCA 2DWAA 2DE3A 3EQ1A 3UGWA 4XTCQ 1ZLQA 4C1TA 2F5XA 2Y7IA 2FYIA 2DS9A 1TFAA 3FZVA 3MUQA 1FQDA 5CMMA 4FECA 4F19A 4NF8A 3KFMA 4F1UA 5I57A 1ELJA 1M5FA 1BTJA 1QVSA 3FJ7A 3O97A 2UXAA 5DVFA 5AA1A 4AQ4A 3G3KA 4ELPA 4OEUA 4R72A 4HS7A 2Q2AA 4NE4A 4F2QA 5AA2A 1ZKBA 2GRVA 1LBCA 2O51A 3W15C 4ZDMA 1Q35A 2Q89A 4TLMB 1ZTYA 2NUVA 2OCUA 4U23A 3RT6B 3VVEA 1MPCA 1R9QA 3TTMA
chains in the Genus database with same CATH superfamily
3OO7A 3G7WA 5TPAB 3TTNA 1IIWA 5EYGA 4F31B 1B3HA 3T9HB 2O69A 1B7HA 4O3AA 4RYAA 3LR1A 2UYFA 4ZEKA 5DEXA 3GBBA 1FPJA 4FBPA 1XVXA 2GHAA 3VLUA 3D4GA 5EYHA 3IOVA 1NKXA 2RINA 4GWXA 1P1UA 1B3EA 2DSFA 3GZGA 4ZS9A 5EQ7A 1SW1A 1POY1 3K1MA 3Q28A 4GWOA 1BIYA 2UVJA 4GWUA 1YXIA 1JW5A 1US4A 1JW1A 4PFTA 3C4MA 1SW5A 3CI8A 3FATA 3WAEA 2IA4A 4HE1A 3DELB 4MF3A 3E9XA 1NUXA 4NGUA 1GR2A 4F22A 4LVQA 1PDAA 1DBZA 4YKPA 1INPA 1UIUA 1XHYA 3FV2A 4ELRA 3UORA 5ET7A 2E1SA 1I69A 1Y4TA 3PV0E 4OVTA 3FVNA 3QYTA 2XXQA 5LDZA 2F35A 2ANJA 4PF8A 5TPAA 2BJJX 1B40A 3MPLA 4G77A 4DE8A 2VD2A 3C32A 1URSA 3K02A 3ILTB 1NUZA 4XKQA 5IZ3A 1LSTA 3CSGA 2XD3A 2H99A 1AWBA 5ICQA 4YKJA 1FTOA 5H8NA 4EQBA 3V89B 1B51A 3MJNA 4ELQA 2CMOA 2Y7KA 3IB0A 5I59B 4U1OA 3RNNA 1MXVA 3T93B 1SVXB 5FHNA 1I6AA 3LSXA 5LTCA 1FPIA 3PPPA 2I0CA 2YJPA 4M4GA 1EZOA 2F8DA 4GLIA 4FE8A 1HSEA 4PETA 2UVIA 2HCAA 3T22A 2DWHA 1B1XA 3GBAA 2H4IA 2VOZA 1N0TA 3MWBA 4JDFA 2BJIA 4LA9A 3T9XB 2XWOA 2ZNSA 3THIA 5LOMA 1P99A 1B2HA 4DZ1A 1MXUA 1M5DA 3MP8A 3G3FA 4GBWA 2XXRA 3R26A 3KN8A 3OD7A 5EYFA 3PUVE 3W9VA 3SERA 3O9PA 1P1QA 2RCAA 2ZZVA 3N94A 2O84X 4EQ9A 2ZYKA 1B3LA 2A5SA 5I58B 1MPDA 4PDDA 4MBPA 4OVRA 1LB8A 4H67A 3IJXB 4YMAA 4QXDA 1S7YA 4O7IA 3QUFA 3ROJA 1N7XA 1URGA 5J1DA 1D9YA 3TDJA 5L8DA 3B6WA 3SZPA 4N4UA 2FIXA 4QHQA 4ZEBA 1OQHA 4GD5A 3PPOA 1B52A 3TCFA 5H8NB 4YKKA 1MRPA 4RK9A 4MLVA 1RYXA 1Y3QA 1FSAA 1PBQA 4JB7A 1MM6A 4KXPA 4EQ7A 4NF4A 5EHMA 3U72A 3TAJA 3LV0A 4OHNA 2OBGA 2NWJA 1DCUA 3C9HA 4GWSA 5I58A 5A5LA 3LSFB 4GX6A 1TWYA 1FPEA 5I59A 1A99A 3GXAA 3O6HA 2OK2A 2V84A 1YPNA 3FV1A 1QGXA 1O64A 4YMBA 1XS5A 1B4HA 4R2BA 2I4CA 4F1YA 3KOSA 2VGQA 3ECRA 2Z8EA 4NTLA 4WKMA 3MYUA 2DE4A 1LBBA 1LLSA 4TLLB 2ABHA 4OENA 4I8CA 3VVDA 4H8JA 2RKMA 1FPDA 1NV0A 3M3FA 4PF6A 4LATA 4G68C 2DXRA 5B7DA 1BKAA 2HXWA 2WBBA 3B6TA 5H8FA 4H6DA 4MFIA 3LUZA 1IMBA 4LZ7A 1NV6A 1QUJA 4G8HA 1T0KA 1MDQA 4F3BA 1FTKA 4HW8A 4NHBA 4JWYA 4GXAA 1CB6A 1S50A 4ECFA 2FIEA 5CMKA 2DQVA 3Q27A 1FTJA 2QMWA 4ISUA 5I5PA 2F97A 4G8NA 4NF6B 3HHGA 5KDTB 2G93A 2WBDA 5H8SA 5DVIA 2QS3A 3VFJA 4XEQA 3IO4A 3GYYA 3ZKLA 1H45A 5I56A 4MJOA 1NNFA 1HSLA 1H76A 4P0IA 3V8XB 4E0WA 2B3FA 4XF5A 3CHGA 4UA8A 1UQWA 1LAXA 3VVFA 4U21A 3KN3A 1R9LA 1IEJA 2OJTA 1MXWA 1OVBA 3TTKA 5ET6A 1FQEA 1H3DA 1BLFA 3K6XA 1K9YA 4F39A 5J16A 3BBRA 3TCGA 3VDFA 2PFZA 2Y84A 2OLBA 1LBWA 2ZYOA 4ZE8A 2O68A 3HHFA 3MP1A 2P3NA 3CG1A 3USDA 1US5A 1FPBA 2V93A 3K0VA 3SEWA 1KZ8A 5HPQA 1B5HA 4I9DA 3HO7A 3PUYE 1TXFA 1MY3A 4QSDA 1Y9UA 5KCJA 4PCDA 4Q0CA 4PDHA 1AL3A 5CMBA 4E0XA 5JTYA 4C1UA 1RDXA 3KZGA 1LCTA 3TQLA 3ISPA 1N7WA 2DE3A 3EQ1A 1FPLA 4XTCQ 1ZLQA 2F5XA 2Y7IA 2FYIA 2DS9A 3FZVA 3MUQA 2F3BA 1ELJA 3G3KA 4HS7A 2QVRA 4ZDMA 2WEFA 2I48A 5JEIA 4KHZE 2AYSA 3OO6A 4IY5A 3VLVA 1B9JA 2I6EA 1NNPA 4OWDA 4HCYA 1Y20A 2A5TA 2Y7RA 4PTKA 5CBRA 2QS1A 3CRBA 4QFKA 4NF5B 4R75A 1DPEA 5CRYA 1RYOA 4MIJA 3AXFA 3L6HA 3RLFE 4MNPA 1EYKA 4IO2A 5TP9A 2X7QA 1D9QA 4KCDA 4PBHA 5CM6A 1FQBA 3A3UA 2ZYNA 1JVYA 3E3KA 2QVVA 3K00A 2XXIA 4NEDA 1YTVA 2O1LA 3PD8A 3ZS6A 4POWA 1LCFA 3L6GA 1LAGE 1GTKA 2XX9A 2IEEA 3IAZA 3H6WA 1Y4CA 2F34A 2XXPA 4U4SA 4MEVA 4FJPA 1GGGA 3IR1A 3CG3A 3VE1B 4QF9A 1MY1A 2RC9A 4H0WA 2O7UA 2XXWA 2P2AA 3ONMA 5DVJA 2H25A 1JQFA 1Y3PA 2ESNA 5EQAA 3KOTA 3TKDA 1USYE 3JYRA 1NV3A 4EF2A 1FTMA 2HZLA 1FPFA 4MH5A 4YZZA 3MSTA 4Q30B 1POTA 1EH3A 4NN3A 4GRKA 5H8HA 3QAXA 1OLAA 4IR8A 4TOZA 1SD3A 1MY0A 5DT6A 3QK6A 3JV9A 4EXLA 3E4RA 2QJEA 3EHUA 3QIMA 2XA5A 3S9NC 3HSTA 4H46A 3RPLA 4ZE9A 4ONYA 1IXCA 1O7TA 1ZU0A 4QFPA 1TT1A 4RK2A 1JEUA 4PP0A 1B3GA 4LUBA 4R73A 3IORA 2Y5KA 5ET5A 3I5OA 2ONSA 4OXVA 4N6KA 2FVZA 2O1MA 3PU5A 5JTYB 3RT8A 3KSXA 1NV4A 1M5BA 3KC1A 4KFQA 3H3GA 2QRYA 1WVJA 4P11A 5KCJB 2QS2A 3DP8A 4O3BA 4PFWA 3MW0A 3S9EA 1MQDA 4OZ9A 3CFZA 3LC8A 1VDWA 3C35A 3IB1A 1IMAA 3CVGA 2Q9TA 3RQTA 4KYDA 2XWIA 3GLBA 4G68A 4U22A 4DDDA 4GBVA 1OMPA 1Q9DA 2YLNA 2FNCA 5KZTA 4LZ8A 2NVUB 4FORA 5H8FB 4NG7A 2DWIA 4DXCA 3OEMA 5I2KA 1VE4A 4LN5A 3ILUB 4FATA 1LAHE 1B7ZA 4U4XA 3RUMA 3U8QA 1K9ZA 3MQ9A 4GIZA 1BP5A 3FUZA 2VD3A 4XKRA 2H5YA 2KLFA 3U93A 1YAEA 2Z22A 4NF0A 3OEKA 5I56B 2QL3A 5H8HB 2ZXTA 3HCQA 4KI0E 4NMYA 2F6PA 4HTGA 4F18A 1EYIA 3MBPA 1FJ9A 1FPKA 2XXUA 3O2AA 3UIFA 1LBXA 1I6BA 5CBSA 3EN3A 1JP4A 4ZZAA 3O28A 3G3IA 2XHDA 4IGTA 4Q5TA 1FBFA 2G29A 3MVZA 4ZECA 4AS5A 3RTFB 5I3SA 5I2KB 1G0HA 2I3WA 3O29A 1TFDA 3MAMA 3S9MC 5BWJA 1LGBC 2W7YA 3H03A 1EU8A 4DLDA 4BLAA 3RN8A 2Q8JA 4BDNA 2H9BA 1DPPA 4OESA 4N17A 1OQGA 4I40A 5AA2B 1GV8A 3TEPA 4KD5A 1B7UA 3EF7A 4N6DA 3N6UA 2I58A 1H44A 4YB5A 1D4NA 4PGNA 2FHYA 4N13A 3Q26A 4DCYA 3IOTA 4R2FA 4GX3A 1D9VA 4N91A 1OVTA 1LAFE 1DTGA 4YKIA 1NV5A 5K2XA 1LBVA 1S9TA 1B3FA 4THIA 3O6GA 2Z8FA 4OTEA 5DTBA 1B1HA 3OXNA 1PB7A 2DXYA 5KDTA 3KGCA 3S2VA 2XD2A 3T1BA 3FIRA 2DP8A 3OMBA 3FXUA 1A8FA 1PB8A 3PPRA 3KJ7A 4OVQA 1FCKA 4OANA 4DXUA 2NOOA 5L9OA 4OFOA 1QKAA 2PBWA 3B6QA 4GVOA 3RYDA 4P47A 1PB9A 1SYHA 2F7CA 2HFBA 2RCBA 4MNCA 1XT8A 4C0RA 2B65A 1LFHA 4PC9A 3R7XA 2VHAA 5ELVA 3UGWA 2F3DA 1TFAA 4F1UA 1QVSA 5AA1A 4NE4A 2Q2AA 4TLMB 2HXRA 1ZTYA 2OCUA 4U23A 3RT6B 3RPWA 2M8CA 1R9QA 1SW2A 2R8TA 2DWJA 4QFOA 1DSNA 3KN7A 3DLNA 4HXVA 1MXYA 3N6TA 3HFUA 3R6UA 1MG1A 3TELA 5L9MA 2Y5LA 1JNFA 3IJOB 4MMPA 3O66A 1IITA 2OWZA 3DP6A 5EQ8A 5F7VA 3PPQA 3BIGA 4F3GA 2UVGA 5TU0A 1FQFA 2V25A 3CR9A 4GWZA 3K6WA 2F6GA 1UIVA 4I3YA 3TUSA 1B58A 2P3VA 2HAUA 4EUOA 2DVZA 4AB5A 1P1OA 5I7IA 5IKBA 1FW0A 1M5CA 1PC3A 2X7PA 1FBEA 4BDQA 5A5XA 4OFJA 5ISUA 2GHBA 4POXA 4X9TA 2UVHA 2FBPA 5I2NB 3EPEA 2XXHA 1SBPA 2Y7WA 4ESXA 4OMBA 3EHTA 2HQ0A 3OO9A 3SEUA 4QBAA 3RTWB 3HV1A 4R6KA 2QMXA 4EDPA 1A40A 3M8UA 2Y7PA 1JW4A 3U1OA 4IO7A 2F7BA 3TTLA 1IMDA 5F1QA 2Q88A 2CEXA 4U2RA 2XWKA 5AA3A 4F3SA 4KYSA 1DMBA 2Q74A 3T96B 3IFAA 3G3HA 3BKIB 3M3KA 4H8IA 4H5GA 5DW8A 4YB7A 2VPOA 1QJMA 1SI0A 4DI4B 3S9LC 4QRZA 2XXXA 1J1NA 1B46A 5HM4B 2I0BA 1AMFA 4EF1A 2DOJA 1Z7NE 4P8BA 3SKPA 3TTRA 4G4PA 1NUYA 3E13X 1PEBA 4FIMA 4HE2A 3I6VA 3RGYA 1IMFA 4YICA 2HEUA 2YPNA 3QUJA 3B7DA 5FTIA 2RF1A 5ITOA 2PT1A 1B0HA 1Q1KA 1Y3NA 2ZZWA 1DK4A 3PMVA 1P1WA 4IO6A 1AIVA 1LFIA 1FBCA 3IFCA 1RDZA 3MC2A 3O6IA 4O7MA 1ATGA 1JETA 4LZ5A 4I3EA 1MPBA 1Z7ME 4XKPA 3A09A 3FVKA 5DEXB 1OLCA 2CZHA 3PMWA 1MY4A 4KYEA 2O6AA 3KG2A 4K3FA 5CC2A 1FRPA 1LEVA 4XXUA 2AL4A 4JSOA 1IQ7A 3K4UA 4IO4A 2F78A 3HN0A 1NI9A 2D3IA 1FTAA 3MVXA 2CZIA 5AA2D 5H8QA 3PMXA 2ZMBA 4PAFA 1IZ1A 2XXKA 2GFEA 2H98A 1L5TA 1USYH 1FTLA 2HPGA 3SESA 1SI1A 1N84A 4OEVA 3KBRA 5IGAA 1VFEA 1VR5A 4DCXA 3V83A 4N81A 1R6ZA 1HSJA 1IXIA 4NF4B 3EHSA 4GWYA 2ALUA 1R1NA 4PAKA 4JSDA 1FJ6A 4PBQA 2A5TB 3IK6B 1EZ9A 4PFYA 4OFLA 4Q8RA 4IO3A 3MVYA 3TZAA 2R6GE 4WXJA 4WEDA 3NOHA 3KJTA 2OWTA 3BFUA 5ET8A 4LP2B 4RPOA 1XVYA 2FA7A 4OERA 1A8EA 2B4LA 1LB9A 4XKNA 3SEYA 3FXRA 2Z8DA 3MP6A 1G0IA 3MZ1A 3MZ9A 3V5AA 1UTHB 1N3XA 2ONKE 4R9FA 2XX8A 2WKYA 1SQYA 3KC0A 1MH3A 4M1VA 3E78A 4PE3A 1IXGA 3H4ZA 1FQAA 4JVCA 4MNIA 2PFYA 2D21A 1P1NA 4RXLA 3CFXA 3ZKKA 3C34A 4F1VA 4P3LA 1B4ZA 3LSLA 1YYZA 2P0SA 1KA1A 3E79A 4BDOA 4FEDA 2O7IA 5I57B 2ZZXA 2D5WA 3SETA 2NXOA 3UN6A 3S4UA 1NL5A 3KBZA 4H45A 5EHSA 3OOAA 4FAJA 2RC7A 2UYEA 3U65A 1IMEA 3F11A 5IAIA 4QSEA 2V3QA 4R6HA 3VLWA 3H6TA 4X8RA 1I6QA 3K01A 2Q2CA 2E0SA 4PAIA 2HAVA 4DXBA 1KWHA 3OENA 4H5FA 4AB6A 2WYKA 3UK4A 2QSXA 2WYPA 1Y1MA 3SEVA 2F36A 5M2VA 4PFRA 3FVOA 4XFEA 4OETA 4IGRA 1MY2A 5AE4A 1ZIUA 4YB6A 1NMUA 1MDP1 2RC8A 4RY1A 2QS4A 3SEXA 2PYYA 4EXKA 5IZZA 3I3VA 1MS7A 3IOWA 4P1EA 2AIXA 4NF5A 3PUXE 4OA4A 4I62A 4NX1A 4NQ8A 4N8YA 4PQJA 1F9BA 2I3VA 2WX9A 3UP9A 2R9JA 3H6VA 1NUWA 3FD3A 3OSQA 2DWAA 2L5VA 5CMMA 4UABA 1SPIA 4AQ4A 1M5FA 3FJ7A 2XWVA 4ELPA 2UXAA 1MPCA 1ZKBA 4JVDA 1LBCA 3W15C 1Q35A 2NUVA 3VVEA 5ESYA 3LSWA 4PFBA 5CI5A 3FXBA 1WODA 1URDA 4OVPA 4ZEDA 5EQ9A 3G3GA 4X1DA 2Z23A 3KEIA 1EZPA 1FPGA 3P7IA 1AOVA 3G3JA 1N3WA 3SDFA 2PT2A 4YAHX 2Q8MA 1A7LA 4G2ZA 1QULA 5BUUA 1FBDA 1NFTA 4MAGA 4IB2A 2ZNTA 4RA1A 4ZEIA 4O3CA 3FXQA 2HZKA 4I1DA 1GVCA 2REGA 3OO8A 4Z0IA 4F3PA 2V3TA 3LBSA 3BIHA 3N26A 5A5XB 4ESWA 4TQUQ 4N6PA 4KPTA 3EKIA 1A54A 4GL8A 2OWSA 4GXSB 3VV5A 3K1PA 1ZMGA 3RPLB 4ND9A 3LUYA 4H1XA 3FASA 1M5EA 2REJA 5FTHA 1NH7A 3TYHA 1SYIA 3K1NA 3JZJA 4MX6A 5AA4B 3K6UA 3C33A 2QPQA 2P1SA 3TODA 4GQOA 1XI6A 2OZZA 1MQGA 2R71A 3PPNA 4OVJA 1FBHA 1PBPA 1LBZA 2F7AA 3FJGA 2JJKA 4JWXA 1YCJA 2V4CA 4GWWA 4WEPA 5FBPA 1BK4A 1NNTA 5DYHA 1NV2A 3T66A 3IO6A 4IY6A 4YU0A 4BDRA 3PTYA 4BDLA 1DTZA 3WAFA 1LFGA 4DI3D 5ITPA 1LBYA 4LONB 2XX7A 3TQWA 1B0LA 4RPNA 4X48A 3A29A 5H8QB 3TMGA 3MVWA 1XC1A 5CMCA 1QUIA 3C31A 5K2YA 3IB2A 4JXIA 2KQZA 3K6VA 3T0JA 3D4CA 1UTBA 5F24A 1N04A 4OQOA 2ZYMA 1MH4A 1JVXA 4LQ2A 1D3KA 1RDYA 3CIJA 4Z7EA 3DM0A 4F2OA 1MQHA 3PD9A 3K2DA 5B70A 2VP1A 2XXTA 3VXCA 4BDMA 4KR5A 1MQJA 4IO5A 4PFUA 4HCWA 3PGFA 1II5A 3PUZE 4KQPA 4DIGA 1WDNA 3QXMA 4GOTA 2XXVA 4MHFA 1YZ0A 3VXBA 4OVSA 1FBGA 4GX4A 4MCOA 1OIBA 1NV1A 4P9KA 3U94A 2GH9A 1CE2A 3UA8A 4G8MA 3TFLA 2KR0A 4NF6A 4MLQA 3DP4A 1MQIA 3ODBA 1QUKA 4L17A 5I2NA 2GQ1A 4R9GA 5L9SA 3FBPA 2I4BA 1DOTA 3T9VA 4N07A 2B3BA 1RKMA 3TCHA 1Y1ZA 4HE0A 1FBPA 2PCRA 2DYXA 4PFIA 4JVIA 4N8GA 2I49A 4XIGQ 5JK4A 3A3CA 5ICTA 4N15A 1KA0A 4FEBA 4O94A 1ZBMA 1QKBA 1AH5A 3B8BA 1SDXA 3ZSFA 3MZBA 3PUWE 1MXZA 3BFTA 2XXYA 4QFNA 2HHMA 4AS4A 4G68B 1ANFA 1MM7A 4GFRA 2DE2A 2VT5A 2CZKA 4ZZEA 2QFLA 4GL0A 3QMFA 3D1RA 3FVGA 3H06B 3FJMA 5I84A 2X26A 4PE5B 1NV7A 1B5IA 1B32A 3FGSA 2ONRA 1ZJLA 3MPKA 5HBCA 4UACA 1VFDA 2PMSA 4ELOA 2CEYA 4RJZA 4NWCA 3H6UA 2THIA 2VPNA 4F29A 4RNSA 5FHOA 4QSCA 4R6YA 3IOUA 4PGPA 5IZ1A 4X1BA 3IL1B 1NNKA 4O8MA 4ZEFA 5IM2A 1NH8A 4QFLA 2V3UA 1FQCA 3H7MA 3N5LA 2PX1A 2B4MA 2OX3A 3Q29A 1H43A 1B5JA 4NAPA 1UTHA 1B6HA 5T3JA 5FHMA 1XOCA 5AA4A 4P0GA 4H65A 3C36A 4P1LA 3RY3A 3Q25A 3M3LA 3T9UA 3W9WA 1SW4A 4NWDA 1VSOA 2DDKA 2LAOA 1N76A 1UTBB 2DVCA 3KSJA 4R74A 3CFLA 4U1ZA 2QVUA 4X04A 1A55A 1MXXA 3B50A 1CNQA 3OELA 1IUDA 2ZNUA 5TP9B 3QSLA 4JBZA 3IX1A 2AL5A 1O63A 4LQ5A 4OYVA 3HPIA 3OSRA 2CZLA 3TPAA 3U92A 1JEVA 1B05A 4G61A 4P56A 1QW0A 2PVUA 4NF8B 1IXHA 4JWOA 3CSBA 4KCCA 5IZ3B 4C1TA 2MKZA 1FQDA 4F19A 4FECA 4NF8A 3KFMA 5I57A 1BTJA 3O97A 5DVFA 4OEUA 4R72A 5AA2A 4F2QA 2GRVA 2O51A 1EYJA 2Q89A 4GF8A 1IMCA 3TTMA
chains in the Genus database with same CATH topology
1SW2A 2DWJA 3OO7A 3G7WA 5TPAB 4QFOA 3LSWA 5CI5A 3TTNA 5JEIA 1IIWA 1DSNA 4KHZE 4F31B 3KN7A 1B3HA 3DLNA 3T9HB 2O69A 1MXYA 2AYSA 1B7HA 3OO6A 1WODA 4O3AA 1URDA 3LR1A 3N6TA 4RYAA 4EQ9A 4ZEDA 3R6UA 2UYFA 1MG1A 4ZEKA 3G3GA 4IY5A 4X1DA 5DEXA 3TELA 3GBBA 5L9MA 1B9JA 2Z23A 3KEIA 1XVXA 1JNFA 2GHAA 3IJOB 3VLUA 1EZPA 2I6EA 1NNPA 4OWDA 3D4GA 3IOVA 3P7IA 3O66A 4HCYA 1AOVA 1IITA 1NKXA 2RINA 3DP6A 3G3JA 5F7VA 3PPQA 1N3WA 1Y20A 2A5TA 3RPWA 1P1UA 4F3GA 2UVGA 2Y7RA 5TU0A 1FQFA 2V25A 3SDFA 5CBRA 2QS1A 2PT2A 1B3EA 3CRBA 3CR9A 4QFKA 4NF5B 4R75A 2DSFA 3GZGA 4YAHX 3K6WA 2F6GA 1DPEA 4ZS9A 1UIVA 3TUSA 1B58A 2HAUA 4EUOA 2DVZA 1A7LA 1RYOA 1QULA 1SW1A 1POY1 4G2ZA 3K1MA 5CRYA 4AB5A 5BUUA 1NFTA 3Q28A 3AXFA 1P1OA 4GWOA 1BIYA 3L6HA 3RLFE 2UVJA 4IB2A 2ZNTA 4IO2A 4RA1A 4ZEIA 5TP9A 2X7QA 5IKBA 1FW0A 1M5CA 1PC3A 4KCDA 2X7PA 4BDQA 5A5XA 5CM6A 4OFJA 4O3CA 5ISUA 3FXQA 1FQBA 2GHBA 2HZKA 3A3UA 4I1DA 2ZYNA 2UVHA 1JW5A 1US4A 4POXA 1JVYA 1JW1A 2REGA 4PFTA 3OO8A 5I2NB 3C4MA 1SW5A 3E3KA 4Z0IA 3CI8A 3FATA 3EPEA 3WAEA 2XXHA 2V3TA 1SBPA 3LBSA 4F3PA 2IA4A 3DELB 2Y7WA 3K00A 3N26A 2XXIA 5A5XB 4NEDA 4MF3A 1YTVA 2O1LA 3PD8A 3ZS6A 3E9XA 4ESWA 4TQUQ 1GR2A 4F22A 4POWA 1LCFA 4ESXA 3L6GA 1LAGE 1GTKA 2XX9A 3EHTA 4OMBA 2IEEA 4N6PA 4LVQA 1PDAA 3IAZA 2HQ0A 3H6WA 1Y4CA 2F34A 4KPTA 4YKPA 2XXPA 1A54A 3OO9A 4GL8A 4U4SA 1UIUA 2OWSA 1XHYA 4GXSB 3SEUA 3RTWB 3VV5A 4FJPA 3FV2A 3K1PA 4ELRA 1GGGA 3IR1A 3HV1A 3UORA 4R6KA 3CG3A 2QMXA 4EDPA 2E1SA 1ZMGA 1A40A 1Y4TA 1I69A 4QF9A 3VE1B 4ND9A 3LUYA 1MY1A 3M8UA 2Y7PA 1JW4A 3FASA 2RC9A 1M5EA 3PV0E 2F7BA 4H1XA 3FVNA 2REJA 4IO7A 5FTHA 3TTLA 4H0WA 1NH7A 3TYHA 2O7UA 5F1QA 2Q88A 2XXWA 2P2AA 4U2RA 1SYIA 3QYTA 5AA3A 3K1NA 3JZJA 2XXQA 4F3SA 5AA4B 4KYSA 1DMBA 3K6UA 3ONMA 5DVJA 2F35A 2H25A 3T96B 2ANJA 1JQFA 5TPAA 2BJJX 1B40A 3C33A 3MPLA 1Y3PA 2ESNA 4G77A 2QPQA 2P1SA 3KOTA 3TODA 4GQOA 4DE8A 2VD2A 3C32A 3G3HA 1URSA 3K02A 2OZZA 3BKIB 3ILTB 3M3KA 4H8IA 4H5GA 1USYE 3TKDA 4DZ1A 1MQGA 4XKQA 2R71A 3PPNA 3JYRA 4OVJA 1PBPA 4EF2A 1FTMA 2HZLA 4YB7A 2F7AA 1LSTA 3CSGA 2XD3A 3FJGA 4MH5A 4YZZA 2H99A 1QJMA 1SI0A 5ICQA 4JWXA 3S9LC 4Q30B 4YKJA 4QRZA 1POTA 1J1NA 1FTOA 1YCJA 1EH3A 1B46A 2XXXA 5H8NA 3V89B 4WEPA 4EQBA 1B51A 3MJNA 4ELQA 2CMOA 2Y7KA 3IB0A 4GRKA 5H8HA 3QAXA 5HM4B 5I59B 4U1OA 3RNNA 1MXVA 1OLAA 2I0BA 3T93B 1AMFA 4EF1A 1NNTA 1SVXB 1I6AA 3LSXA 2DOJA 4X9TA 5DYHA 5FHNA 4TOZA 3T66A 1Z7NE 1SD3A 3PPPA 2I0CA 1MY0A 2YJPA 4M4GA 5DT6A 3IO6A 1EZOA 4IY6A 3SKPA 3QK6A 2F8DA 3JV9A 3TTRA 4GLIA 4FE8A 3VLVA 1HSEA 4EXLA 3E4RA 4YU0A 4G4PA 2QJEA 4BDRA 3EHUA 3QIMA 4BDLA 1DTZA 3E13X 3WAFA 1PEBA 2UVIA 4PETA 4FIMA 1LFGA 2HCAA 3T22A 3S9NC 3I6VA 3HSTA 2DWHA 1B1XA 3GBAA 2H4IA 2VOZA 5ITPA 3RGYA 1N0TA 3MWBA 4JDFA 4LA9A 4ZE9A 4LONB 4ONYA 1IXCA 1O7TA 1ZU0A 3T9XB 2XX7A 4QFPA 2HEUA 2ZNSA 4YICA 1P99A 2YPNA 3THIA 3TQWA 1B2HA 3QUJA 1MXUA 1B0LA 1M5DA 1TT1A 3B7DA 4RK2A 4RPNA 1JEUA 3MP8A 4X48A 4PP0A 3G3FA 5FTIA 2RF1A 2XXRA 3R26A 3KN8A 5H8QB 5ITOA 3OD7A 2PT1A 5EYFA 1B0HA 3PUVE 3TMGA 3MVWA 1Q1KA 1XC1A 5CMCA 1QUIA 3C31A 5K2YA 1Y3NA 3IB2A 4JXIA 3W9VA 1B3GA 3K6VA 3PMVA 3D4CA 1UTBA 3IORA 4LUBA 4R73A 3SERA 1N04A 1P1WA 3O9PA 4IO6A 3I5OA 2ONSA 4OQOA 1AIVA 1LFIA 2ZYMA 1P1QA 1MH4A 1JVXA 4LQ2A 4OXVA 2RCAA 1D3KA 3MC2A 2O1MA 3O6IA 3CIJA 3N94A 4Z7EA 2O84X 1ATGA 3PU5A 3DM0A 5JTYB 3KSXA 1JETA 2ZYKA 1B3LA 4LZ5A 1MQHA 3RT8A 1MPBA 2A5SA 3PD9A 4F2OA 1M5BA 5I58B 1MPDA 3K2DA 4MBPA 1LB8A 1Z7ME 4KFQA 4XKPA 4H67A 5B70A 3A09A 3H3GA 2QRYA 3IJXB 2VP1A 2XXTA 4YMAA 3VXCA 4BDMA 4KR5A 1WVJA 1MQJA 1S7YA 3FVKA 4IO5A 4P11A 5DEXB 3QUFA 5KCJB 1N7XA 1OLCA 2QS2A 3DP8A 4O3BA 4PFWA 1URGA 5J1DA 3PMWA 1D9YA 1MY4A 2O6AA 4KYEA 4PFUA 3TDJA 4HCWA 3PGFA 1II5A 3PUZE 3KG2A 3MW0A 4KQPA 3S9EA 4DIGA 5L8DA 1MQDA 4OZ9A 3CFZA 3LC8A 3B6WA 3C35A 3IB1A 1WDNA 4K3FA 5CC2A 3QXMA 4GOTA 4QHQA 2XXVA 3CVGA 4ZEBA 1OQHA 4GD5A 3VXBA 2Q9TA 3RQTA 3PPOA 5LOMA 1B52A 3TCFA 4KYDA 4XXUA 2AL4A 5H8NB 3GLBA 1OIBA 4JSOA 1IQ7A 3K4UA 4G68A 4YKKA 4IO4A 2F78A 3HN0A 4U22A 3U94A 1MRPA 2GH9A 4RK9A 4DDDA 1CE2A 2D3IA 4MLVA 1RYXA 1Y3QA 3UA8A 4G8MA 3TFLA 3MVXA 5AA2D 1PBQA 1OMPA 3PMXA 2ZMBA 4MLQA 4NF6A 5H8QA 3DP4A 4JB7A 1MQIA 2YLNA 2FNCA 5KZTA 3ODBA 4LZ8A 1IZ1A 2NVUB 1MM6A 1QUKA 2GFEA 2H98A 4FORA 5H8FB 1L5TA 1USYH 4EQ7A 1FTLA 4NF4A 5EHMA 3U1OA 3SESA 1SI1A 4L17A 2DWIA 3U72A 5I2NA 4DXCA 3TAJA 1N84A 4OEVA 3KBRA 4R9GA 3OEMA 5I2KA 1VFEA 5L9SA 1VR5A 1VE4A 4OHNA 2I4BA 2OBGA 4DCXA 2NWJA 3V83A 1DOTA 3T9VA 3ILUB 4FATA 1LAHE 1R6ZA 1B7ZA 1HSJA 1IXIA 3C9HA 4NF4B 4U4XA 3RUMA 4N07A 3U8QA 5I58A 3EHSA 3MQ9A 2B3BA 1RKMA 3TCHA 1Y1ZA 3LSFB 2ALUA 1R1NA 4GIZA 4JSDA 1BP5A 1TWYA 3FUZA 5I59A 2VD3A 1A99A 2DYXA 4XKRA 2I49A 3GXAA 2A5TB 2H5YA 2KLFA 3IK6B 3O6HA 3U93A 1EZ9A 2OK2A 4OFLA 1YAEA 2V84A 1YPNA 4PFYA 2Z22A 4Q8RA 4XIGQ 5JK4A 3FV1A 1O64A 3A3CA 4YMBA 5ICTA 1XS5A 3MVYA 1B4HA 3OEKA 4IO3A 4R2BA 3TZAA 2I4CA 5I56B 2R6GE 4F1YA 4WXJA 4WEDA 2QL3A 2VGQA 3ECRA 2Z8EA 3KOSA 4FEBA 4NTLA 1ZBMA 4WKMA 5H8HB 1QKBA 2ZXTA 2DE4A 3KJTA 1LBBA 2OWTA 3BFUA 1LLSA 4TLLB 1AH5A 2ABHA 3HCQA 4LP2B 4KI0E 4RPOA 1SDXA 1XVYA 3ZSFA 2FA7A 4I8CA 3MZBA 4NMYA 4OENA 3VVDA 2F6PA 4H8JA 1A8EA 4HTGA 2RKMA 3PUWE 4OERA 4F18A 1MXZA 3M3FA 3MBPA 3BFTA 2XXYA 4LATA 4QFNA 1LB9A 4G68C 4XKNA 2DXRA 4G68B 3SEYA 1BKAA 5B7DA 1ANFA 3FXRA 2Z8DA 3MP6A 1MM7A 3MZ1A 3MZ9A 2HXWA 4GFRA 2DE2A 4ZZEA 3V5AA 1UTHB 1N3XA 2XXUA 2ONKE 4GL0A 4R9FA 3FVGA 2XX8A 3H06B 3O2AA 2WKYA 3B6TA 1I6BA 1SQYA 3FJMA 3UIFA 5H8FA 4H6DA 5CBSA 5I84A 2X26A 4MFIA 4PE5B 1MH3A 3EN3A 4M1VA 4ZZAA 3O28A 3G3IA 1B5IA 2XHDA 1B32A 4LZ7A 3FGSA 4IGTA 1QUJA 4Q5TA 4G8HA 1T0KA 1MDQA 2G29A 3MVZA 1IXGA 3H4ZA 1FTKA 4F3BA 4ZECA 4HW8A 3RTFB 2ONRA 1ZJLA 4JWYA 1FQAA 1CB6A 1S50A 4GXAA 5I2KB 4ECFA 5CMKA 2D21A 1P1NA 2DQVA 2I3WA 3CFXA 3O29A 1FTJA 1TFDA 3Q27A 4RXLA 3MPKA 3MAMA 2QMWA 4ISUA 3ZKKA 3S9MC 2F97A 5HBCA 4UACA 5BWJA 4G8NA 1VFDA 3C34A 4NF6B 2PMSA 3HHGA 4ELOA 4F1VA 2G93A 4RJZA 1LGBC 2W7YA 3H03A 5H8SA 5KDTB 1EU8A 4NWCA 3H6UA 1B4ZA 2THIA 3LSLA 5DVIA 4DLDA 2QS3A 3VFJA 4GF8A 4F29A 4BLAA 3IO4A 4RNSA 5FHOA 3RN8A 4QSCA 2Q8JA 4R6YA 1H45A 3IOUA 3ZKLA 4BDNA 5I56A 2H9BA 2P0SA 4X1BA 3IL1B 1DPPA 1NNKA 4BDOA 1NNFA 1HSLA 1H76A 2O7IA 4FEDA 4OESA 4P0IA 5I57B 2D5WA 3V8XB 4ZEFA 2NXOA 3SETA 4E0WA 2I48A 3UN6A 3S4UA 2B3FA 1OQGA 1NH8A 1NL5A 4QFLA 5AA2B 1GV8A 2V3UA 5EHSA 1FQCA 3TEPA 4KD5A 3H7MA 3OOAA 4UA8A 1UQWA 1LAXA 4FAJA 2RC7A 2UYEA 3N5LA 2PX1A 3F11A 1B7UA 3EF7A 5IAIA 4QSEA 3N6UA 2I58A 3VVFA 1H44A 4U21A 3KN3A 2V3QA 1D4NA 1R9LA 4R6HA 4YB5A 1IEJA 3Q29A 3VLWA 1H43A 1B5JA 4N13A 2OJTA 1MXWA 3H6TA 3IOTA 3Q26A 4DCYA 1UTHA 1B6HA 5FHMA 1I6QA 1OVBA 2Q2CA 1XOCA 2E0SA 2M8CA 3K01A 4R2FA 3TTKA 5AA4A 2HAVA 4P0GA 1FQEA 1H3DA 4H65A 1D9VA 4DXBA 1BLFA 3K6XA 1KWHA 3C36A 3OENA 4H5FA 3RY3A 1OVTA 4AB6A 4F39A 1LAFE 1DTGA 3BBRA 3TCGA 3UK4A 4YKIA 3VDFA 2QSXA 2Y84A 3Q25A 2OLBA 5K2XA 1Y1MA 2F36A 3SEVA 1S9TA 3M3LA 1B3FA 4THIA 3O6GA 5M2VA 2Z8FA 2ZYOA 3T9UA 4OTEA 5DTBA 3FVOA 4ZE8A 1SW4A 2O68A 4NWDA 3W9WA 1VSOA 3HHFA 1B1HA 2LAOA 1N76A 3MP1A 1UTBB 3OXNA 4OETA 4IGRA 1MY2A 5AE4A 2DVCA 1ZIUA 4YB6A 1PB7A 2DXYA 1NMUA 3CG1A 3USDA 1US5A 3KGCA 3KSJA 4R74A 5KDTA 3S2VA 1MDP1 2XD2A 2V93A 2RC8A 3CFLA 4RY1A 4U1ZA 3FIRA 3K0VA 2QS4A 3SEWA 3SEXA 1A55A 5HPQA 2PYYA 1B5HA 2DP8A 1MXXA 3OELA 4I9DA 3HO7A 4EXKA 1IUDA 2ZNUA 3OMBA 3FXUA 3PUYE 5TP9B 1TXFA 1MY3A 3QSLA 4JBZA 3I3VA 4QSDA 1A8FA 1PB8A 1MS7A 3PPRA 3KJ7A 1Y9UA 3IOWA 1FCKA 3IX1A 4DXUA 2NOOA 2AL5A 2AIXA 4NF5A 1QKAA 1O63A 2PBWA 4OFOA 3B6QA 5KCJA 5L9OA 4LQ5A 3PUXE 4OYVA 4GVOA 3HPIA 3OSRA 4Q0CA 4I62A 1AL3A 2CZLA 1PB9A 1SYHA 5CMBA 3TPAA 2F7CA 4E0XA 5JTYA 2HFBA 1JEVA 3U92A 1B05A 4C1UA 2RCBA 3KZGA 1LCTA 4PQJA 3TQLA 1F9BA 1N7WA 1XT8A 2B65A 2I3VA 3UP9A 4C0RA 1LFHA 1QW0A 2PVUA 2R9JA 3FD3A 3H6VA 4NF8B 3R7XA 2VHAA 1GVCA 1IXHA 4JWOA 3CSBA 5ELVA 3OSQA 4KCCA 2DWAA 2DE3A 3EQ1A 3UGWA 4XTCQ 1ZLQA 4C1TA 2F5XA 2Y7IA 2FYIA 2DS9A 1TFAA 3FZVA 3MUQA 1FQDA 5CMMA 4FECA 4F19A 4NF8A 3KFMA 4F1UA 5I57A 1ELJA 1M5FA 1BTJA 1QVSA 3FJ7A 3O97A 2UXAA 5DVFA 5AA1A 4AQ4A 3G3KA 4ELPA 4OEUA 4R72A 4HS7A 2Q2AA 4NE4A 4F2QA 5AA2A 1ZKBA 2GRVA 1LBCA 2O51A 3W15C 4ZDMA 1Q35A 2Q89A 4TLMB 1ZTYA 2NUVA 2OCUA 4U23A 3RT6B 3VVEA 1MPCA 1R9QA 3TTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SW2 A;  2DWJ A;  3OO7 A;  3G7W A;  5TPA B;  4QFO A;  3LSW A;  5CI5 A;  3TTN A;  5JEI A;  1IIW A;  1DSN A;  4KHZ E;  4F31 B;  3KN7 A;  1B3H A;  3DLN A;  3T9H B;  2O69 A;  1MXY A;  2AYS A;  1B7H A;  3OO6 A;  1WOD A;  4O3A A;  1URD A;  3LR1 A;  3N6T A;  4RYA A;  4EQ9 A;  4ZED A;  3R6U A;  2UYF A;  1MG1 A;  4ZEK A;  3G3G A;  4IY5 A;  4X1D A;  5DEX A;  3TEL A;  3GBB A;  5L9M A;  1B9J A;  2Z23 A;  3KEI A;  1XVX A;  1JNF A;  2GHA A;  3IJO B;  3VLU A;  1EZP A;  2I6E A;  1NNP A;  4OWD A;  3D4G A;  3IOV A;  3P7I A;  3O66 A;  4HCY A;  1AOV A;  1IIT A;  1NKX A;  2RIN A;  3DP6 A;  3G3J A;  5F7V A;  3PPQ A;  1N3W A;  1Y20 A;  2A5T A;  3RPW A;  1P1U A;  4F3G A;  2UVG A;  2Y7R A;  5TU0 A;  1FQF A;  2V25 A;  3SDF A;  5CBR A;  2QS1 A;  2PT2 A;  1B3E A;  3CRB A;  3CR9 A;  4QFK A;  4NF5 B;  4R75 A;  2DSF A;  3GZG A;  4YAH X;  3K6W A;  2F6G A;  1DPE A;  4ZS9 A;  1UIV A;  3TUS A;  1B58 A;  2HAU A;  4EUO A;  2DVZ A;  1A7L A;  1RYO A;  1QUL A;  1SW1 A;  1POY 1;  4G2Z A;  3K1M A;  5CRY A;  4AB5 A;  5BUU A;  1NFT A;  3Q28 A;  3AXF A;  1P1O A;  4GWO A;  1BIY A;  3L6H A;  3RLF E;  2UVJ A;  4IB2 A;  2ZNT A;  4IO2 A;  4RA1 A;  4ZEI A;  5TP9 A;  2X7Q A;  5IKB A;  1FW0 A;  1M5C A;  1PC3 A;  4KCD A;  2X7P A;  4BDQ A;  5A5X A;  5CM6 A;  4OFJ A;  4O3C A;  5ISU A;  3FXQ A;  1FQB A;  2GHB A;  2HZK A;  3A3U A;  4I1D A;  2ZYN A;  2UVH A;  1JW5 A;  1US4 A;  4POX A;  1JVY A;  1JW1 A;  2REG A;  4PFT A;  3OO8 A;  5I2N B;  3C4M A;  1SW5 A;  3E3K A;  4Z0I A;  3CI8 A;  3FAT A;  3EPE A;  3WAE A;  2XXH A;  2V3T A;  1SBP A;  3LBS A;  4F3P A;  2IA4 A;  3DEL B;  2Y7W A;  3K00 A;  3N26 A;  2XXI A;  5A5X B;  4NED A;  4MF3 A;  1YTV A;  2O1L A;  3PD8 A;  3ZS6 A;  3E9X A;  4ESW A;  4TQU Q;  1GR2 A;  4F22 A;  4POW A;  1LCF A;  4ESX A;  3L6G A;  1LAG E;  1GTK A;  2XX9 A;  3EHT A;  4OMB A;  2IEE A;  4N6P A;  4LVQ A;  1PDA A;  3IAZ A;  2HQ0 A;  3H6W A;  1Y4C A;  2F34 A;  4KPT A;  4YKP A;  2XXP A;  1A54 A;  3OO9 A;  4GL8 A;  4U4S A;  1UIU A;  2OWS A;  1XHY A;  4GXS B;  3SEU A;  3RTW B;  3VV5 A;  4FJP A;  3FV2 A;  3K1P A;  4ELR A;  1GGG A;  3IR1 A;  3HV1 A;  3UOR A;  4R6K A;  3CG3 A;  2QMX A;  4EDP A;  2E1S A;  1ZMG A;  1A40 A;  1Y4T A;  1I69 A;  4QF9 A;  3VE1 B;  4ND9 A;  3LUY A;  1MY1 A;  3M8U A;  2Y7P A;  1JW4 A;  3FAS A;  2RC9 A;  1M5E A;  3PV0 E;  2F7B A;  4H1X A;  3FVN A;  2REJ A;  4IO7 A;  5FTH A;  3TTL A;  4H0W A;  1NH7 A;  3TYH A;  2O7U A;  5F1Q A;  2Q88 A;  2XXW A;  2P2A A;  4U2R A;  1SYI A;  3QYT A;  5AA3 A;  3K1N A;  3JZJ A;  2XXQ A;  4F3S A;  5AA4 B;  4KYS A;  1DMB A;  3K6U A;  3ONM A;  5DVJ A;  2F35 A;  2H25 A;  3T96 B;  2ANJ A;  1JQF A;  5TPA A;  2BJJ X;  1B40 A;  3C33 A;  3MPL A;  1Y3P A;  2ESN A;  4G77 A;  2QPQ A;  2P1S A;  3KOT A;  3TOD A;  4GQO A;  4DE8 A;  2VD2 A;  3C32 A;  3G3H A;  1URS A;  3K02 A;  2OZZ A;  3BKI B;  3ILT B;  3M3K A;  4H8I A;  4H5G A;  1USY E;  3TKD A;  4DZ1 A;  1MQG A;  4XKQ A;  2R71 A;  3PPN A;  3JYR A;  4OVJ A;  1PBP A;  4EF2 A;  1FTM A;  2HZL A;  4YB7 A;  2F7A A;  1LST A;  3CSG A;  2XD3 A;  3FJG A;  4MH5 A;  4YZZ A;  2H99 A;  1QJM A;  1SI0 A;  5ICQ A;  4JWX A;  3S9L C;  4Q30 B;  4YKJ A;  4QRZ A;  1POT A;  1J1N A;  1FTO A;  1YCJ A;  1EH3 A;  1B46 A;  2XXX A;  5H8N A;  3V89 B;  4WEP A;  4EQB A;  1B51 A;  3MJN A;  4ELQ A;  2CMO A;  2Y7K A;  3IB0 A;  4GRK A;  5H8H A;  3QAX A;  5HM4 B;  5I59 B;  4U1O A;  3RNN A;  1MXV A;  1OLA A;  2I0B A;  3T93 B;  1AMF A;  4EF1 A;  1NNT A;  1SVX B;  1I6A A;  3LSX A;  2DOJ A;  4X9T A;  5DYH A;  5FHN A;  4TOZ A;  3T66 A;  1Z7N E;  1SD3 A;  3PPP A;  2I0C A;  1MY0 A;  2YJP A;  4M4G A;  5DT6 A;  3IO6 A;  1EZO A;  4IY6 A;  3SKP A;  3QK6 A;  2F8D A;  3JV9 A;  3TTR A;  4GLI A;  4FE8 A;  3VLV A;  1HSE A;  4EXL A;  3E4R A;  4YU0 A;  4G4P A;  2QJE A;  4BDR A;  3EHU A;  3QIM A;  4BDL A;  1DTZ A;  3E13 X;  3WAF A;  1PEB A;  2UVI A;  4PET A;  4FIM A;  1LFG A;  2HCA A;  3T22 A;  3S9N C;  3I6V A;  3HST A;  2DWH A;  1B1X A;  3GBA A;  2H4I A;  2VOZ A;  5ITP A;  3RGY A;  1N0T A;  3MWB A;  4JDF A;  4LA9 A;  4ZE9 A;  4LON B;  4ONY A;  1IXC A;  1O7T A;  1ZU0 A;  3T9X B;  2XX7 A;  4QFP A;  2HEU A;  2ZNS A;  4YIC A;  1P99 A;  2YPN A;  3THI A;  3TQW A;  1B2H A;  3QUJ A;  1MXU A;  1B0L A;  1M5D A;  1TT1 A;  3B7D A;  4RK2 A;  4RPN A;  1JEU A;  3MP8 A;  4X48 A;  4PP0 A;  3G3F A;  5FTI A;  2RF1 A;  2XXR A;  3R26 A;  3KN8 A;  5H8Q B;  5ITO A;  3OD7 A;  2PT1 A;  5EYF A;  1B0H A;  3PUV E;  3TMG A;  3MVW A;  1Q1K A;  1XC1 A;  5CMC A;  1QUI A;  3C31 A;  5K2Y A;  1Y3N A;  3IB2 A;  4JXI A;  3W9V A;  1B3G A;  3K6V A;  3PMV A;  3D4C A;  1UTB A;  3IOR A;  4LUB A;  4R73 A;  3SER A;  1N04 A;  1P1W A;  3O9P A;  4IO6 A;  3I5O A;  2ONS A;  4OQO A;  1AIV A;  1LFI A;  2ZYM A;  1P1Q A;  1MH4 A;  1JVX A;  4LQ2 A;  4OXV A;  2RCA A;  1D3K A;  3MC2 A;  2O1M A;  3O6I A;  3CIJ A;  3N94 A;  4Z7E A;  2O84 X;  1ATG A;  3PU5 A;  3DM0 A;  5JTY B;  3KSX A;  1JET A;  2ZYK A;  1B3L A;  4LZ5 A;  1MQH A;  3RT8 A;  1MPB A;  2A5S A;  3PD9 A;  4F2O A;  1M5B A;  5I58 B;  1MPD A;  3K2D A;  4MBP A;  1LB8 A;  1Z7M E;  4KFQ A;  4XKP A;  4H67 A;  5B70 A;  3A09 A;  3H3G A;  2QRY A;  3IJX B;  2VP1 A;  2XXT A;  4YMA A;  3VXC A;  4BDM A;  4KR5 A;  1WVJ A;  1MQJ A;  1S7Y A;  3FVK A;  4IO5 A;  4P11 A;  5DEX B;  3QUF A;  5KCJ B;  1N7X A;  1OLC A;  2QS2 A;  3DP8 A;  4O3B A;  4PFW A;  1URG A;  5J1D A;  3PMW A;  1D9Y A;  1MY4 A;  2O6A A;  4KYE A;  4PFU A;  3TDJ A;  4HCW A;  3PGF A;  1II5 A;  3PUZ E;  3KG2 A;  3MW0 A;  4KQP A;  3S9E A;  4DIG A;  5L8D A;  1MQD A;  4OZ9 A;  3CFZ A;  3LC8 A;  3B6W A;  3C35 A;  3IB1 A;  1WDN A;  4K3F A;  5CC2 A;  3QXM A;  4GOT A;  4QHQ A;  2XXV A;  3CVG A;  4ZEB A;  1OQH A;  4GD5 A;  3VXB A;  2Q9T A;  3RQT A;  3PPO A;  5LOM A;  1B52 A;  3TCF A;  4KYD A;  4XXU A;  2AL4 A;  5H8N B;  3GLB A;  1OIB A;  4JSO A;  1IQ7 A;  3K4U A;  4G68 A;  4YKK A;  4IO4 A;  2F78 A;  3HN0 A;  4U22 A;  3U94 A;  1MRP A;  2GH9 A;  4RK9 A;  4DDD A;  1CE2 A;  2D3I A;  4MLV A;  1RYX A;  1Y3Q A;  3UA8 A;  4G8M A;  3TFL A;  3MVX A;  5AA2 D;  1PBQ A;  1OMP A;  3PMX A;  2ZMB A;  4MLQ A;  4NF6 A;  5H8Q A;  3DP4 A;  4JB7 A;  1MQI A;  2YLN A;  2FNC A;  5KZT A;  3ODB A;  4LZ8 A;  1IZ1 A;  2NVU B;  1MM6 A;  1QUK A;  2GFE A;  2H98 A;  4FOR A;  5H8F B;  1L5T A;  1USY H;  4EQ7 A;  1FTL A;  4NF4 A;  5EHM A;  3U1O A;  3SES A;  1SI1 A;  4L17 A;  2DWI A;  3U72 A;  5I2N A;  4DXC A;  3TAJ A;  1N84 A;  4OEV A;  3KBR A;  4R9G A;  3OEM A;  5I2K A;  1VFE A;  5L9S A;  1VR5 A;  1VE4 A;  4OHN A;  2I4B A;  2OBG A;  4DCX A;  2NWJ A;  3V83 A;  1DOT A;  3T9V A;  3ILU B;  4FAT A;  1LAH E;  1R6Z A;  1B7Z A;  1HSJ A;  1IXI A;  3C9H A;  4NF4 B;  4U4X A;  3RUM A;  4N07 A;  3U8Q A;  5I58 A;  3EHS A;  3MQ9 A;  2B3B A;  1RKM A;  3TCH A;  1Y1Z A;  3LSF B;  2ALU A;  1R1N A;  4GIZ A;  4JSD A;  1BP5 A;  1TWY A;  3FUZ A;  5I59 A;  2VD3 A;  1A99 A;  2DYX A;  4XKR A;  2I49 A;  3GXA A;  2A5T B;  2H5Y A;  2KLF A;  3IK6 B;  3O6H A;  3U93 A;  1EZ9 A;  2OK2 A;  4OFL A;  1YAE A;  2V84 A;  1YPN A;  4PFY A;  2Z22 A;  4Q8R A;  4XIG Q;  5JK4 A;  3FV1 A;  1O64 A;  3A3C A;  4YMB A;  5ICT A;  1XS5 A;  3MVY A;  1B4H A;  3OEK A;  4IO3 A;  4R2B A;  3TZA A;  2I4C A;  5I56 B;  2R6G E;  4F1Y A;  4WXJ A;  4WED A;  2QL3 A;  2VGQ A;  3ECR A;  2Z8E A;  3KOS A;  4FEB A;  4NTL A;  1ZBM A;  4WKM A;  5H8H B;  1QKB A;  2ZXT A;  2DE4 A;  3KJT A;  1LBB A;  2OWT A;  3BFU A;  1LLS A;  4TLL B;  1AH5 A;  2ABH A;  3HCQ A;  4LP2 B;  4KI0 E;  4RPO A;  1SDX A;  1XVY A;  3ZSF A;  2FA7 A;  4I8C A;  3MZB A;  4NMY A;  4OEN A;  3VVD A;  2F6P A;  4H8J A;  1A8E A;  4HTG A;  2RKM A;  3PUW E;  4OER A;  4F18 A;  1MXZ A;  3M3F A;  3MBP A;  3BFT A;  2XXY A;  4LAT A;  4QFN A;  1LB9 A;  4G68 C;  4XKN A;  2DXR A;  4G68 B;  3SEY A;  1BKA A;  5B7D A;  1ANF A;  3FXR A;  2Z8D A;  3MP6 A;  1MM7 A;  3MZ1 A;  3MZ9 A;  2HXW A;  4GFR A;  2DE2 A;  4ZZE A;  3V5A A;  1UTH B;  1N3X A;  2XXU A;  2ONK E;  4GL0 A;  4R9F A;  3FVG A;  2XX8 A;  3H06 B;  3O2A A;  2WKY A;  3B6T A;  1I6B A;  1SQY A;  3FJM A;  3UIF A;  5H8F A;  4H6D A;  5CBS A;  5I84 A;  2X26 A;  4MFI A;  4PE5 B;  1MH3 A;  3EN3 A;  4M1V A;  4ZZA A;  3O28 A;  3G3I A;  1B5I A;  2XHD A;  1B32 A;  4LZ7 A;  3FGS A;  4IGT A;  1QUJ A;  4Q5T A;  4G8H A;  1T0K A;  1MDQ A;  2G29 A;  3MVZ A;  1IXG A;  3H4Z A;  1FTK A;  4F3B A;  4ZEC A;  4HW8 A;  3RTF B;  2ONR A;  1ZJL A;  4JWY A;  1FQA A;  1CB6 A;  1S50 A;  4GXA A;  5I2K B;  4ECF A;  5CMK A;  2D21 A;  1P1N A;  2DQV A;  2I3W A;  3CFX A;  3O29 A;  1FTJ A;  1TFD A;  3Q27 A;  4RXL A;  3MPK A;  3MAM A;  2QMW A;  4ISU A;  3ZKK A;  3S9M C;  2F97 A;  5HBC A;  4UAC A;  5BWJ A;  4G8N A;  1VFD A;  3C34 A;  4NF6 B;  2PMS A;  3HHG A;  4ELO A;  4F1V A;  2G93 A;  4RJZ A;  1LGB C;  2W7Y A;  3H03 A;  5H8S A;  5KDT B;  1EU8 A;  4NWC A;  3H6U A;  1B4Z A;  2THI A;  3LSL A;  5DVI A;  4DLD A;  2QS3 A;  3VFJ A;  4GF8 A;  4F29 A;  4BLA A;  3IO4 A;  4RNS A;  5FHO A;  3RN8 A;  4QSC A;  2Q8J A;  4R6Y A;  1H45 A;  3IOU A;  3ZKL A;  4BDN A;  5I56 A;  2H9B A;  2P0S A;  4X1B A;  3IL1 B;  1DPP A;  1NNK A;  4BDO A;  1NNF A;  1HSL A;  1H76 A;  2O7I A;  4FED A;  4OES A;  4P0I A;  5I57 B;  2D5W A;  3V8X B;  4ZEF A;  2NXO A;  3SET A;  4E0W A;  2I48 A;  3UN6 A;  3S4U A;  2B3F A;  1OQG A;  1NH8 A;  1NL5 A;  4QFL A;  5AA2 B;  1GV8 A;  2V3U A;  5EHS A;  1FQC A;  3TEP A;  4KD5 A;  3H7M A;  3OOA A;  4UA8 A;  1UQW A;  1LAX A;  4FAJ A;  2RC7 A;  2UYE A;  3N5L A;  2PX1 A;  3F11 A;  1B7U A;  3EF7 A;  5IAI A;  4QSE A;  3N6U A;  2I58 A;  3VVF A;  1H44 A;  4U21 A;  3KN3 A;  2V3Q A;  1D4N A;  1R9L A;  4R6H A;  4YB5 A;  1IEJ A;  3Q29 A;  3VLW A;  1H43 A;  1B5J A;  4N13 A;  2OJT A;  1MXW A;  3H6T A;  3IOT A;  3Q26 A;  4DCY A;  1UTH A;  1B6H A;  5FHM A;  1I6Q A;  1OVB A;  2Q2C A;  1XOC A;  2E0S A;  2M8C A;  3K01 A;  4R2F A;  3TTK A;  5AA4 A;  2HAV A;  4P0G A;  1FQE A;  1H3D A;  4H65 A;  1D9V A;  4DXB A;  1BLF A;  3K6X A;  1KWH A;  3C36 A;  3OEN A;  4H5F A;  3RY3 A;  1OVT A;  4AB6 A;  4F39 A;  1LAF E;  1DTG A;  3BBR A;  3TCG A;  3UK4 A;  4YKI A;  3VDF A;  2QSX A;  2Y84 A;  3Q25 A;  2OLB A;  5K2X A;  1Y1M A;  2F36 A;  3SEV A;  1S9T A;  3M3L A;  1B3F A;  4THI A;  3O6G A;  5M2V A;  2Z8F A;  2ZYO A;  3T9U A;  4OTE A;  5DTB A;  3FVO A;  4ZE8 A;  1SW4 A;  2O68 A;  4NWD A;  3W9W A;  1VSO A;  3HHF A;  1B1H A;  2LAO A;  1N76 A;  3MP1 A;  1UTB B;  3OXN A;  4OET A;  4IGR A;  1MY2 A;  5AE4 A;  2DVC A;  1ZIU A;  4YB6 A;  1PB7 A;  2DXY A;  1NMU A;  3CG1 A;  3USD A;  1US5 A;  3KGC A;  3KSJ A;  4R74 A;  5KDT A;  3S2V A;  1MDP 1;  2XD2 A;  2V93 A;  2RC8 A;  3CFL A;  4RY1 A;  4U1Z A;  3FIR A;  3K0V A;  2QS4 A;  3SEW A;  3SEX A;  1A55 A;  5HPQ A;  2PYY A;  1B5H A;  2DP8 A;  1MXX A;  3OEL A;  4I9D A;  3HO7 A;  4EXK A;  1IUD A;  2ZNU A;  3OMB A;  3FXU A;  3PUY E;  5TP9 B;  1TXF A;  1MY3 A;  3QSL A;  4JBZ A;  3I3V A;  4QSD A;  1A8F A;  1PB8 A;  1MS7 A;  3PPR A;  3KJ7 A;  1Y9U A;  3IOW A;  1FCK A;  3IX1 A;  4DXU A;  2NOO A;  2AL5 A;  2AIX A;  4NF5 A;  1QKA A;  1O63 A;  2PBW A;  4OFO A;  3B6Q A;  5KCJ A;  5L9O A;  4LQ5 A;  3PUX E;  4OYV A;  4GVO A;  3HPI A;  3OSR A;  4Q0C A;  4I62 A;  1AL3 A;  2CZL A;  1PB9 A;  1SYH A;  5CMB A;  3TPA A;  2F7C A;  4E0X A;  5JTY A;  2HFB A;  1JEV A;  3U92 A;  1B05 A;  4C1U A;  2RCB A;  3KZG A;  1LCT A;  4PQJ A;  3TQL A;  1F9B A;  1N7W A;  1XT8 A;  2B65 A;  2I3V A;  3UP9 A;  4C0R A;  1LFH A;  1QW0 A;  2PVU A;  2R9J A;  3FD3 A;  3H6V A;  4NF8 B;  3R7X A;  2VHA A;  1GVC A;  1IXH A;  4JWO A;  3CSB A;  5ELV A;  3OSQ A;  4KCC A;  2DWA A;  2DE3 A;  3EQ1 A;  3UGW A;  4XTC Q;  1ZLQ A;  4C1T A;  2F5X A;  2Y7I A;  2FYI A;  2DS9 A;  1TFA A;  3FZV A;  3MUQ A;  1FQD A;  5CMM A;  4FEC A;  4F19 A;  4NF8 A;  3KFM A;  4F1U A;  5I57 A;  1ELJ A;  1M5F A;  1BTJ A;  1QVS A;  3FJ7 A;  3O97 A;  2UXA A;  5DVF A;  5AA1 A;  4AQ4 A;  3G3K A;  4ELP A;  4OEU A;  4R72 A;  4HS7 A;  2Q2A A;  4NE4 A;  4F2Q A;  5AA2 A;  1ZKB A;  2GRV A;  1LBC A;  2O51 A;  3W15 C;  4ZDM A;  1Q35 A;  2Q89 A;  4TLM B;  1ZTY A;  2NUV A;  2OCU A;  4U23 A;  3RT6 B;  3VVE A;  1MPC A;  1R9Q A;  3TTM A; 
#chains in the Genus database with same CATH topology
 3OO7 A;  3G7W A;  5TPA B;  3TTN A;  1IIW A;  5EYG A;  4F31 B;  1B3H A;  3T9H B;  2O69 A;  1B7H A;  4O3A A;  4RYA A;  3LR1 A;  2UYF A;  4ZEK A;  5DEX A;  3GBB A;  1FPJ A;  4FBP A;  1XVX A;  2GHA A;  3VLU A;  3D4G A;  5EYH A;  3IOV A;  1NKX A;  2RIN A;  4GWX A;  1P1U A;  1B3E A;  2DSF A;  3GZG A;  4ZS9 A;  5EQ7 A;  1SW1 A;  1POY 1;  3K1M A;  3Q28 A;  4GWO A;  1BIY A;  2UVJ A;  4GWU A;  1YXI A;  1JW5 A;  1US4 A;  1JW1 A;  4PFT A;  3C4M A;  1SW5 A;  3CI8 A;  3FAT A;  3WAE A;  2IA4 A;  4HE1 A;  3DEL B;  4MF3 A;  3E9X A;  1NUX A;  4NGU A;  1GR2 A;  4F22 A;  4LVQ A;  1PDA A;  1DBZ A;  4YKP A;  1INP A;  1UIU A;  1XHY A;  3FV2 A;  4ELR A;  3UOR A;  5ET7 A;  2E1S A;  1I69 A;  1Y4T A;  3PV0 E;  4OVT A;  3FVN A;  3QYT A;  2XXQ A;  5LDZ A;  2F35 A;  2ANJ A;  4PF8 A;  5TPA A;  2BJJ X;  1B40 A;  3MPL A;  4G77 A;  4DE8 A;  2VD2 A;  3C32 A;  1URS A;  3K02 A;  3ILT B;  1NUZ A;  4XKQ A;  5IZ3 A;  1LST A;  3CSG A;  2XD3 A;  2H99 A;  1AWB A;  5ICQ A;  4YKJ A;  1FTO A;  5H8N A;  4EQB A;  3V89 B;  1B51 A;  3MJN A;  4ELQ A;  2CMO A;  2Y7K A;  3IB0 A;  5I59 B;  4U1O A;  3RNN A;  1MXV A;  3T93 B;  1SVX B;  5FHN A;  1I6A A;  3LSX A;  5LTC A;  1FPI A;  3PPP A;  2I0C A;  2YJP A;  4M4G A;  1EZO A;  2F8D A;  4GLI A;  4FE8 A;  1HSE A;  4PET A;  2UVI A;  2HCA A;  3T22 A;  2DWH A;  1B1X A;  3GBA A;  2H4I A;  2VOZ A;  1N0T A;  3MWB A;  4JDF A;  2BJI A;  4LA9 A;  3T9X B;  2XWO A;  2ZNS A;  3THI A;  5LOM A;  1P99 A;  1B2H A;  4DZ1 A;  1MXU A;  1M5D A;  3MP8 A;  3G3F A;  4GBW A;  2XXR A;  3R26 A;  3KN8 A;  3OD7 A;  5EYF A;  3PUV E;  3W9V A;  3SER A;  3O9P A;  1P1Q A;  2RCA A;  2ZZV A;  3N94 A;  2O84 X;  4EQ9 A;  2ZYK A;  1B3L A;  2A5S A;  5I58 B;  1MPD A;  4PDD A;  4MBP A;  4OVR A;  1LB8 A;  4H67 A;  3IJX B;  4YMA A;  4QXD A;  1S7Y A;  4O7I A;  3QUF A;  3ROJ A;  1N7X A;  1URG A;  5J1D A;  1D9Y A;  3TDJ A;  5L8D A;  3B6W A;  3SZP A;  4N4U A;  2FIX A;  4QHQ A;  4ZEB A;  1OQH A;  4GD5 A;  3PPO A;  1B52 A;  3TCF A;  5H8N B;  4YKK A;  1MRP A;  4RK9 A;  4MLV A;  1RYX A;  1Y3Q A;  1FSA A;  1PBQ A;  4JB7 A;  1MM6 A;  4KXP A;  4EQ7 A;  4NF4 A;  5EHM A;  3U72 A;  3TAJ A;  3LV0 A;  4OHN A;  2OBG A;  2NWJ A;  1DCU A;  3C9H A;  4GWS A;  5I58 A;  5A5L A;  3LSF B;  4GX6 A;  1TWY A;  1FPE A;  5I59 A;  1A99 A;  3GXA A;  3O6H A;  2OK2 A;  2V84 A;  1YPN A;  3FV1 A;  1QGX A;  1O64 A;  4YMB A;  1XS5 A;  1B4H A;  4R2B A;  2I4C A;  4F1Y A;  3KOS A;  2VGQ A;  3ECR A;  2Z8E A;  4NTL A;  4WKM A;  3MYU A;  2DE4 A;  1LBB A;  1LLS A;  4TLL B;  2ABH A;  4OEN A;  4I8C A;  3VVD A;  4H8J A;  2RKM A;  1FPD A;  1NV0 A;  3M3F A;  4PF6 A;  4LAT A;  4G68 C;  2DXR A;  5B7D A;  1BKA A;  2HXW A;  2WBB A;  3B6T A;  5H8F A;  4H6D A;  4MFI A;  3LUZ A;  1IMB A;  4LZ7 A;  1NV6 A;  1QUJ A;  4G8H A;  1T0K A;  1MDQ A;  4F3B A;  1FTK A;  4HW8 A;  4NHB A;  4JWY A;  4GXA A;  1CB6 A;  1S50 A;  4ECF A;  2FIE A;  5CMK A;  2DQV A;  3Q27 A;  1FTJ A;  2QMW A;  4ISU A;  5I5P A;  2F97 A;  4G8N A;  4NF6 B;  3HHG A;  5KDT B;  2G93 A;  2WBD A;  5H8S A;  5DVI A;  2QS3 A;  3VFJ A;  4XEQ A;  3IO4 A;  3GYY A;  3ZKL A;  1H45 A;  5I56 A;  4MJO A;  1NNF A;  1HSL A;  1H76 A;  4P0I A;  3V8X B;  4E0W A;  2B3F A;  4XF5 A;  3CHG A;  4UA8 A;  1UQW A;  1LAX A;  3VVF A;  4U21 A;  3KN3 A;  1R9L A;  1IEJ A;  2OJT A;  1MXW A;  1OVB A;  3TTK A;  5ET6 A;  1FQE A;  1H3D A;  1BLF A;  3K6X A;  1K9Y A;  4F39 A;  5J16 A;  3BBR A;  3TCG A;  3VDF A;  2PFZ A;  2Y84 A;  2OLB A;  1LBW A;  2ZYO A;  4ZE8 A;  2O68 A;  3HHF A;  3MP1 A;  2P3N A;  3CG1 A;  3USD A;  1US5 A;  1FPB A;  2V93 A;  3K0V A;  3SEW A;  1KZ8 A;  5HPQ A;  1B5H A;  4I9D A;  3HO7 A;  3PUY E;  1TXF A;  1MY3 A;  4QSD A;  1Y9U A;  5KCJ A;  4PCD A;  4Q0C A;  4PDH A;  1AL3 A;  5CMB A;  4E0X A;  5JTY A;  4C1U A;  1RDX A;  3KZG A;  1LCT A;  3TQL A;  3ISP A;  1N7W A;  2DE3 A;  3EQ1 A;  1FPL A;  4XTC Q;  1ZLQ A;  2F5X A;  2Y7I A;  2FYI A;  2DS9 A;  3FZV A;  3MUQ A;  2F3B A;  1ELJ A;  3G3K A;  4HS7 A;  2QVR A;  4ZDM A;  2WEF A;  2I48 A;  5JEI A;  4KHZ E;  2AYS A;  3OO6 A;  4IY5 A;  3VLV A;  1B9J A;  2I6E A;  1NNP A;  4OWD A;  4HCY A;  1Y20 A;  2A5T A;  2Y7R A;  4PTK A;  5CBR A;  2QS1 A;  3CRB A;  4QFK A;  4NF5 B;  4R75 A;  1DPE A;  5CRY A;  1RYO A;  4MIJ A;  3AXF A;  3L6H A;  3RLF E;  4MNP A;  1EYK A;  4IO2 A;  5TP9 A;  2X7Q A;  1D9Q A;  4KCD A;  4PBH A;  5CM6 A;  1FQB A;  3A3U A;  2ZYN A;  1JVY A;  3E3K A;  2QVV A;  3K00 A;  2XXI A;  4NED A;  1YTV A;  2O1L A;  3PD8 A;  3ZS6 A;  4POW A;  1LCF A;  3L6G A;  1LAG E;  1GTK A;  2XX9 A;  2IEE A;  3IAZ A;  3H6W A;  1Y4C A;  2F34 A;  2XXP A;  4U4S A;  4MEV A;  4FJP A;  1GGG A;  3IR1 A;  3CG3 A;  3VE1 B;  4QF9 A;  1MY1 A;  2RC9 A;  4H0W A;  2O7U A;  2XXW A;  2P2A A;  3ONM A;  5DVJ A;  2H25 A;  1JQF A;  1Y3P A;  2ESN A;  5EQA A;  3KOT A;  3TKD A;  1USY E;  3JYR A;  1NV3 A;  4EF2 A;  1FTM A;  2HZL A;  1FPF A;  4MH5 A;  4YZZ A;  3MST A;  4Q30 B;  1POT A;  1EH3 A;  4NN3 A;  4GRK A;  5H8H A;  3QAX A;  1OLA A;  4IR8 A;  4TOZ A;  1SD3 A;  1MY0 A;  5DT6 A;  3QK6 A;  3JV9 A;  4EXL A;  3E4R A;  2QJE A;  3EHU A;  3QIM A;  2XA5 A;  3S9N C;  3HST A;  4H46 A;  3RPL A;  4ZE9 A;  4ONY A;  1IXC A;  1O7T A;  1ZU0 A;  4QFP A;  1TT1 A;  4RK2 A;  1JEU A;  4PP0 A;  1B3G A;  4LUB A;  4R73 A;  3IOR A;  2Y5K A;  5ET5 A;  3I5O A;  2ONS A;  4OXV A;  4N6K A;  2FVZ A;  2O1M A;  3PU5 A;  5JTY B;  3RT8 A;  3KSX A;  1NV4 A;  1M5B A;  3KC1 A;  4KFQ A;  3H3G A;  2QRY A;  1WVJ A;  4P11 A;  5KCJ B;  2QS2 A;  3DP8 A;  4O3B A;  4PFW A;  3MW0 A;  3S9E A;  1MQD A;  4OZ9 A;  3CFZ A;  3LC8 A;  1VDW A;  3C35 A;  3IB1 A;  1IMA A;  3CVG A;  2Q9T A;  3RQT A;  4KYD A;  2XWI A;  3GLB A;  4G68 A;  4U22 A;  4DDD A;  4GBV A;  1OMP A;  1Q9D A;  2YLN A;  2FNC A;  5KZT A;  4LZ8 A;  2NVU B;  4FOR A;  5H8F B;  4NG7 A;  2DWI A;  4DXC A;  3OEM A;  5I2K A;  1VE4 A;  4LN5 A;  3ILU B;  4FAT A;  1LAH E;  1B7Z A;  4U4X A;  3RUM A;  3U8Q A;  1K9Z A;  3MQ9 A;  4GIZ A;  1BP5 A;  3FUZ A;  2VD3 A;  4XKR A;  2H5Y A;  2KLF A;  3U93 A;  1YAE A;  2Z22 A;  4NF0 A;  3OEK A;  5I56 B;  2QL3 A;  5H8H B;  2ZXT A;  3HCQ A;  4KI0 E;  4NMY A;  2F6P A;  4HTG A;  4F18 A;  1EYI A;  3MBP A;  1FJ9 A;  1FPK A;  2XXU A;  3O2A A;  3UIF A;  1LBX A;  1I6B A;  5CBS A;  3EN3 A;  1JP4 A;  4ZZA A;  3O28 A;  3G3I A;  2XHD A;  4IGT A;  4Q5T A;  1FBF A;  2G29 A;  3MVZ A;  4ZEC A;  4AS5 A;  3RTF B;  5I3S A;  5I2K B;  1G0H A;  2I3W A;  3O29 A;  1TFD A;  3MAM A;  3S9M C;  5BWJ A;  1LGB C;  2W7Y A;  3H03 A;  1EU8 A;  4DLD A;  4BLA A;  3RN8 A;  2Q8J A;  4BDN A;  2H9B A;  1DPP A;  4OES A;  4N17 A;  1OQG A;  4I40 A;  5AA2 B;  1GV8 A;  3TEP A;  4KD5 A;  1B7U A;  3EF7 A;  4N6D A;  3N6U A;  2I58 A;  1H44 A;  4YB5 A;  1D4N A;  4PGN A;  2FHY A;  4N13 A;  3Q26 A;  4DCY A;  3IOT A;  4R2F A;  4GX3 A;  1D9V A;  4N91 A;  1OVT A;  1LAF E;  1DTG A;  4YKI A;  1NV5 A;  5K2X A;  1LBV A;  1S9T A;  1B3F A;  4THI A;  3O6G A;  2Z8F A;  4OTE A;  5DTB A;  1B1H A;  3OXN A;  1PB7 A;  2DXY A;  5KDT A;  3KGC A;  3S2V A;  2XD2 A;  3T1B A;  3FIR A;  2DP8 A;  3OMB A;  3FXU A;  1A8F A;  1PB8 A;  3PPR A;  3KJ7 A;  4OVQ A;  1FCK A;  4OAN A;  4DXU A;  2NOO A;  5L9O A;  4OFO A;  1QKA A;  2PBW A;  3B6Q A;  4GVO A;  3RYD A;  4P47 A;  1PB9 A;  1SYH A;  2F7C A;  2HFB A;  2RCB A;  4MNC A;  1XT8 A;  4C0R A;  2B65 A;  1LFH A;  4PC9 A;  3R7X A;  2VHA A;  5ELV A;  3UGW A;  2F3D A;  1TFA A;  4F1U A;  1QVS A;  5AA1 A;  4NE4 A;  2Q2A A;  4TLM B;  2HXR A;  1ZTY A;  2OCU A;  4U23 A;  3RT6 B;  3RPW A;  2M8C A;  1R9Q A;  1SW2 A;  2R8T A;  2DWJ A;  4QFO A;  1DSN A;  3KN7 A;  3DLN A;  4HXV A;  1MXY A;  3N6T A;  3HFU A;  3R6U A;  1MG1 A;  3TEL A;  5L9M A;  2Y5L A;  1JNF A;  3IJO B;  4MMP A;  3O66 A;  1IIT A;  2OWZ A;  3DP6 A;  5EQ8 A;  5F7V A;  3PPQ A;  3BIG A;  4F3G A;  2UVG A;  5TU0 A;  1FQF A;  2V25 A;  3CR9 A;  4GWZ A;  3K6W A;  2F6G A;  1UIV A;  4I3Y A;  3TUS A;  1B58 A;  2P3V A;  2HAU A;  4EUO A;  2DVZ A;  4AB5 A;  1P1O A;  5I7I A;  5IKB A;  1FW0 A;  1M5C A;  1PC3 A;  2X7P A;  1FBE A;  4BDQ A;  5A5X A;  4OFJ A;  5ISU A;  2GHB A;  4POX A;  4X9T A;  2UVH A;  2FBP A;  5I2N B;  3EPE A;  2XXH A;  1SBP A;  2Y7W A;  4ESX A;  4OMB A;  3EHT A;  2HQ0 A;  3OO9 A;  3SEU A;  4QBA A;  3RTW B;  3HV1 A;  4R6K A;  2QMX A;  4EDP A;  1A40 A;  3M8U A;  2Y7P A;  1JW4 A;  3U1O A;  4IO7 A;  2F7B A;  3TTL A;  1IMD A;  5F1Q A;  2Q88 A;  2CEX A;  4U2R A;  2XWK A;  5AA3 A;  4F3S A;  4KYS A;  1DMB A;  2Q74 A;  3T96 B;  3IFA A;  3G3H A;  3BKI B;  3M3K A;  4H8I A;  4H5G A;  5DW8 A;  4YB7 A;  2VPO A;  1QJM A;  1SI0 A;  4DI4 B;  3S9L C;  4QRZ A;  2XXX A;  1J1N A;  1B46 A;  5HM4 B;  2I0B A;  1AMF A;  4EF1 A;  2DOJ A;  1Z7N E;  4P8B A;  3SKP A;  3TTR A;  4G4P A;  1NUY A;  3E13 X;  1PEB A;  4FIM A;  4HE2 A;  3I6V A;  3RGY A;  1IMF A;  4YIC A;  2HEU A;  2YPN A;  3QUJ A;  3B7D A;  5FTI A;  2RF1 A;  5ITO A;  2PT1 A;  1B0H A;  1Q1K A;  1Y3N A;  2ZZW A;  1DK4 A;  3PMV A;  1P1W A;  4IO6 A;  1AIV A;  1LFI A;  1FBC A;  3IFC A;  1RDZ A;  3MC2 A;  3O6I A;  4O7M A;  1ATG A;  1JET A;  4LZ5 A;  4I3E A;  1MPB A;  1Z7M E;  4XKP A;  3A09 A;  3FVK A;  5DEX B;  1OLC A;  2CZH A;  3PMW A;  1MY4 A;  4KYE A;  2O6A A;  3KG2 A;  4K3F A;  5CC2 A;  1FRP A;  1LEV A;  4XXU A;  2AL4 A;  4JSO A;  1IQ7 A;  3K4U A;  4IO4 A;  2F78 A;  3HN0 A;  1NI9 A;  2D3I A;  1FTA A;  3MVX A;  2CZI A;  5AA2 D;  5H8Q A;  3PMX A;  2ZMB A;  4PAF A;  1IZ1 A;  2XXK A;  2GFE A;  2H98 A;  1L5T A;  1USY H;  1FTL A;  2HPG A;  3SES A;  1SI1 A;  1N84 A;  4OEV A;  3KBR A;  5IGA A;  1VFE A;  1VR5 A;  4DCX A;  3V83 A;  4N81 A;  1R6Z A;  1HSJ A;  1IXI A;  4NF4 B;  3EHS A;  4GWY A;  2ALU A;  1R1N A;  4PAK A;  4JSD A;  1FJ6 A;  4PBQ A;  2A5T B;  3IK6 B;  1EZ9 A;  4PFY A;  4OFL A;  4Q8R A;  4IO3 A;  3MVY A;  3TZA A;  2R6G E;  4WXJ A;  4WED A;  3NOH A;  3KJT A;  2OWT A;  3BFU A;  5ET8 A;  4LP2 B;  4RPO A;  1XVY A;  2FA7 A;  4OER A;  1A8E A;  2B4L A;  1LB9 A;  4XKN A;  3SEY A;  3FXR A;  2Z8D A;  3MP6 A;  1G0I A;  3MZ1 A;  3MZ9 A;  3V5A A;  1UTH B;  1N3X A;  2ONK E;  4R9F A;  2XX8 A;  2WKY A;  1SQY A;  3KC0 A;  1MH3 A;  4M1V A;  3E78 A;  4PE3 A;  1IXG A;  3H4Z A;  1FQA A;  4JVC A;  4MNI A;  2PFY A;  2D21 A;  1P1N A;  4RXL A;  3CFX A;  3ZKK A;  3C34 A;  4F1V A;  4P3L A;  1B4Z A;  3LSL A;  1YYZ A;  2P0S A;  1KA1 A;  3E79 A;  4BDO A;  4FED A;  2O7I A;  5I57 B;  2ZZX A;  2D5W A;  3SET A;  2NXO A;  3UN6 A;  3S4U A;  1NL5 A;  3KBZ A;  4H45 A;  5EHS A;  3OOA A;  4FAJ A;  2RC7 A;  2UYE A;  3U65 A;  1IME A;  3F11 A;  5IAI A;  4QSE A;  2V3Q A;  4R6H A;  3VLW A;  3H6T A;  4X8R A;  1I6Q A;  3K01 A;  2Q2C A;  2E0S A;  4PAI A;  2HAV A;  4DXB A;  1KWH A;  3OEN A;  4H5F A;  4AB6 A;  2WYK A;  3UK4 A;  2QSX A;  2WYP A;  1Y1M A;  3SEV A;  2F36 A;  5M2V A;  4PFR A;  3FVO A;  4XFE A;  4OET A;  4IGR A;  1MY2 A;  5AE4 A;  1ZIU A;  4YB6 A;  1NMU A;  1MDP 1;  2RC8 A;  4RY1 A;  2QS4 A;  3SEX A;  2PYY A;  4EXK A;  5IZZ A;  3I3V A;  1MS7 A;  3IOW A;  4P1E A;  2AIX A;  4NF5 A;  3PUX E;  4OA4 A;  4I62 A;  4NX1 A;  4NQ8 A;  4N8Y A;  4PQJ A;  1F9B A;  2I3V A;  2WX9 A;  3UP9 A;  2R9J A;  3H6V A;  1NUW A;  3FD3 A;  3OSQ A;  2DWA A;  2L5V A;  5CMM A;  4UAB A;  1SPI A;  4AQ4 A;  1M5F A;  3FJ7 A;  2XWV A;  4ELP A;  2UXA A;  1MPC A;  1ZKB A;  4JVD A;  1LBC A;  3W15 C;  1Q35 A;  2NUV A;  3VVE A;  5ESY A;  3LSW A;  4PFB A;  5CI5 A;  3FXB A;  1WOD A;  1URD A;  4OVP A;  4ZED A;  5EQ9 A;  3G3G A;  4X1D A;  2Z23 A;  3KEI A;  1EZP A;  1FPG A;  3P7I A;  1AOV A;  3G3J A;  1N3W A;  3SDF A;  2PT2 A;  4YAH X;  2Q8M A;  1A7L A;  4G2Z A;  1QUL A;  5BUU A;  1FBD A;  1NFT A;  4MAG A;  4IB2 A;  2ZNT A;  4RA1 A;  4ZEI A;  4O3C A;  3FXQ A;  2HZK A;  4I1D A;  1GVC A;  2REG A;  3OO8 A;  4Z0I A;  4F3P A;  2V3T A;  3LBS A;  3BIH A;  3N26 A;  5A5X B;  4ESW A;  4TQU Q;  4N6P A;  4KPT A;  3EKI A;  1A54 A;  4GL8 A;  2OWS A;  4GXS B;  3VV5 A;  3K1P A;  1ZMG A;  3RPL B;  4ND9 A;  3LUY A;  4H1X A;  3FAS A;  1M5E A;  2REJ A;  5FTH A;  1NH7 A;  3TYH A;  1SYI A;  3K1N A;  3JZJ A;  4MX6 A;  5AA4 B;  3K6U A;  3C33 A;  2QPQ A;  2P1S A;  3TOD A;  4GQO A;  1XI6 A;  2OZZ A;  1MQG A;  2R71 A;  3PPN A;  4OVJ A;  1FBH A;  1PBP A;  1LBZ A;  2F7A A;  3FJG A;  2JJK A;  4JWX A;  1YCJ A;  2V4C A;  4GWW A;  4WEP A;  5FBP A;  1BK4 A;  1NNT A;  5DYH A;  1NV2 A;  3T66 A;  3IO6 A;  4IY6 A;  4YU0 A;  4BDR A;  3PTY A;  4BDL A;  1DTZ A;  3WAF A;  1LFG A;  4DI3 D;  5ITP A;  1LBY A;  4LON B;  2XX7 A;  3TQW A;  1B0L A;  4RPN A;  4X48 A;  3A29 A;  5H8Q B;  3TMG A;  3MVW A;  1XC1 A;  5CMC A;  1QUI A;  3C31 A;  5K2Y A;  3IB2 A;  4JXI A;  2KQZ A;  3K6V A;  3T0J A;  3D4C A;  1UTB A;  5F24 A;  1N04 A;  4OQO A;  2ZYM A;  1MH4 A;  1JVX A;  4LQ2 A;  1D3K A;  1RDY A;  3CIJ A;  4Z7E A;  3DM0 A;  4F2O A;  1MQH A;  3PD9 A;  3K2D A;  5B70 A;  2VP1 A;  2XXT A;  3VXC A;  4BDM A;  4KR5 A;  1MQJ A;  4IO5 A;  4PFU A;  4HCW A;  3PGF A;  1II5 A;  3PUZ E;  4KQP A;  4DIG A;  1WDN A;  3QXM A;  4GOT A;  2XXV A;  4MHF A;  1YZ0 A;  3VXB A;  4OVS A;  1FBG A;  4GX4 A;  4MCO A;  1OIB A;  1NV1 A;  4P9K A;  3U94 A;  2GH9 A;  1CE2 A;  3UA8 A;  4G8M A;  3TFL A;  2KR0 A;  4NF6 A;  4MLQ A;  3DP4 A;  1MQI A;  3ODB A;  1QUK A;  4L17 A;  5I2N A;  2GQ1 A;  4R9G A;  5L9S A;  3FBP A;  2I4B A;  1DOT A;  3T9V A;  4N07 A;  2B3B A;  1RKM A;  3TCH A;  1Y1Z A;  4HE0 A;  1FBP A;  2PCR A;  2DYX A;  4PFI A;  4JVI A;  4N8G A;  2I49 A;  4XIG Q;  5JK4 A;  3A3C A;  5ICT A;  4N15 A;  1KA0 A;  4FEB A;  4O94 A;  1ZBM A;  1QKB A;  1AH5 A;  3B8B A;  1SDX A;  3ZSF A;  3MZB A;  3PUW E;  1MXZ A;  3BFT A;  2XXY A;  4QFN A;  2HHM A;  4AS4 A;  4G68 B;  1ANF A;  1MM7 A;  4GFR A;  2DE2 A;  2VT5 A;  2CZK A;  4ZZE A;  2QFL A;  4GL0 A;  3QMF A;  3D1R A;  3FVG A;  3H06 B;  3FJM A;  5I84 A;  2X26 A;  4PE5 B;  1NV7 A;  1B5I A;  1B32 A;  3FGS A;  2ONR A;  1ZJL A;  3MPK A;  5HBC A;  4UAC A;  1VFD A;  2PMS A;  4ELO A;  2CEY A;  4RJZ A;  4NWC A;  3H6U A;  2THI A;  2VPN A;  4F29 A;  4RNS A;  5FHO A;  4QSC A;  4R6Y A;  3IOU A;  4PGP A;  5IZ1 A;  4X1B A;  3IL1 B;  1NNK A;  4O8M A;  4ZEF A;  5IM2 A;  1NH8 A;  4QFL A;  2V3U A;  1FQC A;  3H7M A;  3N5L A;  2PX1 A;  2B4M A;  2OX3 A;  3Q29 A;  1H43 A;  1B5J A;  4NAP A;  1UTH A;  1B6H A;  5T3J A;  5FHM A;  1XOC A;  5AA4 A;  4P0G A;  4H65 A;  3C36 A;  4P1L A;  3RY3 A;  3Q25 A;  3M3L A;  3T9U A;  3W9W A;  1SW4 A;  4NWD A;  1VSO A;  2DDK A;  2LAO A;  1N76 A;  1UTB B;  2DVC A;  3KSJ A;  4R74 A;  3CFL A;  4U1Z A;  2QVU A;  4X04 A;  1A55 A;  1MXX A;  3B50 A;  1CNQ A;  3OEL A;  1IUD A;  2ZNU A;  5TP9 B;  3QSL A;  4JBZ A;  3IX1 A;  2AL5 A;  1O63 A;  4LQ5 A;  4OYV A;  3HPI A;  3OSR A;  2CZL A;  3TPA A;  3U92 A;  1JEV A;  1B05 A;  4G61 A;  4P56 A;  1QW0 A;  2PVU A;  4NF8 B;  1IXH A;  4JWO A;  3CSB A;  4KCC A;  5IZ3 B;  4C1T A;  2MKZ A;  1FQD A;  4F19 A;  4FEC A;  4NF8 A;  3KFM A;  5I57 A;  1BTJ A;  3O97 A;  5DVF A;  4OEU A;  4R72 A;  5AA2 A;  4F2Q A;  2GRV A;  2O51 A;  1EYJ A;  2Q89 A;  4GF8 A;  1IMC A;  3TTM A; 
#chains in the Genus database with same CATH homology
 1SW2 A;  2DWJ A;  3OO7 A;  3G7W A;  5TPA B;  4QFO A;  3LSW A;  5CI5 A;  3TTN A;  5JEI A;  1IIW A;  1DSN A;  4KHZ E;  4F31 B;  3KN7 A;  1B3H A;  3DLN A;  3T9H B;  2O69 A;  1MXY A;  2AYS A;  1B7H A;  3OO6 A;  1WOD A;  4O3A A;  1URD A;  3LR1 A;  3N6T A;  4RYA A;  4EQ9 A;  4ZED A;  3R6U A;  2UYF A;  1MG1 A;  4ZEK A;  3G3G A;  4IY5 A;  4X1D A;  5DEX A;  3TEL A;  3GBB A;  5L9M A;  1B9J A;  2Z23 A;  3KEI A;  1XVX A;  1JNF A;  2GHA A;  3IJO B;  3VLU A;  1EZP A;  2I6E A;  1NNP A;  4OWD A;  3D4G A;  3IOV A;  3P7I A;  3O66 A;  4HCY A;  1AOV A;  1IIT A;  1NKX A;  2RIN A;  3DP6 A;  3G3J A;  5F7V A;  3PPQ A;  1N3W A;  1Y20 A;  2A5T A;  3RPW A;  1P1U A;  4F3G A;  2UVG A;  2Y7R A;  5TU0 A;  1FQF A;  2V25 A;  3SDF A;  5CBR A;  2QS1 A;  2PT2 A;  1B3E A;  3CRB A;  3CR9 A;  4QFK A;  4NF5 B;  4R75 A;  2DSF A;  3GZG A;  4YAH X;  3K6W A;  2F6G A;  1DPE A;  4ZS9 A;  1UIV A;  3TUS A;  1B58 A;  2HAU A;  4EUO A;  2DVZ A;  1A7L A;  1RYO A;  1QUL A;  1SW1 A;  1POY 1;  4G2Z A;  3K1M A;  5CRY A;  4AB5 A;  5BUU A;  1NFT A;  3Q28 A;  3AXF A;  1P1O A;  4GWO A;  1BIY A;  3L6H A;  3RLF E;  2UVJ A;  4IB2 A;  2ZNT A;  4IO2 A;  4RA1 A;  4ZEI A;  5TP9 A;  2X7Q A;  5IKB A;  1FW0 A;  1M5C A;  1PC3 A;  4KCD A;  2X7P A;  4BDQ A;  5A5X A;  5CM6 A;  4OFJ A;  4O3C A;  5ISU A;  3FXQ A;  1FQB A;  2GHB A;  2HZK A;  3A3U A;  4I1D A;  2ZYN A;  2UVH A;  1JW5 A;  1US4 A;  4POX A;  1JVY A;  1JW1 A;  2REG A;  4PFT A;  3OO8 A;  5I2N B;  3C4M A;  1SW5 A;  3E3K A;  4Z0I A;  3CI8 A;  3FAT A;  3EPE A;  3WAE A;  2XXH A;  2V3T A;  1SBP A;  3LBS A;  4F3P A;  2IA4 A;  3DEL B;  2Y7W A;  3K00 A;  3N26 A;  2XXI A;  5A5X B;  4NED A;  4MF3 A;  1YTV A;  2O1L A;  3PD8 A;  3ZS6 A;  3E9X A;  4ESW A;  4TQU Q;  1GR2 A;  4F22 A;  4POW A;  1LCF A;  4ESX A;  3L6G A;  1LAG E;  1GTK A;  2XX9 A;  3EHT A;  4OMB A;  2IEE A;  4N6P A;  4LVQ A;  1PDA A;  3IAZ A;  2HQ0 A;  3H6W A;  1Y4C A;  2F34 A;  4KPT A;  4YKP A;  2XXP A;  1A54 A;  3OO9 A;  4GL8 A;  4U4S A;  1UIU A;  2OWS A;  1XHY A;  4GXS B;  3SEU A;  3RTW B;  3VV5 A;  4FJP A;  3FV2 A;  3K1P A;  4ELR A;  1GGG A;  3IR1 A;  3HV1 A;  3UOR A;  4R6K A;  3CG3 A;  2QMX A;  4EDP A;  2E1S A;  1ZMG A;  1A40 A;  1Y4T A;  1I69 A;  4QF9 A;  3VE1 B;  4ND9 A;  3LUY A;  1MY1 A;  3M8U A;  2Y7P A;  1JW4 A;  3FAS A;  2RC9 A;  1M5E A;  3PV0 E;  2F7B A;  4H1X A;  3FVN A;  2REJ A;  4IO7 A;  5FTH A;  3TTL A;  4H0W A;  1NH7 A;  3TYH A;  2O7U A;  5F1Q A;  2Q88 A;  2XXW A;  2P2A A;  4U2R A;  1SYI A;  3QYT A;  5AA3 A;  3K1N A;  3JZJ A;  2XXQ A;  4F3S A;  5AA4 B;  4KYS A;  1DMB A;  3K6U A;  3ONM A;  5DVJ A;  2F35 A;  2H25 A;  3T96 B;  2ANJ A;  1JQF A;  5TPA A;  2BJJ X;  1B40 A;  3C33 A;  3MPL A;  1Y3P A;  2ESN A;  4G77 A;  2QPQ A;  2P1S A;  3KOT A;  3TOD A;  4GQO A;  4DE8 A;  2VD2 A;  3C32 A;  3G3H A;  1URS A;  3K02 A;  2OZZ A;  3BKI B;  3ILT B;  3M3K A;  4H8I A;  4H5G A;  1USY E;  3TKD A;  4DZ1 A;  1MQG A;  4XKQ A;  2R71 A;  3PPN A;  3JYR A;  4OVJ A;  1PBP A;  4EF2 A;  1FTM A;  2HZL A;  4YB7 A;  2F7A A;  1LST A;  3CSG A;  2XD3 A;  3FJG A;  4MH5 A;  4YZZ A;  2H99 A;  1QJM A;  1SI0 A;  5ICQ A;  4JWX A;  3S9L C;  4Q30 B;  4YKJ A;  4QRZ A;  1POT A;  1J1N A;  1FTO A;  1YCJ A;  1EH3 A;  1B46 A;  2XXX A;  5H8N A;  3V89 B;  4WEP A;  4EQB A;  1B51 A;  3MJN A;  4ELQ A;  2CMO A;  2Y7K A;  3IB0 A;  4GRK A;  5H8H A;  3QAX A;  5HM4 B;  5I59 B;  4U1O A;  3RNN A;  1MXV A;  1OLA A;  2I0B A;  3T93 B;  1AMF A;  4EF1 A;  1NNT A;  1SVX B;  1I6A A;  3LSX A;  2DOJ A;  4X9T A;  5DYH A;  5FHN A;  4TOZ A;  3T66 A;  1Z7N E;  1SD3 A;  3PPP A;  2I0C A;  1MY0 A;  2YJP A;  4M4G A;  5DT6 A;  3IO6 A;  1EZO A;  4IY6 A;  3SKP A;  3QK6 A;  2F8D A;  3JV9 A;  3TTR A;  4GLI A;  4FE8 A;  3VLV A;  1HSE A;  4EXL A;  3E4R A;  4YU0 A;  4G4P A;  2QJE A;  4BDR A;  3EHU A;  3QIM A;  4BDL A;  1DTZ A;  3E13 X;  3WAF A;  1PEB A;  2UVI A;  4PET A;  4FIM A;  1LFG A;  2HCA A;  3T22 A;  3S9N C;  3I6V A;  3HST A;  2DWH A;  1B1X A;  3GBA A;  2H4I A;  2VOZ A;  5ITP A;  3RGY A;  1N0T A;  3MWB A;  4JDF A;  4LA9 A;  4ZE9 A;  4LON B;  4ONY A;  1IXC A;  1O7T A;  1ZU0 A;  3T9X B;  2XX7 A;  4QFP A;  2HEU A;  2ZNS A;  4YIC A;  1P99 A;  2YPN A;  3THI A;  3TQW A;  1B2H A;  3QUJ A;  1MXU A;  1B0L A;  1M5D A;  1TT1 A;  3B7D A;  4RK2 A;  4RPN A;  1JEU A;  3MP8 A;  4X48 A;  4PP0 A;  3G3F A;  5FTI A;  2RF1 A;  2XXR A;  3R26 A;  3KN8 A;  5H8Q B;  5ITO A;  3OD7 A;  2PT1 A;  5EYF A;  1B0H A;  3PUV E;  3TMG A;  3MVW A;  1Q1K A;  1XC1 A;  5CMC A;  1QUI A;  3C31 A;  5K2Y A;  1Y3N A;  3IB2 A;  4JXI A;  3W9V A;  1B3G A;  3K6V A;  3PMV A;  3D4C A;  1UTB A;  3IOR A;  4LUB A;  4R73 A;  3SER A;  1N04 A;  1P1W A;  3O9P A;  4IO6 A;  3I5O A;  2ONS A;  4OQO A;  1AIV A;  1LFI A;  2ZYM A;  1P1Q A;  1MH4 A;  1JVX A;  4LQ2 A;  4OXV A;  2RCA A;  1D3K A;  3MC2 A;  2O1M A;  3O6I A;  3CIJ A;  3N94 A;  4Z7E A;  2O84 X;  1ATG A;  3PU5 A;  3DM0 A;  5JTY B;  3KSX A;  1JET A;  2ZYK A;  1B3L A;  4LZ5 A;  1MQH A;  3RT8 A;  1MPB A;  2A5S A;  3PD9 A;  4F2O A;  1M5B A;  5I58 B;  1MPD A;  3K2D A;  4MBP A;  1LB8 A;  1Z7M E;  4KFQ A;  4XKP A;  4H67 A;  5B70 A;  3A09 A;  3H3G A;  2QRY A;  3IJX B;  2VP1 A;  2XXT A;  4YMA A;  3VXC A;  4BDM A;  4KR5 A;  1WVJ A;  1MQJ A;  1S7Y A;  3FVK A;  4IO5 A;  4P11 A;  5DEX B;  3QUF A;  5KCJ B;  1N7X A;  1OLC A;  2QS2 A;  3DP8 A;  4O3B A;  4PFW A;  1URG A;  5J1D A;  3PMW A;  1D9Y A;  1MY4 A;  2O6A A;  4KYE A;  4PFU A;  3TDJ A;  4HCW A;  3PGF A;  1II5 A;  3PUZ E;  3KG2 A;  3MW0 A;  4KQP A;  3S9E A;  4DIG A;  5L8D A;  1MQD A;  4OZ9 A;  3CFZ A;  3LC8 A;  3B6W A;  3C35 A;  3IB1 A;  1WDN A;  4K3F A;  5CC2 A;  3QXM A;  4GOT A;  4QHQ A;  2XXV A;  3CVG A;  4ZEB A;  1OQH A;  4GD5 A;  3VXB A;  2Q9T A;  3RQT A;  3PPO A;  5LOM A;  1B52 A;  3TCF A;  4KYD A;  4XXU A;  2AL4 A;  5H8N B;  3GLB A;  1OIB A;  4JSO A;  1IQ7 A;  3K4U A;  4G68 A;  4YKK A;  4IO4 A;  2F78 A;  3HN0 A;  4U22 A;  3U94 A;  1MRP A;  2GH9 A;  4RK9 A;  4DDD A;  1CE2 A;  2D3I A;  4MLV A;  1RYX A;  1Y3Q A;  3UA8 A;  4G8M A;  3TFL A;  3MVX A;  5AA2 D;  1PBQ A;  1OMP A;  3PMX A;  2ZMB A;  4MLQ A;  4NF6 A;  5H8Q A;  3DP4 A;  4JB7 A;  1MQI A;  2YLN A;  2FNC A;  5KZT A;  3ODB A;  4LZ8 A;  1IZ1 A;  2NVU B;  1MM6 A;  1QUK A;  2GFE A;  2H98 A;  4FOR A;  5H8F B;  1L5T A;  1USY H;  4EQ7 A;  1FTL A;  4NF4 A;  5EHM A;  3U1O A;  3SES A;  1SI1 A;  4L17 A;  2DWI A;  3U72 A;  5I2N A;  4DXC A;  3TAJ A;  1N84 A;  4OEV A;  3KBR A;  4R9G A;  3OEM A;  5I2K A;  1VFE A;  5L9S A;  1VR5 A;  1VE4 A;  4OHN A;  2I4B A;  2OBG A;  4DCX A;  2NWJ A;  3V83 A;  1DOT A;  3T9V A;  3ILU B;  4FAT A;  1LAH E;  1R6Z A;  1B7Z A;  1HSJ A;  1IXI A;  3C9H A;  4NF4 B;  4U4X A;  3RUM A;  4N07 A;  3U8Q A;  5I58 A;  3EHS A;  3MQ9 A;  2B3B A;  1RKM A;  3TCH A;  1Y1Z A;  3LSF B;  2ALU A;  1R1N A;  4GIZ A;  4JSD A;  1BP5 A;  1TWY A;  3FUZ A;  5I59 A;  2VD3 A;  1A99 A;  2DYX A;  4XKR A;  2I49 A;  3GXA A;  2A5T B;  2H5Y A;  2KLF A;  3IK6 B;  3O6H A;  3U93 A;  1EZ9 A;  2OK2 A;  4OFL A;  1YAE A;  2V84 A;  1YPN A;  4PFY A;  2Z22 A;  4Q8R A;  4XIG Q;  5JK4 A;  3FV1 A;  1O64 A;  3A3C A;  4YMB A;  5ICT A;  1XS5 A;  3MVY A;  1B4H A;  3OEK A;  4IO3 A;  4R2B A;  3TZA A;  2I4C A;  5I56 B;  2R6G E;  4F1Y A;  4WXJ A;  4WED A;  2QL3 A;  2VGQ A;  3ECR A;  2Z8E A;  3KOS A;  4FEB A;  4NTL A;  1ZBM A;  4WKM A;  5H8H B;  1QKB A;  2ZXT A;  2DE4 A;  3KJT A;  1LBB A;  2OWT A;  3BFU A;  1LLS A;  4TLL B;  1AH5 A;  2ABH A;  3HCQ A;  4LP2 B;  4KI0 E;  4RPO A;  1SDX A;  1XVY A;  3ZSF A;  2FA7 A;  4I8C A;  3MZB A;  4NMY A;  4OEN A;  3VVD A;  2F6P A;  4H8J A;  1A8E A;  4HTG A;  2RKM A;  3PUW E;  4OER A;  4F18 A;  1MXZ A;  3M3F A;  3MBP A;  3BFT A;  2XXY A;  4LAT A;  4QFN A;  1LB9 A;  4G68 C;  4XKN A;  2DXR A;  4G68 B;  3SEY A;  1BKA A;  5B7D A;  1ANF A;  3FXR A;  2Z8D A;  3MP6 A;  1MM7 A;  3MZ1 A;  3MZ9 A;  2HXW A;  4GFR A;  2DE2 A;  4ZZE A;  3V5A A;  1UTH B;  1N3X A;  2XXU A;  2ONK E;  4GL0 A;  4R9F A;  3FVG A;  2XX8 A;  3H06 B;  3O2A A;  2WKY A;  3B6T A;  1I6B A;  1SQY A;  3FJM A;  3UIF A;  5H8F A;  4H6D A;  5CBS A;  5I84 A;  2X26 A;  4MFI A;  4PE5 B;  1MH3 A;  3EN3 A;  4M1V A;  4ZZA A;  3O28 A;  3G3I A;  1B5I A;  2XHD A;  1B32 A;  4LZ7 A;  3FGS A;  4IGT A;  1QUJ A;  4Q5T A;  4G8H A;  1T0K A;  1MDQ A;  2G29 A;  3MVZ A;  1IXG A;  3H4Z A;  1FTK A;  4F3B A;  4ZEC A;  4HW8 A;  3RTF B;  2ONR A;  1ZJL A;  4JWY A;  1FQA A;  1CB6 A;  1S50 A;  4GXA A;  5I2K B;  4ECF A;  5CMK A;  2D21 A;  1P1N A;  2DQV A;  2I3W A;  3CFX A;  3O29 A;  1FTJ A;  1TFD A;  3Q27 A;  4RXL A;  3MPK A;  3MAM A;  2QMW A;  4ISU A;  3ZKK A;  3S9M C;  2F97 A;  5HBC A;  4UAC A;  5BWJ A;  4G8N A;  1VFD A;  3C34 A;  4NF6 B;  2PMS A;  3HHG A;  4ELO A;  4F1V A;  2G93 A;  4RJZ A;  1LGB C;  2W7Y A;  3H03 A;  5H8S A;  5KDT B;  1EU8 A;  4NWC A;  3H6U A;  1B4Z A;  2THI A;  3LSL A;  5DVI A;  4DLD A;  2QS3 A;  3VFJ A;  4GF8 A;  4F29 A;  4BLA A;  3IO4 A;  4RNS A;  5FHO A;  3RN8 A;  4QSC A;  2Q8J A;  4R6Y A;  1H45 A;  3IOU A;  3ZKL A;  4BDN A;  5I56 A;  2H9B A;  2P0S A;  4X1B A;  3IL1 B;  1DPP A;  1NNK A;  4BDO A;  1NNF A;  1HSL A;  1H76 A;  2O7I A;  4FED A;  4OES A;  4P0I A;  5I57 B;  2D5W A;  3V8X B;  4ZEF A;  2NXO A;  3SET A;  4E0W A;  2I48 A;  3UN6 A;  3S4U A;  2B3F A;  1OQG A;  1NH8 A;  1NL5 A;  4QFL A;  5AA2 B;  1GV8 A;  2V3U A;  5EHS A;  1FQC A;  3TEP A;  4KD5 A;  3H7M A;  3OOA A;  4UA8 A;  1UQW A;  1LAX A;  4FAJ A;  2RC7 A;  2UYE A;  3N5L A;  2PX1 A;  3F11 A;  1B7U A;  3EF7 A;  5IAI A;  4QSE A;  3N6U A;  2I58 A;  3VVF A;  1H44 A;  4U21 A;  3KN3 A;  2V3Q A;  1D4N A;  1R9L A;  4R6H A;  4YB5 A;  1IEJ A;  3Q29 A;  3VLW A;  1H43 A;  1B5J A;  4N13 A;  2OJT A;  1MXW A;  3H6T A;  3IOT A;  3Q26 A;  4DCY A;  1UTH A;  1B6H A;  5FHM A;  1I6Q A;  1OVB A;  2Q2C A;  1XOC A;  2E0S A;  2M8C A;  3K01 A;  4R2F A;  3TTK A;  5AA4 A;  2HAV A;  4P0G A;  1FQE A;  1H3D A;  4H65 A;  1D9V A;  4DXB A;  1BLF A;  3K6X A;  1KWH A;  3C36 A;  3OEN A;  4H5F A;  3RY3 A;  1OVT A;  4AB6 A;  4F39 A;  1LAF E;  1DTG A;  3BBR A;  3TCG A;  3UK4 A;  4YKI A;  3VDF A;  2QSX A;  2Y84 A;  3Q25 A;  2OLB A;  5K2X A;  1Y1M A;  2F36 A;  3SEV A;  1S9T A;  3M3L A;  1B3F A;  4THI A;  3O6G A;  5M2V A;  2Z8F A;  2ZYO A;  3T9U A;  4OTE A;  5DTB A;  3FVO A;  4ZE8 A;  1SW4 A;  2O68 A;  4NWD A;  3W9W A;  1VSO A;  3HHF A;  1B1H A;  2LAO A;  1N76 A;  3MP1 A;  1UTB B;  3OXN A;  4OET A;  4IGR A;  1MY2 A;  5AE4 A;  2DVC A;  1ZIU A;  4YB6 A;  1PB7 A;  2DXY A;  1NMU A;  3CG1 A;  3USD A;  1US5 A;  3KGC A;  3KSJ A;  4R74 A;  5KDT A;  3S2V A;  1MDP 1;  2XD2 A;  2V93 A;  2RC8 A;  3CFL A;  4RY1 A;  4U1Z A;  3FIR A;  3K0V A;  2QS4 A;  3SEW A;  3SEX A;  1A55 A;  5HPQ A;  2PYY A;  1B5H A;  2DP8 A;  1MXX A;  3OEL A;  4I9D A;  3HO7 A;  4EXK A;  1IUD A;  2ZNU A;  3OMB A;  3FXU A;  3PUY E;  5TP9 B;  1TXF A;  1MY3 A;  3QSL A;  4JBZ A;  3I3V A;  4QSD A;  1A8F A;  1PB8 A;  1MS7 A;  3PPR A;  3KJ7 A;  1Y9U A;  3IOW A;  1FCK A;  3IX1 A;  4DXU A;  2NOO A;  2AL5 A;  2AIX A;  4NF5 A;  1QKA A;  1O63 A;  2PBW A;  4OFO A;  3B6Q A;  5KCJ A;  5L9O A;  4LQ5 A;  3PUX E;  4OYV A;  4GVO A;  3HPI A;  3OSR A;  4Q0C A;  4I62 A;  1AL3 A;  2CZL A;  1PB9 A;  1SYH A;  5CMB A;  3TPA A;  2F7C A;  4E0X A;  5JTY A;  2HFB A;  1JEV A;  3U92 A;  1B05 A;  4C1U A;  2RCB A;  3KZG A;  1LCT A;  4PQJ A;  3TQL A;  1F9B A;  1N7W A;  1XT8 A;  2B65 A;  2I3V A;  3UP9 A;  4C0R A;  1LFH A;  1QW0 A;  2PVU A;  2R9J A;  3FD3 A;  3H6V A;  4NF8 B;  3R7X A;  2VHA A;  1GVC A;  1IXH A;  4JWO A;  3CSB A;  5ELV A;  3OSQ A;  4KCC A;  2DWA A;  2DE3 A;  3EQ1 A;  3UGW A;  4XTC Q;  1ZLQ A;  4C1T A;  2F5X A;  2Y7I A;  2FYI A;  2DS9 A;  1TFA A;  3FZV A;  3MUQ A;  1FQD A;  5CMM A;  4FEC A;  4F19 A;  4NF8 A;  3KFM A;  4F1U A;  5I57 A;  1ELJ A;  1M5F A;  1BTJ A;  1QVS A;  3FJ7 A;  3O97 A;  2UXA A;  5DVF A;  5AA1 A;  4AQ4 A;  3G3K A;  4ELP A;  4OEU A;  4R72 A;  4HS7 A;  2Q2A A;  4NE4 A;  4F2Q A;  5AA2 A;  1ZKB A;  2GRV A;  1LBC A;  2O51 A;  3W15 C;  4ZDM A;  1Q35 A;  2Q89 A;  4TLM B;  1ZTY A;  2NUV A;  2OCU A;  4U23 A;  3RT6 B;  3VVE A;  1MPC A;  1R9Q A;  3TTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...