4G4PA

Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
235
Chain Sequence
HHGENLYFQGMEGKKYTIGTDLTFAPFEFQDSKGKYIGIDVDLLDAIAKDQDFEVDLKPLGFDSAVQAIQSKQIDGMIAGMSITDERKKSFDFSDPYFDSGLQLAVKKGNDKIKSYDDLKGKTVAAKVGTESANFLEKNKEKYDYTIKNFDDATGLYKALENGEADAIVDDYPVLGYAVKNGQKLQLVGDKETGSSYGFAVKKGQNPELIKKFNAGLKNLKDNGTYDKILNNYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid ABC transporter, amino acid-binding/permease prot
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transport protein
total genus 77
structure length 235
sequence length 235
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g4pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g4pA02
1MM7A 3OO8A 4QRZA 4OFLA 3EHSA 4YKJA 4MH5A 3TCGA 3FJGA 1MXYA 2VGQA 3JZJA 3TUSA 3T9HB 4MLVA 5L9SA 2PMSA 1J1NA 2ZNSA 2Q89A 3PPNA 1OMPA 5CMKA 3ZKKA 2PT2A 3UA8A 3F11A 1JVXA 2D21A 4U21A 4KYSA 1ZMGA 4GWOA 5IKBA 1RYOA 3U92A 4KYEA 3MQ9A 3KFMA 4EQ7A 2I4BA 2Y7WA 1N3WA 3GLBA 2ZYKA 3C4MA 3SEYA 3O97A 1TWYA 5JTYB 3S4UA 5CBSA 3TAJA 4BDRA 4NF8B 2HAVA 5AA2D 5DVFA 1PB8A 4G8NA 3TPAA 5EHSA 4F1UA 1YPNA 3T93B 2V93A 4EF1A 4LONB 1B5HA 4JWXA 2RF1A 1UTBA 2XX9A 2NXOA 4G4PA 4R2FA 2I3WA 3FD3A 2I0CA 4RPOA 2I4CA 3A3CA 4PP0A 3TODA 5H8SA 4NF6A 1SQYA 4H1XA 2GH9A 1FQEA 3FJMA 2AL4A 5DEXB 4F2QA 1XC1A 4YAHX 1SDXA 2AL5A 2XXUA 1XVXA 4OYVA 5I57B 4JBZA 1MRPA 3K1NA 2ZXTA 3OOAA 1POY1 3CVGA 4XKNA 4H0WA 3QYTA 5JEIA 3H4ZA 1B0HA 4KD5A 5F7VA 4TLMB 1Z7ME 3ECRA 1FTJA 4PFWA 5I2KA 4GRKA 1JEUA 4WEPA 2XXIA 2CMOA 1QKAA 3MVZA 3C35A 4G68B 2F6PA 4RA1A 3C32A 3CI8A 1FTKA 4JB7A 2UVGA 2XXVA 4YB5A 1B58A 5BWJA 3T9VA 4F18A 4R6YA 1Y4TA 4LZ7A 5K2YA 1MH3A 2CZLA 4JDFA 3CSGA 4OETA 1A40A 5KDTA 2FA7A 1B1HA 1Z7NE 3OELA 4X9TA 4IO6A 3QK6A 3H6TA 4YB7A 3A3UA 3N5LA 1BLFA 4ZZAA 3Q28A 3LSWA 4ZEBA 4I8CA 3FZVA 3M3FA 1PBQA 4U2RA 4U1ZA 2R9JA 4KPTA 2LAOA 1ZLQA 4ELOA 4QSEA 2Q2AA 2R71A 3LSFB 3IJOB 3EQ1A 1XT8A 4POWA 4H8IA 3OXNA 3JV9A 3PD9A 2D3IA 3VVDA 2QS4A 1MM6A 4OFJA 4KCCA 4TLLB 4X1BA 1QUIA 4DXUA 4H5FA 2ZYMA 5B7DA 1NFTA 2YPNA 1OLCA 4OFOA 1H43A 4RK2A 1A8FA 3RLFE 3PGFA 3FVNA 3G3FA 2XXYA 3E9XA 4ZE8A 5FHNA 3B6QA 5CI5A 2OCUA 3V8XB 1N7XA 4DXCA 4Z0IA 3TQLA 1UTBB 1YTVA 3OO9A 2QPQA 2BJJX 1GVCA 3W15C 3IB0A 3VXCA 2UYEA 1NNFA 2VP1A 4I1DA 3CFXA 4C0RA 1HSLA 1N04A 4FIMA 5JK4A 5HM4B 1D9VA 5I56A 4AB5A 1A8EA 4KHZE 3PPRA 4C1UA 4NF6B 2DVCA 1LGBC 1TT1A 3EN3A 1AOVA 4QFPA 5TU0A 1NKXA 3K02A 1PC3A 5L9MA 5I59A 4GXAA 3T9UA 1NH8A 4O3AA 1LAXA 4OESA 4OQOA 4H67A 4QHQA 4RPNA 3GZGA 1XHYA 1GV8A 4ZEKA 4ZZEA 1UTHA 1JVYA 4YKIA 4Q30B 3TDJA 2FYIA 3SEXA 4C1TA 2AYSA 3K6VA 5B70A 3FUZA 1DTGA 3K1PA 4F2OA 2VHAA 1RKMA 3RN8A 3Q26A 4FAJA 2NOOA 4NMYA 1SYHA 3JYRA 3C36A 1MQGA 1M5EA 4NE4A 1OVTA 4F3SA 2X26A 1SI1A 3MPKA 2RCAA 3KOTA 3RNNA 5KDTB 4F3GA 1B1XA 3RT6B 3PUYE 1UQWA 2Z23A 1R1NA 3O28A 3UIFA 1JW1A 4P0GA 1LAHE 2DE4A 4G8HA 2OLBA 1SW1A 4R9GA 4F19A 2A5SA 2HQ0A 3IX1A 3N6TA 4KYDA 3O66A 3K1MA 2O84X 3TFLA 1IEJA 3MJNA 1US4A 3RGYA 3IJXB 1AMFA 2GFEA 1ATGA 3O6IA 1IIWA 3SETA 4E0WA 4JXIA 4I9DA 1GTKA 2UYFA 3TZAA 4EF2A 1JW4A 3K4UA 2QRYA 4FJPA 5KCJA 2W7YA 4K3FA 2QMWA 1MY0A 4G8MA 4YICA 4R9FA 4F29A 1FW0A 2OK2A 4DLDA 4HTGA 4ZE9A 3M8UA 5ICQA 2V3QA 3FGSA 2DWHA 5TPAB 4F22A 3RT8A 1CB6A 2F35A 3SERA 3UK4A 1N76A 3QIMA 3VVEA 1OIBA 1IITA 3VLWA 5HBCA 4OZ9A 1MS7A 4YKPA 4FEDA 4R6KA 1I6AA 3I6VA 3H03A 1AIVA 3FATA 1IXIA 2QSXA 2X7QA 5DTBA 1QW0A 2FNCA 3FIRA 4BLAA 4IO5A 2F97A 4KCDA 3T9XB 2HZLA 4R72A 2GRVA 3BFTA 3TCHA 2G93A 3PPOA 4OMBA 4G77A 4HCYA 1B46A 1H44A 2DWAA 4ELRA 1QJMA 4ELQA 5I59B 2QS3A 2DXRA 2F34A 1LSTA 4YMBA 3U8QA 4GL8A 4MFIA 4RNSA 3FVOA 2DS9A 4O3CA 2Y84A 3EHTA 1DSNA 1FCKA 1UTHB 2XXTA 1L5TA 3IAZA 1CE2A 1MXVA 3VDFA 3O6HA 3EPEA 4KFQA 2DSFA 2ESNA 2D5WA 4E0XA 1ZBMA 2O7IA 1R9QA 4HW8A 3IB2A 2QS1A 2O1MA 1I6QA 3HPIA 2XX8A 1NNTA 4NWDA 2XXPA 1B7HA 2XXHA 4F31B 1R9LA 1VSOA 3UGWA 1P1QA 1IUDA 3B6WA 4LP2B 2YLNA 1EZ9A 3E3KA 1Y20A 3P7IA 3S9EA 4H6DA 3CG1A 4GFRA 1ZIUA 3U1OA 3VLVA 1BP5A 1LFHA 5H8HA 4IB2A 3MVXA 4ND9A 1FQBA 4N6PA 3TELA 1SD3A 1SBPA 5AA4A 1MXXA 2PX1A 4PFTA 3V83A 4BDMA 1BTJA 3Q29A 2H5YA 5ITOA 2DP8A 1UIUA 2V3TA 4Q0CA 5AE4A 2I58A 4U22A 4DCYA 3G3GA 1LFIA 1OVBA 3WAEA 1URDA 2H4IA 4R73A 1B52A 3V5AA 3C33A 4EXKA 3TTRA 4DE8A 4HS7A 4LZ8A 3ILUB 3B6TA 1Y3QA 3TMGA 1B7ZA 4M1VA 4QFNA 4KR5A 3MZ1A 2ZNUA 3HO7A 4NF4A 5CRYA 3K0VA 1FQFA 2F6GA 4N07A 1LBBA 2A5TA 1TXFA 4NTLA 5LOMA 3BFUA 3DLNA 4GXSB 2XHDA 4X1DA 2Q2CA 3G3IA 4Q5TA 2IEEA 2O51A 4XKQA 1XS5A 3IB1A 3IL1B 3LSLA 3DELB 4DCXA 1Y3NA 5DVIA 2B3FA 2I3VA 2GHBA 3DP4A 1PB7A 4EDPA 3MWBA 3V89B 5I58A 2Y7PA 4DIGA 1JNFA 2DVZA 2DYXA 3N26A 5EHMA 3KN8A 5DYHA 1EZPA 3KBRA 2OZZA 2ZYOA 3KSJA 3HCQA 2Y7RA 3T22A 2DE2A 1MPCA 5BUUA 1TFAA 2I48A 5L9OA 1NH7A 1LBCA 2ANJA 3KG2A 1B5JA 1NNPA 4QSDA 2F8DA 3PD8A 3IR1A 1QKBA 3HHFA 1B6HA 3E13X 2F7BA 3R26A 2F78A 3BBRA 2NWJA 5M2VA 3KGCA 3KJTA 1LLSA 4IO3A 1VR5A 1S50A 1Q35A 2Z8EA 2RINA 2Q88A 3DP8A 4RYAA 4JWYA 1BKAA 1B3EA 3CR9A 3KEIA 4KI0E 3SEWA 2HCAA 5AA2A 3OENA 3G3KA 4X48A 4XTCQ 1XVYA 1WDNA 1SYIA 1LFGA 1IXHA 1B3GA 3TQWA 4ISUA 1EH3A 2OWSA 3FXQA 3SDFA 2Y7IA 2V84A 2OWTA 2ALUA 4PE5B 3PPPA 3IOTA 2B65A 3MBPA 1AL3A 5A5XA 1A7LA 3U93A 5H8QA 3T96B 1MQIA 3H6WA 1I6BA 2REJA 5H8HB 3PUXE 4GQOA 3HV1A 5DVJA 4G2ZA 1SW5A 2ABHA 4RY1A 5AA4B 4EQBA 3MUQA 3I3VA 4ELPA 1B40A 2F7AA 3M3LA 1FTOA 2PYYA 2PT1A 3RUMA 3N6UA 4JWOA 4GF8A 3VE1B 3H7MA 1RYXA 2H98A 3KN3A 3KJ7A 2VOZA 5FHMA 5FHOA 1OLAA 3C31A 4NF4B 5I2KB 3KZGA 1B5IA 1LB9A 4OXVA 2A5TB 3O2AA 1AH5A 3TKDA 4N13A 4BDLA 1A54A 3D4CA 3HSTA 3K01A 3IO6A 1MPBA 2G29A 2QJEA 2XXQA 3ILTB 4H5GA 1M5CA 3D4GA 4BDNA 2OBGA 1I69A 3OSRA 2UVHA 4LZ5A 3PMXA 4GL0A 2Z8DA 1OQGA 4WXJA 5FTHA 2KLFA 3CG3A 5CMBA 3VLUA 3CIJA 2ZYNA 2XX7A 3E4RA 4FATA 5H8NA 3H3GA 3O6GA 3LBSA 1B2HA 4PFUA 2XD3A 1QULA 1MPDA 1B7UA 1USYE 1FTMA 4IY6A 3GBBA 1PDAA 4GLIA 2P2AA 4P11A 4QFOA 3ZKLA 5IAIA 2O1LA 2R6GE 1XOCA 4L17A 2OJTA 4YKKA 1FTLA 2DWIA 4QF9A 3SEVA 3VFJA 3U72A 1II5A 1M5DA 3PMVA 1ZJLA 4WEDA 4G68A 4F39A 4XIGQ 5A5XB 5H8QB 3OSQA 3R7XA 1VFDA 2O68A 4UACA 1B0LA 3ZS6A 1FQDA 4ONYA 5I56B 3FV2A 2P0SA 1MY4A 4IO4A 1MXWA 2YJPA 1N84A 4NWCA 3CFLA 3L6GA 3W9WA 1D4NA 1MQJA 3EHUA 1LCTA 3EF7A 3RY3A 4YZZA 1US5A 3QAXA 1WVJA 3AXFA 1IZ1A 2XXXA 3L6HA 1IXCA 3A09A 2AIXA 2HEUA 4POXA 5CMCA 3Q25A 3TEPA 1SVXB 4PETA 3TTLA 1ANFA 2PBWA 3UN6A 2H9BA 3FVKA 4F1VA 4U4SA 1HSEA 1M5FA 3C34A 4FE8A 3H06B 2P1SA 3FXRA 4ECFA 3W9VA 3QUFA 2O6AA 1MQDA 4LQ2A 4UA8A 4IO7A 2ONKE 4H65A 2UVJA 3CRBA 5L8DA 2RKMA 3VXBA 4Q8RA 2M8CA 4FEBA 4ZDMA 4IGRA 1IQ7A 4QFKA 4DDDA 4TOZA 1URGA 4U1OA 3MVWA 1HSJA 3PU5A 5I2NA 3G3HA 5ITPA 4RXLA 4QFLA 2UVIA 1ELJA 1SW2A 3R6UA 5TP9A 3H6VA 2ONRA 3MP1A 4U4XA 1Y4CA 2E1SA 1PB9A 3G3JA 1NNKA 1MG1A 1ZU0A 1Y1ZA 1POTA 4NF5A 2VD3A 1B9JA 1D9YA 2O69A 5H8NB 2E0SA 3PMWA 1SW4A 3ONMA 4F3BA 3MZ9A 4I62A 3K2DA 3Q27A 3THIA 2RC9A 5AA1A 3PUWE 4XKRA 3TYHA 4OWDA 1MY2A 2REGA 3IK6B 4M4GA 1VFEA 5ICTA 2THIA 4ESWA 5CM6A 4IGTA 1EZOA 1LAFE 3HN0A 4R74A 1B05A 3FJ7A 4HCWA 4YU0A 5KCJB 2B3BA 3CSBA 4LA9A 1YCJA 2Z8FA 1FQCA 5CC2A 1EU8A 4F1YA 1O7TA 2QMXA 3HHGA 4IY5A 4LUBA 2I6EA 1OQHA 2VD2A 1QVSA 1GGGA 4RK9A 5KZTA 4ZECA 3B7DA 3MW0A 1JQFA 1QUJA 1H3DA 3VVFA 3FXUA 3OEMA 2XXRA 5H8FA 1T0KA 3OO7A 5ELVA 2QS2A 4QSCA 2HFBA 4OEVA 3O29A 4MLQA 5EYFA 1F9BA 4EXLA 3K00A 4EQ9A 3S9MC 1S9TA 3SKPA 2V25A 2H99A 3FASA 4OTEA 4GIZA 4G68C 4O3BA 1Y9UA 4KQPA 4NEDA 2ONSA 1B4HA 4FORA 4DZ1A 2NVUB 1N3XA 3SEUA 2DE3A 5FTIA 3ZSFA 1D3KA 4R6HA 3S9NC 3MPLA 4MF3A 1Y1MA 4OHNA 4R75A 2NUVA 3RTWB 4OVJA 3UP9A 3KN7A 4GD5A 4LVQA 1MY3A 2UXAA 1A99A 4F3PA 3PUZE 1URSA 1DPEA 4ZEFA 5HPQA 2O7UA 3OEKA 3GXAA 2DOJA 2Q9TA 3MC2A 3IORA 1ZKBA 4H8JA 1O63A 2QL3A 3LR1A 3M3KA 1DPPA 5F1QA 5TPAA 3LC8A 1ZTYA 4PFYA 1Q1KA 4ESXA 5I2NB 2F7CA 2V3UA 3FV1A 3CFZA 1P1OA 5AA3A 5TP9B 4AB6A 3K6UA 3O9PA 3SESA 3S2VA 4Z7EA 1B3HA 4NF5B 4DXBA 3UORA 1BIYA 1USYH 3TTKA 4ZEDA 2IA4A 1YAEA 2HXWA 2DWJA 1R6ZA 3RTFB 1MH4A 3FVGA 1H76A 3K6XA 1NL5A 4XXUA 3QXMA 1B3FA 4ZS9A 3RPWA 3DM0A 1B32A 3IOUA 4EUOA 4U23A 4WKMA 1VE4A 2F36A 4FECA 3K6WA 5ISUA 1MY1A 1A55A 1M5BA 1QUKA 1N0TA 5J1DA 1LCFA 2RC8A 4IO2A 1MXZA 3IOVA 5JTYA 3QSLA 4YB6A 1GR2A 1PBPA 5CMMA 1O64A 3G7WA 4PQJA 4NF8A 1P1WA 4ZEIA 3OO6A 1DMBA 1H45A 2F5XA 3USDA 3MP8A 3PPQA 3I5OA 5K2XA 1P99A 3MP6A 5I58B 1WODA 2DXYA 3N94A 5H8FB 4BDQA 1MDP1 2RCBA 2X7PA 4LATA 1SI0A 2HAUA 3TTMA 3LUYA 3VV5A 5DT6A 3U94A 5I84A 3MVYA 3KSXA 2DQVA 2Z22A 1DOTA 3RQTA 3TCFA 1B3LA 1UIVA 2I49A 1LB8A 5CBRA 4OEUA 1B4ZA 4LQ5A 3WAFA 4GOTA 1DTZA 2GHAA 3LSXA 1Y3PA 2ZMBA 4OERA 2XXWA 3C9HA 4MBPA 1B51A 1MXUA 1FQAA 3KOSA 5DEXA 1P1UA 4RJZA 4R2BA 1JETA 4OENA 1JW5A 3OD7A 3S9LC 5I57A 2WKYA 2Q8JA 1JEVA 1MQHA 1N7WA 3ODBA 5AA2B 4P0IA 1P1NA 3MZBA 2I0BA 4JSOA 2RC7A 2Y7KA 1IXGA 2XD2A 4YMAA 3T66A 3OMBA 3TTNA 3BKIB 3MAMA 1PEBA 3QUJA 1S7YA 1TFDA 3H6UA 4GVOA 3DP6A 3PUVE 4JSDA 4TQUQ 3PV0E 1KWHA 1MDQA 4BDOA 2PVUA 1LAGE 3IO4A 1NMUA 4AQ4A 3IOWA 3GBAA 2H25A 2HZKA 4XKPA 2ZNTA 4THIA
chains in the Genus database with same CATH superfamily
1MM7A 3OO8A 4QRZA 2FIEA 4QBAA 4OFLA 3EHSA 1FBCA 4YKJA 4MH5A 3TCGA 3FJGA 1MXYA 2QVUA 2VGQA 3JZJA 3TUSA 1D9QA 4JVIA 3T9HB 4MLVA 5L9SA 2PMSA 1J1NA 2ZNSA 4PAIA 2Q89A 1IMFA 3PPNA 4N4UA 1OMPA 4PF6A 4N8GA 5CMKA 3PTYA 3ZKKA 2PT2A 2XWIA 2ZZVA 3UA8A 3F11A 1G0IA 1JVXA 2D21A 4U21A 4KYSA 1ZMGA 4GWOA 5IKBA 4P9KA 1RYOA 3U92A 4OVTA 4PTKA 4KYEA 3MQ9A 3KFMA 3RPLA 4EQ7A 2I4BA 2L5VA 2Y7WA 1N3WA 3GLBA 2CZKA 2ZYKA 3C4MA 3SEYA 3O97A 1LBVA 1TWYA 5JTYB 3MSTA 2WBDA 3S4UA 1EYKA 2FHYA 4MJOA 4PC9A 5CBSA 3TAJA 4BDRA 4NF8B 2HAVA 5AA2D 5DVFA 1PB8A 4G8NA 3TPAA 2VPNA 4NAPA 5EHSA 4GBWA 4F1UA 1YPNA 3T93B 2V93A 4EF1A 4LONB 1B5HA 4JWXA 2RF1A 1UTBA 2BJIA 2XX9A 2NXOA 4G4PA 4R2FA 4I3YA 2I3WA 3FD3A 2I0CA 4RPOA 2I4CA 3A3CA 4PP0A 3TODA 5H8SA 4NF6A 4IR8A 1FPJA 1FPLA 1SQYA 4H1XA 2GH9A 4H45A 5IGAA 1FQEA 3FJMA 2AL4A 5DEXB 4F2QA 1XC1A 4YAHX 1SDXA 2AL5A 2XXUA 1XVXA 4OYVA 3BIGA 5I57B 4JBZA 1MRPA 3K1NA 1FBGA 2ZXTA 3OOAA 1POY1 3CVGA 4XKNA 4H0WA 3QYTA 5JEIA 3H4ZA 1B0HA 4KD5A 1FRPA 5F7VA 4TLMB 1Z7ME 3ECRA 1FTJA 4PFWA 5I2KA 4GRKA 1JEUA 4WEPA 2XXIA 2CMOA 1QKAA 3MVZA 3C35A 4G68B 2F6PA 4RA1A 3C32A 3CI8A 1FTKA 1K9YA 4JB7A 2UVGA 2XXVA 4YB5A 1B58A 5BWJA 3EKIA 3T9VA 4F18A 4R6YA 1Y4TA 4LZ7A 5K2YA 1MH3A 2CZLA 4JDFA 3CSGA 4OETA 1A40A 5KDTA 2FA7A 1B1HA 1LBYA 1Z7NE 3OELA 4X9TA 4IO6A 3QK6A 3H6TA 4YB7A 3A3UA 3N5LA 1IMDA 1BLFA 4ZZAA 3Q28A 3LSWA 4ZEBA 4I8CA 3FZVA 3M3FA 1PBQA 4U2RA 1NV4A 4U1ZA 2R9JA 4LN5A 4KPTA 2LAOA 4O7IA 1ZLQA 4ELOA 4QSEA 2Q2AA 2R71A 4XFEA 4PFIA 3LSFB 3IJOB 3EQ1A 1XT8A 2HPGA 1LBZA 4POWA 1IMCA 4GWWA 4H8IA 3OXNA 3JV9A 3PD9A 2D3IA 5IZ3B 2VPOA 3VVDA 2QS4A 1MM6A 4OFJA 3D1RA 4KCCA 4TLLB 3RPLB 2B4LA 1YYZA 4X1BA 1QUIA 4DXUA 4H5FA 2ZYMA 4PAFA 5B7DA 1NFTA 2FBPA 2YPNA 4N8YA 1OLCA 4OFOA 1H43A 4RK2A 1A8FA 3RLFE 3PGFA 4GWYA 3GYYA 3FVNA 4MNIA 3G3FA 2XXYA 3E9XA 4ZE8A 5FHNA 3B6QA 5CI5A 2OCUA 3V8XB 4AS5A 1N7XA 1FPKA 4DXCA 4Z0IA 3TQLA 1UTBB 1YTVA 3OO9A 2QPQA 2BJJX 1GVCA 3W15C 3IB0A 3VXCA 2UYEA 1NNFA 2VP1A 4I1DA 3CFXA 4C0RA 1XI6A 1HSLA 1N04A 4FIMA 5JK4A 5HM4B 3SZPA 1D9VA 5I56A 4AB5A 5EQAA 1A8EA 4KHZE 3PPRA 4C1UA 4NF6B 2DVCA 1LGBC 1TT1A 3EN3A 1AOVA 4QFPA 5TU0A 1NKXA 3K02A 4KXPA 1PC3A 1CNQA 5L9MA 5I59A 1FPIA 4GXAA 3T9UA 1NH8A 4O3AA 1LAXA 4OESA 4OQOA 4H67A 4QHQA 4RPNA 3FXBA 3GZGA 4GWZA 1XHYA 1GV8A 4ZEKA 1G0HA 4ZZEA 1UTHA 2B4MA 1JVYA 4YKIA 4GX3A 4Q30B 3TDJA 2FYIA 3SEXA 4C1TA 2AYSA 3K6VA 5B70A 3FUZA 4PBHA 1IMEA 1FBHA 1DTGA 3K1PA 4MCOA 4F2OA 2VHAA 1RKMA 3RN8A 1FPFA 3Q26A 4FAJA 4NG7A 2NOOA 4NMYA 1SYHA 3JYRA 3C36A 1MQGA 1M5EA 4NE4A 1OVTA 4F3SA 2X26A 1AWBA 1SI1A 3MPKA 2RCAA 3KOTA 3RNNA 5KDTB 2Y5KA 4F3GA 1B1XA 3RT6B 3PUYE 4DI4B 1UQWA 2Z23A 1R1NA 3O28A 3UIFA 1JW1A 4P0GA 1LAHE 2DE4A 4G8HA 2OLBA 1SW1A 4R9GA 4F19A 2A5SA 2HQ0A 3B8BA 3IX1A 3N6TA 3QMFA 4KYDA 3O66A 3K1MA 2O84X 3TFLA 2PFYA 1IEJA 3MJNA 1US4A 1FTAA 3RGYA 3IJXB 1AMFA 2GFEA 1ATGA 2XWVA 3O6IA 1IIWA 4HE2A 3SETA 4E0WA 4JXIA 1DBZA 4I9DA 1GTKA 2UYFA 3TZAA 4EF2A 1JW4A 1KA0A 3K4UA 2QRYA 4FJPA 5KCJA 2W7YA 4K3FA 2QMWA 1MY0A 4G8MA 4GBVA 4YICA 4R9FA 4F29A 1FW0A 2OK2A 4DLDA 4HTGA 4ZE9A 3M8UA 5ICQA 2V3QA 3FGSA 2DWHA 5TPAB 4F22A 4O7MA 3RT8A 3IFCA 1CB6A 2F35A 3SERA 3UK4A 1N76A 3QIMA 3VVEA 1OIBA 1IITA 3VLWA 5HBCA 4OZ9A 1MS7A 4YKPA 4FEDA 4R6KA 1I6AA 3I6VA 3H03A 3RYDA 1AIVA 3FATA 1IXIA 2QSXA 2X7QA 5DTBA 1QW0A 2FNCA 3FIRA 2WYKA 5IZZA 4BLAA 4IO5A 2F97A 4KCDA 3T9XB 3U65A 3CHGA 2HZLA 4R72A 2GRVA 3BFTA 3TCHA 2G93A 3PPOA 4OMBA 4G77A 4HCYA 4OVSA 4UABA 1B46A 1H44A 2DWAA 4O94A 1QJMA 4ELRA 4ELQA 5I59B 2QS3A 2DXRA 2F34A 1LSTA 2FVZA 4YMBA 3U8QA 4GL8A 4MFIA 4RNSA 3FVOA 2DS9A 4O3CA 2Y84A 3EHTA 1DSNA 1FCKA 1UTHB 2XXTA 1L5TA 3IAZA 1CE2A 1MXVA 3VDFA 3O6HA 3EPEA 4KFQA 2DSFA 2ESNA 2D5WA 4E0XA 1ZBMA 4NHBA 2O7IA 1R9QA 4HW8A 3IB2A 2QS1A 2O1MA 1I6QA 5ESYA 3HPIA 2XX8A 1NNTA 4NWDA 2XXPA 1B7HA 2XXHA 4F31B 4PFBA 1R9LA 1VSOA 3UGWA 1P1QA 1IUDA 3B6WA 4LP2B 3A29A 4QXDA 2YLNA 1EZ9A 3E3KA 1Y20A 3P7IA 3S9EA 4H6DA 2FIXA 3CG1A 4GFRA 1ZIUA 3U1OA 3VLVA 1BP5A 1LFHA 5H8HA 4PF8A 4IB2A 3MVXA 4ND9A 1FQBA 4N6PA 3TELA 1SD3A 1SBPA 5AA4A 1MXXA 2PX1A 4PFTA 3V83A 4BDMA 1BTJA 3Q29A 2H5YA 5ITOA 2DP8A 4I40A 1UIUA 1IMAA 2V3TA 4Q0CA 5AE4A 2I58A 4U22A 4DCYA 3G3GA 1LFIA 1OVBA 3WAEA 1URDA 2H4IA 4R73A 1B52A 3V5AA 3C33A 4EXKA 3TTRA 4DE8A 5I5PA 4HS7A 4N15A 4LZ8A 3ILUB 3B6TA 1Y3QA 3TMGA 1B7ZA 4P8BA 4M1VA 4QFNA 4KR5A 3MZ1A 2ZNUA 3HO7A 4NF4A 1YZ0A 5CRYA 3K0VA 1FQFA 2F6GA 4N07A 1LBBA 2A5TA 1TXFA 4NTLA 5LOMA 3BFUA 3DLNA 4GXSB 2XHDA 4X1DA 2Q2CA 3G3IA 4Q5TA 2IEEA 2O51A 1FJ9A 4XKQA 1JP4A 1XS5A 3IB1A 1NUXA 3IL1B 3LSLA 3DELB 4DCXA 1Y3NA 5DVIA 2B3FA 2I3VA 2GHBA 3DP4A 1PB7A 4EDPA 3MWBA 3V89B 5I58A 2Y7PA 1FBFA 4DIGA 1JNFA 2DVZA 2DYXA 3N26A 5EHMA 3KN8A 5DYHA 1EZPA 3KBRA 2OZZA 2ZYOA 3KSJA 3HCQA 2Y7RA 3T22A 2DE2A 1FPDA 1MPCA 4NN3A 5BUUA 1TFAA 2I48A 5L9OA 1NH7A 1LBCA 2ANJA 3KG2A 1B5JA 1NNPA 4QSDA 2F8DA 4MX6A 3PD8A 5ET5A 3IR1A 5F24A 1QKBA 4OA4A 3HHFA 1B6HA 3E13X 2F7BA 3R26A 2F78A 3BBRA 2NWJA 4NX1A 5M2VA 3KGCA 3KJTA 1LLSA 4IO3A 1VR5A 1S50A 1Q35A 2Z8EA 2PFZA 2RINA 1EYJA 2Q88A 3DP8A 4RYAA 4JWYA 1BKAA 1B3EA 3CR9A 3KEIA 4KI0E 3SEWA 2HCAA 5AA2A 3OENA 3G3KA 4X48A 4O8MA 4XTCQ 1XVYA 1DCUA 1WDNA 1SYIA 2WBBA 1LFGA 1IXHA 1B3GA 3TQWA 4ISUA 1EH3A 2OWSA 3FXQA 3SDFA 2Y7IA 2V84A 2OWTA 2ALUA 4PE5B 3PPPA 3IOTA 2B65A 3MBPA 4FBPA 2WYPA 5T3JA 1AL3A 5A5XA 1A7LA 3U93A 5H8QA 3T96B 1MQIA 3H6WA 4H46A 2Q8MA 4PCDA 1I6BA 2REJA 5H8HB 3PUXE 4GQOA 3HV1A 5DVJA 4G2ZA 2PCRA 1SW5A 4NGUA 2ABHA 4RY1A 5ET7A 5AA4B 4EQBA 4OANA 3MUQA 3I3VA 3LV0A 4ELPA 1B40A 1Q9DA 2F7AA 4MMPA 3M3LA 1FTOA 2PYYA 3FBPA 2PT1A 3RUMA 1EYIA 3N6UA 4X04A 3E78A 4JWOA 4GF8A 3VE1B 3H7MA 1RYXA 2H98A 1FBEA 5EQ9A 2XXKA 3KN3A 3KJ7A 4G61A 1NV0A 5EQ7A 2VOZA 2HHMA 5FHMA 5FHOA 1OLAA 3C31A 4NF4B 5I2KB 3KC0A 3KZGA 1B5IA 1LB9A 4OXVA 2A5TB 4MEVA 3O2AA 1FPEA 4MNCA 1AH5A 1FPBA 2OX3A 3TKDA 4N13A 4BDLA 1A54A 1VDWA 1LEVA 3D4CA 5IZ1A 3ISPA 3HSTA 3K01A 3IO6A 1NV7A 1MPBA 2G29A 2QJEA 2XXQA 3ILTB 4H5GA 3BIHA 1M5CA 3D4GA 4BDNA 1K9ZA 2OBGA 1I69A 3OSRA 2UVHA 4LZ5A 1KA1A 3PMXA 2CEYA 4GL0A 2Z8DA 1OQGA 4WXJA 5FTHA 2KLFA 3CG3A 4DI3D 4NF0A 5CMBA 3VLUA 3CIJA 1LBXA 2ZYNA 2XX7A 3E4RA 4FATA 5H8NA 3H3GA 3O6GA 3LBSA 1B2HA 4PFUA 2XD3A 1LBWA 1QULA 1MPDA 4GWXA 1B7UA 1USYE 1FTMA 4IY6A 3GBBA 1PDAA 4GLIA 4HE1A 2P2AA 4P11A 1NV3A 4N91A 4QFOA 3ZKLA 2V4CA 5IAIA 2O1LA 2R6GE 1XOCA 4L17A 2MKZA 1NUYA 2OJTA 1NV2A 4YKKA 1FTLA 2DWIA 4QF9A 3ROJA 3SEVA 3VFJA 3U72A 5ET6A 3T1BA 1II5A 1M5DA 3PMVA 3NOHA 2WEFA 1ZJLA 2QVVA 4WEDA 2JJKA 4G68A 4F39A 4XIGQ 5A5XB 1NUWA 5H8QB 3OSQA 3R7XA 1VFDA 2O68A 4UACA 1B0LA 3ZS6A 1FQDA 4ONYA 5I56B 5EQ8A 3FV2A 2P0SA 4NQ8A 1MY4A 4IO4A 1MXWA 2YJPA 2XA5A 1N84A 1NV6A 4NWCA 3CFLA 3L6GA 5EYHA 3W9WA 1FPGA 1D4NA 1MQJA 3EHUA 1LCTA 3EF7A 3RY3A 2P3VA 4YZZA 4JVDA 4MHFA 5DW8A 1US5A 3QAXA 1WVJA 3AXFA 1IZ1A 4P56A 2XXXA 2CZIA 1IXCA 3L6HA 3A09A 2AIXA 2HEUA 4POXA 5CMCA 3Q25A 3TEPA 1SVXB 4PETA 2PBWA 1ANFA 3TTLA 3UN6A 2H9BA 2GQ1A 3FVKA 5IZ3A 1YXIA 4F1VA 4U4SA 1HSEA 1M5FA 3C34A 4FE8A 3H06B 2ZZXA 2P1SA 3FXRA 4P47A 4ECFA 2F3BA 3W9VA 3QUFA 2O6AA 1MQDA 4LQ2A 4UA8A 4HXVA 1FBDA 2Y5LA 4IO7A 2ONKE 4H65A 2UVJA 3CRBA 5L8DA 2RKMA 3VXBA 4Q8RA 2M8CA 4FEBA 4ZDMA 4IGRA 1IQ7A 3IFAA 4PAKA 4QFKA 4DDDA 4TOZA 1URGA 4U1OA 3MVWA 4OVPA 1FJ6A 1HSJA 3PU5A 5I2NA 5J16A 3G3HA 4PFRA 5ITPA 4PDHA 2R8TA 4RXLA 4QFLA 2UVIA 1ELJA 1SW2A 4X8RA 3R6UA 5TP9A 3H6VA 2ONRA 3MP1A 4U4XA 1Y4CA 2E1SA 1PB9A 2DDKA 3G3JA 1NNKA 4PGNA 1MG1A 4P3LA 1ZU0A 1Y1ZA 1POTA 4NF5A 2VD3A 1B9JA 1D9YA 2HXRA 2O69A 5H8NB 2E0SA 3PMWA 1SW4A 3ONMA 4F3BA 3MZ9A 4I62A 3K2DA 3Q27A 3THIA 2RC9A 5AA1A 3PUWE 4XKRA 3TYHA 4OWDA 1MY2A 2REGA 3IK6B 4GX6A 4M4GA 4HE0A 1VFEA 5FBPA 4GWUA 5ICTA 2THIA 4XF5A 4ESWA 5CM6A 4IGTA 1EZOA 1LAFE 3HN0A 4R74A 1B05A 3FJ7A 4HCWA 4YU0A 5KCJB 2B3BA 3CSBA 4LA9A 1FSAA 1YCJA 2Z8FA 1FQCA 5A5LA 4MNPA 5CC2A 1EU8A 4F1YA 1FBPA 4GWSA 2KQZA 1O7TA 2QMXA 3HHGA 4IY5A 4LUBA 2I6EA 1OQHA 2VD2A 1QVSA 1GGGA 1IMBA 4RK9A 5KZTA 4ZECA 3B7DA 3MW0A 1JQFA 1QUJA 1H3DA 3VVFA 3FXUA 3OEMA 2XXRA 5H8FA 1T0KA 3OO7A 5ELVA 3T0JA 2QS2A 4QSCA 2HFBA 4OEVA 3O29A 4MLQA 3E79A 5EYFA 1F9BA 1NUZA 4PE3A 4EXLA 3K00A 4EQ9A 3S9MC 1S9TA 3SKPA 2V25A 2H99A 4MAGA 3FASA 4OTEA 4GIZA 4G68C 4O3BA 1Y9UA 4KQPA 4NEDA 2ONSA 1B4HA 4FORA 5EYGA 4DZ1A 2NVUB 1N3XA 3SEUA 2DE3A 5FTIA 3B50A 3ZSFA 1D3KA 4R6HA 3S9NC 3MPLA 4MF3A 4P1LA 1NI9A 1Y1MA 4OHNA 4R75A 4N17A 2NUVA 1RDYA 3RTWB 4OVJA 3UP9A 3KN7A 4GD5A 4LVQA 2OWZA 1MY3A 2UXAA 1A99A 4F3PA 3PUZE 1URSA 1DPEA 4N6DA 4ZEFA 5HPQA 2O7UA 4XEQA 3OEKA 3GXAA 2DOJA 2Q9TA 3MC2A 3IORA 1ZKBA 4H8JA 1O63A 2QL3A 3LR1A 3M3KA 1DPPA 5F1QA 2F3DA 5TPAA 3LC8A 1ZTYA 4PFYA 1Q1KA 4ESXA 5I2NB 2F7CA 2V3UA 3FV1A 3CFZA 1P1OA 5LDZA 4AS4A 5AA3A 5TP9B 4OVRA 4AB6A 3K6UA 2Q74A 3O9PA 3SESA 3S2VA 1DK4A 4Z7EA 1B3HA 4NF5B 1RDXA 4DXBA 3UORA 1BIYA 1USYH 3TTKA 4ZEDA 2VT5A 2IA4A 1YAEA 2HXWA 2DWJA 1R6ZA 3RTFB 1MH4A 3FVGA 1H76A 3KC1A 3K6XA 4N6KA 1NL5A 4XXUA 3QXMA 1B3FA 4ZS9A 3RPWA 3DM0A 1B32A 3IOUA 4EUOA 4U23A 3HFUA 4WKMA 1VE4A 2F36A 4FECA 3K6WA 1INPA 4PBQA 5ISUA 1MY1A 1A55A 1M5BA 2WX9A 1QUKA 1N0TA 5J1DA 2P3NA 1LCFA 2RC8A 4IO2A 1MXZA 3IOVA 5JTYA 3QSLA 4YB6A 1BK4A 1GR2A 1PBPA 5CMMA 1O64A 3G7WA 2ZZWA 5IM2A 4PQJA 4NF8A 1P1WA 4ZEIA 3OO6A 2KR0A 1DMBA 4PGPA 1H45A 2F5XA 3USDA 3MP8A 3PPQA 3I5OA 5K2XA 1P99A 3MP6A 5I58B 1WODA 1KZ8A 2DXYA 3N94A 5H8FB 4P1EA 4BDQA 1MDP1 2RCBA 2X7PA 4LATA 1SI0A 2HAUA 4PDDA 3TTMA 3LUYA 3VV5A 5DT6A 1NV5A 3U94A 2XWOA 5I84A 3MVYA 2QFLA 3KSXA 2DQVA 2Z22A 4MIJA 1DOTA 3RQTA 3TCFA 1B3LA 1SPIA 1UIVA 2I49A 1LB8A 4JVCA 5CBRA 4OEUA 1B4ZA 4LQ5A 3WAFA 4GOTA 1DTZA 2GHAA 3LSXA 1Y3PA 2ZMBA 4OERA 2XXWA 3C9HA 4MBPA 1B51A 1MXUA 1FQAA 3KOSA 5DEXA 5LTCA 1P1UA 1QGXA 5ET8A 2XWKA 4RJZA 4R2BA 5I7IA 2CEXA 1JETA 4OENA 1JW5A 3OD7A 3S9LC 5I57A 2WKYA 2Q8JA 1JEVA 1MQHA 1N7WA 3ODBA 5AA2B 4P0IA 1P1NA 3MZBA 2I0BA 1NV1A 4JSOA 4I3EA 2RC7A 1RDZA 2Y7KA 1IXGA 2XD2A 4YMAA 3T66A 3OMBA 4GX4A 3TTNA 3BKIB 3MAMA 1PEBA 2QVRA 3QUJA 1S7YA 1TFDA 5I3SA 3H6UA 3MYUA 4GVOA 3DP6A 3PUVE 4JSDA 4TQUQ 3PV0E 1KWHA 1MDQA 3KBZA 4BDOA 2PVUA 1LAGE 3IO4A 1NMUA 4AQ4A 3LUZA 3IOWA 3GBAA 2H25A 4OVQA 2HZKA 4XKPA 2ZNTA 4THIA 2CZHA 4N81A
chains in the Genus database with same CATH topology
1MM7A 3OO8A 4QRZA 4OFLA 3EHSA 4YKJA 4MH5A 3TCGA 3FJGA 1MXYA 2VGQA 3JZJA 3TUSA 3T9HB 4MLVA 5L9SA 2PMSA 1J1NA 2ZNSA 2Q89A 3PPNA 1OMPA 5CMKA 3ZKKA 2PT2A 3UA8A 3F11A 1JVXA 2D21A 4U21A 4KYSA 1ZMGA 4GWOA 5IKBA 1RYOA 3U92A 4KYEA 3MQ9A 3KFMA 4EQ7A 2I4BA 2Y7WA 1N3WA 3GLBA 2ZYKA 3C4MA 3SEYA 3O97A 1TWYA 5JTYB 3S4UA 5CBSA 3TAJA 4BDRA 4NF8B 2HAVA 5AA2D 5DVFA 1PB8A 4G8NA 3TPAA 5EHSA 4F1UA 1YPNA 3T93B 2V93A 4EF1A 4LONB 1B5HA 4JWXA 2RF1A 1UTBA 2XX9A 2NXOA 4G4PA 4R2FA 2I3WA 3FD3A 2I0CA 4RPOA 2I4CA 3A3CA 4PP0A 3TODA 5H8SA 4NF6A 1SQYA 4H1XA 2GH9A 1FQEA 3FJMA 2AL4A 5DEXB 4F2QA 1XC1A 4YAHX 1SDXA 2AL5A 2XXUA 1XVXA 4OYVA 5I57B 4JBZA 1MRPA 3K1NA 2ZXTA 3OOAA 1POY1 3CVGA 4XKNA 4H0WA 3QYTA 5JEIA 3H4ZA 1B0HA 4KD5A 5F7VA 4TLMB 1Z7ME 3ECRA 1FTJA 4PFWA 5I2KA 4GRKA 1JEUA 4WEPA 2XXIA 2CMOA 1QKAA 3MVZA 3C35A 4G68B 2F6PA 4RA1A 3C32A 3CI8A 1FTKA 4JB7A 2UVGA 2XXVA 4YB5A 1B58A 5BWJA 3T9VA 4F18A 4R6YA 1Y4TA 4LZ7A 5K2YA 1MH3A 2CZLA 4JDFA 3CSGA 4OETA 1A40A 5KDTA 2FA7A 1B1HA 1Z7NE 3OELA 4X9TA 4IO6A 3QK6A 3H6TA 4YB7A 3A3UA 3N5LA 1BLFA 4ZZAA 3Q28A 3LSWA 4ZEBA 4I8CA 3FZVA 3M3FA 1PBQA 4U2RA 4U1ZA 2R9JA 4KPTA 2LAOA 1ZLQA 4ELOA 4QSEA 2Q2AA 2R71A 3LSFB 3IJOB 3EQ1A 1XT8A 4POWA 4H8IA 3OXNA 3JV9A 3PD9A 2D3IA 3VVDA 2QS4A 1MM6A 4OFJA 4KCCA 4TLLB 4X1BA 1QUIA 4DXUA 4H5FA 2ZYMA 5B7DA 1NFTA 2YPNA 1OLCA 4OFOA 1H43A 4RK2A 1A8FA 3RLFE 3PGFA 3FVNA 3G3FA 2XXYA 3E9XA 4ZE8A 5FHNA 3B6QA 5CI5A 2OCUA 3V8XB 1N7XA 4DXCA 4Z0IA 3TQLA 1UTBB 1YTVA 3OO9A 2QPQA 2BJJX 1GVCA 3W15C 3IB0A 3VXCA 2UYEA 1NNFA 2VP1A 4I1DA 3CFXA 4C0RA 1HSLA 1N04A 4FIMA 5JK4A 5HM4B 1D9VA 5I56A 4AB5A 1A8EA 4KHZE 3PPRA 4C1UA 4NF6B 2DVCA 1LGBC 1TT1A 3EN3A 1AOVA 4QFPA 5TU0A 1NKXA 3K02A 1PC3A 5L9MA 5I59A 4GXAA 3T9UA 1NH8A 4O3AA 1LAXA 4OESA 4OQOA 4H67A 4QHQA 4RPNA 3GZGA 1XHYA 1GV8A 4ZEKA 4ZZEA 1UTHA 1JVYA 4YKIA 4Q30B 3TDJA 2FYIA 3SEXA 4C1TA 2AYSA 3K6VA 5B70A 3FUZA 1DTGA 3K1PA 4F2OA 2VHAA 1RKMA 3RN8A 3Q26A 4FAJA 2NOOA 4NMYA 1SYHA 3JYRA 3C36A 1MQGA 1M5EA 4NE4A 1OVTA 4F3SA 2X26A 1SI1A 3MPKA 2RCAA 3KOTA 3RNNA 5KDTB 4F3GA 1B1XA 3RT6B 3PUYE 1UQWA 2Z23A 1R1NA 3O28A 3UIFA 1JW1A 4P0GA 1LAHE 2DE4A 4G8HA 2OLBA 1SW1A 4R9GA 4F19A 2A5SA 2HQ0A 3IX1A 3N6TA 4KYDA 3O66A 3K1MA 2O84X 3TFLA 1IEJA 3MJNA 1US4A 3RGYA 3IJXB 1AMFA 2GFEA 1ATGA 3O6IA 1IIWA 3SETA 4E0WA 4JXIA 4I9DA 1GTKA 2UYFA 3TZAA 4EF2A 1JW4A 3K4UA 2QRYA 4FJPA 5KCJA 2W7YA 4K3FA 2QMWA 1MY0A 4G8MA 4YICA 4R9FA 4F29A 1FW0A 2OK2A 4DLDA 4HTGA 4ZE9A 3M8UA 5ICQA 2V3QA 3FGSA 2DWHA 5TPAB 4F22A 3RT8A 1CB6A 2F35A 3SERA 3UK4A 1N76A 3QIMA 3VVEA 1OIBA 1IITA 3VLWA 5HBCA 4OZ9A 1MS7A 4YKPA 4FEDA 4R6KA 1I6AA 3I6VA 3H03A 1AIVA 3FATA 1IXIA 2QSXA 2X7QA 5DTBA 1QW0A 2FNCA 3FIRA 4BLAA 4IO5A 2F97A 4KCDA 3T9XB 2HZLA 4R72A 2GRVA 3BFTA 3TCHA 2G93A 3PPOA 4OMBA 4G77A 4HCYA 1B46A 1H44A 2DWAA 4ELRA 1QJMA 4ELQA 5I59B 2QS3A 2DXRA 2F34A 1LSTA 4YMBA 3U8QA 4GL8A 4MFIA 4RNSA 3FVOA 2DS9A 4O3CA 2Y84A 3EHTA 1DSNA 1FCKA 1UTHB 2XXTA 1L5TA 3IAZA 1CE2A 1MXVA 3VDFA 3O6HA 3EPEA 4KFQA 2DSFA 2ESNA 2D5WA 4E0XA 1ZBMA 2O7IA 1R9QA 4HW8A 3IB2A 2QS1A 2O1MA 1I6QA 3HPIA 2XX8A 1NNTA 4NWDA 2XXPA 1B7HA 2XXHA 4F31B 1R9LA 1VSOA 3UGWA 1P1QA 1IUDA 3B6WA 4LP2B 2YLNA 1EZ9A 3E3KA 1Y20A 3P7IA 3S9EA 4H6DA 3CG1A 4GFRA 1ZIUA 3U1OA 3VLVA 1BP5A 1LFHA 5H8HA 4IB2A 3MVXA 4ND9A 1FQBA 4N6PA 3TELA 1SD3A 1SBPA 5AA4A 1MXXA 2PX1A 4PFTA 3V83A 4BDMA 1BTJA 3Q29A 2H5YA 5ITOA 2DP8A 1UIUA 2V3TA 4Q0CA 5AE4A 2I58A 4U22A 4DCYA 3G3GA 1LFIA 1OVBA 3WAEA 1URDA 2H4IA 4R73A 1B52A 3V5AA 3C33A 4EXKA 3TTRA 4DE8A 4HS7A 4LZ8A 3ILUB 3B6TA 1Y3QA 3TMGA 1B7ZA 4M1VA 4QFNA 4KR5A 3MZ1A 2ZNUA 3HO7A 4NF4A 5CRYA 3K0VA 1FQFA 2F6GA 4N07A 1LBBA 2A5TA 1TXFA 4NTLA 5LOMA 3BFUA 3DLNA 4GXSB 2XHDA 4X1DA 2Q2CA 3G3IA 4Q5TA 2IEEA 2O51A 4XKQA 1XS5A 3IB1A 3IL1B 3LSLA 3DELB 4DCXA 1Y3NA 5DVIA 2B3FA 2I3VA 2GHBA 3DP4A 1PB7A 4EDPA 3MWBA 3V89B 5I58A 2Y7PA 4DIGA 1JNFA 2DVZA 2DYXA 3N26A 5EHMA 3KN8A 5DYHA 1EZPA 3KBRA 2OZZA 2ZYOA 3KSJA 3HCQA 2Y7RA 3T22A 2DE2A 1MPCA 5BUUA 1TFAA 2I48A 5L9OA 1NH7A 1LBCA 2ANJA 3KG2A 1B5JA 1NNPA 4QSDA 2F8DA 3PD8A 3IR1A 1QKBA 3HHFA 1B6HA 3E13X 2F7BA 3R26A 2F78A 3BBRA 2NWJA 5M2VA 3KGCA 3KJTA 1LLSA 4IO3A 1VR5A 1S50A 1Q35A 2Z8EA 2RINA 2Q88A 3DP8A 4RYAA 4JWYA 1BKAA 1B3EA 3CR9A 3KEIA 4KI0E 3SEWA 2HCAA 5AA2A 3OENA 3G3KA 4X48A 4XTCQ 1XVYA 1WDNA 1SYIA 1LFGA 1IXHA 1B3GA 3TQWA 4ISUA 1EH3A 2OWSA 3FXQA 3SDFA 2Y7IA 2V84A 2OWTA 2ALUA 4PE5B 3PPPA 3IOTA 2B65A 3MBPA 1AL3A 5A5XA 1A7LA 3U93A 5H8QA 3T96B 1MQIA 3H6WA 1I6BA 2REJA 5H8HB 3PUXE 4GQOA 3HV1A 5DVJA 4G2ZA 1SW5A 2ABHA 4RY1A 5AA4B 4EQBA 3MUQA 3I3VA 4ELPA 1B40A 2F7AA 3M3LA 1FTOA 2PYYA 2PT1A 3RUMA 3N6UA 4JWOA 4GF8A 3VE1B 3H7MA 1RYXA 2H98A 3KN3A 3KJ7A 2VOZA 5FHMA 5FHOA 1OLAA 3C31A 4NF4B 5I2KB 3KZGA 1B5IA 1LB9A 4OXVA 2A5TB 3O2AA 1AH5A 3TKDA 4N13A 4BDLA 1A54A 3D4CA 3HSTA 3K01A 3IO6A 1MPBA 2G29A 2QJEA 2XXQA 3ILTB 4H5GA 1M5CA 3D4GA 4BDNA 2OBGA 1I69A 3OSRA 2UVHA 4LZ5A 3PMXA 4GL0A 2Z8DA 1OQGA 4WXJA 5FTHA 2KLFA 3CG3A 5CMBA 3VLUA 3CIJA 2ZYNA 2XX7A 3E4RA 4FATA 5H8NA 3H3GA 3O6GA 3LBSA 1B2HA 4PFUA 2XD3A 1QULA 1MPDA 1B7UA 1USYE 1FTMA 4IY6A 3GBBA 1PDAA 4GLIA 2P2AA 4P11A 4QFOA 3ZKLA 5IAIA 2O1LA 2R6GE 1XOCA 4L17A 2OJTA 4YKKA 1FTLA 2DWIA 4QF9A 3SEVA 3VFJA 3U72A 1II5A 1M5DA 3PMVA 1ZJLA 4WEDA 4G68A 4F39A 4XIGQ 5A5XB 5H8QB 3OSQA 3R7XA 1VFDA 2O68A 4UACA 1B0LA 3ZS6A 1FQDA 4ONYA 5I56B 3FV2A 2P0SA 1MY4A 4IO4A 1MXWA 2YJPA 1N84A 4NWCA 3CFLA 3L6GA 3W9WA 1D4NA 1MQJA 3EHUA 1LCTA 3EF7A 3RY3A 4YZZA 1US5A 3QAXA 1WVJA 3AXFA 1IZ1A 2XXXA 3L6HA 1IXCA 3A09A 2AIXA 2HEUA 4POXA 5CMCA 3Q25A 3TEPA 1SVXB 4PETA 3TTLA 1ANFA 2PBWA 3UN6A 2H9BA 3FVKA 4F1VA 4U4SA 1HSEA 1M5FA 3C34A 4FE8A 3H06B 2P1SA 3FXRA 4ECFA 3W9VA 3QUFA 2O6AA 1MQDA 4LQ2A 4UA8A 4IO7A 2ONKE 4H65A 2UVJA 3CRBA 5L8DA 2RKMA 3VXBA 4Q8RA 2M8CA 4FEBA 4ZDMA 4IGRA 1IQ7A 4QFKA 4DDDA 4TOZA 1URGA 4U1OA 3MVWA 1HSJA 3PU5A 5I2NA 3G3HA 5ITPA 4RXLA 4QFLA 2UVIA 1ELJA 1SW2A 3R6UA 5TP9A 3H6VA 2ONRA 3MP1A 4U4XA 1Y4CA 2E1SA 1PB9A 3G3JA 1NNKA 1MG1A 1ZU0A 1Y1ZA 1POTA 4NF5A 2VD3A 1B9JA 1D9YA 2O69A 5H8NB 2E0SA 3PMWA 1SW4A 3ONMA 4F3BA 3MZ9A 4I62A 3K2DA 3Q27A 3THIA 2RC9A 5AA1A 3PUWE 4XKRA 3TYHA 4OWDA 1MY2A 2REGA 3IK6B 4M4GA 1VFEA 5ICTA 2THIA 4ESWA 5CM6A 4IGTA 1EZOA 1LAFE 3HN0A 4R74A 1B05A 3FJ7A 4HCWA 4YU0A 5KCJB 2B3BA 3CSBA 4LA9A 1YCJA 2Z8FA 1FQCA 5CC2A 1EU8A 4F1YA 1O7TA 2QMXA 3HHGA 4IY5A 4LUBA 2I6EA 1OQHA 2VD2A 1QVSA 1GGGA 4RK9A 5KZTA 4ZECA 3B7DA 3MW0A 1JQFA 1QUJA 1H3DA 3VVFA 3FXUA 3OEMA 2XXRA 5H8FA 1T0KA 3OO7A 5ELVA 2QS2A 4QSCA 2HFBA 4OEVA 3O29A 4MLQA 5EYFA 1F9BA 4EXLA 3K00A 4EQ9A 3S9MC 1S9TA 3SKPA 2V25A 2H99A 3FASA 4OTEA 4GIZA 4G68C 4O3BA 1Y9UA 4KQPA 4NEDA 2ONSA 1B4HA 4FORA 4DZ1A 2NVUB 1N3XA 3SEUA 2DE3A 5FTIA 3ZSFA 1D3KA 4R6HA 3S9NC 3MPLA 4MF3A 1Y1MA 4OHNA 4R75A 2NUVA 3RTWB 4OVJA 3UP9A 3KN7A 4GD5A 4LVQA 1MY3A 2UXAA 1A99A 4F3PA 3PUZE 1URSA 1DPEA 4ZEFA 5HPQA 2O7UA 3OEKA 3GXAA 2DOJA 2Q9TA 3MC2A 3IORA 1ZKBA 4H8JA 1O63A 2QL3A 3LR1A 3M3KA 1DPPA 5F1QA 5TPAA 3LC8A 1ZTYA 4PFYA 1Q1KA 4ESXA 5I2NB 2F7CA 2V3UA 3FV1A 3CFZA 1P1OA 5AA3A 5TP9B 4AB6A 3K6UA 3O9PA 3SESA 3S2VA 4Z7EA 1B3HA 4NF5B 4DXBA 3UORA 1BIYA 1USYH 3TTKA 4ZEDA 2IA4A 1YAEA 2HXWA 2DWJA 1R6ZA 3RTFB 1MH4A 3FVGA 1H76A 3K6XA 1NL5A 4XXUA 3QXMA 1B3FA 4ZS9A 3RPWA 3DM0A 1B32A 3IOUA 4EUOA 4U23A 4WKMA 1VE4A 2F36A 4FECA 3K6WA 5ISUA 1MY1A 1A55A 1M5BA 1QUKA 1N0TA 5J1DA 1LCFA 2RC8A 4IO2A 1MXZA 3IOVA 5JTYA 3QSLA 4YB6A 1GR2A 1PBPA 5CMMA 1O64A 3G7WA 4PQJA 4NF8A 1P1WA 4ZEIA 3OO6A 1DMBA 1H45A 2F5XA 3USDA 3MP8A 3PPQA 3I5OA 5K2XA 1P99A 3MP6A 5I58B 1WODA 2DXYA 3N94A 5H8FB 4BDQA 1MDP1 2RCBA 2X7PA 4LATA 1SI0A 2HAUA 3TTMA 3LUYA 3VV5A 5DT6A 3U94A 5I84A 3MVYA 3KSXA 2DQVA 2Z22A 1DOTA 3RQTA 3TCFA 1B3LA 1UIVA 2I49A 1LB8A 5CBRA 4OEUA 1B4ZA 4LQ5A 3WAFA 4GOTA 1DTZA 2GHAA 3LSXA 1Y3PA 2ZMBA 4OERA 2XXWA 3C9HA 4MBPA 1B51A 1MXUA 1FQAA 3KOSA 5DEXA 1P1UA 4RJZA 4R2BA 1JETA 4OENA 1JW5A 3OD7A 3S9LC 5I57A 2WKYA 2Q8JA 1JEVA 1MQHA 1N7WA 3ODBA 5AA2B 4P0IA 1P1NA 3MZBA 2I0BA 4JSOA 2RC7A 2Y7KA 1IXGA 2XD2A 4YMAA 3T66A 3OMBA 3TTNA 3BKIB 3MAMA 1PEBA 3QUJA 1S7YA 1TFDA 3H6UA 4GVOA 3DP6A 3PUVE 4JSDA 4TQUQ 3PV0E 1KWHA 1MDQA 4BDOA 2PVUA 1LAGE 3IO4A 1NMUA 4AQ4A 3IOWA 3GBAA 2H25A 2HZKA 4XKPA 2ZNTA 4THIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM7 A;  3OO8 A;  4QRZ A;  4OFL A;  3EHS A;  4YKJ A;  4MH5 A;  3TCG A;  3FJG A;  1MXY A;  2VGQ A;  3JZJ A;  3TUS A;  3T9H B;  4MLV A;  5L9S A;  2PMS A;  1J1N A;  2ZNS A;  2Q89 A;  3PPN A;  1OMP A;  5CMK A;  3ZKK A;  2PT2 A;  3UA8 A;  3F11 A;  1JVX A;  2D21 A;  4U21 A;  4KYS A;  1ZMG A;  4GWO A;  5IKB A;  1RYO A;  3U92 A;  4KYE A;  3MQ9 A;  3KFM A;  4EQ7 A;  2I4B A;  2Y7W A;  1N3W A;  3GLB A;  2ZYK A;  3C4M A;  3SEY A;  3O97 A;  1TWY A;  5JTY B;  3S4U A;  5CBS A;  3TAJ A;  4BDR A;  4NF8 B;  2HAV A;  5AA2 D;  5DVF A;  1PB8 A;  4G8N A;  3TPA A;  5EHS A;  4F1U A;  1YPN A;  3T93 B;  2V93 A;  4EF1 A;  4LON B;  1B5H A;  4JWX A;  2RF1 A;  1UTB A;  2XX9 A;  2NXO A;  4G4P A;  4R2F A;  2I3W A;  3FD3 A;  2I0C A;  4RPO A;  2I4C A;  3A3C A;  4PP0 A;  3TOD A;  5H8S A;  4NF6 A;  1SQY A;  4H1X A;  2GH9 A;  1FQE A;  3FJM A;  2AL4 A;  5DEX B;  4F2Q A;  1XC1 A;  4YAH X;  1SDX A;  2AL5 A;  2XXU A;  1XVX A;  4OYV A;  5I57 B;  4JBZ A;  1MRP A;  3K1N A;  2ZXT A;  3OOA A;  1POY 1;  3CVG A;  4XKN A;  4H0W A;  3QYT A;  5JEI A;  3H4Z A;  1B0H A;  4KD5 A;  5F7V A;  4TLM B;  1Z7M E;  3ECR A;  1FTJ A;  4PFW A;  5I2K A;  4GRK A;  1JEU A;  4WEP A;  2XXI A;  2CMO A;  1QKA A;  3MVZ A;  3C35 A;  4G68 B;  2F6P A;  4RA1 A;  3C32 A;  3CI8 A;  1FTK A;  4JB7 A;  2UVG A;  2XXV A;  4YB5 A;  1B58 A;  5BWJ A;  3T9V A;  4F18 A;  4R6Y A;  1Y4T A;  4LZ7 A;  5K2Y A;  1MH3 A;  2CZL A;  4JDF A;  3CSG A;  4OET A;  1A40 A;  5KDT A;  2FA7 A;  1B1H A;  1Z7N E;  3OEL A;  4X9T A;  4IO6 A;  3QK6 A;  3H6T A;  4YB7 A;  3A3U A;  3N5L A;  1BLF A;  4ZZA A;  3Q28 A;  3LSW A;  4ZEB A;  4I8C A;  3FZV A;  3M3F A;  1PBQ A;  4U2R A;  4U1Z A;  2R9J A;  4KPT A;  2LAO A;  1ZLQ A;  4ELO A;  4QSE A;  2Q2A A;  2R71 A;  3LSF B;  3IJO B;  3EQ1 A;  1XT8 A;  4POW A;  4H8I A;  3OXN A;  3JV9 A;  3PD9 A;  2D3I A;  3VVD A;  2QS4 A;  1MM6 A;  4OFJ A;  4KCC A;  4TLL B;  4X1B A;  1QUI A;  4DXU A;  4H5F A;  2ZYM A;  5B7D A;  1NFT A;  2YPN A;  1OLC A;  4OFO A;  1H43 A;  4RK2 A;  1A8F A;  3RLF E;  3PGF A;  3FVN A;  3G3F A;  2XXY A;  3E9X A;  4ZE8 A;  5FHN A;  3B6Q A;  5CI5 A;  2OCU A;  3V8X B;  1N7X A;  4DXC A;  4Z0I A;  3TQL A;  1UTB B;  1YTV A;  3OO9 A;  2QPQ A;  2BJJ X;  1GVC A;  3W15 C;  3IB0 A;  3VXC A;  2UYE A;  1NNF A;  2VP1 A;  4I1D A;  3CFX A;  4C0R A;  1HSL A;  1N04 A;  4FIM A;  5JK4 A;  5HM4 B;  1D9V A;  5I56 A;  4AB5 A;  1A8E A;  4KHZ E;  3PPR A;  4C1U A;  4NF6 B;  2DVC A;  1LGB C;  1TT1 A;  3EN3 A;  1AOV A;  4QFP A;  5TU0 A;  1NKX A;  3K02 A;  1PC3 A;  5L9M A;  5I59 A;  4GXA A;  3T9U A;  1NH8 A;  4O3A A;  1LAX A;  4OES A;  4OQO A;  4H67 A;  4QHQ A;  4RPN A;  3GZG A;  1XHY A;  1GV8 A;  4ZEK A;  4ZZE A;  1UTH A;  1JVY A;  4YKI A;  4Q30 B;  3TDJ A;  2FYI A;  3SEX A;  4C1T A;  2AYS A;  3K6V A;  5B70 A;  3FUZ A;  1DTG A;  3K1P A;  4F2O A;  2VHA A;  1RKM A;  3RN8 A;  3Q26 A;  4FAJ A;  2NOO A;  4NMY A;  1SYH A;  3JYR A;  3C36 A;  1MQG A;  1M5E A;  4NE4 A;  1OVT A;  4F3S A;  2X26 A;  1SI1 A;  3MPK A;  2RCA A;  3KOT A;  3RNN A;  5KDT B;  4F3G A;  1B1X A;  3RT6 B;  3PUY E;  1UQW A;  2Z23 A;  1R1N A;  3O28 A;  3UIF A;  1JW1 A;  4P0G A;  1LAH E;  2DE4 A;  4G8H A;  2OLB A;  1SW1 A;  4R9G A;  4F19 A;  2A5S A;  2HQ0 A;  3IX1 A;  3N6T A;  4KYD A;  3O66 A;  3K1M A;  2O84 X;  3TFL A;  1IEJ A;  3MJN A;  1US4 A;  3RGY A;  3IJX B;  1AMF A;  2GFE A;  1ATG A;  3O6I A;  1IIW A;  3SET A;  4E0W A;  4JXI A;  4I9D A;  1GTK A;  2UYF A;  3TZA A;  4EF2 A;  1JW4 A;  3K4U A;  2QRY A;  4FJP A;  5KCJ A;  2W7Y A;  4K3F A;  2QMW A;  1MY0 A;  4G8M A;  4YIC A;  4R9F A;  4F29 A;  1FW0 A;  2OK2 A;  4DLD A;  4HTG A;  4ZE9 A;  3M8U A;  5ICQ A;  2V3Q A;  3FGS A;  2DWH A;  5TPA B;  4F22 A;  3RT8 A;  1CB6 A;  2F35 A;  3SER A;  3UK4 A;  1N76 A;  3QIM A;  3VVE A;  1OIB A;  1IIT A;  3VLW A;  5HBC A;  4OZ9 A;  1MS7 A;  4YKP A;  4FED A;  4R6K A;  1I6A A;  3I6V A;  3H03 A;  1AIV A;  3FAT A;  1IXI A;  2QSX A;  2X7Q A;  5DTB A;  1QW0 A;  2FNC A;  3FIR A;  4BLA A;  4IO5 A;  2F97 A;  4KCD A;  3T9X B;  2HZL A;  4R72 A;  2GRV A;  3BFT A;  3TCH A;  2G93 A;  3PPO A;  4OMB A;  4G77 A;  4HCY A;  1B46 A;  1H44 A;  2DWA A;  4ELR A;  1QJM A;  4ELQ A;  5I59 B;  2QS3 A;  2DXR A;  2F34 A;  1LST A;  4YMB A;  3U8Q A;  4GL8 A;  4MFI A;  4RNS A;  3FVO A;  2DS9 A;  4O3C A;  2Y84 A;  3EHT A;  1DSN A;  1FCK A;  1UTH B;  2XXT A;  1L5T A;  3IAZ A;  1CE2 A;  1MXV A;  3VDF A;  3O6H A;  3EPE A;  4KFQ A;  2DSF A;  2ESN A;  2D5W A;  4E0X A;  1ZBM A;  2O7I A;  1R9Q A;  4HW8 A;  3IB2 A;  2QS1 A;  2O1M A;  1I6Q A;  3HPI A;  2XX8 A;  1NNT A;  4NWD A;  2XXP A;  1B7H A;  2XXH A;  4F31 B;  1R9L A;  1VSO A;  3UGW A;  1P1Q A;  1IUD A;  3B6W A;  4LP2 B;  2YLN A;  1EZ9 A;  3E3K A;  1Y20 A;  3P7I A;  3S9E A;  4H6D A;  3CG1 A;  4GFR A;  1ZIU A;  3U1O A;  3VLV A;  1BP5 A;  1LFH A;  5H8H A;  4IB2 A;  3MVX A;  4ND9 A;  1FQB A;  4N6P A;  3TEL A;  1SD3 A;  1SBP A;  5AA4 A;  1MXX A;  2PX1 A;  4PFT A;  3V83 A;  4BDM A;  1BTJ A;  3Q29 A;  2H5Y A;  5ITO A;  2DP8 A;  1UIU A;  2V3T A;  4Q0C A;  5AE4 A;  2I58 A;  4U22 A;  4DCY A;  3G3G A;  1LFI A;  1OVB A;  3WAE A;  1URD A;  2H4I A;  4R73 A;  1B52 A;  3V5A A;  3C33 A;  4EXK A;  3TTR A;  4DE8 A;  4HS7 A;  4LZ8 A;  3ILU B;  3B6T A;  1Y3Q A;  3TMG A;  1B7Z A;  4M1V A;  4QFN A;  4KR5 A;  3MZ1 A;  2ZNU A;  3HO7 A;  4NF4 A;  5CRY A;  3K0V A;  1FQF A;  2F6G A;  4N07 A;  1LBB A;  2A5T A;  1TXF A;  4NTL A;  5LOM A;  3BFU A;  3DLN A;  4GXS B;  2XHD A;  4X1D A;  2Q2C A;  3G3I A;  4Q5T A;  2IEE A;  2O51 A;  4XKQ A;  1XS5 A;  3IB1 A;  3IL1 B;  3LSL A;  3DEL B;  4DCX A;  1Y3N A;  5DVI A;  2B3F A;  2I3V A;  2GHB A;  3DP4 A;  1PB7 A;  4EDP A;  3MWB A;  3V89 B;  5I58 A;  2Y7P A;  4DIG A;  1JNF A;  2DVZ A;  2DYX A;  3N26 A;  5EHM A;  3KN8 A;  5DYH A;  1EZP A;  3KBR A;  2OZZ A;  2ZYO A;  3KSJ A;  3HCQ A;  2Y7R A;  3T22 A;  2DE2 A;  1MPC A;  5BUU A;  1TFA A;  2I48 A;  5L9O A;  1NH7 A;  1LBC A;  2ANJ A;  3KG2 A;  1B5J A;  1NNP A;  4QSD A;  2F8D A;  3PD8 A;  3IR1 A;  1QKB A;  3HHF A;  1B6H A;  3E13 X;  2F7B A;  3R26 A;  2F78 A;  3BBR A;  2NWJ A;  5M2V A;  3KGC A;  3KJT A;  1LLS A;  4IO3 A;  1VR5 A;  1S50 A;  1Q35 A;  2Z8E A;  2RIN A;  2Q88 A;  3DP8 A;  4RYA A;  4JWY A;  1BKA A;  1B3E A;  3CR9 A;  3KEI A;  4KI0 E;  3SEW A;  2HCA A;  5AA2 A;  3OEN A;  3G3K A;  4X48 A;  4XTC Q;  1XVY A;  1WDN A;  1SYI A;  1LFG A;  1IXH A;  1B3G A;  3TQW A;  4ISU A;  1EH3 A;  2OWS A;  3FXQ A;  3SDF A;  2Y7I A;  2V84 A;  2OWT A;  2ALU A;  4PE5 B;  3PPP A;  3IOT A;  2B65 A;  3MBP A;  1AL3 A;  5A5X A;  1A7L A;  3U93 A;  5H8Q A;  3T96 B;  1MQI A;  3H6W A;  1I6B A;  2REJ A;  5H8H B;  3PUX E;  4GQO A;  3HV1 A;  5DVJ A;  4G2Z A;  1SW5 A;  2ABH A;  4RY1 A;  5AA4 B;  4EQB A;  3MUQ A;  3I3V A;  4ELP A;  1B40 A;  2F7A A;  3M3L A;  1FTO A;  2PYY A;  2PT1 A;  3RUM A;  3N6U A;  4JWO A;  4GF8 A;  3VE1 B;  3H7M A;  1RYX A;  2H98 A;  3KN3 A;  3KJ7 A;  2VOZ A;  5FHM A;  5FHO A;  1OLA A;  3C31 A;  4NF4 B;  5I2K B;  3KZG A;  1B5I A;  1LB9 A;  4OXV A;  2A5T B;  3O2A A;  1AH5 A;  3TKD A;  4N13 A;  4BDL A;  1A54 A;  3D4C A;  3HST A;  3K01 A;  3IO6 A;  1MPB A;  2G29 A;  2QJE A;  2XXQ A;  3ILT B;  4H5G A;  1M5C A;  3D4G A;  4BDN A;  2OBG A;  1I69 A;  3OSR A;  2UVH A;  4LZ5 A;  3PMX A;  4GL0 A;  2Z8D A;  1OQG A;  4WXJ A;  5FTH A;  2KLF A;  3CG3 A;  5CMB A;  3VLU A;  3CIJ A;  2ZYN A;  2XX7 A;  3E4R A;  4FAT A;  5H8N A;  3H3G A;  3O6G A;  3LBS A;  1B2H A;  4PFU A;  2XD3 A;  1QUL A;  1MPD A;  1B7U A;  1USY E;  1FTM A;  4IY6 A;  3GBB A;  1PDA A;  4GLI A;  2P2A A;  4P11 A;  4QFO A;  3ZKL A;  5IAI A;  2O1L A;  2R6G E;  1XOC A;  4L17 A;  2OJT A;  4YKK A;  1FTL A;  2DWI A;  4QF9 A;  3SEV A;  3VFJ A;  3U72 A;  1II5 A;  1M5D A;  3PMV A;  1ZJL A;  4WED A;  4G68 A;  4F39 A;  4XIG Q;  5A5X B;  5H8Q B;  3OSQ A;  3R7X A;  1VFD A;  2O68 A;  4UAC A;  1B0L A;  3ZS6 A;  1FQD A;  4ONY A;  5I56 B;  3FV2 A;  2P0S A;  1MY4 A;  4IO4 A;  1MXW A;  2YJP A;  1N84 A;  4NWC A;  3CFL A;  3L6G A;  3W9W A;  1D4N A;  1MQJ A;  3EHU A;  1LCT A;  3EF7 A;  3RY3 A;  4YZZ A;  1US5 A;  3QAX A;  1WVJ A;  3AXF A;  1IZ1 A;  2XXX A;  3L6H A;  1IXC A;  3A09 A;  2AIX A;  2HEU A;  4POX A;  5CMC A;  3Q25 A;  3TEP A;  1SVX B;  4PET A;  3TTL A;  1ANF A;  2PBW A;  3UN6 A;  2H9B A;  3FVK A;  4F1V A;  4U4S A;  1HSE A;  1M5F A;  3C34 A;  4FE8 A;  3H06 B;  2P1S A;  3FXR A;  4ECF A;  3W9V A;  3QUF A;  2O6A A;  1MQD A;  4LQ2 A;  4UA8 A;  4IO7 A;  2ONK E;  4H65 A;  2UVJ A;  3CRB A;  5L8D A;  2RKM A;  3VXB A;  4Q8R A;  2M8C A;  4FEB A;  4ZDM A;  4IGR A;  1IQ7 A;  4QFK A;  4DDD A;  4TOZ A;  1URG A;  4U1O A;  3MVW A;  1HSJ A;  3PU5 A;  5I2N A;  3G3H A;  5ITP A;  4RXL A;  4QFL A;  2UVI A;  1ELJ A;  1SW2 A;  3R6U A;  5TP9 A;  3H6V A;  2ONR A;  3MP1 A;  4U4X A;  1Y4C A;  2E1S A;  1PB9 A;  3G3J A;  1NNK A;  1MG1 A;  1ZU0 A;  1Y1Z A;  1POT A;  4NF5 A;  2VD3 A;  1B9J A;  1D9Y A;  2O69 A;  5H8N B;  2E0S A;  3PMW A;  1SW4 A;  3ONM A;  4F3B A;  3MZ9 A;  4I62 A;  3K2D A;  3Q27 A;  3THI A;  2RC9 A;  5AA1 A;  3PUW E;  4XKR A;  3TYH A;  4OWD A;  1MY2 A;  2REG A;  3IK6 B;  4M4G A;  1VFE A;  5ICT A;  2THI A;  4ESW A;  5CM6 A;  4IGT A;  1EZO A;  1LAF E;  3HN0 A;  4R74 A;  1B05 A;  3FJ7 A;  4HCW A;  4YU0 A;  5KCJ B;  2B3B A;  3CSB A;  4LA9 A;  1YCJ A;  2Z8F A;  1FQC A;  5CC2 A;  1EU8 A;  4F1Y A;  1O7T A;  2QMX A;  3HHG A;  4IY5 A;  4LUB A;  2I6E A;  1OQH A;  2VD2 A;  1QVS A;  1GGG A;  4RK9 A;  5KZT A;  4ZEC A;  3B7D A;  3MW0 A;  1JQF A;  1QUJ A;  1H3D A;  3VVF A;  3FXU A;  3OEM A;  2XXR A;  5H8F A;  1T0K A;  3OO7 A;  5ELV A;  2QS2 A;  4QSC A;  2HFB A;  4OEV A;  3O29 A;  4MLQ A;  5EYF A;  1F9B A;  4EXL A;  3K00 A;  4EQ9 A;  3S9M C;  1S9T A;  3SKP A;  2V25 A;  2H99 A;  3FAS A;  4OTE A;  4GIZ A;  4G68 C;  4O3B A;  1Y9U A;  4KQP A;  4NED A;  2ONS A;  1B4H A;  4FOR A;  4DZ1 A;  2NVU B;  1N3X A;  3SEU A;  2DE3 A;  5FTI A;  3ZSF A;  1D3K A;  4R6H A;  3S9N C;  3MPL A;  4MF3 A;  1Y1M A;  4OHN A;  4R75 A;  2NUV A;  3RTW B;  4OVJ A;  3UP9 A;  3KN7 A;  4GD5 A;  4LVQ A;  1MY3 A;  2UXA A;  1A99 A;  4F3P A;  3PUZ E;  1URS A;  1DPE A;  4ZEF A;  5HPQ A;  2O7U A;  3OEK A;  3GXA A;  2DOJ A;  2Q9T A;  3MC2 A;  3IOR A;  1ZKB A;  4H8J A;  1O63 A;  2QL3 A;  3LR1 A;  3M3K A;  1DPP A;  5F1Q A;  5TPA A;  3LC8 A;  1ZTY A;  4PFY A;  1Q1K A;  4ESX A;  5I2N B;  2F7C A;  2V3U A;  3FV1 A;  3CFZ A;  1P1O A;  5AA3 A;  5TP9 B;  4AB6 A;  3K6U A;  3O9P A;  3SES A;  3S2V A;  4Z7E A;  1B3H A;  4NF5 B;  4DXB A;  3UOR A;  1BIY A;  1USY H;  3TTK A;  4ZED A;  2IA4 A;  1YAE A;  2HXW A;  2DWJ A;  1R6Z A;  3RTF B;  1MH4 A;  3FVG A;  1H76 A;  3K6X A;  1NL5 A;  4XXU A;  3QXM A;  1B3F A;  4ZS9 A;  3RPW A;  3DM0 A;  1B32 A;  3IOU A;  4EUO A;  4U23 A;  4WKM A;  1VE4 A;  2F36 A;  4FEC A;  3K6W A;  5ISU A;  1MY1 A;  1A55 A;  1M5B A;  1QUK A;  1N0T A;  5J1D A;  1LCF A;  2RC8 A;  4IO2 A;  1MXZ A;  3IOV A;  5JTY A;  3QSL A;  4YB6 A;  1GR2 A;  1PBP A;  5CMM A;  1O64 A;  3G7W A;  4PQJ A;  4NF8 A;  1P1W A;  4ZEI A;  3OO6 A;  1DMB A;  1H45 A;  2F5X A;  3USD A;  3MP8 A;  3PPQ A;  3I5O A;  5K2X A;  1P99 A;  3MP6 A;  5I58 B;  1WOD A;  2DXY A;  3N94 A;  5H8F B;  4BDQ A;  1MDP 1;  2RCB A;  2X7P A;  4LAT A;  1SI0 A;  2HAU A;  3TTM A;  3LUY A;  3VV5 A;  5DT6 A;  3U94 A;  5I84 A;  3MVY A;  3KSX A;  2DQV A;  2Z22 A;  1DOT A;  3RQT A;  3TCF A;  1B3L A;  1UIV A;  2I49 A;  1LB8 A;  5CBR A;  4OEU A;  1B4Z A;  4LQ5 A;  3WAF A;  4GOT A;  1DTZ A;  2GHA A;  3LSX A;  1Y3P A;  2ZMB A;  4OER A;  2XXW A;  3C9H A;  4MBP A;  1B51 A;  1MXU A;  1FQA A;  3KOS A;  5DEX A;  1P1U A;  4RJZ A;  4R2B A;  1JET A;  4OEN A;  1JW5 A;  3OD7 A;  3S9L C;  5I57 A;  2WKY A;  2Q8J A;  1JEV A;  1MQH A;  1N7W A;  3ODB A;  5AA2 B;  4P0I A;  1P1N A;  3MZB A;  2I0B A;  4JSO A;  2RC7 A;  2Y7K A;  1IXG A;  2XD2 A;  4YMA A;  3T66 A;  3OMB A;  3TTN A;  3BKI B;  3MAM A;  1PEB A;  3QUJ A;  1S7Y A;  1TFD A;  3H6U A;  4GVO A;  3DP6 A;  3PUV E;  4JSD A;  4TQU Q;  3PV0 E;  1KWH A;  1MDQ A;  4BDO A;  2PVU A;  1LAG E;  3IO4 A;  1NMU A;  4AQ4 A;  3IOW A;  3GBA A;  2H25 A;  2HZK A;  4XKP A;  2ZNT A;  4THI A; 
#chains in the Genus database with same CATH topology
 1MM7 A;  3OO8 A;  4QRZ A;  2FIE A;  4QBA A;  4OFL A;  3EHS A;  1FBC A;  4YKJ A;  4MH5 A;  3TCG A;  3FJG A;  1MXY A;  2QVU A;  2VGQ A;  3JZJ A;  3TUS A;  1D9Q A;  4JVI A;  3T9H B;  4MLV A;  5L9S A;  2PMS A;  1J1N A;  2ZNS A;  4PAI A;  2Q89 A;  1IMF A;  3PPN A;  4N4U A;  1OMP A;  4PF6 A;  4N8G A;  5CMK A;  3PTY A;  3ZKK A;  2PT2 A;  2XWI A;  2ZZV A;  3UA8 A;  3F11 A;  1G0I A;  1JVX A;  2D21 A;  4U21 A;  4KYS A;  1ZMG A;  4GWO A;  5IKB A;  4P9K A;  1RYO A;  3U92 A;  4OVT A;  4PTK A;  4KYE A;  3MQ9 A;  3KFM A;  3RPL A;  4EQ7 A;  2I4B A;  2L5V A;  2Y7W A;  1N3W A;  3GLB A;  2CZK A;  2ZYK A;  3C4M A;  3SEY A;  3O97 A;  1LBV A;  1TWY A;  5JTY B;  3MST A;  2WBD A;  3S4U A;  1EYK A;  2FHY A;  4MJO A;  4PC9 A;  5CBS A;  3TAJ A;  4BDR A;  4NF8 B;  2HAV A;  5AA2 D;  5DVF A;  1PB8 A;  4G8N A;  3TPA A;  2VPN A;  4NAP A;  5EHS A;  4GBW A;  4F1U A;  1YPN A;  3T93 B;  2V93 A;  4EF1 A;  4LON B;  1B5H A;  4JWX A;  2RF1 A;  1UTB A;  2BJI A;  2XX9 A;  2NXO A;  4G4P A;  4R2F A;  4I3Y A;  2I3W A;  3FD3 A;  2I0C A;  4RPO A;  2I4C A;  3A3C A;  4PP0 A;  3TOD A;  5H8S A;  4NF6 A;  4IR8 A;  1FPJ A;  1FPL A;  1SQY A;  4H1X A;  2GH9 A;  4H45 A;  5IGA A;  1FQE A;  3FJM A;  2AL4 A;  5DEX B;  4F2Q A;  1XC1 A;  4YAH X;  1SDX A;  2AL5 A;  2XXU A;  1XVX A;  4OYV A;  3BIG A;  5I57 B;  4JBZ A;  1MRP A;  3K1N A;  1FBG A;  2ZXT A;  3OOA A;  1POY 1;  3CVG A;  4XKN A;  4H0W A;  3QYT A;  5JEI A;  3H4Z A;  1B0H A;  4KD5 A;  1FRP A;  5F7V A;  4TLM B;  1Z7M E;  3ECR A;  1FTJ A;  4PFW A;  5I2K A;  4GRK A;  1JEU A;  4WEP A;  2XXI A;  2CMO A;  1QKA A;  3MVZ A;  3C35 A;  4G68 B;  2F6P A;  4RA1 A;  3C32 A;  3CI8 A;  1FTK A;  1K9Y A;  4JB7 A;  2UVG A;  2XXV A;  4YB5 A;  1B58 A;  5BWJ A;  3EKI A;  3T9V A;  4F18 A;  4R6Y A;  1Y4T A;  4LZ7 A;  5K2Y A;  1MH3 A;  2CZL A;  4JDF A;  3CSG A;  4OET A;  1A40 A;  5KDT A;  2FA7 A;  1B1H A;  1LBY A;  1Z7N E;  3OEL A;  4X9T A;  4IO6 A;  3QK6 A;  3H6T A;  4YB7 A;  3A3U A;  3N5L A;  1IMD A;  1BLF A;  4ZZA A;  3Q28 A;  3LSW A;  4ZEB A;  4I8C A;  3FZV A;  3M3F A;  1PBQ A;  4U2R A;  1NV4 A;  4U1Z A;  2R9J A;  4LN5 A;  4KPT A;  2LAO A;  4O7I A;  1ZLQ A;  4ELO A;  4QSE A;  2Q2A A;  2R71 A;  4XFE A;  4PFI A;  3LSF B;  3IJO B;  3EQ1 A;  1XT8 A;  2HPG A;  1LBZ A;  4POW A;  1IMC A;  4GWW A;  4H8I A;  3OXN A;  3JV9 A;  3PD9 A;  2D3I A;  5IZ3 B;  2VPO A;  3VVD A;  2QS4 A;  1MM6 A;  4OFJ A;  3D1R A;  4KCC A;  4TLL B;  3RPL B;  2B4L A;  1YYZ A;  4X1B A;  1QUI A;  4DXU A;  4H5F A;  2ZYM A;  4PAF A;  5B7D A;  1NFT A;  2FBP A;  2YPN A;  4N8Y A;  1OLC A;  4OFO A;  1H43 A;  4RK2 A;  1A8F A;  3RLF E;  3PGF A;  4GWY A;  3GYY A;  3FVN A;  4MNI A;  3G3F A;  2XXY A;  3E9X A;  4ZE8 A;  5FHN A;  3B6Q A;  5CI5 A;  2OCU A;  3V8X B;  4AS5 A;  1N7X A;  1FPK A;  4DXC A;  4Z0I A;  3TQL A;  1UTB B;  1YTV A;  3OO9 A;  2QPQ A;  2BJJ X;  1GVC A;  3W15 C;  3IB0 A;  3VXC A;  2UYE A;  1NNF A;  2VP1 A;  4I1D A;  3CFX A;  4C0R A;  1XI6 A;  1HSL A;  1N04 A;  4FIM A;  5JK4 A;  5HM4 B;  3SZP A;  1D9V A;  5I56 A;  4AB5 A;  5EQA A;  1A8E A;  4KHZ E;  3PPR A;  4C1U A;  4NF6 B;  2DVC A;  1LGB C;  1TT1 A;  3EN3 A;  1AOV A;  4QFP A;  5TU0 A;  1NKX A;  3K02 A;  4KXP A;  1PC3 A;  1CNQ A;  5L9M A;  5I59 A;  1FPI A;  4GXA A;  3T9U A;  1NH8 A;  4O3A A;  1LAX A;  4OES A;  4OQO A;  4H67 A;  4QHQ A;  4RPN A;  3FXB A;  3GZG A;  4GWZ A;  1XHY A;  1GV8 A;  4ZEK A;  1G0H A;  4ZZE A;  1UTH A;  2B4M A;  1JVY A;  4YKI A;  4GX3 A;  4Q30 B;  3TDJ A;  2FYI A;  3SEX A;  4C1T A;  2AYS A;  3K6V A;  5B70 A;  3FUZ A;  4PBH A;  1IME A;  1FBH A;  1DTG A;  3K1P A;  4MCO A;  4F2O A;  2VHA A;  1RKM A;  3RN8 A;  1FPF A;  3Q26 A;  4FAJ A;  4NG7 A;  2NOO A;  4NMY A;  1SYH A;  3JYR A;  3C36 A;  1MQG A;  1M5E A;  4NE4 A;  1OVT A;  4F3S A;  2X26 A;  1AWB A;  1SI1 A;  3MPK A;  2RCA A;  3KOT A;  3RNN A;  5KDT B;  2Y5K A;  4F3G A;  1B1X A;  3RT6 B;  3PUY E;  4DI4 B;  1UQW A;  2Z23 A;  1R1N A;  3O28 A;  3UIF A;  1JW1 A;  4P0G A;  1LAH E;  2DE4 A;  4G8H A;  2OLB A;  1SW1 A;  4R9G A;  4F19 A;  2A5S A;  2HQ0 A;  3B8B A;  3IX1 A;  3N6T A;  3QMF A;  4KYD A;  3O66 A;  3K1M A;  2O84 X;  3TFL A;  2PFY A;  1IEJ A;  3MJN A;  1US4 A;  1FTA A;  3RGY A;  3IJX B;  1AMF A;  2GFE A;  1ATG A;  2XWV A;  3O6I A;  1IIW A;  4HE2 A;  3SET A;  4E0W A;  4JXI A;  1DBZ A;  4I9D A;  1GTK A;  2UYF A;  3TZA A;  4EF2 A;  1JW4 A;  1KA0 A;  3K4U A;  2QRY A;  4FJP A;  5KCJ A;  2W7Y A;  4K3F A;  2QMW A;  1MY0 A;  4G8M A;  4GBV A;  4YIC A;  4R9F A;  4F29 A;  1FW0 A;  2OK2 A;  4DLD A;  4HTG A;  4ZE9 A;  3M8U A;  5ICQ A;  2V3Q A;  3FGS A;  2DWH A;  5TPA B;  4F22 A;  4O7M A;  3RT8 A;  3IFC A;  1CB6 A;  2F35 A;  3SER A;  3UK4 A;  1N76 A;  3QIM A;  3VVE A;  1OIB A;  1IIT A;  3VLW A;  5HBC A;  4OZ9 A;  1MS7 A;  4YKP A;  4FED A;  4R6K A;  1I6A A;  3I6V A;  3H03 A;  3RYD A;  1AIV A;  3FAT A;  1IXI A;  2QSX A;  2X7Q A;  5DTB A;  1QW0 A;  2FNC A;  3FIR A;  2WYK A;  5IZZ A;  4BLA A;  4IO5 A;  2F97 A;  4KCD A;  3T9X B;  3U65 A;  3CHG A;  2HZL A;  4R72 A;  2GRV A;  3BFT A;  3TCH A;  2G93 A;  3PPO A;  4OMB A;  4G77 A;  4HCY A;  4OVS A;  4UAB A;  1B46 A;  1H44 A;  2DWA A;  4O94 A;  1QJM A;  4ELR A;  4ELQ A;  5I59 B;  2QS3 A;  2DXR A;  2F34 A;  1LST A;  2FVZ A;  4YMB A;  3U8Q A;  4GL8 A;  4MFI A;  4RNS A;  3FVO A;  2DS9 A;  4O3C A;  2Y84 A;  3EHT A;  1DSN A;  1FCK A;  1UTH B;  2XXT A;  1L5T A;  3IAZ A;  1CE2 A;  1MXV A;  3VDF A;  3O6H A;  3EPE A;  4KFQ A;  2DSF A;  2ESN A;  2D5W A;  4E0X A;  1ZBM A;  4NHB A;  2O7I A;  1R9Q A;  4HW8 A;  3IB2 A;  2QS1 A;  2O1M A;  1I6Q A;  5ESY A;  3HPI A;  2XX8 A;  1NNT A;  4NWD A;  2XXP A;  1B7H A;  2XXH A;  4F31 B;  4PFB A;  1R9L A;  1VSO A;  3UGW A;  1P1Q A;  1IUD A;  3B6W A;  4LP2 B;  3A29 A;  4QXD A;  2YLN A;  1EZ9 A;  3E3K A;  1Y20 A;  3P7I A;  3S9E A;  4H6D A;  2FIX A;  3CG1 A;  4GFR A;  1ZIU A;  3U1O A;  3VLV A;  1BP5 A;  1LFH A;  5H8H A;  4PF8 A;  4IB2 A;  3MVX A;  4ND9 A;  1FQB A;  4N6P A;  3TEL A;  1SD3 A;  1SBP A;  5AA4 A;  1MXX A;  2PX1 A;  4PFT A;  3V83 A;  4BDM A;  1BTJ A;  3Q29 A;  2H5Y A;  5ITO A;  2DP8 A;  4I40 A;  1UIU A;  1IMA A;  2V3T A;  4Q0C A;  5AE4 A;  2I58 A;  4U22 A;  4DCY A;  3G3G A;  1LFI A;  1OVB A;  3WAE A;  1URD A;  2H4I A;  4R73 A;  1B52 A;  3V5A A;  3C33 A;  4EXK A;  3TTR A;  4DE8 A;  5I5P A;  4HS7 A;  4N15 A;  4LZ8 A;  3ILU B;  3B6T A;  1Y3Q A;  3TMG A;  1B7Z A;  4P8B A;  4M1V A;  4QFN A;  4KR5 A;  3MZ1 A;  2ZNU A;  3HO7 A;  4NF4 A;  1YZ0 A;  5CRY A;  3K0V A;  1FQF A;  2F6G A;  4N07 A;  1LBB A;  2A5T A;  1TXF A;  4NTL A;  5LOM A;  3BFU A;  3DLN A;  4GXS B;  2XHD A;  4X1D A;  2Q2C A;  3G3I A;  4Q5T A;  2IEE A;  2O51 A;  1FJ9 A;  4XKQ A;  1JP4 A;  1XS5 A;  3IB1 A;  1NUX A;  3IL1 B;  3LSL A;  3DEL B;  4DCX A;  1Y3N A;  5DVI A;  2B3F A;  2I3V A;  2GHB A;  3DP4 A;  1PB7 A;  4EDP A;  3MWB A;  3V89 B;  5I58 A;  2Y7P A;  1FBF A;  4DIG A;  1JNF A;  2DVZ A;  2DYX A;  3N26 A;  5EHM A;  3KN8 A;  5DYH A;  1EZP A;  3KBR A;  2OZZ A;  2ZYO A;  3KSJ A;  3HCQ A;  2Y7R A;  3T22 A;  2DE2 A;  1FPD A;  1MPC A;  4NN3 A;  5BUU A;  1TFA A;  2I48 A;  5L9O A;  1NH7 A;  1LBC A;  2ANJ A;  3KG2 A;  1B5J A;  1NNP A;  4QSD A;  2F8D A;  4MX6 A;  3PD8 A;  5ET5 A;  3IR1 A;  5F24 A;  1QKB A;  4OA4 A;  3HHF A;  1B6H A;  3E13 X;  2F7B A;  3R26 A;  2F78 A;  3BBR A;  2NWJ A;  4NX1 A;  5M2V A;  3KGC A;  3KJT A;  1LLS A;  4IO3 A;  1VR5 A;  1S50 A;  1Q35 A;  2Z8E A;  2PFZ A;  2RIN A;  1EYJ A;  2Q88 A;  3DP8 A;  4RYA A;  4JWY A;  1BKA A;  1B3E A;  3CR9 A;  3KEI A;  4KI0 E;  3SEW A;  2HCA A;  5AA2 A;  3OEN A;  3G3K A;  4X48 A;  4O8M A;  4XTC Q;  1XVY A;  1DCU A;  1WDN A;  1SYI A;  2WBB A;  1LFG A;  1IXH A;  1B3G A;  3TQW A;  4ISU A;  1EH3 A;  2OWS A;  3FXQ A;  3SDF A;  2Y7I A;  2V84 A;  2OWT A;  2ALU A;  4PE5 B;  3PPP A;  3IOT A;  2B65 A;  3MBP A;  4FBP A;  2WYP A;  5T3J A;  1AL3 A;  5A5X A;  1A7L A;  3U93 A;  5H8Q A;  3T96 B;  1MQI A;  3H6W A;  4H46 A;  2Q8M A;  4PCD A;  1I6B A;  2REJ A;  5H8H B;  3PUX E;  4GQO A;  3HV1 A;  5DVJ A;  4G2Z A;  2PCR A;  1SW5 A;  4NGU A;  2ABH A;  4RY1 A;  5ET7 A;  5AA4 B;  4EQB A;  4OAN A;  3MUQ A;  3I3V A;  3LV0 A;  4ELP A;  1B40 A;  1Q9D A;  2F7A A;  4MMP A;  3M3L A;  1FTO A;  2PYY A;  3FBP A;  2PT1 A;  3RUM A;  1EYI A;  3N6U A;  4X04 A;  3E78 A;  4JWO A;  4GF8 A;  3VE1 B;  3H7M A;  1RYX A;  2H98 A;  1FBE A;  5EQ9 A;  2XXK A;  3KN3 A;  3KJ7 A;  4G61 A;  1NV0 A;  5EQ7 A;  2VOZ A;  2HHM A;  5FHM A;  5FHO A;  1OLA A;  3C31 A;  4NF4 B;  5I2K B;  3KC0 A;  3KZG A;  1B5I A;  1LB9 A;  4OXV A;  2A5T B;  4MEV A;  3O2A A;  1FPE A;  4MNC A;  1AH5 A;  1FPB A;  2OX3 A;  3TKD A;  4N13 A;  4BDL A;  1A54 A;  1VDW A;  1LEV A;  3D4C A;  5IZ1 A;  3ISP A;  3HST A;  3K01 A;  3IO6 A;  1NV7 A;  1MPB A;  2G29 A;  2QJE A;  2XXQ A;  3ILT B;  4H5G A;  3BIH A;  1M5C A;  3D4G A;  4BDN A;  1K9Z A;  2OBG A;  1I69 A;  3OSR A;  2UVH A;  4LZ5 A;  1KA1 A;  3PMX A;  2CEY A;  4GL0 A;  2Z8D A;  1OQG A;  4WXJ A;  5FTH A;  2KLF A;  3CG3 A;  4DI3 D;  4NF0 A;  5CMB A;  3VLU A;  3CIJ A;  1LBX A;  2ZYN A;  2XX7 A;  3E4R A;  4FAT A;  5H8N A;  3H3G A;  3O6G A;  3LBS A;  1B2H A;  4PFU A;  2XD3 A;  1LBW A;  1QUL A;  1MPD A;  4GWX A;  1B7U A;  1USY E;  1FTM A;  4IY6 A;  3GBB A;  1PDA A;  4GLI A;  4HE1 A;  2P2A A;  4P11 A;  1NV3 A;  4N91 A;  4QFO A;  3ZKL A;  2V4C A;  5IAI A;  2O1L A;  2R6G E;  1XOC A;  4L17 A;  2MKZ A;  1NUY A;  2OJT A;  1NV2 A;  4YKK A;  1FTL A;  2DWI A;  4QF9 A;  3ROJ A;  3SEV A;  3VFJ A;  3U72 A;  5ET6 A;  3T1B A;  1II5 A;  1M5D A;  3PMV A;  3NOH A;  2WEF A;  1ZJL A;  2QVV A;  4WED A;  2JJK A;  4G68 A;  4F39 A;  4XIG Q;  5A5X B;  1NUW A;  5H8Q B;  3OSQ A;  3R7X A;  1VFD A;  2O68 A;  4UAC A;  1B0L A;  3ZS6 A;  1FQD A;  4ONY A;  5I56 B;  5EQ8 A;  3FV2 A;  2P0S A;  4NQ8 A;  1MY4 A;  4IO4 A;  1MXW A;  2YJP A;  2XA5 A;  1N84 A;  1NV6 A;  4NWC A;  3CFL A;  3L6G A;  5EYH A;  3W9W A;  1FPG A;  1D4N A;  1MQJ A;  3EHU A;  1LCT A;  3EF7 A;  3RY3 A;  2P3V A;  4YZZ A;  4JVD A;  4MHF A;  5DW8 A;  1US5 A;  3QAX A;  1WVJ A;  3AXF A;  1IZ1 A;  4P56 A;  2XXX A;  2CZI A;  1IXC A;  3L6H A;  3A09 A;  2AIX A;  2HEU A;  4POX A;  5CMC A;  3Q25 A;  3TEP A;  1SVX B;  4PET A;  2PBW A;  1ANF A;  3TTL A;  3UN6 A;  2H9B A;  2GQ1 A;  3FVK A;  5IZ3 A;  1YXI A;  4F1V A;  4U4S A;  1HSE A;  1M5F A;  3C34 A;  4FE8 A;  3H06 B;  2ZZX A;  2P1S A;  3FXR A;  4P47 A;  4ECF A;  2F3B A;  3W9V A;  3QUF A;  2O6A A;  1MQD A;  4LQ2 A;  4UA8 A;  4HXV A;  1FBD A;  2Y5L A;  4IO7 A;  2ONK E;  4H65 A;  2UVJ A;  3CRB A;  5L8D A;  2RKM A;  3VXB A;  4Q8R A;  2M8C A;  4FEB A;  4ZDM A;  4IGR A;  1IQ7 A;  3IFA A;  4PAK A;  4QFK A;  4DDD A;  4TOZ A;  1URG A;  4U1O A;  3MVW A;  4OVP A;  1FJ6 A;  1HSJ A;  3PU5 A;  5I2N A;  5J16 A;  3G3H A;  4PFR A;  5ITP A;  4PDH A;  2R8T A;  4RXL A;  4QFL A;  2UVI A;  1ELJ A;  1SW2 A;  4X8R A;  3R6U A;  5TP9 A;  3H6V A;  2ONR A;  3MP1 A;  4U4X A;  1Y4C A;  2E1S A;  1PB9 A;  2DDK A;  3G3J A;  1NNK A;  4PGN A;  1MG1 A;  4P3L A;  1ZU0 A;  1Y1Z A;  1POT A;  4NF5 A;  2VD3 A;  1B9J A;  1D9Y A;  2HXR A;  2O69 A;  5H8N B;  2E0S A;  3PMW A;  1SW4 A;  3ONM A;  4F3B A;  3MZ9 A;  4I62 A;  3K2D A;  3Q27 A;  3THI A;  2RC9 A;  5AA1 A;  3PUW E;  4XKR A;  3TYH A;  4OWD A;  1MY2 A;  2REG A;  3IK6 B;  4GX6 A;  4M4G A;  4HE0 A;  1VFE A;  5FBP A;  4GWU A;  5ICT A;  2THI A;  4XF5 A;  4ESW A;  5CM6 A;  4IGT A;  1EZO A;  1LAF E;  3HN0 A;  4R74 A;  1B05 A;  3FJ7 A;  4HCW A;  4YU0 A;  5KCJ B;  2B3B A;  3CSB A;  4LA9 A;  1FSA A;  1YCJ A;  2Z8F A;  1FQC A;  5A5L A;  4MNP A;  5CC2 A;  1EU8 A;  4F1Y A;  1FBP A;  4GWS A;  2KQZ A;  1O7T A;  2QMX A;  3HHG A;  4IY5 A;  4LUB A;  2I6E A;  1OQH A;  2VD2 A;  1QVS A;  1GGG A;  1IMB A;  4RK9 A;  5KZT A;  4ZEC A;  3B7D A;  3MW0 A;  1JQF A;  1QUJ A;  1H3D A;  3VVF A;  3FXU A;  3OEM A;  2XXR A;  5H8F A;  1T0K A;  3OO7 A;  5ELV A;  3T0J A;  2QS2 A;  4QSC A;  2HFB A;  4OEV A;  3O29 A;  4MLQ A;  3E79 A;  5EYF A;  1F9B A;  1NUZ A;  4PE3 A;  4EXL A;  3K00 A;  4EQ9 A;  3S9M C;  1S9T A;  3SKP A;  2V25 A;  2H99 A;  4MAG A;  3FAS A;  4OTE A;  4GIZ A;  4G68 C;  4O3B A;  1Y9U A;  4KQP A;  4NED A;  2ONS A;  1B4H A;  4FOR A;  5EYG A;  4DZ1 A;  2NVU B;  1N3X A;  3SEU A;  2DE3 A;  5FTI A;  3B50 A;  3ZSF A;  1D3K A;  4R6H A;  3S9N C;  3MPL A;  4MF3 A;  4P1L A;  1NI9 A;  1Y1M A;  4OHN A;  4R75 A;  4N17 A;  2NUV A;  1RDY A;  3RTW B;  4OVJ A;  3UP9 A;  3KN7 A;  4GD5 A;  4LVQ A;  2OWZ A;  1MY3 A;  2UXA A;  1A99 A;  4F3P A;  3PUZ E;  1URS A;  1DPE A;  4N6D A;  4ZEF A;  5HPQ A;  2O7U A;  4XEQ A;  3OEK A;  3GXA A;  2DOJ A;  2Q9T A;  3MC2 A;  3IOR A;  1ZKB A;  4H8J A;  1O63 A;  2QL3 A;  3LR1 A;  3M3K A;  1DPP A;  5F1Q A;  2F3D A;  5TPA A;  3LC8 A;  1ZTY A;  4PFY A;  1Q1K A;  4ESX A;  5I2N B;  2F7C A;  2V3U A;  3FV1 A;  3CFZ A;  1P1O A;  5LDZ A;  4AS4 A;  5AA3 A;  5TP9 B;  4OVR A;  4AB6 A;  3K6U A;  2Q74 A;  3O9P A;  3SES A;  3S2V A;  1DK4 A;  4Z7E A;  1B3H A;  4NF5 B;  1RDX A;  4DXB A;  3UOR A;  1BIY A;  1USY H;  3TTK A;  4ZED A;  2VT5 A;  2IA4 A;  1YAE A;  2HXW A;  2DWJ A;  1R6Z A;  3RTF B;  1MH4 A;  3FVG A;  1H76 A;  3KC1 A;  3K6X A;  4N6K A;  1NL5 A;  4XXU A;  3QXM A;  1B3F A;  4ZS9 A;  3RPW A;  3DM0 A;  1B32 A;  3IOU A;  4EUO A;  4U23 A;  3HFU A;  4WKM A;  1VE4 A;  2F36 A;  4FEC A;  3K6W A;  1INP A;  4PBQ A;  5ISU A;  1MY1 A;  1A55 A;  1M5B A;  2WX9 A;  1QUK A;  1N0T A;  5J1D A;  2P3N A;  1LCF A;  2RC8 A;  4IO2 A;  1MXZ A;  3IOV A;  5JTY A;  3QSL A;  4YB6 A;  1BK4 A;  1GR2 A;  1PBP A;  5CMM A;  1O64 A;  3G7W A;  2ZZW A;  5IM2 A;  4PQJ A;  4NF8 A;  1P1W A;  4ZEI A;  3OO6 A;  2KR0 A;  1DMB A;  4PGP A;  1H45 A;  2F5X A;  3USD A;  3MP8 A;  3PPQ A;  3I5O A;  5K2X A;  1P99 A;  3MP6 A;  5I58 B;  1WOD A;  1KZ8 A;  2DXY A;  3N94 A;  5H8F B;  4P1E A;  4BDQ A;  1MDP 1;  2RCB A;  2X7P A;  4LAT A;  1SI0 A;  2HAU A;  4PDD A;  3TTM A;  3LUY A;  3VV5 A;  5DT6 A;  1NV5 A;  3U94 A;  2XWO A;  5I84 A;  3MVY A;  2QFL A;  3KSX A;  2DQV A;  2Z22 A;  4MIJ A;  1DOT A;  3RQT A;  3TCF A;  1B3L A;  1SPI A;  1UIV A;  2I49 A;  1LB8 A;  4JVC A;  5CBR A;  4OEU A;  1B4Z A;  4LQ5 A;  3WAF A;  4GOT A;  1DTZ A;  2GHA A;  3LSX A;  1Y3P A;  2ZMB A;  4OER A;  2XXW A;  3C9H A;  4MBP A;  1B51 A;  1MXU A;  1FQA A;  3KOS A;  5DEX A;  5LTC A;  1P1U A;  1QGX A;  5ET8 A;  2XWK A;  4RJZ A;  4R2B A;  5I7I A;  2CEX A;  1JET A;  4OEN A;  1JW5 A;  3OD7 A;  3S9L C;  5I57 A;  2WKY A;  2Q8J A;  1JEV A;  1MQH A;  1N7W A;  3ODB A;  5AA2 B;  4P0I A;  1P1N A;  3MZB A;  2I0B A;  1NV1 A;  4JSO A;  4I3E A;  2RC7 A;  1RDZ A;  2Y7K A;  1IXG A;  2XD2 A;  4YMA A;  3T66 A;  3OMB A;  4GX4 A;  3TTN A;  3BKI B;  3MAM A;  1PEB A;  2QVR A;  3QUJ A;  1S7Y A;  1TFD A;  5I3S A;  3H6U A;  3MYU A;  4GVO A;  3DP6 A;  3PUV E;  4JSD A;  4TQU Q;  3PV0 E;  1KWH A;  1MDQ A;  3KBZ A;  4BDO A;  2PVU A;  1LAG E;  3IO4 A;  1NMU A;  4AQ4 A;  3LUZ A;  3IOW A;  3GBA A;  2H25 A;  4OVQ A;  2HZK A;  4XKP A;  2ZNT A;  4THI A;  2CZH A;  4N81 A; 
#chains in the Genus database with same CATH homology
 1MM7 A;  3OO8 A;  4QRZ A;  4OFL A;  3EHS A;  4YKJ A;  4MH5 A;  3TCG A;  3FJG A;  1MXY A;  2VGQ A;  3JZJ A;  3TUS A;  3T9H B;  4MLV A;  5L9S A;  2PMS A;  1J1N A;  2ZNS A;  2Q89 A;  3PPN A;  1OMP A;  5CMK A;  3ZKK A;  2PT2 A;  3UA8 A;  3F11 A;  1JVX A;  2D21 A;  4U21 A;  4KYS A;  1ZMG A;  4GWO A;  5IKB A;  1RYO A;  3U92 A;  4KYE A;  3MQ9 A;  3KFM A;  4EQ7 A;  2I4B A;  2Y7W A;  1N3W A;  3GLB A;  2ZYK A;  3C4M A;  3SEY A;  3O97 A;  1TWY A;  5JTY B;  3S4U A;  5CBS A;  3TAJ A;  4BDR A;  4NF8 B;  2HAV A;  5AA2 D;  5DVF A;  1PB8 A;  4G8N A;  3TPA A;  5EHS A;  4F1U A;  1YPN A;  3T93 B;  2V93 A;  4EF1 A;  4LON B;  1B5H A;  4JWX A;  2RF1 A;  1UTB A;  2XX9 A;  2NXO A;  4G4P A;  4R2F A;  2I3W A;  3FD3 A;  2I0C A;  4RPO A;  2I4C A;  3A3C A;  4PP0 A;  3TOD A;  5H8S A;  4NF6 A;  1SQY A;  4H1X A;  2GH9 A;  1FQE A;  3FJM A;  2AL4 A;  5DEX B;  4F2Q A;  1XC1 A;  4YAH X;  1SDX A;  2AL5 A;  2XXU A;  1XVX A;  4OYV A;  5I57 B;  4JBZ A;  1MRP A;  3K1N A;  2ZXT A;  3OOA A;  1POY 1;  3CVG A;  4XKN A;  4H0W A;  3QYT A;  5JEI A;  3H4Z A;  1B0H A;  4KD5 A;  5F7V A;  4TLM B;  1Z7M E;  3ECR A;  1FTJ A;  4PFW A;  5I2K A;  4GRK A;  1JEU A;  4WEP A;  2XXI A;  2CMO A;  1QKA A;  3MVZ A;  3C35 A;  4G68 B;  2F6P A;  4RA1 A;  3C32 A;  3CI8 A;  1FTK A;  4JB7 A;  2UVG A;  2XXV A;  4YB5 A;  1B58 A;  5BWJ A;  3T9V A;  4F18 A;  4R6Y A;  1Y4T A;  4LZ7 A;  5K2Y A;  1MH3 A;  2CZL A;  4JDF A;  3CSG A;  4OET A;  1A40 A;  5KDT A;  2FA7 A;  1B1H A;  1Z7N E;  3OEL A;  4X9T A;  4IO6 A;  3QK6 A;  3H6T A;  4YB7 A;  3A3U A;  3N5L A;  1BLF A;  4ZZA A;  3Q28 A;  3LSW A;  4ZEB A;  4I8C A;  3FZV A;  3M3F A;  1PBQ A;  4U2R A;  4U1Z A;  2R9J A;  4KPT A;  2LAO A;  1ZLQ A;  4ELO A;  4QSE A;  2Q2A A;  2R71 A;  3LSF B;  3IJO B;  3EQ1 A;  1XT8 A;  4POW A;  4H8I A;  3OXN A;  3JV9 A;  3PD9 A;  2D3I A;  3VVD A;  2QS4 A;  1MM6 A;  4OFJ A;  4KCC A;  4TLL B;  4X1B A;  1QUI A;  4DXU A;  4H5F A;  2ZYM A;  5B7D A;  1NFT A;  2YPN A;  1OLC A;  4OFO A;  1H43 A;  4RK2 A;  1A8F A;  3RLF E;  3PGF A;  3FVN A;  3G3F A;  2XXY A;  3E9X A;  4ZE8 A;  5FHN A;  3B6Q A;  5CI5 A;  2OCU A;  3V8X B;  1N7X A;  4DXC A;  4Z0I A;  3TQL A;  1UTB B;  1YTV A;  3OO9 A;  2QPQ A;  2BJJ X;  1GVC A;  3W15 C;  3IB0 A;  3VXC A;  2UYE A;  1NNF A;  2VP1 A;  4I1D A;  3CFX A;  4C0R A;  1HSL A;  1N04 A;  4FIM A;  5JK4 A;  5HM4 B;  1D9V A;  5I56 A;  4AB5 A;  1A8E A;  4KHZ E;  3PPR A;  4C1U A;  4NF6 B;  2DVC A;  1LGB C;  1TT1 A;  3EN3 A;  1AOV A;  4QFP A;  5TU0 A;  1NKX A;  3K02 A;  1PC3 A;  5L9M A;  5I59 A;  4GXA A;  3T9U A;  1NH8 A;  4O3A A;  1LAX A;  4OES A;  4OQO A;  4H67 A;  4QHQ A;  4RPN A;  3GZG A;  1XHY A;  1GV8 A;  4ZEK A;  4ZZE A;  1UTH A;  1JVY A;  4YKI A;  4Q30 B;  3TDJ A;  2FYI A;  3SEX A;  4C1T A;  2AYS A;  3K6V A;  5B70 A;  3FUZ A;  1DTG A;  3K1P A;  4F2O A;  2VHA A;  1RKM A;  3RN8 A;  3Q26 A;  4FAJ A;  2NOO A;  4NMY A;  1SYH A;  3JYR A;  3C36 A;  1MQG A;  1M5E A;  4NE4 A;  1OVT A;  4F3S A;  2X26 A;  1SI1 A;  3MPK A;  2RCA A;  3KOT A;  3RNN A;  5KDT B;  4F3G A;  1B1X A;  3RT6 B;  3PUY E;  1UQW A;  2Z23 A;  1R1N A;  3O28 A;  3UIF A;  1JW1 A;  4P0G A;  1LAH E;  2DE4 A;  4G8H A;  2OLB A;  1SW1 A;  4R9G A;  4F19 A;  2A5S A;  2HQ0 A;  3IX1 A;  3N6T A;  4KYD A;  3O66 A;  3K1M A;  2O84 X;  3TFL A;  1IEJ A;  3MJN A;  1US4 A;  3RGY A;  3IJX B;  1AMF A;  2GFE A;  1ATG A;  3O6I A;  1IIW A;  3SET A;  4E0W A;  4JXI A;  4I9D A;  1GTK A;  2UYF A;  3TZA A;  4EF2 A;  1JW4 A;  3K4U A;  2QRY A;  4FJP A;  5KCJ A;  2W7Y A;  4K3F A;  2QMW A;  1MY0 A;  4G8M A;  4YIC A;  4R9F A;  4F29 A;  1FW0 A;  2OK2 A;  4DLD A;  4HTG A;  4ZE9 A;  3M8U A;  5ICQ A;  2V3Q A;  3FGS A;  2DWH A;  5TPA B;  4F22 A;  3RT8 A;  1CB6 A;  2F35 A;  3SER A;  3UK4 A;  1N76 A;  3QIM A;  3VVE A;  1OIB A;  1IIT A;  3VLW A;  5HBC A;  4OZ9 A;  1MS7 A;  4YKP A;  4FED A;  4R6K A;  1I6A A;  3I6V A;  3H03 A;  1AIV A;  3FAT A;  1IXI A;  2QSX A;  2X7Q A;  5DTB A;  1QW0 A;  2FNC A;  3FIR A;  4BLA A;  4IO5 A;  2F97 A;  4KCD A;  3T9X B;  2HZL A;  4R72 A;  2GRV A;  3BFT A;  3TCH A;  2G93 A;  3PPO A;  4OMB A;  4G77 A;  4HCY A;  1B46 A;  1H44 A;  2DWA A;  4ELR A;  1QJM A;  4ELQ A;  5I59 B;  2QS3 A;  2DXR A;  2F34 A;  1LST A;  4YMB A;  3U8Q A;  4GL8 A;  4MFI A;  4RNS A;  3FVO A;  2DS9 A;  4O3C A;  2Y84 A;  3EHT A;  1DSN A;  1FCK A;  1UTH B;  2XXT A;  1L5T A;  3IAZ A;  1CE2 A;  1MXV A;  3VDF A;  3O6H A;  3EPE A;  4KFQ A;  2DSF A;  2ESN A;  2D5W A;  4E0X A;  1ZBM A;  2O7I A;  1R9Q A;  4HW8 A;  3IB2 A;  2QS1 A;  2O1M A;  1I6Q A;  3HPI A;  2XX8 A;  1NNT A;  4NWD A;  2XXP A;  1B7H A;  2XXH A;  4F31 B;  1R9L A;  1VSO A;  3UGW A;  1P1Q A;  1IUD A;  3B6W A;  4LP2 B;  2YLN A;  1EZ9 A;  3E3K A;  1Y20 A;  3P7I A;  3S9E A;  4H6D A;  3CG1 A;  4GFR A;  1ZIU A;  3U1O A;  3VLV A;  1BP5 A;  1LFH A;  5H8H A;  4IB2 A;  3MVX A;  4ND9 A;  1FQB A;  4N6P A;  3TEL A;  1SD3 A;  1SBP A;  5AA4 A;  1MXX A;  2PX1 A;  4PFT A;  3V83 A;  4BDM A;  1BTJ A;  3Q29 A;  2H5Y A;  5ITO A;  2DP8 A;  1UIU A;  2V3T A;  4Q0C A;  5AE4 A;  2I58 A;  4U22 A;  4DCY A;  3G3G A;  1LFI A;  1OVB A;  3WAE A;  1URD A;  2H4I A;  4R73 A;  1B52 A;  3V5A A;  3C33 A;  4EXK A;  3TTR A;  4DE8 A;  4HS7 A;  4LZ8 A;  3ILU B;  3B6T A;  1Y3Q A;  3TMG A;  1B7Z A;  4M1V A;  4QFN A;  4KR5 A;  3MZ1 A;  2ZNU A;  3HO7 A;  4NF4 A;  5CRY A;  3K0V A;  1FQF A;  2F6G A;  4N07 A;  1LBB A;  2A5T A;  1TXF A;  4NTL A;  5LOM A;  3BFU A;  3DLN A;  4GXS B;  2XHD A;  4X1D A;  2Q2C A;  3G3I A;  4Q5T A;  2IEE A;  2O51 A;  4XKQ A;  1XS5 A;  3IB1 A;  3IL1 B;  3LSL A;  3DEL B;  4DCX A;  1Y3N A;  5DVI A;  2B3F A;  2I3V A;  2GHB A;  3DP4 A;  1PB7 A;  4EDP A;  3MWB A;  3V89 B;  5I58 A;  2Y7P A;  4DIG A;  1JNF A;  2DVZ A;  2DYX A;  3N26 A;  5EHM A;  3KN8 A;  5DYH A;  1EZP A;  3KBR A;  2OZZ A;  2ZYO A;  3KSJ A;  3HCQ A;  2Y7R A;  3T22 A;  2DE2 A;  1MPC A;  5BUU A;  1TFA A;  2I48 A;  5L9O A;  1NH7 A;  1LBC A;  2ANJ A;  3KG2 A;  1B5J A;  1NNP A;  4QSD A;  2F8D A;  3PD8 A;  3IR1 A;  1QKB A;  3HHF A;  1B6H A;  3E13 X;  2F7B A;  3R26 A;  2F78 A;  3BBR A;  2NWJ A;  5M2V A;  3KGC A;  3KJT A;  1LLS A;  4IO3 A;  1VR5 A;  1S50 A;  1Q35 A;  2Z8E A;  2RIN A;  2Q88 A;  3DP8 A;  4RYA A;  4JWY A;  1BKA A;  1B3E A;  3CR9 A;  3KEI A;  4KI0 E;  3SEW A;  2HCA A;  5AA2 A;  3OEN A;  3G3K A;  4X48 A;  4XTC Q;  1XVY A;  1WDN A;  1SYI A;  1LFG A;  1IXH A;  1B3G A;  3TQW A;  4ISU A;  1EH3 A;  2OWS A;  3FXQ A;  3SDF A;  2Y7I A;  2V84 A;  2OWT A;  2ALU A;  4PE5 B;  3PPP A;  3IOT A;  2B65 A;  3MBP A;  1AL3 A;  5A5X A;  1A7L A;  3U93 A;  5H8Q A;  3T96 B;  1MQI A;  3H6W A;  1I6B A;  2REJ A;  5H8H B;  3PUX E;  4GQO A;  3HV1 A;  5DVJ A;  4G2Z A;  1SW5 A;  2ABH A;  4RY1 A;  5AA4 B;  4EQB A;  3MUQ A;  3I3V A;  4ELP A;  1B40 A;  2F7A A;  3M3L A;  1FTO A;  2PYY A;  2PT1 A;  3RUM A;  3N6U A;  4JWO A;  4GF8 A;  3VE1 B;  3H7M A;  1RYX A;  2H98 A;  3KN3 A;  3KJ7 A;  2VOZ A;  5FHM A;  5FHO A;  1OLA A;  3C31 A;  4NF4 B;  5I2K B;  3KZG A;  1B5I A;  1LB9 A;  4OXV A;  2A5T B;  3O2A A;  1AH5 A;  3TKD A;  4N13 A;  4BDL A;  1A54 A;  3D4C A;  3HST A;  3K01 A;  3IO6 A;  1MPB A;  2G29 A;  2QJE A;  2XXQ A;  3ILT B;  4H5G A;  1M5C A;  3D4G A;  4BDN A;  2OBG A;  1I69 A;  3OSR A;  2UVH A;  4LZ5 A;  3PMX A;  4GL0 A;  2Z8D A;  1OQG A;  4WXJ A;  5FTH A;  2KLF A;  3CG3 A;  5CMB A;  3VLU A;  3CIJ A;  2ZYN A;  2XX7 A;  3E4R A;  4FAT A;  5H8N A;  3H3G A;  3O6G A;  3LBS A;  1B2H A;  4PFU A;  2XD3 A;  1QUL A;  1MPD A;  1B7U A;  1USY E;  1FTM A;  4IY6 A;  3GBB A;  1PDA A;  4GLI A;  2P2A A;  4P11 A;  4QFO A;  3ZKL A;  5IAI A;  2O1L A;  2R6G E;  1XOC A;  4L17 A;  2OJT A;  4YKK A;  1FTL A;  2DWI A;  4QF9 A;  3SEV A;  3VFJ A;  3U72 A;  1II5 A;  1M5D A;  3PMV A;  1ZJL A;  4WED A;  4G68 A;  4F39 A;  4XIG Q;  5A5X B;  5H8Q B;  3OSQ A;  3R7X A;  1VFD A;  2O68 A;  4UAC A;  1B0L A;  3ZS6 A;  1FQD A;  4ONY A;  5I56 B;  3FV2 A;  2P0S A;  1MY4 A;  4IO4 A;  1MXW A;  2YJP A;  1N84 A;  4NWC A;  3CFL A;  3L6G A;  3W9W A;  1D4N A;  1MQJ A;  3EHU A;  1LCT A;  3EF7 A;  3RY3 A;  4YZZ A;  1US5 A;  3QAX A;  1WVJ A;  3AXF A;  1IZ1 A;  2XXX A;  3L6H A;  1IXC A;  3A09 A;  2AIX A;  2HEU A;  4POX A;  5CMC A;  3Q25 A;  3TEP A;  1SVX B;  4PET A;  3TTL A;  1ANF A;  2PBW A;  3UN6 A;  2H9B A;  3FVK A;  4F1V A;  4U4S A;  1HSE A;  1M5F A;  3C34 A;  4FE8 A;  3H06 B;  2P1S A;  3FXR A;  4ECF A;  3W9V A;  3QUF A;  2O6A A;  1MQD A;  4LQ2 A;  4UA8 A;  4IO7 A;  2ONK E;  4H65 A;  2UVJ A;  3CRB A;  5L8D A;  2RKM A;  3VXB A;  4Q8R A;  2M8C A;  4FEB A;  4ZDM A;  4IGR A;  1IQ7 A;  4QFK A;  4DDD A;  4TOZ A;  1URG A;  4U1O A;  3MVW A;  1HSJ A;  3PU5 A;  5I2N A;  3G3H A;  5ITP A;  4RXL A;  4QFL A;  2UVI A;  1ELJ A;  1SW2 A;  3R6U A;  5TP9 A;  3H6V A;  2ONR A;  3MP1 A;  4U4X A;  1Y4C A;  2E1S A;  1PB9 A;  3G3J A;  1NNK A;  1MG1 A;  1ZU0 A;  1Y1Z A;  1POT A;  4NF5 A;  2VD3 A;  1B9J A;  1D9Y A;  2O69 A;  5H8N B;  2E0S A;  3PMW A;  1SW4 A;  3ONM A;  4F3B A;  3MZ9 A;  4I62 A;  3K2D A;  3Q27 A;  3THI A;  2RC9 A;  5AA1 A;  3PUW E;  4XKR A;  3TYH A;  4OWD A;  1MY2 A;  2REG A;  3IK6 B;  4M4G A;  1VFE A;  5ICT A;  2THI A;  4ESW A;  5CM6 A;  4IGT A;  1EZO A;  1LAF E;  3HN0 A;  4R74 A;  1B05 A;  3FJ7 A;  4HCW A;  4YU0 A;  5KCJ B;  2B3B A;  3CSB A;  4LA9 A;  1YCJ A;  2Z8F A;  1FQC A;  5CC2 A;  1EU8 A;  4F1Y A;  1O7T A;  2QMX A;  3HHG A;  4IY5 A;  4LUB A;  2I6E A;  1OQH A;  2VD2 A;  1QVS A;  1GGG A;  4RK9 A;  5KZT A;  4ZEC A;  3B7D A;  3MW0 A;  1JQF A;  1QUJ A;  1H3D A;  3VVF A;  3FXU A;  3OEM A;  2XXR A;  5H8F A;  1T0K A;  3OO7 A;  5ELV A;  2QS2 A;  4QSC A;  2HFB A;  4OEV A;  3O29 A;  4MLQ A;  5EYF A;  1F9B A;  4EXL A;  3K00 A;  4EQ9 A;  3S9M C;  1S9T A;  3SKP A;  2V25 A;  2H99 A;  3FAS A;  4OTE A;  4GIZ A;  4G68 C;  4O3B A;  1Y9U A;  4KQP A;  4NED A;  2ONS A;  1B4H A;  4FOR A;  4DZ1 A;  2NVU B;  1N3X A;  3SEU A;  2DE3 A;  5FTI A;  3ZSF A;  1D3K A;  4R6H A;  3S9N C;  3MPL A;  4MF3 A;  1Y1M A;  4OHN A;  4R75 A;  2NUV A;  3RTW B;  4OVJ A;  3UP9 A;  3KN7 A;  4GD5 A;  4LVQ A;  1MY3 A;  2UXA A;  1A99 A;  4F3P A;  3PUZ E;  1URS A;  1DPE A;  4ZEF A;  5HPQ A;  2O7U A;  3OEK A;  3GXA A;  2DOJ A;  2Q9T A;  3MC2 A;  3IOR A;  1ZKB A;  4H8J A;  1O63 A;  2QL3 A;  3LR1 A;  3M3K A;  1DPP A;  5F1Q A;  5TPA A;  3LC8 A;  1ZTY A;  4PFY A;  1Q1K A;  4ESX A;  5I2N B;  2F7C A;  2V3U A;  3FV1 A;  3CFZ A;  1P1O A;  5AA3 A;  5TP9 B;  4AB6 A;  3K6U A;  3O9P A;  3SES A;  3S2V A;  4Z7E A;  1B3H A;  4NF5 B;  4DXB A;  3UOR A;  1BIY A;  1USY H;  3TTK A;  4ZED A;  2IA4 A;  1YAE A;  2HXW A;  2DWJ A;  1R6Z A;  3RTF B;  1MH4 A;  3FVG A;  1H76 A;  3K6X A;  1NL5 A;  4XXU A;  3QXM A;  1B3F A;  4ZS9 A;  3RPW A;  3DM0 A;  1B32 A;  3IOU A;  4EUO A;  4U23 A;  4WKM A;  1VE4 A;  2F36 A;  4FEC A;  3K6W A;  5ISU A;  1MY1 A;  1A55 A;  1M5B A;  1QUK A;  1N0T A;  5J1D A;  1LCF A;  2RC8 A;  4IO2 A;  1MXZ A;  3IOV A;  5JTY A;  3QSL A;  4YB6 A;  1GR2 A;  1PBP A;  5CMM A;  1O64 A;  3G7W A;  4PQJ A;  4NF8 A;  1P1W A;  4ZEI A;  3OO6 A;  1DMB A;  1H45 A;  2F5X A;  3USD A;  3MP8 A;  3PPQ A;  3I5O A;  5K2X A;  1P99 A;  3MP6 A;  5I58 B;  1WOD A;  2DXY A;  3N94 A;  5H8F B;  4BDQ A;  1MDP 1;  2RCB A;  2X7P A;  4LAT A;  1SI0 A;  2HAU A;  3TTM A;  3LUY A;  3VV5 A;  5DT6 A;  3U94 A;  5I84 A;  3MVY A;  3KSX A;  2DQV A;  2Z22 A;  1DOT A;  3RQT A;  3TCF A;  1B3L A;  1UIV A;  2I49 A;  1LB8 A;  5CBR A;  4OEU A;  1B4Z A;  4LQ5 A;  3WAF A;  4GOT A;  1DTZ A;  2GHA A;  3LSX A;  1Y3P A;  2ZMB A;  4OER A;  2XXW A;  3C9H A;  4MBP A;  1B51 A;  1MXU A;  1FQA A;  3KOS A;  5DEX A;  1P1U A;  4RJZ A;  4R2B A;  1JET A;  4OEN A;  1JW5 A;  3OD7 A;  3S9L C;  5I57 A;  2WKY A;  2Q8J A;  1JEV A;  1MQH A;  1N7W A;  3ODB A;  5AA2 B;  4P0I A;  1P1N A;  3MZB A;  2I0B A;  4JSO A;  2RC7 A;  2Y7K A;  1IXG A;  2XD2 A;  4YMA A;  3T66 A;  3OMB A;  3TTN A;  3BKI B;  3MAM A;  1PEB A;  3QUJ A;  1S7Y A;  1TFD A;  3H6U A;  4GVO A;  3DP6 A;  3PUV E;  4JSD A;  4TQU Q;  3PV0 E;  1KWH A;  1MDQ A;  4BDO A;  2PVU A;  1LAG E;  3IO4 A;  1NMU A;  4AQ4 A;  3IOW A;  3GBA A;  2H25 A;  2HZK A;  4XKP A;  2ZNT A;  4THI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...