4G4PA

Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
235
Chain Sequence
HHGENLYFQGMEGKKYTIGTDLTFAPFEFQDSKGKYIGIDVDLLDAIAKDQDFEVDLKPLGFDSAVQAIQSKQIDGMIAGMSITDERKKSFDFSDPYFDSGLQLAVKKGNDKIKSYDDLKGKTVAAKVGTESANFLEKNKEKYDYTIKNFDDATGLYKALENGEADAIVDDYPVLGYAVKNGQKLQLVGDKETGSSYGFAVKKGQNPELIKKFNAGLKNLKDNGTYDKILNNYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transport protein
molecule keywords Amino acid ABC transporter, amino acid-binding/permease prot
total genus 77
structure length 235
sequence length 235
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g4pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g4pA02
1HSJA 2DWHA 3QK6A 3QIMA 3I6VA 3N94A 3H3GA 4KFQA 3V8XB 1LFGA 3PV0E 1O63A 4OEVA 4PE5B 1NL5A 1N7WA 5DVJA 4X48A 4OXVA 2A5TA 5AA3A 1NNTA 2B3FA 2THIA 4FORA 1Y4CA 4H67A 3VVEA 4ECFA 5AA4A 2ESNA 4O3AA 2CZLA 2OJTA 2XXQA 1Z7ME 4FEBA 4OETA 5I57A 5LOMA 1GGGA 3DP4A 1NH8A 1B52A 2HZLA 4ZEFA 2XXRA 5H8QA 4ZZEA 3WAFA 4ZE8A 2F35A 4JSDA 4TLMB 3VV5A 3LSFB 2F7CA 2VOZA 4JWYA 3W9VA 4DCXA 4NE4A 1FTLA 5H8FB 1N84A 2AIXA 4H1XA 3RQTA 3KSXA 2Y7KA 5TP9B 3SEXA 3S9MC 3U8QA 2ANJA 1YTVA 3K1NA 4WEDA 4N6PA 1LAGE 4Z7EA 4YAHX 3N6TA 3SEUA 2O6AA 1MQIA 1ZBMA 4X1BA 3VLUA 1F9BA 2DYXA 3MC2A 4G8NA 4HW8A 5BWJA 3S9LC 1Y1MA 5CMKA 4EDPA 5TP9A 1I6AA 1MY4A 2IA4A 4BDOA 5H8FA 3N6UA 1TWYA 1FTOA 3KFMA 3ONMA 2H99A 4YMAA 2ONSA 3CG1A 1FTKA 4OEUA 2D3IA 2OLBA 2UVHA 3O6HA 2XX9A 4GF8A 4KHZE 3ZKLA 1EZOA 1FTJA 1DPPA 5H8QB 1ZJLA 1LCFA 2F7AA 2RINA 3MP6A 4E0WA 3G3IA 5EHSA 2PT2A 4FEDA 4FECA 4H0WA 4XKPA 3VXCA 3MW0A 2DWIA 1P99A 3IX1A 4IO5A 4YKPA 4WXJA 3MPKA 2Q2AA 2HXWA 3PUWE 3SEWA 2AYSA 1KWHA 3TQWA 4RXLA 3FJGA 3IR1A 4G4PA 3K00A 2A5TB 1B46A 3VFJA 3RNNA 3O29A 4UA8A 2DWAA 1JVXA 2RC9A 4RNSA 5CM6A 4MH5A 5AA2D 4H5FA 1A8FA 5IAIA 4POWA 4DXBA 1US4A 3ZS6A 1QKAA 3BKIB 2Q89A 3UP9A 3S2VA 1H45A 1MXWA 2O51A 4NMYA 4POXA 4QF9A 5CC2A 1DPEA 3UN6A 2CMOA 3KGCA 4I9DA 4NF4A 1UIVA 2GH9A 4U4XA 2QMWA 3TTNA 1PB7A 4PFWA 1Y4TA 1AOVA 4F19A 3H7MA 2O7UA 3IK6B 3TEPA 3CVGA 3PMWA 1IQ7A 3IORA 1B4HA 4ZEKA 3VVDA 5FHMA 2NOOA 1AMFA 2Q9TA 5K2YA 1RKMA 4NF8B 5M2VA 3TYHA 4GL0A 4NF6A 5CI5A 5I57B 2I48A 2RC7A 3EF7A 2QS4A 1B58A 3TFLA 2X7QA 1B0LA 3C33A 1S50A 3OENA 5CMBA 4F2QA 4H5GA 2PYYA 3R26A 3B7DA 4MBPA 2GRVA 2V93A 3HN0A 3PPRA 1D3KA 3G3GA 5I2KB 3O28A 2W7YA 4OWDA 1VE4A 3MPLA 4GL8A 4NF5A 3M3KA 4DE8A 5JTYA 1BLFA 1M5FA 1MH4A 3G3JA 4U2RA 1B2HA 1YPNA 1MRPA 1QW0A 2XXVA 3EQ1A 3FJMA 4QSDA 2F34A 4TLLB 4YKIA 1FQCA 5F7VA 5AA2B 3ZKKA 1B3LA 2I0BA 3N26A 1MDQA 1SQYA 4IO6A 4RY1A 1VSOA 2V3TA 4ZDMA 5TU0A 2WKYA 4KR5A 3TCHA 2I49A 2QMXA 1CB6A 3WAEA 3HO7A 3FV2A 4X9TA 4ESXA 1SI1A 4GXSB 5H8NB 2Z8FA 1CE2A 1B05A 1B1XA 4AB5A 1URGA 2Y7RA 3C31A 3C4MA 3H06B 4NF4B 4OZ9A 3RPWA 4QFKA 3U92A 5KZTA 4RK2A 3VDFA 1B5HA 3PPNA 4Q30B 2QS2A 4QFPA 2XXYA 4GXAA 4U1ZA 1BKAA 4EUOA 4P0GA 1OVBA 2NVUB 4HCWA 2XXIA 3IL1B 3ODBA 1Z7NE 3SESA 4DZ1A 4FIMA 3IB0A 4PQJA 5JK4A 1LFHA 3PPPA 3N5LA 2OWTA 1L5TA 1IXGA 1BP5A 4N13A 3T66A 1Q35A 3H4ZA 2DXRA 2I0CA 1LLSA 3K6WA 4U23A 4ZE9A 5I58A 4BLAA 4G68C 1B5IA 2OK2A 3KZGA 3ZSFA 4EQ9A 5B7DA 3PMXA 1P1QA 5A5XB 1M5DA 1D9YA 3MVWA 4OQOA 4OHNA 5JEIA 1ZMGA 2Y7IA 3HHFA 1SW4A 1UTHB 2O1LA 2Y7PA 2ZXTA 3AXFA 3PUXE 5H8HA 4LZ5A 2O7IA 4PFYA 3CR9A 4IGRA 3CG3A 5FHOA 1SW2A 4ONYA 3SERA 3KOSA 4OFJA 5DYHA 4ND9A 4BDNA 1IITA 4GOTA 4R2FA 4DXUA 2R71A 2OZZA 2DE2A 1IUDA 1ZLQA 2XX8A 3L6HA 2R6GE 1SW5A 3E9XA 2G29A 1N7XA 2XD3A 1OQGA 1XHYA 3MZ1A 3FVGA 5L9SA 2PX1A 1OLAA 1DTZA 2R9JA 3B6TA 1P1UA 3ILTB 3T93B 5F1QA 4I1DA 1HSLA 1PB9A 3LR1A 2DOJA 3EHTA 4M4GA 1RYOA 2Q88A 4PFTA 2V25A 4IO7A 3IJXB 3A3UA 5CMCA 4F22A 3TQLA 1M5EA 1JETA 2H98A 3FVOA 1PBPA 4F1UA 3O97A 1N3XA 5DTBA 5ISUA 3DP8A 4LQ5A 3W9WA 3TTKA 5CRYA 1MQHA 3KOTA 1JVYA 4XIGQ 3THIA 4AQ4A 3T96B 1MPCA 4KCCA 4LZ8A 3Q25A 5TPAB 1POY1 1NMUA 1A54A 1PBQA 2M8CA 3OELA 4QFNA 4R9FA 3TTLA 1II5A 1LCTA 2DXYA 3TTMA 3USDA 5ICTA 2F78A 2NXOA 3GBBA 1OLCA 3O66A 3DLNA 3OO7A 4QFLA 4MLVA 4JXIA 4KCDA 4P11A 4PETA 5DVFA 3LUYA 3SEVA 2F97A 1I69A 3DELB 2QRYA 2Z22A 2ZNSA 3EN3A 3OOAA 4H65A 3FD3A 1JW1A 3FXQA 1UIUA 3KN3A 3SEYA 5KDTA 2QPQA 1R9QA 4G68B 2KLFA 1LAFE 2XXUA 3GZGA 1LSTA 3RTFB 3TTRA 3IOTA 3TZAA 3VLWA 5I84A 5IKBA 3A3CA 2DE3A 5K2XA 2G93A 1JEVA 2RCAA 3CFZA 3P7IA 3TKDA 4OFOA 3K4UA 4F29A 2ONKE 3C34A 1JQFA 1OMPA 1MG1A 3PPQA 4I8CA 4QSEA 1VFDA 2ZMBA 3FIRA 4KD5A 4OYVA 1IXHA 4F3PA 2NWJA 1B3HA 2H25A 5I2NB 1SVXB 1IXIA 2OWSA 3FV1A 3PU5A 2OCUA 4OESA 1LFIA 1FW0A 5KCJB 5ELVA 3R7XA 1TT1A 1URDA 4F1YA 1JNFA 4FATA 2H5YA 3O6IA 3C36A 1IXCA 3U72A 4AB6A 2I6EA 3K6VA 1O7TA 4U22A 1MXXA 1Y3PA 4MLQA 1H76A 3RT8A 1OQHA 3HHGA 1BTJA 3FUZA 4QFOA 2QJEA 4FJPA 4QRZA 4R6YA 3L6GA 4TOZA 4IO4A 4DDDA 1EH3A 2D5WA 3EHSA 3FXUA 3O6GA 4L17A 3RTWB 1Y9UA 5I56A 1AIVA 4G8HA 2UVIA 1AH5A 2DVZA 2GHBA 1MDP1 3W15C 4GLIA 1US5A 1MY1A 5L9MA 4EXKA 4R72A 4OMBA 4K3FA 2Y84A 1ATGA 2O1MA 3Q27A 3FVKA 4ISUA 1B3EA 1MY2A 2O84X 2UVJA 1MM7A 1SI0A 3QYTA 4R73A 4RYAA 1Y20A 3TCGA 4EF2A 1QUKA 1LBCA 3TDJA 2I3WA 4RPNA 4FAJA 3MP1A 2QL3A 5AA1A 3S9EA 5CMMA 3LSXA 3MQ9A 2P1SA 2Z23A 3OO6A 1QULA 3M3FA 4XTCQ 4RA1A 1N3WA 4IY6A 3Q26A 3B6WA 3C32A 3PMVA 5I2NA 4LP2B 3VXBA 4NWCA 1PDAA 2AL4A 4JDFA 1UTBA 3OXNA 4F3SA 1QUIA 3EHUA 3OEKA 4NTLA 3RN8A 3UORA 5I59B 3O2AA 4TQUQ 2HZKA 5DEXA 1Y1ZA 1QJMA 5ITOA 3CIJA 1IZ1A 2X26A 1Y3NA 4P0IA 4YICA 5J1DA 1YAEA 2FNCA 4F18A 3FVNA 2ZYOA 3OEMA 1RYXA 2YJPA 5KDTB 1N76A 2XXXA 3MVYA 4C1TA 1MXVA 4F39A 1P1NA 2DSFA 2I4CA 4YB5A 3RT6B 1POTA 1I6QA 2O68A 1MY3A 2ZYMA 1A99A 1DTGA 1MS7A 2V84A 3I3VA 3G7WA 3PPOA 2HCAA 3FATA 3CI8A 1USYH 1LGBC 1SW1A 3RY3A 5L8DA 4OVJA 1R6ZA 4R9GA 2F8DA 4N07A 4RPOA 1NNPA 4OFLA 3V89B 1FQFA 1MY0A 2PBWA 3TPAA 4PP0A 3LC8A 1FTMA 5DEXB 4ZZAA 5EYFA 4IO2A 3G3FA 3OSQA 3LSLA 1H44A 1B9JA 1ZIUA 2A5SA 1ANFA 2I4BA 1IIWA 1B51A 2GHAA 3DM0A 3IOWA 1ELJA 1JW5A 3MBPA 1H3DA 2VD3A 4FE8A 4YZZA 2RC8A 2YLNA 3VLVA 1TFDA 3D4GA 3KEIA 3GBAA 3A09A 4IY5A 1NFTA 1B1HA 1B3GA 1HSEA 3E3KA 3IAZA 4GWOA 4R75A 1USYE 5HM4B 1H43A 3KN8A 3KG2A 2O69A 4WKMA 3QUFA 2VP1A 1P1OA 3EPEA 4GD5A 4KYSA 3ECRA 3K0VA 3OD7A 1GVCA 3V5AA 4JWXA 1DMBA 1XC1A 4R6HA 3K02A 1A7LA 3MUQA 3MWBA 1BIYA 4Q0CA 4HCYA 2I3VA 4H8JA 4MF3A 4R2BA 3M3LA 3T9XB 4F2OA 1LB8A 3HPIA 2P2AA 1PB8A 1MQGA 3OO9A 4GRKA 2VGQA 4OENA 3T9VA 2REGA 1XS5A 4GFRA 4YMBA 2B65A 3CSGA 3HSTA 3TODA 1UTBB 4QSCA 5I58B 1SBPA 1GV8A 2XXHA 3K6UA 1JEUA 4F31B 5HPQA 3OSRA 1B32A 4Q8RA 2OBGA 3TELA 4G2ZA 1O64A 4IGTA 3TCFA 3TUSA 1AL3A 2PVUA 4HTGA 1WODA 3U93A 3Q28A 3V83A 3R6UA 4QHQA 1EZPA 1S9TA 2F6PA 2Q2CA 4LATA 2ONRA 4BDQA 4YU0A 4ZS9A 3T9HB 4EF1A 3JV9A 3T22A 1ZU0A 2DVCA 4DXCA 4EQBA 3K1MA 2ZNTA 3G3HA 3MAMA 5H8HB 1NKXA 4XKQA 4HS7A 4ELRA 1NNFA 4DLDA 1UQWA 1MM6A 4KYEA 3TAJA 1QUJA 3BFTA 2X7PA 3FASA 5AE4A 4R74A 3RUMA 3KJ7A 4R6KA 2F5XA 1ZTYA 1FQDA 1EZ9A 2QS1A 3UA8A 5B70A 1B0HA 2FYIA 3IOUA 5CBSA 1B40A 1B5JA 1XOCA 3B6QA 4JBZA 4KI0E 1MPBA 1B6HA 2LAOA 3MVZA 3UGWA 1R9LA 3SKPA 4ELQA 1MQDA 2F6GA 4M1VA 4WEPA 1LB9A 4H6DA 4EQ7A 2HAUA 5JTYB 1DOTA 4XKNA 1P1WA 5I2KA 4GIZA 1XVYA 3VVFA 4GVOA 2D21A 2HQ0A 3PUVE 4ZEIA 5H8SA 3UIFA 1WDNA 1B7UA 4Q5TA 5HBCA 4NEDA 4H8IA 2FA7A 5TPAA 2E1SA 5FTHA 3OMBA 3S9NC 4F3GA 3TMGA 3CSBA 3E4RA 4NF8A 2XXWA 2Y7WA 1B3FA 3BFUA 3PD9A 3D4CA 3UK4A 3QUJA 3OO8A 2H9BA 4IB2A 2IEEA 4GQOA 3K1PA 2UYFA 2YPNA 4LUBA 3C9HA 1LAHE 4G68A 4YKJA 2RF1A 4F1VA 4F3BA 2P0SA 5L9OA 1MXUA 3MJNA 4RK9A 4ZECA 4LA9A 3H6UA 1QVSA 3PGFA 1OVTA 1MQJA 4I62A 3U94A 1EU8A 2F36A 1J1NA 3FZVA 4EXLA 1T0KA 2XHDA 5EHMA 3MZBA 4OERA 1NH7A 2HAVA 4G8MA 4IO3A 3MZ9A 4THIA 1WVJA 1FQAA 1QKBA 2Z8DA 2Q8JA 3K2DA 2ZNUA 1SYHA 3F11A 3H6WA 5DVIA 3IO6A 1DSNA 2PMSA 3JZJA 4XKRA 1SD3A 4LONB 3IO4A 1LBBA 3PD8A 2XX7A 1NNKA 3IOVA 3PUZE 1FCKA 1MXZA 1Y3QA 1URSA 3Q29A 5I59A 2RCBA 4C1UA 1B7ZA 4ESWA 4JWOA 4KYDA 1I6BA 3KJTA 3HCQA 3U1OA 2PT1A 3K6XA 1IEJA 2VD2A 1TFAA 2RKMA 4BDRA 3IJOB 2E0SA 4E0XA 3CFXA 4ELOA 4LVQA 4U21A 3KN7A 4U1OA 2ZYNA 1XT8A 4UACA 1ZKBA 3C35A 4U4SA 3VE1B 5ICQA 3E13X 1GR2A 1GTKA 1M5BA 2I58A 2DE4A 1A40A 1OIBA 2ZYKA 4PFUA 1A8EA 1PEBA 1TXFA 1S7YA 4LQ2A 3H6VA 1UTHA 2HFBA 3K01A 2ABHA 3SDFA 2B3BA 2HEUA 2QS3A 4LZ7A 3T9UA 1MXYA 3O9PA 4G77A 3FGSA 4YB6A 2DP8A 2XXTA 1N0TA 2ALUA 5DT6A 1B7HA 4Z0IA 4ELPA 2V3UA 5A5XA 1JW4A 3GLBA 5I56B 2NUVA 3FJ7A 1FQEA 3SETA 4RJZA 5CBRA 1YCJA 1M5CA 2AL5A 2DS9A 2UXAA 5AA4B 4KQPA 3CRBA 3HV1A 4BDLA 1B4ZA 3KSJA 3QAXA 4OTEA 4DIGA 3ILUB 4ZEBA 2REJA 1MH3A 4NF5B 3LSWA 4X1DA 4YB7A 4ZEDA 1SYIA 4O3BA 1PC3A 2UVGA 2V3QA 2XD2A 1R1NA 3M8UA 3CFLA 3MP8A 1VR5A 4O3CA 4BDMA 1N04A 3H03A 1MPDA 2BJJX 4XXUA 5KCJA 3KBRA 2UYEA 3GXAA 3IB2A 1VFEA 2QSXA 3QXMA 3FXRA 4NF6B 2F7BA 1FQBA 2Z8EA 1LAXA 1XVXA 2GFEA 3MVXA 4YKKA 5FHNA 3I5OA 4MFIA 1D4NA 3IB1A 4DCYA 5FTIA 5H8NA 2H4IA 3BBRA 5BUUA 3S4UA 3QSLA 1D9VA 1SDXA 2DWJA 3JYRA 2VHAA 5ITPA 1Q1KA 2XXPA 4NWDA 3RGYA 4KPTA 4JSOA 3G3KA 4C0RA 5AA2A 2DQVA 4JB7A 3H6TA 3PUYE 3RLFE 3LBSA 3DP6A 1A55A
chains in the Genus database with same CATH superfamily
1HSJA 1G0IA 5EYHA 3V8XB 1LFGA 4PE5B 5ET7A 1Y4CA 4ECFA 2XXQA 1K9YA 1Z7ME 1NH8A 1B52A 4PCDA 4ZE8A 4TLMB 3VV5A 2VOZA 1FTLA 2AIXA 2Y7KA 5TP9B 3U8QA 2ANJA 1YTVA 4YAHX 4P3LA 3VLUA 1K9ZA 2DYXA 3MC2A 3S9LC 4N17A 5CMKA 5TP9A 1MY4A 4YMAA 3KFMA 4DI4B 2ONSA 5H8HB 4OEUA 4PGPA 1LCFA 2F7AA 3MP6A 3VXCA 2DWIA 1JP4A 4WXJA 1NI9A 2HXWA 4RXLA 4I3YA 1B46A 4UA8A 5CM6A 1JVXA 4GWZA 4N91A 1A8FA 5IAIA 3ZS6A 1FBPA 3GYYA 1MXWA 1NV3A 2CMOA 1AOVA 1Y4TA 2O7UA 3CVGA 3PMWA 3IORA 2NOOA 1AMFA 3TYHA 4NF8B 2I48A 2ZZWA 1S50A 3R26A 2V93A 3HN0A 3PPRA 3G3GA 2W7YA 4AS4A 4NF5A 2R8TA 1M5FA 1MH4A 3G3JA 2CEYA 4U2RA 1QW0A 5F7VA 1FQCA 3ZKKA 2I0BA 1SQYA 4RY1A 5TU0A 2WKYA 4KR5A 2I49A 3WAEA 1CB6A 3T0JA 5H8NB 4AB5A 1B1XA 4NF4B 2QVVA 4Q30B 2XXYA 1BKAA 4FIMA 3IB0A 5JK4A 1LFHA 3PPPA 3N5LA 4GWUA 3U65A 4N13A 1Q35A 2DXRA 4U23A 2OK2A 3ZSFA 1IMDA 2Q8MA 3AXFA 2O1LA 1IITA 2DE2A 2XX8A 3L6HA 5IZ1A 1SW5A 2G29A 1OLAA 2DOJA 1VDWA 3EHTA 4M4GA 4PFTA 4N4UA 1NUYA 3TQLA 1M5EA 3FVOA 5ISUA 3O97A 4LQ5A 3TTKA 1MQHA 3T96B 3FBPA 3Q25A 4EXKA 2M8CA 1LCTA 2F78A 2NXOA 1OLCA 4P11A 3LUYA 3EN3A 3FD3A 3FXQA 5KDTA 1UIUA 4G68B 2KLFA 2XXUA 4GX3A 3TZAA 5K2XA 2RCAA 3TKDA 4F29A 4MJOA 1OMPA 2ZMBA 2H25A 3FV1A 2WEFA 1EYJA 1URDA 1FPJA 2H5YA 3U72A 3K6VA 1H76A 1BTJA 3SERA 3L6GA 1EH3A 3FXUA 3RTWB 1Y9UA 4G8HA 2UVIA 2DVZA 4OVQA 4NHBA 1US5A 3QMFA 2Y84A 4ISUA 4EF2A 4R73A 1Y20A 3MP1A 3A29A 3LSXA 1FSAA 1LBZA 2P1SA 3OO6A 3Q26A 3B6WA 3PMVA 3OXNA 4F3SA 3EHUA 3OEKA 4O7MA 5DEXA 1QJMA 1Y3NA 5J1DA 2XXXA 2DSFA 1POTA 4PE3A 3I3VA 1LGBC 1SW1A 1FQFA 1FBCA 1FBGA 3LC8A 1B9JA 1ANFA 1JW5A 1H3DA 3KEIA 4GWYA 2L5VA 1KA1A 4R75A 3IAZA 5EYGA 1H43A 3V5AA 1NV1A 4N8GA 3MWBA 1IMAA 3M3LA 1MQGA 4X04A 4MEVA 4F31B 1LEVA 2PVUA 2ZZVA 4QHQA 3T9HB 5IZ3A 3JV9A 2DVCA 3LUZA 3K1MA 4DLDA 2XA5A 3FASA 5AE4A 4R6KA 1ZTYA 2QS1A 2FYIA 1R9LA 2F6GA 5JTYB 4XKNA 4GIZA 3UIFA 1WDNA 4Q5TA 5HBCA 4H8IA 2E1SA 5FTHA 3S9NC 2IEEA 4LUBA 4G68A 4YKJA 1MXUA 4ZECA 4RK9A 4LA9A 1T0KA 1EU8A 4GBWA 1EYKA 4QBAA 1NH7A 3MYUA 3F11A 3JZJA 5T3JA 2FIXA 1LBBA 3PUZE 5I59A 2RCBA 1B7ZA 1I6BA 1TFAA 2RKMA 4E0XA 2E0SA 4U1OA 5EQ8A 1M5BA 1A8EA 2B4LA 3H6VA 3K01A 2QS3A 4G77A 3FGSA 4ELPA 2DP8A 2XXTA 1N0TA 4Z0IA 2V3UA 1LBVA 4RJZA 2DS9A 4MCOA 4OTEA 3ILUB 4O7IA 3LSWA 3M8UA 3MP8A 1VR5A 1N04A 1MPDA 1VFEA 3QXMA 4NF6B 1LAXA 2FBPA 2GFEA 3I5OA 5FTIA 5H8NA 2DWJA 2VHAA 1LBWA 4HXVA 3H6TA 2Y5LA 3DP6A 2BJIA 2DWHA 3N94A 3H3GA 2THIA 4FORA 2ESNA 4H46A 1KZ8A 2HZLA 5ET8A 3WAFA 4PAFA 4BDQA 4JSDA 4DCXA 2WX9A 1FPKA 3W9VA 1N84A 4H1XA 3MSTA 4PF8A 3SEXA 5DW8A 2O6AA 2CZKA 4XFEA 1I6AA 5H8FA 3N6UA 3CG1A 4I40A 2D3IA 2OLBA 2XX9A 4GF8A 1EZOA 3ZKLA 1FTAA 1CNQA 5EHSA 4H0WA 4IO5A 2Q2AA 2AYSA 1KWHA 1QGXA 2A5TB 3VFJA 2RC9A 4RNSA 4X8RA 3B50A 1QKAA 2Q89A 4NGUA 4PDDA 4POXA 4QF9A 5CC2A 3KGCA 4I9DA 3TTNA 1UIVA 2QMWA 1PB7A 4PFWA 4F19A 3H7MA 3IK6B 4ZEKA 1B4HA 4NF0A 5CI5A 2QS4A 1B58A 2X7QA 5CMBA 4F2QA 4H5GA 2GRVA 4PF6A 4OWDA 4DE8A 3MPLA 5JTYA 1YPNA 1MRPA 3FJMA 1B3LA 4IO6A 4ZDMA 2V3TA 4X9TA 1SI1A 4GXSB 1FBHA 2Y7RA 3IFCA 4OANA 4QFKA 3U92A 5KZTA 5ET6A 1RDXA 4EUOA 1OVBA 3ODBA 1Z7NE 4DZ1A 1LLSA 1B5IA 5ESYA 1NV5A 4OQOA 4OHNA 5JEIA 2Y7IA 1SW4A 4GWWA 3B8BA 2O7IA 4PFYA 2VT5A 3CR9A 2PCRA 4IGRA 5DYHA 4ND9A 4BDNA 4R2FA 2OZZA 2XD3A 5L9SA 2PX1A 2R9JA 3B6TA 1P1UA 3LR1A 1RYOA 2Q88A 2V25A 3IJXB 3A3UA 2H98A 1BK4A 5DTBA 2B4MA 1JVYA 4KCCA 4LZ8A 3TTMA 3O66A 4KCDA 5DVFA 3SEVA 1I69A 2Z22A 1JW1A 3KN3A 3LV0A 2QPQA 1R9QA 1LAFE 3TTRA 2CZHA 3VLWA 4PFIA 5IKBA 3A3CA 4AS5A 3CFZA 2ONKE 3C34A 3PPQA 4QSEA 1VFDA 4O8MA 4KD5A 1IXIA 2OWSA 2OCUA 1FW0A 1TT1A 4F1YA 1JNFA 1IXCA 2I6EA 4U22A 1Y3PA 4MLQA 1OQHA 4QRZA 4QFOA 5IM2A 4IO4A 4GLIA 1MY1A 5L9MA 4K3FA 3FVKA 4HE2A 1FPEA 1B3EA 1MY2A 3QYTA 3TCGA 1NV6A 1LBCA 1IMFA 2I3WA 4RPNA 2QL3A 5AA1A 3S9EA 3MQ9A 3M3FA 5EQ7A 1N3WA 1PDAA 4JDFA 1UTBA 4PBHA 5ITOA 2X26A 4P0IA 2FNCA 4F18A 3OEMA 1RYXA 2YJPA 5KDTB 3E79A 1LBXA 1I6QA 2O68A 1MY3A 1DTGA 2V84A 2P3VA 4PFBA 5L8DA 1R6ZA 4RPOA 4OFLA 1MY0A 3KC0A 4PP0A 4N15A 4IO2A 3G3FA 3LSLA 1H44A 2I4BA 3IOWA 4E0WA 2GHAA 1ELJA 3MBPA 4FE8A 2RC8A 1TFDA 4MNIA 4NN3A 4PBQA 1B1HA 3E3KA 5HM4B 3KC1A 4GWOA 2O69A 4GWXA 3QUFA 4GD5A 3ECRA 1DMBA 1XC1A 4R2BA 4P8BA 3HPIA 1PB8A 4PAKA 2VGQA 4GFRA 3HSTA 5J16A 4QSCA 1SBPA 2F3DA 3RPLB 3OSRA 1B32A 1O64A 4IGTA 3TCFA 1AL3A 4HTGA 3Q28A 3V83A 1ZU0A 4HS7A 1UQWA 3TAJA 3BFTA 3UA8A 1FQDA 3IOUA 4KI0E 4JBZA 3MVZA 1B6HA 2LAOA 3UGWA 4M1VA 4WEPA 4H6DA 1P1WA 1XVYA 3VVFA 4GVOA 2HQ0A 4ZEIA 1B7UA 5TPAA 2FA7A 4P47A 4NF8A 2XXWA 3BFUA 3QUJA 2RF1A 4F3BA 2P0SA 5L9OA 1QVSA 3PGFA 4I62A 1J1NA 4EXLA 3MZBA 2HAVA 4THIA 4I3EA 2Z8DA 1SYHA 5EQ9A 3PD8A 1URSA 4C1UA 5LTCA 4BDRA 2ZYNA 1XT8A 4U4SA 5ICQA 3E13X 4GWSA 2I58A 1A40A 2DE4A 2Q74A 1PEBA 1UTHA 2HFBA 3T9UA 4LZ7A 3O9PA 5DT6A 2ALUA 5A5XA 4KXPA 1FQEA 1M5CA 2AL5A 2UXAA 3KSJA 3QAXA 4X1DA 4UABA 4ZEDA 1PC3A 2V3QA 1EYIA 4BDMA 3CFLA 3H03A 3KBRA 3IB2A 2F3BA 2Z8EA 5FHNA 4YKKA 3MVXA 4MFIA 1D4NA 5BUUA 3JYRA 5ITPA 2DQVA 4GX4A 4JB7A 3RLFE 3LBSA 3HFUA 3QK6A 3I6VA 3PV0E 1O63A 1N7WA 1NNTA 2B3FA 5AA4A 4OETA 5LOMA 4XEQA 4ZZEA 5H8QA 2F7CA 4JWYA 4NE4A 3RQTA 3S9MC 3K1NA 4Z7EA 3N6TA 1Q9DA 4X1BA 1F9BA 2XWKA 5BWJA 4EDPA 2IA4A 3O6HA 4P9KA 5H8QB 1ZJLA 2RINA 4HE1A 3G3IA 4FEDA 3MW0A 1P99A 3MPKA 2XXKA 3PUWE 3FJGA 3IR1A 3KBZA 3RNNA 4MIJA 4PGNA 4MH5A 5AA2D 4POWA 1G0HA 1NV0A 3UP9A 1H45A 1DPEA 3UN6A 2GH9A 4U4XA 3VVDA 5K2YA 4GL0A 4OVSA 5I57B 2RC7A 1FRPA 2QVUA 3C33A 2PYYA 3B7DA 4MBPA 1LBYA 4PDHA 1D3KA 5I2KB 1VE4A 4GL8A 3M3KA 1BLFA 5F24A 3T1BA 3EQ1A 2XXVA 4TLLB 2F34A 2XWVA 4MMPA 5AA2B 2Y5KA 4EQ9A 3TCHA 5A5XB 3HO7A 3FV2A 2XWIA 2FVZA 1FBEA 4OZ9A 4RK2A 1B5HA 2QS2A 4QFPA 4GXAA 2NVUB 4HCWA 2XXIA 3SESA 2VPNA 4PQJA 1FPFA 1L5TA 1IXGA 2KR0A 3H4ZA 2I0CA 5I58A 4BLAA 5B7DA 1P1QA 4MNCA 1ZMGA 3HHFA 3PUXE 4GBVA 2ZXTA 4LZ5A 3CG3A 4ONYA 4OFJA 4DXUA 1ZLQA 2PFZA 2R6GE 3E9XA 1FBFA 1OQGA 1XHYA 3MZ1A 3FVGA 4I1DA 4IO7A 5CMCA 4F1UA 1PBPA 3DP8A 1YZ0A 4AQ4A 1MPCA 3BIGA 5TPAB 1POY1 4R9FA 4QFNA 1YYZA 5ICTA 3USDA 2P3NA 4DI3D 2F97A 2WBBA 3DELB 2ZNSA 4H65A 1RDYA 3RTFB 3GZGA 5I84A 2DE3A 1JEVA 3EKIA 3P7IA 1JQFA 1MG1A 2WYKA 4OYVA 1IXHA 2ZZXA 2NWJA 4F3PA 1B3HA 5I2NB 1SVXB 3R7XA 4FATA 3O6IA 3HHGA 3RPLA 3FUZA 4FJPA 4GX6A 3O6GA 3EHSA 1AH5A 1MDP1 5I5PA 4R72A 4OMBA 4XF5A 2O84X 2UVJA 1MM7A 1SI0A 4XTCQ 4IY6A 3E78A 2WYPA 3VXBA 4NWCA 2AL4A 4N6KA 1QUIA 5I59B 4LN5A 4NTLA 3O2AA 1Y1ZA 3CIJA 2WBDA 1YAEA 2ZYOA 1N76A 3MVYA 4F39A 4C1TA 1MXVA 2I4CA 4YB5A 3RT6B 3IFAA 3G7WA 2HCAA 3FATA 3CI8A 1USYH 4OVJA 4R9GA 4JVIA 3V89B 2PBWA 1DK4A 4ZZAA 3OSQA 2JJKA 4LVQA 2A5SA 4DXBA 3VLVA 2YLNA 3GBAA 1USYE 2CEXA 3KN8A 3KG2A 1P1OA 3OD7A 4JWXA 1BIYA 4Q0CA 4HCYA 4MF3A 1NV2A 2P2AA 3T9VA 2REGA 1XS5A 2B65A 3CSGA 3TODA 4Q8RA 2OBGA 4G2ZA 5IZ3B 3U93A 1EZPA 1S9TA 2F6PA 2Q2CA 4LATA 4YU0A 4ZS9A 4EF1A 4ELRA 1NNFA 1MM6A 4KYEA 2X7PA 3RUMA 5CBSA 1B5JA 4PFRA 3SKPA 1DOTA 4NEDA 3OMBA 4F3GA 3CSBA 3OO8A 2H9BA 5LDZA 4GQOA 3K1PA 2UYFA 2YPNA 3C9HA 1MQJA 3U94A 1DCUA 2F36A 1FBDA 4MNPA 2XHDA 5EHMA 2V4CA 1FPLA 3MZ9A 1NUWA 5ET5A 1QKBA 3H6WA 3IO6A 2PMSA 4XKRA 1SD3A 3IO4A 2XX7A 3IOVA 1FCKA 1Y3QA 3Q29A 4ESWA 4JWOA 4KYDA 3KJTA 3HCQA 4OA4A 4ELOA 4UACA 1ZKBA 3C35A 4HE0A 2ZYKA 1S7YA 4LQ2A 3SDFA 2B3BA 2HEUA 1MXYA 3GLBA 2NUVA 4NAPA 5CBRA 4KQPA 3CRBA 3HV1A 1YXIA 4PAIA 4BDLA 1B4ZA 2REJA 1MH3A 1SYIA 4O3BA 4NG7A 2XD2A 4OVRA 2BJJX 2UYEA 3GXAA 2KQZA 2F7BA 1FQBA 5A5LA 1XVXA 1FPGA 3IB1A 4DCYA 2H4IA 3BBRA 3QSLA 1D9VA 1SDXA 1Q1KA 2XXPA 3CHGA 3RGYA 4KPTA 4JSOA 4C0RA 5AA2A 3BIHA 4O94A 3QIMA 4FBPA 4KFQA 4OEVA 1NL5A 5DVJA 4X48A 4OXVA 2A5TA 5AA3A 4H67A 3FXBA 3VVEA 4O3AA 2CZLA 2OJTA 4FEBA 5I57A 1GGGA 3DP4A 4ZEFA 2XXRA 2F35A 2FHYA 3LSFB 4N81A 5H8FB 4NX1A 3KSXA 4WEDA 4N6PA 1LAGE 3SEUA 1MQIA 1ZBMA 4G8NA 1XI6A 4HW8A 2HPGA 1Y1MA 4OVPA 2OWZA 4BDOA 1TWYA 1FTOA 3ONMA 2H99A 4N8YA 1FTKA 2UVHA 4KHZE 2QVRA 1FTJA 1DPPA 2PT2A 4FECA 4XKPA 3IX1A 1INPA 4YKPA 4NQ8A 3SEWA 3TQWA 4G4PA 3K00A 3O29A 2DWAA 4H5FA 1US4A 1NV4A 3BKIB 3S2VA 4NMYA 2O51A 4NF4A 3TEPA 4G61A 1IQ7A 5FHMA 2Q9TA 1RKMA 5M2VA 4NF6A 3EF7A 3TFLA 1RDZA 1B0LA 3OENA 5FBPA 4P56A 3RYDA 3O28A 1B2HA 4YKIA 4QSDA 3N26A 1MDQA 1VSOA 4ESXA 2QMXA 2Z8FA 1CE2A 1B05A 1NV7A 1URGA 1IMEA 3C31A 3C4MA 3H06B 3RPWA 3NOHA 3VDFA 3PPNA 2VPOA 4U1ZA 4P0GA 3IL1B 4OVTA 2OWTA 1BP5A 3T66A 4ZE9A 3K6WA 4G68C 3KZGA 3PMXA 1M5DA 1D9YA 3MVWA 1UTHB 2Y7PA 5H8HA 1SPIA 2MKZA 5FHOA 1SW2A 3KOSA 2CZIA 4GOTA 2R71A 3ISPA 1IUDA 1N7XA 1FJ6A 1DTZA 3T93B 3ILTB 5F1QA 1HSLA 4MX6A 1PB9A 4H45A 4F22A 1JETA 4MAGA 1N3XA 3W9WA 5CRYA 3KOTA 3THIA 4XIGQ 1IMCA 4PTKA 3TTLA 1NMUA 1A54A 1PBQA 3OELA 5IZZA 4MHFA 1II5A 2DXYA 3GBBA 3DLNA 3OO7A 4QFLA 4MLVA 4JXIA 4PETA 2QRYA 3OOAA 3SEYA 4P1EA 2QFLA 1LSTA 2DDKA 3IOTA 2G93A 4OFOA 3K4UA 4I8CA 1FPIA 3FIRA 5KCJB 3PU5A 4OESA 1LFIA 5ELVA 1FJ9A 3C36A 4IR8A 4AB6A 1O7TA 1MXXA 3RT8A 4TOZA 4R6YA 2QJEA 4DDDA 2D5WA 4L17A 5I56A 1AIVA 2GHBA 3W15C 1ATGA 2O1MA 3Q27A 4RYAA 1QUKA 3TDJA 4FAJA 5CMMA 2Z23A 1QULA 4RA1A 2GQ1A 3C32A 5I2NA 4LP2B 3RN8A 3UORA 4TQUQ 2HZKA 1IZ1A 4YICA 3FVNA 1P1NA 5I7IA 2ZYMA 1A99A 1MS7A 3PPOA 5I3SA 3RY3A 2F8DA 4N07A 1NNPA 3TPAA 5DEXB 1FTMA 4PC9A 5EYFA 1ZIUA 4OENA 1IIWA 1B51A 3DM0A 4YZZA 2VD3A 3D4GA 3A09A 4IY5A 1NFTA 1B3GA 1HSEA 4WKMA 2VP1A 3EPEA 4KYSA 1GVCA 3K0VA 4R6HA 3K02A 1A7LA 3MUQA 2I3VA 4H8JA 3T9XB 4F2OA 1LB8A 3OO9A 4GRKA 4YMBA 5I58B 1UTBB 1GV8A 2XXHA 3K6UA 1JEUA 5HPQA 3TELA 3TUSA 1WODA 3R6UA 4N6DA 2ONRA 2HHMA 3T22A 4DXCA 4EQBA 3D1RA 2ZNTA 3G3HA 3MAMA 1AWBA 1NKXA 4XKQA 1NUXA 5EQAA 1QUJA 4R74A 3KJ7A 2F5XA 5B70A 1EZ9A 1B0HA 1B40A 1XOCA 3B6QA 1MPBA 1NUZA 4ELQA 1MQDA 2HXRA 1LB9A 4EQ7A 2HAUA 5I2KA 2D21A 4P1LA 3PUVE 5H8SA 3TMGA 2OX3A 3E4RA 2Y7WA 1B3FA 3PD9A 3D4CA 3UK4A 4IB2A 1KA0A 3ROJA 4QXDA 1LAHE 4F1VA 3MJNA 3H6UA 1OVTA 3FZVA 4OERA 4G8MA 4IO3A 1WVJA 1FQAA 2Q8JA 2XWOA 2PFYA 2ZNUA 3K2DA 5DVIA 1DSNA 1D9QA 4LONB 1NNKA 1MXZA 3U1OA 2PT1A 3K6XA 1FPDA 1IEJA 4JVCA 2VD2A 3SZPA 3IJOB 3CFXA 4U21A 3KN7A 1IMBA 4JVDA 2FIEA 3VE1B 5IGAA 1GR2A 1GTKA 1OIBA 4PFUA 1TXFA 2ABHA 3PTYA 4YB6A 1B7HA 1JW4A 5I56B 3FJ7A 3SETA 1YCJA 5AA4B 4DIGA 4ZEBA 4NF5B 4YB7A 2UVGA 1R1NA 4O3CA 5KCJA 4XXUA 1DBZA 2QSXA 3FXRA 1FPBA 3S4UA 4NWDA 3G3KA 3PUYE 1A55A
chains in the Genus database with same CATH topology
1HSJA 2DWHA 3QK6A 3QIMA 3I6VA 3N94A 3H3GA 4KFQA 3V8XB 1LFGA 3PV0E 1O63A 4OEVA 4PE5B 1NL5A 1N7WA 5DVJA 4X48A 4OXVA 2A5TA 5AA3A 1NNTA 2B3FA 2THIA 4FORA 1Y4CA 4H67A 3VVEA 4ECFA 5AA4A 2ESNA 4O3AA 2CZLA 2OJTA 2XXQA 1Z7ME 4FEBA 4OETA 5I57A 5LOMA 1GGGA 3DP4A 1NH8A 1B52A 2HZLA 4ZEFA 2XXRA 5H8QA 4ZZEA 3WAFA 4ZE8A 2F35A 4JSDA 4TLMB 3VV5A 3LSFB 2F7CA 2VOZA 4JWYA 3W9VA 4DCXA 4NE4A 1FTLA 5H8FB 1N84A 2AIXA 4H1XA 3RQTA 3KSXA 2Y7KA 5TP9B 3SEXA 3S9MC 3U8QA 2ANJA 1YTVA 3K1NA 4WEDA 4N6PA 1LAGE 4Z7EA 4YAHX 3N6TA 3SEUA 2O6AA 1MQIA 1ZBMA 4X1BA 3VLUA 1F9BA 2DYXA 3MC2A 4G8NA 4HW8A 5BWJA 3S9LC 1Y1MA 5CMKA 4EDPA 5TP9A 1I6AA 1MY4A 2IA4A 4BDOA 5H8FA 3N6UA 1TWYA 1FTOA 3KFMA 3ONMA 2H99A 4YMAA 2ONSA 3CG1A 1FTKA 4OEUA 2D3IA 2OLBA 2UVHA 3O6HA 2XX9A 4GF8A 4KHZE 3ZKLA 1EZOA 1FTJA 1DPPA 5H8QB 1ZJLA 1LCFA 2F7AA 2RINA 3MP6A 4E0WA 3G3IA 5EHSA 2PT2A 4FEDA 4FECA 4H0WA 4XKPA 3VXCA 3MW0A 2DWIA 1P99A 3IX1A 4IO5A 4YKPA 4WXJA 3MPKA 2Q2AA 2HXWA 3PUWE 3SEWA 2AYSA 1KWHA 3TQWA 4RXLA 3FJGA 3IR1A 4G4PA 3K00A 2A5TB 1B46A 3VFJA 3RNNA 3O29A 4UA8A 2DWAA 1JVXA 2RC9A 4RNSA 5CM6A 4MH5A 5AA2D 4H5FA 1A8FA 5IAIA 4POWA 4DXBA 1US4A 3ZS6A 1QKAA 3BKIB 2Q89A 3UP9A 3S2VA 1H45A 1MXWA 2O51A 4NMYA 4POXA 4QF9A 5CC2A 1DPEA 3UN6A 2CMOA 3KGCA 4I9DA 4NF4A 1UIVA 2GH9A 4U4XA 2QMWA 3TTNA 1PB7A 4PFWA 1Y4TA 1AOVA 4F19A 3H7MA 2O7UA 3IK6B 3TEPA 3CVGA 3PMWA 1IQ7A 3IORA 1B4HA 4ZEKA 3VVDA 5FHMA 2NOOA 1AMFA 2Q9TA 5K2YA 1RKMA 4NF8B 5M2VA 3TYHA 4GL0A 4NF6A 5CI5A 5I57B 2I48A 2RC7A 3EF7A 2QS4A 1B58A 3TFLA 2X7QA 1B0LA 3C33A 1S50A 3OENA 5CMBA 4F2QA 4H5GA 2PYYA 3R26A 3B7DA 4MBPA 2GRVA 2V93A 3HN0A 3PPRA 1D3KA 3G3GA 5I2KB 3O28A 2W7YA 4OWDA 1VE4A 3MPLA 4GL8A 4NF5A 3M3KA 4DE8A 5JTYA 1BLFA 1M5FA 1MH4A 3G3JA 4U2RA 1B2HA 1YPNA 1MRPA 1QW0A 2XXVA 3EQ1A 3FJMA 4QSDA 2F34A 4TLLB 4YKIA 1FQCA 5F7VA 5AA2B 3ZKKA 1B3LA 2I0BA 3N26A 1MDQA 1SQYA 4IO6A 4RY1A 1VSOA 2V3TA 4ZDMA 5TU0A 2WKYA 4KR5A 3TCHA 2I49A 2QMXA 1CB6A 3WAEA 3HO7A 3FV2A 4X9TA 4ESXA 1SI1A 4GXSB 5H8NB 2Z8FA 1CE2A 1B05A 1B1XA 4AB5A 1URGA 2Y7RA 3C31A 3C4MA 3H06B 4NF4B 4OZ9A 3RPWA 4QFKA 3U92A 5KZTA 4RK2A 3VDFA 1B5HA 3PPNA 4Q30B 2QS2A 4QFPA 2XXYA 4GXAA 4U1ZA 1BKAA 4EUOA 4P0GA 1OVBA 2NVUB 4HCWA 2XXIA 3IL1B 3ODBA 1Z7NE 3SESA 4DZ1A 4FIMA 3IB0A 4PQJA 5JK4A 1LFHA 3PPPA 3N5LA 2OWTA 1L5TA 1IXGA 1BP5A 4N13A 3T66A 1Q35A 3H4ZA 2DXRA 2I0CA 1LLSA 3K6WA 4U23A 4ZE9A 5I58A 4BLAA 4G68C 1B5IA 2OK2A 3KZGA 3ZSFA 4EQ9A 5B7DA 3PMXA 1P1QA 5A5XB 1M5DA 1D9YA 3MVWA 4OQOA 4OHNA 5JEIA 1ZMGA 2Y7IA 3HHFA 1SW4A 1UTHB 2O1LA 2Y7PA 2ZXTA 3AXFA 3PUXE 5H8HA 4LZ5A 2O7IA 4PFYA 3CR9A 4IGRA 3CG3A 5FHOA 1SW2A 4ONYA 3SERA 3KOSA 4OFJA 5DYHA 4ND9A 4BDNA 1IITA 4GOTA 4R2FA 4DXUA 2R71A 2OZZA 2DE2A 1IUDA 1ZLQA 2XX8A 3L6HA 2R6GE 1SW5A 3E9XA 2G29A 1N7XA 2XD3A 1OQGA 1XHYA 3MZ1A 3FVGA 5L9SA 2PX1A 1OLAA 1DTZA 2R9JA 3B6TA 1P1UA 3ILTB 3T93B 5F1QA 4I1DA 1HSLA 1PB9A 3LR1A 2DOJA 3EHTA 4M4GA 1RYOA 2Q88A 4PFTA 2V25A 4IO7A 3IJXB 3A3UA 5CMCA 4F22A 3TQLA 1M5EA 1JETA 2H98A 3FVOA 1PBPA 4F1UA 3O97A 1N3XA 5DTBA 5ISUA 3DP8A 4LQ5A 3W9WA 3TTKA 5CRYA 1MQHA 3KOTA 1JVYA 4XIGQ 3THIA 4AQ4A 3T96B 1MPCA 4KCCA 4LZ8A 3Q25A 5TPAB 1POY1 1NMUA 1A54A 1PBQA 2M8CA 3OELA 4QFNA 4R9FA 3TTLA 1II5A 1LCTA 2DXYA 3TTMA 3USDA 5ICTA 2F78A 2NXOA 3GBBA 1OLCA 3O66A 3DLNA 3OO7A 4QFLA 4MLVA 4JXIA 4KCDA 4P11A 4PETA 5DVFA 3LUYA 3SEVA 2F97A 1I69A 3DELB 2QRYA 2Z22A 2ZNSA 3EN3A 3OOAA 4H65A 3FD3A 1JW1A 3FXQA 1UIUA 3KN3A 3SEYA 5KDTA 2QPQA 1R9QA 4G68B 2KLFA 1LAFE 2XXUA 3GZGA 1LSTA 3RTFB 3TTRA 3IOTA 3TZAA 3VLWA 5I84A 5IKBA 3A3CA 2DE3A 5K2XA 2G93A 1JEVA 2RCAA 3CFZA 3P7IA 3TKDA 4OFOA 3K4UA 4F29A 2ONKE 3C34A 1JQFA 1OMPA 1MG1A 3PPQA 4I8CA 4QSEA 1VFDA 2ZMBA 3FIRA 4KD5A 4OYVA 1IXHA 4F3PA 2NWJA 1B3HA 2H25A 5I2NB 1SVXB 1IXIA 2OWSA 3FV1A 3PU5A 2OCUA 4OESA 1LFIA 1FW0A 5KCJB 5ELVA 3R7XA 1TT1A 1URDA 4F1YA 1JNFA 4FATA 2H5YA 3O6IA 3C36A 1IXCA 3U72A 4AB6A 2I6EA 3K6VA 1O7TA 4U22A 1MXXA 1Y3PA 4MLQA 1H76A 3RT8A 1OQHA 3HHGA 1BTJA 3FUZA 4QFOA 2QJEA 4FJPA 4QRZA 4R6YA 3L6GA 4TOZA 4IO4A 4DDDA 1EH3A 2D5WA 3EHSA 3FXUA 3O6GA 4L17A 3RTWB 1Y9UA 5I56A 1AIVA 4G8HA 2UVIA 1AH5A 2DVZA 2GHBA 1MDP1 3W15C 4GLIA 1US5A 1MY1A 5L9MA 4EXKA 4R72A 4OMBA 4K3FA 2Y84A 1ATGA 2O1MA 3Q27A 3FVKA 4ISUA 1B3EA 1MY2A 2O84X 2UVJA 1MM7A 1SI0A 3QYTA 4R73A 4RYAA 1Y20A 3TCGA 4EF2A 1QUKA 1LBCA 3TDJA 2I3WA 4RPNA 4FAJA 3MP1A 2QL3A 5AA1A 3S9EA 5CMMA 3LSXA 3MQ9A 2P1SA 2Z23A 3OO6A 1QULA 3M3FA 4XTCQ 4RA1A 1N3WA 4IY6A 3Q26A 3B6WA 3C32A 3PMVA 5I2NA 4LP2B 3VXBA 4NWCA 1PDAA 2AL4A 4JDFA 1UTBA 3OXNA 4F3SA 1QUIA 3EHUA 3OEKA 4NTLA 3RN8A 3UORA 5I59B 3O2AA 4TQUQ 2HZKA 5DEXA 1Y1ZA 1QJMA 5ITOA 3CIJA 1IZ1A 2X26A 1Y3NA 4P0IA 4YICA 5J1DA 1YAEA 2FNCA 4F18A 3FVNA 2ZYOA 3OEMA 1RYXA 2YJPA 5KDTB 1N76A 2XXXA 3MVYA 4C1TA 1MXVA 4F39A 1P1NA 2DSFA 2I4CA 4YB5A 3RT6B 1POTA 1I6QA 2O68A 1MY3A 2ZYMA 1A99A 1DTGA 1MS7A 2V84A 3I3VA 3G7WA 3PPOA 2HCAA 3FATA 3CI8A 1USYH 1LGBC 1SW1A 3RY3A 5L8DA 4OVJA 1R6ZA 4R9GA 2F8DA 4N07A 4RPOA 1NNPA 4OFLA 3V89B 1FQFA 1MY0A 2PBWA 3TPAA 4PP0A 3LC8A 1FTMA 5DEXB 4ZZAA 5EYFA 4IO2A 3G3FA 3OSQA 3LSLA 1H44A 1B9JA 1ZIUA 2A5SA 1ANFA 2I4BA 1IIWA 1B51A 2GHAA 3DM0A 3IOWA 1ELJA 1JW5A 3MBPA 1H3DA 2VD3A 4FE8A 4YZZA 2RC8A 2YLNA 3VLVA 1TFDA 3D4GA 3KEIA 3GBAA 3A09A 4IY5A 1NFTA 1B1HA 1B3GA 1HSEA 3E3KA 3IAZA 4GWOA 4R75A 1USYE 5HM4B 1H43A 3KN8A 3KG2A 2O69A 4WKMA 3QUFA 2VP1A 1P1OA 3EPEA 4GD5A 4KYSA 3ECRA 3K0VA 3OD7A 1GVCA 3V5AA 4JWXA 1DMBA 1XC1A 4R6HA 3K02A 1A7LA 3MUQA 3MWBA 1BIYA 4Q0CA 4HCYA 2I3VA 4H8JA 4MF3A 4R2BA 3M3LA 3T9XB 4F2OA 1LB8A 3HPIA 2P2AA 1PB8A 1MQGA 3OO9A 4GRKA 2VGQA 4OENA 3T9VA 2REGA 1XS5A 4GFRA 4YMBA 2B65A 3CSGA 3HSTA 3TODA 1UTBB 4QSCA 5I58B 1SBPA 1GV8A 2XXHA 3K6UA 1JEUA 4F31B 5HPQA 3OSRA 1B32A 4Q8RA 2OBGA 3TELA 4G2ZA 1O64A 4IGTA 3TCFA 3TUSA 1AL3A 2PVUA 4HTGA 1WODA 3U93A 3Q28A 3V83A 3R6UA 4QHQA 1EZPA 1S9TA 2F6PA 2Q2CA 4LATA 2ONRA 4BDQA 4YU0A 4ZS9A 3T9HB 4EF1A 3JV9A 3T22A 1ZU0A 2DVCA 4DXCA 4EQBA 3K1MA 2ZNTA 3G3HA 3MAMA 5H8HB 1NKXA 4XKQA 4HS7A 4ELRA 1NNFA 4DLDA 1UQWA 1MM6A 4KYEA 3TAJA 1QUJA 3BFTA 2X7PA 3FASA 5AE4A 4R74A 3RUMA 3KJ7A 4R6KA 2F5XA 1ZTYA 1FQDA 1EZ9A 2QS1A 3UA8A 5B70A 1B0HA 2FYIA 3IOUA 5CBSA 1B40A 1B5JA 1XOCA 3B6QA 4JBZA 4KI0E 1MPBA 1B6HA 2LAOA 3MVZA 3UGWA 1R9LA 3SKPA 4ELQA 1MQDA 2F6GA 4M1VA 4WEPA 1LB9A 4H6DA 4EQ7A 2HAUA 5JTYB 1DOTA 4XKNA 1P1WA 5I2KA 4GIZA 1XVYA 3VVFA 4GVOA 2D21A 2HQ0A 3PUVE 4ZEIA 5H8SA 3UIFA 1WDNA 1B7UA 4Q5TA 5HBCA 4NEDA 4H8IA 2FA7A 5TPAA 2E1SA 5FTHA 3OMBA 3S9NC 4F3GA 3TMGA 3CSBA 3E4RA 4NF8A 2XXWA 2Y7WA 1B3FA 3BFUA 3PD9A 3D4CA 3UK4A 3QUJA 3OO8A 2H9BA 4IB2A 2IEEA 4GQOA 3K1PA 2UYFA 2YPNA 4LUBA 3C9HA 1LAHE 4G68A 4YKJA 2RF1A 4F1VA 4F3BA 2P0SA 5L9OA 1MXUA 3MJNA 4RK9A 4ZECA 4LA9A 3H6UA 1QVSA 3PGFA 1OVTA 1MQJA 4I62A 3U94A 1EU8A 2F36A 1J1NA 3FZVA 4EXLA 1T0KA 2XHDA 5EHMA 3MZBA 4OERA 1NH7A 2HAVA 4G8MA 4IO3A 3MZ9A 4THIA 1WVJA 1FQAA 1QKBA 2Z8DA 2Q8JA 3K2DA 2ZNUA 1SYHA 3F11A 3H6WA 5DVIA 3IO6A 1DSNA 2PMSA 3JZJA 4XKRA 1SD3A 4LONB 3IO4A 1LBBA 3PD8A 2XX7A 1NNKA 3IOVA 3PUZE 1FCKA 1MXZA 1Y3QA 1URSA 3Q29A 5I59A 2RCBA 4C1UA 1B7ZA 4ESWA 4JWOA 4KYDA 1I6BA 3KJTA 3HCQA 3U1OA 2PT1A 3K6XA 1IEJA 2VD2A 1TFAA 2RKMA 4BDRA 3IJOB 2E0SA 4E0XA 3CFXA 4ELOA 4LVQA 4U21A 3KN7A 4U1OA 2ZYNA 1XT8A 4UACA 1ZKBA 3C35A 4U4SA 3VE1B 5ICQA 3E13X 1GR2A 1GTKA 1M5BA 2I58A 2DE4A 1A40A 1OIBA 2ZYKA 4PFUA 1A8EA 1PEBA 1TXFA 1S7YA 4LQ2A 3H6VA 1UTHA 2HFBA 3K01A 2ABHA 3SDFA 2B3BA 2HEUA 2QS3A 4LZ7A 3T9UA 1MXYA 3O9PA 4G77A 3FGSA 4YB6A 2DP8A 2XXTA 1N0TA 2ALUA 5DT6A 1B7HA 4Z0IA 4ELPA 2V3UA 5A5XA 1JW4A 3GLBA 5I56B 2NUVA 3FJ7A 1FQEA 3SETA 4RJZA 5CBRA 1YCJA 1M5CA 2AL5A 2DS9A 2UXAA 5AA4B 4KQPA 3CRBA 3HV1A 4BDLA 1B4ZA 3KSJA 3QAXA 4OTEA 4DIGA 3ILUB 4ZEBA 2REJA 1MH3A 4NF5B 3LSWA 4X1DA 4YB7A 4ZEDA 1SYIA 4O3BA 1PC3A 2UVGA 2V3QA 2XD2A 1R1NA 3M8UA 3CFLA 3MP8A 1VR5A 4O3CA 4BDMA 1N04A 3H03A 1MPDA 2BJJX 4XXUA 5KCJA 3KBRA 2UYEA 3GXAA 3IB2A 1VFEA 2QSXA 3QXMA 3FXRA 4NF6B 2F7BA 1FQBA 2Z8EA 1LAXA 1XVXA 2GFEA 3MVXA 4YKKA 5FHNA 3I5OA 4MFIA 1D4NA 3IB1A 4DCYA 5FTIA 5H8NA 2H4IA 3BBRA 5BUUA 3S4UA 3QSLA 1D9VA 1SDXA 2DWJA 3JYRA 2VHAA 5ITPA 1Q1KA 2XXPA 4NWDA 3RGYA 4KPTA 4JSOA 3G3KA 4C0RA 5AA2A 2DQVA 4JB7A 3H6TA 3PUYE 3RLFE 3LBSA 3DP6A 1A55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HSJ A;  2DWH A;  3QK6 A;  3QIM A;  3I6V A;  3N94 A;  3H3G A;  4KFQ A;  3V8X B;  1LFG A;  3PV0 E;  1O63 A;  4OEV A;  4PE5 B;  1NL5 A;  1N7W A;  5DVJ A;  4X48 A;  4OXV A;  2A5T A;  5AA3 A;  1NNT A;  2B3F A;  2THI A;  4FOR A;  1Y4C A;  4H67 A;  3VVE A;  4ECF A;  5AA4 A;  2ESN A;  4O3A A;  2CZL A;  2OJT A;  2XXQ A;  1Z7M E;  4FEB A;  4OET A;  5I57 A;  5LOM A;  1GGG A;  3DP4 A;  1NH8 A;  1B52 A;  2HZL A;  4ZEF A;  2XXR A;  5H8Q A;  4ZZE A;  3WAF A;  4ZE8 A;  2F35 A;  4JSD A;  4TLM B;  3VV5 A;  3LSF B;  2F7C A;  2VOZ A;  4JWY A;  3W9V A;  4DCX A;  4NE4 A;  1FTL A;  5H8F B;  1N84 A;  2AIX A;  4H1X A;  3RQT A;  3KSX A;  2Y7K A;  5TP9 B;  3SEX A;  3S9M C;  3U8Q A;  2ANJ A;  1YTV A;  3K1N A;  4WED A;  4N6P A;  1LAG E;  4Z7E A;  4YAH X;  3N6T A;  3SEU A;  2O6A A;  1MQI A;  1ZBM A;  4X1B A;  3VLU A;  1F9B A;  2DYX A;  3MC2 A;  4G8N A;  4HW8 A;  5BWJ A;  3S9L C;  1Y1M A;  5CMK A;  4EDP A;  5TP9 A;  1I6A A;  1MY4 A;  2IA4 A;  4BDO A;  5H8F A;  3N6U A;  1TWY A;  1FTO A;  3KFM A;  3ONM A;  2H99 A;  4YMA A;  2ONS A;  3CG1 A;  1FTK A;  4OEU A;  2D3I A;  2OLB A;  2UVH A;  3O6H A;  2XX9 A;  4GF8 A;  4KHZ E;  3ZKL A;  1EZO A;  1FTJ A;  1DPP A;  5H8Q B;  1ZJL A;  1LCF A;  2F7A A;  2RIN A;  3MP6 A;  4E0W A;  3G3I A;  5EHS A;  2PT2 A;  4FED A;  4FEC A;  4H0W A;  4XKP A;  3VXC A;  3MW0 A;  2DWI A;  1P99 A;  3IX1 A;  4IO5 A;  4YKP A;  4WXJ A;  3MPK A;  2Q2A A;  2HXW A;  3PUW E;  3SEW A;  2AYS A;  1KWH A;  3TQW A;  4RXL A;  3FJG A;  3IR1 A;  4G4P A;  3K00 A;  2A5T B;  1B46 A;  3VFJ A;  3RNN A;  3O29 A;  4UA8 A;  2DWA A;  1JVX A;  2RC9 A;  4RNS A;  5CM6 A;  4MH5 A;  5AA2 D;  4H5F A;  1A8F A;  5IAI A;  4POW A;  4DXB A;  1US4 A;  3ZS6 A;  1QKA A;  3BKI B;  2Q89 A;  3UP9 A;  3S2V A;  1H45 A;  1MXW A;  2O51 A;  4NMY A;  4POX A;  4QF9 A;  5CC2 A;  1DPE A;  3UN6 A;  2CMO A;  3KGC A;  4I9D A;  4NF4 A;  1UIV A;  2GH9 A;  4U4X A;  2QMW A;  3TTN A;  1PB7 A;  4PFW A;  1Y4T A;  1AOV A;  4F19 A;  3H7M A;  2O7U A;  3IK6 B;  3TEP A;  3CVG A;  3PMW A;  1IQ7 A;  3IOR A;  1B4H A;  4ZEK A;  3VVD A;  5FHM A;  2NOO A;  1AMF A;  2Q9T A;  5K2Y A;  1RKM A;  4NF8 B;  5M2V A;  3TYH A;  4GL0 A;  4NF6 A;  5CI5 A;  5I57 B;  2I48 A;  2RC7 A;  3EF7 A;  2QS4 A;  1B58 A;  3TFL A;  2X7Q A;  1B0L A;  3C33 A;  1S50 A;  3OEN A;  5CMB A;  4F2Q A;  4H5G A;  2PYY A;  3R26 A;  3B7D A;  4MBP A;  2GRV A;  2V93 A;  3HN0 A;  3PPR A;  1D3K A;  3G3G A;  5I2K B;  3O28 A;  2W7Y A;  4OWD A;  1VE4 A;  3MPL A;  4GL8 A;  4NF5 A;  3M3K A;  4DE8 A;  5JTY A;  1BLF A;  1M5F A;  1MH4 A;  3G3J A;  4U2R A;  1B2H A;  1YPN A;  1MRP A;  1QW0 A;  2XXV A;  3EQ1 A;  3FJM A;  4QSD A;  2F34 A;  4TLL B;  4YKI A;  1FQC A;  5F7V A;  5AA2 B;  3ZKK A;  1B3L A;  2I0B A;  3N26 A;  1MDQ A;  1SQY A;  4IO6 A;  4RY1 A;  1VSO A;  2V3T A;  4ZDM A;  5TU0 A;  2WKY A;  4KR5 A;  3TCH A;  2I49 A;  2QMX A;  1CB6 A;  3WAE A;  3HO7 A;  3FV2 A;  4X9T A;  4ESX A;  1SI1 A;  4GXS B;  5H8N B;  2Z8F A;  1CE2 A;  1B05 A;  1B1X A;  4AB5 A;  1URG A;  2Y7R A;  3C31 A;  3C4M A;  3H06 B;  4NF4 B;  4OZ9 A;  3RPW A;  4QFK A;  3U92 A;  5KZT A;  4RK2 A;  3VDF A;  1B5H A;  3PPN A;  4Q30 B;  2QS2 A;  4QFP A;  2XXY A;  4GXA A;  4U1Z A;  1BKA A;  4EUO A;  4P0G A;  1OVB A;  2NVU B;  4HCW A;  2XXI A;  3IL1 B;  3ODB A;  1Z7N E;  3SES A;  4DZ1 A;  4FIM A;  3IB0 A;  4PQJ A;  5JK4 A;  1LFH A;  3PPP A;  3N5L A;  2OWT A;  1L5T A;  1IXG A;  1BP5 A;  4N13 A;  3T66 A;  1Q35 A;  3H4Z A;  2DXR A;  2I0C A;  1LLS A;  3K6W A;  4U23 A;  4ZE9 A;  5I58 A;  4BLA A;  4G68 C;  1B5I A;  2OK2 A;  3KZG A;  3ZSF A;  4EQ9 A;  5B7D A;  3PMX A;  1P1Q A;  5A5X B;  1M5D A;  1D9Y A;  3MVW A;  4OQO A;  4OHN A;  5JEI A;  1ZMG A;  2Y7I A;  3HHF A;  1SW4 A;  1UTH B;  2O1L A;  2Y7P A;  2ZXT A;  3AXF A;  3PUX E;  5H8H A;  4LZ5 A;  2O7I A;  4PFY A;  3CR9 A;  4IGR A;  3CG3 A;  5FHO A;  1SW2 A;  4ONY A;  3SER A;  3KOS A;  4OFJ A;  5DYH A;  4ND9 A;  4BDN A;  1IIT A;  4GOT A;  4R2F A;  4DXU A;  2R71 A;  2OZZ A;  2DE2 A;  1IUD A;  1ZLQ A;  2XX8 A;  3L6H A;  2R6G E;  1SW5 A;  3E9X A;  2G29 A;  1N7X A;  2XD3 A;  1OQG A;  1XHY A;  3MZ1 A;  3FVG A;  5L9S A;  2PX1 A;  1OLA A;  1DTZ A;  2R9J A;  3B6T A;  1P1U A;  3ILT B;  3T93 B;  5F1Q A;  4I1D A;  1HSL A;  1PB9 A;  3LR1 A;  2DOJ A;  3EHT A;  4M4G A;  1RYO A;  2Q88 A;  4PFT A;  2V25 A;  4IO7 A;  3IJX B;  3A3U A;  5CMC A;  4F22 A;  3TQL A;  1M5E A;  1JET A;  2H98 A;  3FVO A;  1PBP A;  4F1U A;  3O97 A;  1N3X A;  5DTB A;  5ISU A;  3DP8 A;  4LQ5 A;  3W9W A;  3TTK A;  5CRY A;  1MQH A;  3KOT A;  1JVY A;  4XIG Q;  3THI A;  4AQ4 A;  3T96 B;  1MPC A;  4KCC A;  4LZ8 A;  3Q25 A;  5TPA B;  1POY 1;  1NMU A;  1A54 A;  1PBQ A;  2M8C A;  3OEL A;  4QFN A;  4R9F A;  3TTL A;  1II5 A;  1LCT A;  2DXY A;  3TTM A;  3USD A;  5ICT A;  2F78 A;  2NXO A;  3GBB A;  1OLC A;  3O66 A;  3DLN A;  3OO7 A;  4QFL A;  4MLV A;  4JXI A;  4KCD A;  4P11 A;  4PET A;  5DVF A;  3LUY A;  3SEV A;  2F97 A;  1I69 A;  3DEL B;  2QRY A;  2Z22 A;  2ZNS A;  3EN3 A;  3OOA A;  4H65 A;  3FD3 A;  1JW1 A;  3FXQ A;  1UIU A;  3KN3 A;  3SEY A;  5KDT A;  2QPQ A;  1R9Q A;  4G68 B;  2KLF A;  1LAF E;  2XXU A;  3GZG A;  1LST A;  3RTF B;  3TTR A;  3IOT A;  3TZA A;  3VLW A;  5I84 A;  5IKB A;  3A3C A;  2DE3 A;  5K2X A;  2G93 A;  1JEV A;  2RCA A;  3CFZ A;  3P7I A;  3TKD A;  4OFO A;  3K4U A;  4F29 A;  2ONK E;  3C34 A;  1JQF A;  1OMP A;  1MG1 A;  3PPQ A;  4I8C A;  4QSE A;  1VFD A;  2ZMB A;  3FIR A;  4KD5 A;  4OYV A;  1IXH A;  4F3P A;  2NWJ A;  1B3H A;  2H25 A;  5I2N B;  1SVX B;  1IXI A;  2OWS A;  3FV1 A;  3PU5 A;  2OCU A;  4OES A;  1LFI A;  1FW0 A;  5KCJ B;  5ELV A;  3R7X A;  1TT1 A;  1URD A;  4F1Y A;  1JNF A;  4FAT A;  2H5Y A;  3O6I A;  3C36 A;  1IXC A;  3U72 A;  4AB6 A;  2I6E A;  3K6V A;  1O7T A;  4U22 A;  1MXX A;  1Y3P A;  4MLQ A;  1H76 A;  3RT8 A;  1OQH A;  3HHG A;  1BTJ A;  3FUZ A;  4QFO A;  2QJE A;  4FJP A;  4QRZ A;  4R6Y A;  3L6G A;  4TOZ A;  4IO4 A;  4DDD A;  1EH3 A;  2D5W A;  3EHS A;  3FXU A;  3O6G A;  4L17 A;  3RTW B;  1Y9U A;  5I56 A;  1AIV A;  4G8H A;  2UVI A;  1AH5 A;  2DVZ A;  2GHB A;  1MDP 1;  3W15 C;  4GLI A;  1US5 A;  1MY1 A;  5L9M A;  4EXK A;  4R72 A;  4OMB A;  4K3F A;  2Y84 A;  1ATG A;  2O1M A;  3Q27 A;  3FVK A;  4ISU A;  1B3E A;  1MY2 A;  2O84 X;  2UVJ A;  1MM7 A;  1SI0 A;  3QYT A;  4R73 A;  4RYA A;  1Y20 A;  3TCG A;  4EF2 A;  1QUK A;  1LBC A;  3TDJ A;  2I3W A;  4RPN A;  4FAJ A;  3MP1 A;  2QL3 A;  5AA1 A;  3S9E A;  5CMM A;  3LSX A;  3MQ9 A;  2P1S A;  2Z23 A;  3OO6 A;  1QUL A;  3M3F A;  4XTC Q;  4RA1 A;  1N3W A;  4IY6 A;  3Q26 A;  3B6W A;  3C32 A;  3PMV A;  5I2N A;  4LP2 B;  3VXB A;  4NWC A;  1PDA A;  2AL4 A;  4JDF A;  1UTB A;  3OXN A;  4F3S A;  1QUI A;  3EHU A;  3OEK A;  4NTL A;  3RN8 A;  3UOR A;  5I59 B;  3O2A A;  4TQU Q;  2HZK A;  5DEX A;  1Y1Z A;  1QJM A;  5ITO A;  3CIJ A;  1IZ1 A;  2X26 A;  1Y3N A;  4P0I A;  4YIC A;  5J1D A;  1YAE A;  2FNC A;  4F18 A;  3FVN A;  2ZYO A;  3OEM A;  1RYX A;  2YJP A;  5KDT B;  1N76 A;  2XXX A;  3MVY A;  4C1T A;  1MXV A;  4F39 A;  1P1N A;  2DSF A;  2I4C A;  4YB5 A;  3RT6 B;  1POT A;  1I6Q A;  2O68 A;  1MY3 A;  2ZYM A;  1A99 A;  1DTG A;  1MS7 A;  2V84 A;  3I3V A;  3G7W A;  3PPO A;  2HCA A;  3FAT A;  3CI8 A;  1USY H;  1LGB C;  1SW1 A;  3RY3 A;  5L8D A;  4OVJ A;  1R6Z A;  4R9G A;  2F8D A;  4N07 A;  4RPO A;  1NNP A;  4OFL A;  3V89 B;  1FQF A;  1MY0 A;  2PBW A;  3TPA A;  4PP0 A;  3LC8 A;  1FTM A;  5DEX B;  4ZZA A;  5EYF A;  4IO2 A;  3G3F A;  3OSQ A;  3LSL A;  1H44 A;  1B9J A;  1ZIU A;  2A5S A;  1ANF A;  2I4B A;  1IIW A;  1B51 A;  2GHA A;  3DM0 A;  3IOW A;  1ELJ A;  1JW5 A;  3MBP A;  1H3D A;  2VD3 A;  4FE8 A;  4YZZ A;  2RC8 A;  2YLN A;  3VLV A;  1TFD A;  3D4G A;  3KEI A;  3GBA A;  3A09 A;  4IY5 A;  1NFT A;  1B1H A;  1B3G A;  1HSE A;  3E3K A;  3IAZ A;  4GWO A;  4R75 A;  1USY E;  5HM4 B;  1H43 A;  3KN8 A;  3KG2 A;  2O69 A;  4WKM A;  3QUF A;  2VP1 A;  1P1O A;  3EPE A;  4GD5 A;  4KYS A;  3ECR A;  3K0V A;  3OD7 A;  1GVC A;  3V5A A;  4JWX A;  1DMB A;  1XC1 A;  4R6H A;  3K02 A;  1A7L A;  3MUQ A;  3MWB A;  1BIY A;  4Q0C A;  4HCY A;  2I3V A;  4H8J A;  4MF3 A;  4R2B A;  3M3L A;  3T9X B;  4F2O A;  1LB8 A;  3HPI A;  2P2A A;  1PB8 A;  1MQG A;  3OO9 A;  4GRK A;  2VGQ A;  4OEN A;  3T9V A;  2REG A;  1XS5 A;  4GFR A;  4YMB A;  2B65 A;  3CSG A;  3HST A;  3TOD A;  1UTB B;  4QSC A;  5I58 B;  1SBP A;  1GV8 A;  2XXH A;  3K6U A;  1JEU A;  4F31 B;  5HPQ A;  3OSR A;  1B32 A;  4Q8R A;  2OBG A;  3TEL A;  4G2Z A;  1O64 A;  4IGT A;  3TCF A;  3TUS A;  1AL3 A;  2PVU A;  4HTG A;  1WOD A;  3U93 A;  3Q28 A;  3V83 A;  3R6U A;  4QHQ A;  1EZP A;  1S9T A;  2F6P A;  2Q2C A;  4LAT A;  2ONR A;  4BDQ A;  4YU0 A;  4ZS9 A;  3T9H B;  4EF1 A;  3JV9 A;  3T22 A;  1ZU0 A;  2DVC A;  4DXC A;  4EQB A;  3K1M A;  2ZNT A;  3G3H A;  3MAM A;  5H8H B;  1NKX A;  4XKQ A;  4HS7 A;  4ELR A;  1NNF A;  4DLD A;  1UQW A;  1MM6 A;  4KYE A;  3TAJ A;  1QUJ A;  3BFT A;  2X7P A;  3FAS A;  5AE4 A;  4R74 A;  3RUM A;  3KJ7 A;  4R6K A;  2F5X A;  1ZTY A;  1FQD A;  1EZ9 A;  2QS1 A;  3UA8 A;  5B70 A;  1B0H A;  2FYI A;  3IOU A;  5CBS A;  1B40 A;  1B5J A;  1XOC A;  3B6Q A;  4JBZ A;  4KI0 E;  1MPB A;  1B6H A;  2LAO A;  3MVZ A;  3UGW A;  1R9L A;  3SKP A;  4ELQ A;  1MQD A;  2F6G A;  4M1V A;  4WEP A;  1LB9 A;  4H6D A;  4EQ7 A;  2HAU A;  5JTY B;  1DOT A;  4XKN A;  1P1W A;  5I2K A;  4GIZ A;  1XVY A;  3VVF A;  4GVO A;  2D21 A;  2HQ0 A;  3PUV E;  4ZEI A;  5H8S A;  3UIF A;  1WDN A;  1B7U A;  4Q5T A;  5HBC A;  4NED A;  4H8I A;  2FA7 A;  5TPA A;  2E1S A;  5FTH A;  3OMB A;  3S9N C;  4F3G A;  3TMG A;  3CSB A;  3E4R A;  4NF8 A;  2XXW A;  2Y7W A;  1B3F A;  3BFU A;  3PD9 A;  3D4C A;  3UK4 A;  3QUJ A;  3OO8 A;  2H9B A;  4IB2 A;  2IEE A;  4GQO A;  3K1P A;  2UYF A;  2YPN A;  4LUB A;  3C9H A;  1LAH E;  4G68 A;  4YKJ A;  2RF1 A;  4F1V A;  4F3B A;  2P0S A;  5L9O A;  1MXU A;  3MJN A;  4RK9 A;  4ZEC A;  4LA9 A;  3H6U A;  1QVS A;  3PGF A;  1OVT A;  1MQJ A;  4I62 A;  3U94 A;  1EU8 A;  2F36 A;  1J1N A;  3FZV A;  4EXL A;  1T0K A;  2XHD A;  5EHM A;  3MZB A;  4OER A;  1NH7 A;  2HAV A;  4G8M A;  4IO3 A;  3MZ9 A;  4THI A;  1WVJ A;  1FQA A;  1QKB A;  2Z8D A;  2Q8J A;  3K2D A;  2ZNU A;  1SYH A;  3F11 A;  3H6W A;  5DVI A;  3IO6 A;  1DSN A;  2PMS A;  3JZJ A;  4XKR A;  1SD3 A;  4LON B;  3IO4 A;  1LBB A;  3PD8 A;  2XX7 A;  1NNK A;  3IOV A;  3PUZ E;  1FCK A;  1MXZ A;  1Y3Q A;  1URS A;  3Q29 A;  5I59 A;  2RCB A;  4C1U A;  1B7Z A;  4ESW A;  4JWO A;  4KYD A;  1I6B A;  3KJT A;  3HCQ A;  3U1O A;  2PT1 A;  3K6X A;  1IEJ A;  2VD2 A;  1TFA A;  2RKM A;  4BDR A;  3IJO B;  2E0S A;  4E0X A;  3CFX A;  4ELO A;  4LVQ A;  4U21 A;  3KN7 A;  4U1O A;  2ZYN A;  1XT8 A;  4UAC A;  1ZKB A;  3C35 A;  4U4S A;  3VE1 B;  5ICQ A;  3E13 X;  1GR2 A;  1GTK A;  1M5B A;  2I58 A;  2DE4 A;  1A40 A;  1OIB A;  2ZYK A;  4PFU A;  1A8E A;  1PEB A;  1TXF A;  1S7Y A;  4LQ2 A;  3H6V A;  1UTH A;  2HFB A;  3K01 A;  2ABH A;  3SDF A;  2B3B A;  2HEU A;  2QS3 A;  4LZ7 A;  3T9U A;  1MXY A;  3O9P A;  4G77 A;  3FGS A;  4YB6 A;  2DP8 A;  2XXT A;  1N0T A;  2ALU A;  5DT6 A;  1B7H A;  4Z0I A;  4ELP A;  2V3U A;  5A5X A;  1JW4 A;  3GLB A;  5I56 B;  2NUV A;  3FJ7 A;  1FQE A;  3SET A;  4RJZ A;  5CBR A;  1YCJ A;  1M5C A;  2AL5 A;  2DS9 A;  2UXA A;  5AA4 B;  4KQP A;  3CRB A;  3HV1 A;  4BDL A;  1B4Z A;  3KSJ A;  3QAX A;  4OTE A;  4DIG A;  3ILU B;  4ZEB A;  2REJ A;  1MH3 A;  4NF5 B;  3LSW A;  4X1D A;  4YB7 A;  4ZED A;  1SYI A;  4O3B A;  1PC3 A;  2UVG A;  2V3Q A;  2XD2 A;  1R1N A;  3M8U A;  3CFL A;  3MP8 A;  1VR5 A;  4O3C A;  4BDM A;  1N04 A;  3H03 A;  1MPD A;  2BJJ X;  4XXU A;  5KCJ A;  3KBR A;  2UYE A;  3GXA A;  3IB2 A;  1VFE A;  2QSX A;  3QXM A;  3FXR A;  4NF6 B;  2F7B A;  1FQB A;  2Z8E A;  1LAX A;  1XVX A;  2GFE A;  3MVX A;  4YKK A;  5FHN A;  3I5O A;  4MFI A;  1D4N A;  3IB1 A;  4DCY A;  5FTI A;  5H8N A;  2H4I A;  3BBR A;  5BUU A;  3S4U A;  3QSL A;  1D9V A;  1SDX A;  2DWJ A;  3JYR A;  2VHA A;  5ITP A;  1Q1K A;  2XXP A;  4NWD A;  3RGY A;  4KPT A;  4JSO A;  3G3K A;  4C0R A;  5AA2 A;  2DQV A;  4JB7 A;  3H6T A;  3PUY E;  3RLF E;  3LBS A;  3DP6 A;  1A55 A; 
#chains in the Genus database with same CATH topology
 1HSJ A;  1G0I A;  5EYH A;  3V8X B;  1LFG A;  4PE5 B;  5ET7 A;  1Y4C A;  4ECF A;  2XXQ A;  1K9Y A;  1Z7M E;  1NH8 A;  1B52 A;  4PCD A;  4ZE8 A;  4TLM B;  3VV5 A;  2VOZ A;  1FTL A;  2AIX A;  2Y7K A;  5TP9 B;  3U8Q A;  2ANJ A;  1YTV A;  4YAH X;  4P3L A;  3VLU A;  1K9Z A;  2DYX A;  3MC2 A;  3S9L C;  4N17 A;  5CMK A;  5TP9 A;  1MY4 A;  4YMA A;  3KFM A;  4DI4 B;  2ONS A;  5H8H B;  4OEU A;  4PGP A;  1LCF A;  2F7A A;  3MP6 A;  3VXC A;  2DWI A;  1JP4 A;  4WXJ A;  1NI9 A;  2HXW A;  4RXL A;  4I3Y A;  1B46 A;  4UA8 A;  5CM6 A;  1JVX A;  4GWZ A;  4N91 A;  1A8F A;  5IAI A;  3ZS6 A;  1FBP A;  3GYY A;  1MXW A;  1NV3 A;  2CMO A;  1AOV A;  1Y4T A;  2O7U A;  3CVG A;  3PMW A;  3IOR A;  2NOO A;  1AMF A;  3TYH A;  4NF8 B;  2I48 A;  2ZZW A;  1S50 A;  3R26 A;  2V93 A;  3HN0 A;  3PPR A;  3G3G A;  2W7Y A;  4AS4 A;  4NF5 A;  2R8T A;  1M5F A;  1MH4 A;  3G3J A;  2CEY A;  4U2R A;  1QW0 A;  5F7V A;  1FQC A;  3ZKK A;  2I0B A;  1SQY A;  4RY1 A;  5TU0 A;  2WKY A;  4KR5 A;  2I49 A;  3WAE A;  1CB6 A;  3T0J A;  5H8N B;  4AB5 A;  1B1X A;  4NF4 B;  2QVV A;  4Q30 B;  2XXY A;  1BKA A;  4FIM A;  3IB0 A;  5JK4 A;  1LFH A;  3PPP A;  3N5L A;  4GWU A;  3U65 A;  4N13 A;  1Q35 A;  2DXR A;  4U23 A;  2OK2 A;  3ZSF A;  1IMD A;  2Q8M A;  3AXF A;  2O1L A;  1IIT A;  2DE2 A;  2XX8 A;  3L6H A;  5IZ1 A;  1SW5 A;  2G29 A;  1OLA A;  2DOJ A;  1VDW A;  3EHT A;  4M4G A;  4PFT A;  4N4U A;  1NUY A;  3TQL A;  1M5E A;  3FVO A;  5ISU A;  3O97 A;  4LQ5 A;  3TTK A;  1MQH A;  3T96 B;  3FBP A;  3Q25 A;  4EXK A;  2M8C A;  1LCT A;  2F78 A;  2NXO A;  1OLC A;  4P11 A;  3LUY A;  3EN3 A;  3FD3 A;  3FXQ A;  5KDT A;  1UIU A;  4G68 B;  2KLF A;  2XXU A;  4GX3 A;  3TZA A;  5K2X A;  2RCA A;  3TKD A;  4F29 A;  4MJO A;  1OMP A;  2ZMB A;  2H25 A;  3FV1 A;  2WEF A;  1EYJ A;  1URD A;  1FPJ A;  2H5Y A;  3U72 A;  3K6V A;  1H76 A;  1BTJ A;  3SER A;  3L6G A;  1EH3 A;  3FXU A;  3RTW B;  1Y9U A;  4G8H A;  2UVI A;  2DVZ A;  4OVQ A;  4NHB A;  1US5 A;  3QMF A;  2Y84 A;  4ISU A;  4EF2 A;  4R73 A;  1Y20 A;  3MP1 A;  3A29 A;  3LSX A;  1FSA A;  1LBZ A;  2P1S A;  3OO6 A;  3Q26 A;  3B6W A;  3PMV A;  3OXN A;  4F3S A;  3EHU A;  3OEK A;  4O7M A;  5DEX A;  1QJM A;  1Y3N A;  5J1D A;  2XXX A;  2DSF A;  1POT A;  4PE3 A;  3I3V A;  1LGB C;  1SW1 A;  1FQF A;  1FBC A;  1FBG A;  3LC8 A;  1B9J A;  1ANF A;  1JW5 A;  1H3D A;  3KEI A;  4GWY A;  2L5V A;  1KA1 A;  4R75 A;  3IAZ A;  5EYG A;  1H43 A;  3V5A A;  1NV1 A;  4N8G A;  3MWB A;  1IMA A;  3M3L A;  1MQG A;  4X04 A;  4MEV A;  4F31 B;  1LEV A;  2PVU A;  2ZZV A;  4QHQ A;  3T9H B;  5IZ3 A;  3JV9 A;  2DVC A;  3LUZ A;  3K1M A;  4DLD A;  2XA5 A;  3FAS A;  5AE4 A;  4R6K A;  1ZTY A;  2QS1 A;  2FYI A;  1R9L A;  2F6G A;  5JTY B;  4XKN A;  4GIZ A;  3UIF A;  1WDN A;  4Q5T A;  5HBC A;  4H8I A;  2E1S A;  5FTH A;  3S9N C;  2IEE A;  4LUB A;  4G68 A;  4YKJ A;  1MXU A;  4ZEC A;  4RK9 A;  4LA9 A;  1T0K A;  1EU8 A;  4GBW A;  1EYK A;  4QBA A;  1NH7 A;  3MYU A;  3F11 A;  3JZJ A;  5T3J A;  2FIX A;  1LBB A;  3PUZ E;  5I59 A;  2RCB A;  1B7Z A;  1I6B A;  1TFA A;  2RKM A;  4E0X A;  2E0S A;  4U1O A;  5EQ8 A;  1M5B A;  1A8E A;  2B4L A;  3H6V A;  3K01 A;  2QS3 A;  4G77 A;  3FGS A;  4ELP A;  2DP8 A;  2XXT A;  1N0T A;  4Z0I A;  2V3U A;  1LBV A;  4RJZ A;  2DS9 A;  4MCO A;  4OTE A;  3ILU B;  4O7I A;  3LSW A;  3M8U A;  3MP8 A;  1VR5 A;  1N04 A;  1MPD A;  1VFE A;  3QXM A;  4NF6 B;  1LAX A;  2FBP A;  2GFE A;  3I5O A;  5FTI A;  5H8N A;  2DWJ A;  2VHA A;  1LBW A;  4HXV A;  3H6T A;  2Y5L A;  3DP6 A;  2BJI A;  2DWH A;  3N94 A;  3H3G A;  2THI A;  4FOR A;  2ESN A;  4H46 A;  1KZ8 A;  2HZL A;  5ET8 A;  3WAF A;  4PAF A;  4BDQ A;  4JSD A;  4DCX A;  2WX9 A;  1FPK A;  3W9V A;  1N84 A;  4H1X A;  3MST A;  4PF8 A;  3SEX A;  5DW8 A;  2O6A A;  2CZK A;  4XFE A;  1I6A A;  5H8F A;  3N6U A;  3CG1 A;  4I40 A;  2D3I A;  2OLB A;  2XX9 A;  4GF8 A;  1EZO A;  3ZKL A;  1FTA A;  1CNQ A;  5EHS A;  4H0W A;  4IO5 A;  2Q2A A;  2AYS A;  1KWH A;  1QGX A;  2A5T B;  3VFJ A;  2RC9 A;  4RNS A;  4X8R A;  3B50 A;  1QKA A;  2Q89 A;  4NGU A;  4PDD A;  4POX A;  4QF9 A;  5CC2 A;  3KGC A;  4I9D A;  3TTN A;  1UIV A;  2QMW A;  1PB7 A;  4PFW A;  4F19 A;  3H7M A;  3IK6 B;  4ZEK A;  1B4H A;  4NF0 A;  5CI5 A;  2QS4 A;  1B58 A;  2X7Q A;  5CMB A;  4F2Q A;  4H5G A;  2GRV A;  4PF6 A;  4OWD A;  4DE8 A;  3MPL A;  5JTY A;  1YPN A;  1MRP A;  3FJM A;  1B3L A;  4IO6 A;  4ZDM A;  2V3T A;  4X9T A;  1SI1 A;  4GXS B;  1FBH A;  2Y7R A;  3IFC A;  4OAN A;  4QFK A;  3U92 A;  5KZT A;  5ET6 A;  1RDX A;  4EUO A;  1OVB A;  3ODB A;  1Z7N E;  4DZ1 A;  1LLS A;  1B5I A;  5ESY A;  1NV5 A;  4OQO A;  4OHN A;  5JEI A;  2Y7I A;  1SW4 A;  4GWW A;  3B8B A;  2O7I A;  4PFY A;  2VT5 A;  3CR9 A;  2PCR A;  4IGR A;  5DYH A;  4ND9 A;  4BDN A;  4R2F A;  2OZZ A;  2XD3 A;  5L9S A;  2PX1 A;  2R9J A;  3B6T A;  1P1U A;  3LR1 A;  1RYO A;  2Q88 A;  2V25 A;  3IJX B;  3A3U A;  2H98 A;  1BK4 A;  5DTB A;  2B4M A;  1JVY A;  4KCC A;  4LZ8 A;  3TTM A;  3O66 A;  4KCD A;  5DVF A;  3SEV A;  1I69 A;  2Z22 A;  1JW1 A;  3KN3 A;  3LV0 A;  2QPQ A;  1R9Q A;  1LAF E;  3TTR A;  2CZH A;  3VLW A;  4PFI A;  5IKB A;  3A3C A;  4AS5 A;  3CFZ A;  2ONK E;  3C34 A;  3PPQ A;  4QSE A;  1VFD A;  4O8M A;  4KD5 A;  1IXI A;  2OWS A;  2OCU A;  1FW0 A;  1TT1 A;  4F1Y A;  1JNF A;  1IXC A;  2I6E A;  4U22 A;  1Y3P A;  4MLQ A;  1OQH A;  4QRZ A;  4QFO A;  5IM2 A;  4IO4 A;  4GLI A;  1MY1 A;  5L9M A;  4K3F A;  3FVK A;  4HE2 A;  1FPE A;  1B3E A;  1MY2 A;  3QYT A;  3TCG A;  1NV6 A;  1LBC A;  1IMF A;  2I3W A;  4RPN A;  2QL3 A;  5AA1 A;  3S9E A;  3MQ9 A;  3M3F A;  5EQ7 A;  1N3W A;  1PDA A;  4JDF A;  1UTB A;  4PBH A;  5ITO A;  2X26 A;  4P0I A;  2FNC A;  4F18 A;  3OEM A;  1RYX A;  2YJP A;  5KDT B;  3E79 A;  1LBX A;  1I6Q A;  2O68 A;  1MY3 A;  1DTG A;  2V84 A;  2P3V A;  4PFB A;  5L8D A;  1R6Z A;  4RPO A;  4OFL A;  1MY0 A;  3KC0 A;  4PP0 A;  4N15 A;  4IO2 A;  3G3F A;  3LSL A;  1H44 A;  2I4B A;  3IOW A;  4E0W A;  2GHA A;  1ELJ A;  3MBP A;  4FE8 A;  2RC8 A;  1TFD A;  4MNI A;  4NN3 A;  4PBQ A;  1B1H A;  3E3K A;  5HM4 B;  3KC1 A;  4GWO A;  2O69 A;  4GWX A;  3QUF A;  4GD5 A;  3ECR A;  1DMB A;  1XC1 A;  4R2B A;  4P8B A;  3HPI A;  1PB8 A;  4PAK A;  2VGQ A;  4GFR A;  3HST A;  5J16 A;  4QSC A;  1SBP A;  2F3D A;  3RPL B;  3OSR A;  1B32 A;  1O64 A;  4IGT A;  3TCF A;  1AL3 A;  4HTG A;  3Q28 A;  3V83 A;  1ZU0 A;  4HS7 A;  1UQW A;  3TAJ A;  3BFT A;  3UA8 A;  1FQD A;  3IOU A;  4KI0 E;  4JBZ A;  3MVZ A;  1B6H A;  2LAO A;  3UGW A;  4M1V A;  4WEP A;  4H6D A;  1P1W A;  1XVY A;  3VVF A;  4GVO A;  2HQ0 A;  4ZEI A;  1B7U A;  5TPA A;  2FA7 A;  4P47 A;  4NF8 A;  2XXW A;  3BFU A;  3QUJ A;  2RF1 A;  4F3B A;  2P0S A;  5L9O A;  1QVS A;  3PGF A;  4I62 A;  1J1N A;  4EXL A;  3MZB A;  2HAV A;  4THI A;  4I3E A;  2Z8D A;  1SYH A;  5EQ9 A;  3PD8 A;  1URS A;  4C1U A;  5LTC A;  4BDR A;  2ZYN A;  1XT8 A;  4U4S A;  5ICQ A;  3E13 X;  4GWS A;  2I58 A;  1A40 A;  2DE4 A;  2Q74 A;  1PEB A;  1UTH A;  2HFB A;  3T9U A;  4LZ7 A;  3O9P A;  5DT6 A;  2ALU A;  5A5X A;  4KXP A;  1FQE A;  1M5C A;  2AL5 A;  2UXA A;  3KSJ A;  3QAX A;  4X1D A;  4UAB A;  4ZED A;  1PC3 A;  2V3Q A;  1EYI A;  4BDM A;  3CFL A;  3H03 A;  3KBR A;  3IB2 A;  2F3B A;  2Z8E A;  5FHN A;  4YKK A;  3MVX A;  4MFI A;  1D4N A;  5BUU A;  3JYR A;  5ITP A;  2DQV A;  4GX4 A;  4JB7 A;  3RLF E;  3LBS A;  3HFU A;  3QK6 A;  3I6V A;  3PV0 E;  1O63 A;  1N7W A;  1NNT A;  2B3F A;  5AA4 A;  4OET A;  5LOM A;  4XEQ A;  4ZZE A;  5H8Q A;  2F7C A;  4JWY A;  4NE4 A;  3RQT A;  3S9M C;  3K1N A;  4Z7E A;  3N6T A;  1Q9D A;  4X1B A;  1F9B A;  2XWK A;  5BWJ A;  4EDP A;  2IA4 A;  3O6H A;  4P9K A;  5H8Q B;  1ZJL A;  2RIN A;  4HE1 A;  3G3I A;  4FED A;  3MW0 A;  1P99 A;  3MPK A;  2XXK A;  3PUW E;  3FJG A;  3IR1 A;  3KBZ A;  3RNN A;  4MIJ A;  4PGN A;  4MH5 A;  5AA2 D;  4POW A;  1G0H A;  1NV0 A;  3UP9 A;  1H45 A;  1DPE A;  3UN6 A;  2GH9 A;  4U4X A;  3VVD A;  5K2Y A;  4GL0 A;  4OVS A;  5I57 B;  2RC7 A;  1FRP A;  2QVU A;  3C33 A;  2PYY A;  3B7D A;  4MBP A;  1LBY A;  4PDH A;  1D3K A;  5I2K B;  1VE4 A;  4GL8 A;  3M3K A;  1BLF A;  5F24 A;  3T1B A;  3EQ1 A;  2XXV A;  4TLL B;  2F34 A;  2XWV A;  4MMP A;  5AA2 B;  2Y5K A;  4EQ9 A;  3TCH A;  5A5X B;  3HO7 A;  3FV2 A;  2XWI A;  2FVZ A;  1FBE A;  4OZ9 A;  4RK2 A;  1B5H A;  2QS2 A;  4QFP A;  4GXA A;  2NVU B;  4HCW A;  2XXI A;  3SES A;  2VPN A;  4PQJ A;  1FPF A;  1L5T A;  1IXG A;  2KR0 A;  3H4Z A;  2I0C A;  5I58 A;  4BLA A;  5B7D A;  1P1Q A;  4MNC A;  1ZMG A;  3HHF A;  3PUX E;  4GBV A;  2ZXT A;  4LZ5 A;  3CG3 A;  4ONY A;  4OFJ A;  4DXU A;  1ZLQ A;  2PFZ A;  2R6G E;  3E9X A;  1FBF A;  1OQG A;  1XHY A;  3MZ1 A;  3FVG A;  4I1D A;  4IO7 A;  5CMC A;  4F1U A;  1PBP A;  3DP8 A;  1YZ0 A;  4AQ4 A;  1MPC A;  3BIG A;  5TPA B;  1POY 1;  4R9F A;  4QFN A;  1YYZ A;  5ICT A;  3USD A;  2P3N A;  4DI3 D;  2F97 A;  2WBB A;  3DEL B;  2ZNS A;  4H65 A;  1RDY A;  3RTF B;  3GZG A;  5I84 A;  2DE3 A;  1JEV A;  3EKI A;  3P7I A;  1JQF A;  1MG1 A;  2WYK A;  4OYV A;  1IXH A;  2ZZX A;  2NWJ A;  4F3P A;  1B3H A;  5I2N B;  1SVX B;  3R7X A;  4FAT A;  3O6I A;  3HHG A;  3RPL A;  3FUZ A;  4FJP A;  4GX6 A;  3O6G A;  3EHS A;  1AH5 A;  1MDP 1;  5I5P A;  4R72 A;  4OMB A;  4XF5 A;  2O84 X;  2UVJ A;  1MM7 A;  1SI0 A;  4XTC Q;  4IY6 A;  3E78 A;  2WYP A;  3VXB A;  4NWC A;  2AL4 A;  4N6K A;  1QUI A;  5I59 B;  4LN5 A;  4NTL A;  3O2A A;  1Y1Z A;  3CIJ A;  2WBD A;  1YAE A;  2ZYO A;  1N76 A;  3MVY A;  4F39 A;  4C1T A;  1MXV A;  2I4C A;  4YB5 A;  3RT6 B;  3IFA A;  3G7W A;  2HCA A;  3FAT A;  3CI8 A;  1USY H;  4OVJ A;  4R9G A;  4JVI A;  3V89 B;  2PBW A;  1DK4 A;  4ZZA A;  3OSQ A;  2JJK A;  4LVQ A;  2A5S A;  4DXB A;  3VLV A;  2YLN A;  3GBA A;  1USY E;  2CEX A;  3KN8 A;  3KG2 A;  1P1O A;  3OD7 A;  4JWX A;  1BIY A;  4Q0C A;  4HCY A;  4MF3 A;  1NV2 A;  2P2A A;  3T9V A;  2REG A;  1XS5 A;  2B65 A;  3CSG A;  3TOD A;  4Q8R A;  2OBG A;  4G2Z A;  5IZ3 B;  3U93 A;  1EZP A;  1S9T A;  2F6P A;  2Q2C A;  4LAT A;  4YU0 A;  4ZS9 A;  4EF1 A;  4ELR A;  1NNF A;  1MM6 A;  4KYE A;  2X7P A;  3RUM A;  5CBS A;  1B5J A;  4PFR A;  3SKP A;  1DOT A;  4NED A;  3OMB A;  4F3G A;  3CSB A;  3OO8 A;  2H9B A;  5LDZ A;  4GQO A;  3K1P A;  2UYF A;  2YPN A;  3C9H A;  1MQJ A;  3U94 A;  1DCU A;  2F36 A;  1FBD A;  4MNP A;  2XHD A;  5EHM A;  2V4C A;  1FPL A;  3MZ9 A;  1NUW A;  5ET5 A;  1QKB A;  3H6W A;  3IO6 A;  2PMS A;  4XKR A;  1SD3 A;  3IO4 A;  2XX7 A;  3IOV A;  1FCK A;  1Y3Q A;  3Q29 A;  4ESW A;  4JWO A;  4KYD A;  3KJT A;  3HCQ A;  4OA4 A;  4ELO A;  4UAC A;  1ZKB A;  3C35 A;  4HE0 A;  2ZYK A;  1S7Y A;  4LQ2 A;  3SDF A;  2B3B A;  2HEU A;  1MXY A;  3GLB A;  2NUV A;  4NAP A;  5CBR A;  4KQP A;  3CRB A;  3HV1 A;  1YXI A;  4PAI A;  4BDL A;  1B4Z A;  2REJ A;  1MH3 A;  1SYI A;  4O3B A;  4NG7 A;  2XD2 A;  4OVR A;  2BJJ X;  2UYE A;  3GXA A;  2KQZ A;  2F7B A;  1FQB A;  5A5L A;  1XVX A;  1FPG A;  3IB1 A;  4DCY A;  2H4I A;  3BBR A;  3QSL A;  1D9V A;  1SDX A;  1Q1K A;  2XXP A;  3CHG A;  3RGY A;  4KPT A;  4JSO A;  4C0R A;  5AA2 A;  3BIH A;  4O94 A;  3QIM A;  4FBP A;  4KFQ A;  4OEV A;  1NL5 A;  5DVJ A;  4X48 A;  4OXV A;  2A5T A;  5AA3 A;  4H67 A;  3FXB A;  3VVE A;  4O3A A;  2CZL A;  2OJT A;  4FEB A;  5I57 A;  1GGG A;  3DP4 A;  4ZEF A;  2XXR A;  2F35 A;  2FHY A;  3LSF B;  4N81 A;  5H8F B;  4NX1 A;  3KSX A;  4WED A;  4N6P A;  1LAG E;  3SEU A;  1MQI A;  1ZBM A;  4G8N A;  1XI6 A;  4HW8 A;  2HPG A;  1Y1M A;  4OVP A;  2OWZ A;  4BDO A;  1TWY A;  1FTO A;  3ONM A;  2H99 A;  4N8Y A;  1FTK A;  2UVH A;  4KHZ E;  2QVR A;  1FTJ A;  1DPP A;  2PT2 A;  4FEC A;  4XKP A;  3IX1 A;  1INP A;  4YKP A;  4NQ8 A;  3SEW A;  3TQW A;  4G4P A;  3K00 A;  3O29 A;  2DWA A;  4H5F A;  1US4 A;  1NV4 A;  3BKI B;  3S2V A;  4NMY A;  2O51 A;  4NF4 A;  3TEP A;  4G61 A;  1IQ7 A;  5FHM A;  2Q9T A;  1RKM A;  5M2V A;  4NF6 A;  3EF7 A;  3TFL A;  1RDZ A;  1B0L A;  3OEN A;  5FBP A;  4P56 A;  3RYD A;  3O28 A;  1B2H A;  4YKI A;  4QSD A;  3N26 A;  1MDQ A;  1VSO A;  4ESX A;  2QMX A;  2Z8F A;  1CE2 A;  1B05 A;  1NV7 A;  1URG A;  1IME A;  3C31 A;  3C4M A;  3H06 B;  3RPW A;  3NOH A;  3VDF A;  3PPN A;  2VPO A;  4U1Z A;  4P0G A;  3IL1 B;  4OVT A;  2OWT A;  1BP5 A;  3T66 A;  4ZE9 A;  3K6W A;  4G68 C;  3KZG A;  3PMX A;  1M5D A;  1D9Y A;  3MVW A;  1UTH B;  2Y7P A;  5H8H A;  1SPI A;  2MKZ A;  5FHO A;  1SW2 A;  3KOS A;  2CZI A;  4GOT A;  2R71 A;  3ISP A;  1IUD A;  1N7X A;  1FJ6 A;  1DTZ A;  3T93 B;  3ILT B;  5F1Q A;  1HSL A;  4MX6 A;  1PB9 A;  4H45 A;  4F22 A;  1JET A;  4MAG A;  1N3X A;  3W9W A;  5CRY A;  3KOT A;  3THI A;  4XIG Q;  1IMC A;  4PTK A;  3TTL A;  1NMU A;  1A54 A;  1PBQ A;  3OEL A;  5IZZ A;  4MHF A;  1II5 A;  2DXY A;  3GBB A;  3DLN A;  3OO7 A;  4QFL A;  4MLV A;  4JXI A;  4PET A;  2QRY A;  3OOA A;  3SEY A;  4P1E A;  2QFL A;  1LST A;  2DDK A;  3IOT A;  2G93 A;  4OFO A;  3K4U A;  4I8C A;  1FPI A;  3FIR A;  5KCJ B;  3PU5 A;  4OES A;  1LFI A;  5ELV A;  1FJ9 A;  3C36 A;  4IR8 A;  4AB6 A;  1O7T A;  1MXX A;  3RT8 A;  4TOZ A;  4R6Y A;  2QJE A;  4DDD A;  2D5W A;  4L17 A;  5I56 A;  1AIV A;  2GHB A;  3W15 C;  1ATG A;  2O1M A;  3Q27 A;  4RYA A;  1QUK A;  3TDJ A;  4FAJ A;  5CMM A;  2Z23 A;  1QUL A;  4RA1 A;  2GQ1 A;  3C32 A;  5I2N A;  4LP2 B;  3RN8 A;  3UOR A;  4TQU Q;  2HZK A;  1IZ1 A;  4YIC A;  3FVN A;  1P1N A;  5I7I A;  2ZYM A;  1A99 A;  1MS7 A;  3PPO A;  5I3S A;  3RY3 A;  2F8D A;  4N07 A;  1NNP A;  3TPA A;  5DEX B;  1FTM A;  4PC9 A;  5EYF A;  1ZIU A;  4OEN A;  1IIW A;  1B51 A;  3DM0 A;  4YZZ A;  2VD3 A;  3D4G A;  3A09 A;  4IY5 A;  1NFT A;  1B3G A;  1HSE A;  4WKM A;  2VP1 A;  3EPE A;  4KYS A;  1GVC A;  3K0V A;  4R6H A;  3K02 A;  1A7L A;  3MUQ A;  2I3V A;  4H8J A;  3T9X B;  4F2O A;  1LB8 A;  3OO9 A;  4GRK A;  4YMB A;  5I58 B;  1UTB B;  1GV8 A;  2XXH A;  3K6U A;  1JEU A;  5HPQ A;  3TEL A;  3TUS A;  1WOD A;  3R6U A;  4N6D A;  2ONR A;  2HHM A;  3T22 A;  4DXC A;  4EQB A;  3D1R A;  2ZNT A;  3G3H A;  3MAM A;  1AWB A;  1NKX A;  4XKQ A;  1NUX A;  5EQA A;  1QUJ A;  4R74 A;  3KJ7 A;  2F5X A;  5B70 A;  1EZ9 A;  1B0H A;  1B40 A;  1XOC A;  3B6Q A;  1MPB A;  1NUZ A;  4ELQ A;  1MQD A;  2HXR A;  1LB9 A;  4EQ7 A;  2HAU A;  5I2K A;  2D21 A;  4P1L A;  3PUV E;  5H8S A;  3TMG A;  2OX3 A;  3E4R A;  2Y7W A;  1B3F A;  3PD9 A;  3D4C A;  3UK4 A;  4IB2 A;  1KA0 A;  3ROJ A;  4QXD A;  1LAH E;  4F1V A;  3MJN A;  3H6U A;  1OVT A;  3FZV A;  4OER A;  4G8M A;  4IO3 A;  1WVJ A;  1FQA A;  2Q8J A;  2XWO A;  2PFY A;  2ZNU A;  3K2D A;  5DVI A;  1DSN A;  1D9Q A;  4LON B;  1NNK A;  1MXZ A;  3U1O A;  2PT1 A;  3K6X A;  1FPD A;  1IEJ A;  4JVC A;  2VD2 A;  3SZP A;  3IJO B;  3CFX A;  4U21 A;  3KN7 A;  1IMB A;  4JVD A;  2FIE A;  3VE1 B;  5IGA A;  1GR2 A;  1GTK A;  1OIB A;  4PFU A;  1TXF A;  2ABH A;  3PTY A;  4YB6 A;  1B7H A;  1JW4 A;  5I56 B;  3FJ7 A;  3SET A;  1YCJ A;  5AA4 B;  4DIG A;  4ZEB A;  4NF5 B;  4YB7 A;  2UVG A;  1R1N A;  4O3C A;  5KCJ A;  4XXU A;  1DBZ A;  2QSX A;  3FXR A;  1FPB A;  3S4U A;  4NWD A;  3G3K A;  3PUY E;  1A55 A; 
#chains in the Genus database with same CATH homology
 1HSJ A;  2DWH A;  3QK6 A;  3QIM A;  3I6V A;  3N94 A;  3H3G A;  4KFQ A;  3V8X B;  1LFG A;  3PV0 E;  1O63 A;  4OEV A;  4PE5 B;  1NL5 A;  1N7W A;  5DVJ A;  4X48 A;  4OXV A;  2A5T A;  5AA3 A;  1NNT A;  2B3F A;  2THI A;  4FOR A;  1Y4C A;  4H67 A;  3VVE A;  4ECF A;  5AA4 A;  2ESN A;  4O3A A;  2CZL A;  2OJT A;  2XXQ A;  1Z7M E;  4FEB A;  4OET A;  5I57 A;  5LOM A;  1GGG A;  3DP4 A;  1NH8 A;  1B52 A;  2HZL A;  4ZEF A;  2XXR A;  5H8Q A;  4ZZE A;  3WAF A;  4ZE8 A;  2F35 A;  4JSD A;  4TLM B;  3VV5 A;  3LSF B;  2F7C A;  2VOZ A;  4JWY A;  3W9V A;  4DCX A;  4NE4 A;  1FTL A;  5H8F B;  1N84 A;  2AIX A;  4H1X A;  3RQT A;  3KSX A;  2Y7K A;  5TP9 B;  3SEX A;  3S9M C;  3U8Q A;  2ANJ A;  1YTV A;  3K1N A;  4WED A;  4N6P A;  1LAG E;  4Z7E A;  4YAH X;  3N6T A;  3SEU A;  2O6A A;  1MQI A;  1ZBM A;  4X1B A;  3VLU A;  1F9B A;  2DYX A;  3MC2 A;  4G8N A;  4HW8 A;  5BWJ A;  3S9L C;  1Y1M A;  5CMK A;  4EDP A;  5TP9 A;  1I6A A;  1MY4 A;  2IA4 A;  4BDO A;  5H8F A;  3N6U A;  1TWY A;  1FTO A;  3KFM A;  3ONM A;  2H99 A;  4YMA A;  2ONS A;  3CG1 A;  1FTK A;  4OEU A;  2D3I A;  2OLB A;  2UVH A;  3O6H A;  2XX9 A;  4GF8 A;  4KHZ E;  3ZKL A;  1EZO A;  1FTJ A;  1DPP A;  5H8Q B;  1ZJL A;  1LCF A;  2F7A A;  2RIN A;  3MP6 A;  4E0W A;  3G3I A;  5EHS A;  2PT2 A;  4FED A;  4FEC A;  4H0W A;  4XKP A;  3VXC A;  3MW0 A;  2DWI A;  1P99 A;  3IX1 A;  4IO5 A;  4YKP A;  4WXJ A;  3MPK A;  2Q2A A;  2HXW A;  3PUW E;  3SEW A;  2AYS A;  1KWH A;  3TQW A;  4RXL A;  3FJG A;  3IR1 A;  4G4P A;  3K00 A;  2A5T B;  1B46 A;  3VFJ A;  3RNN A;  3O29 A;  4UA8 A;  2DWA A;  1JVX A;  2RC9 A;  4RNS A;  5CM6 A;  4MH5 A;  5AA2 D;  4H5F A;  1A8F A;  5IAI A;  4POW A;  4DXB A;  1US4 A;  3ZS6 A;  1QKA A;  3BKI B;  2Q89 A;  3UP9 A;  3S2V A;  1H45 A;  1MXW A;  2O51 A;  4NMY A;  4POX A;  4QF9 A;  5CC2 A;  1DPE A;  3UN6 A;  2CMO A;  3KGC A;  4I9D A;  4NF4 A;  1UIV A;  2GH9 A;  4U4X A;  2QMW A;  3TTN A;  1PB7 A;  4PFW A;  1Y4T A;  1AOV A;  4F19 A;  3H7M A;  2O7U A;  3IK6 B;  3TEP A;  3CVG A;  3PMW A;  1IQ7 A;  3IOR A;  1B4H A;  4ZEK A;  3VVD A;  5FHM A;  2NOO A;  1AMF A;  2Q9T A;  5K2Y A;  1RKM A;  4NF8 B;  5M2V A;  3TYH A;  4GL0 A;  4NF6 A;  5CI5 A;  5I57 B;  2I48 A;  2RC7 A;  3EF7 A;  2QS4 A;  1B58 A;  3TFL A;  2X7Q A;  1B0L A;  3C33 A;  1S50 A;  3OEN A;  5CMB A;  4F2Q A;  4H5G A;  2PYY A;  3R26 A;  3B7D A;  4MBP A;  2GRV A;  2V93 A;  3HN0 A;  3PPR A;  1D3K A;  3G3G A;  5I2K B;  3O28 A;  2W7Y A;  4OWD A;  1VE4 A;  3MPL A;  4GL8 A;  4NF5 A;  3M3K A;  4DE8 A;  5JTY A;  1BLF A;  1M5F A;  1MH4 A;  3G3J A;  4U2R A;  1B2H A;  1YPN A;  1MRP A;  1QW0 A;  2XXV A;  3EQ1 A;  3FJM A;  4QSD A;  2F34 A;  4TLL B;  4YKI A;  1FQC A;  5F7V A;  5AA2 B;  3ZKK A;  1B3L A;  2I0B A;  3N26 A;  1MDQ A;  1SQY A;  4IO6 A;  4RY1 A;  1VSO A;  2V3T A;  4ZDM A;  5TU0 A;  2WKY A;  4KR5 A;  3TCH A;  2I49 A;  2QMX A;  1CB6 A;  3WAE A;  3HO7 A;  3FV2 A;  4X9T A;  4ESX A;  1SI1 A;  4GXS B;  5H8N B;  2Z8F A;  1CE2 A;  1B05 A;  1B1X A;  4AB5 A;  1URG A;  2Y7R A;  3C31 A;  3C4M A;  3H06 B;  4NF4 B;  4OZ9 A;  3RPW A;  4QFK A;  3U92 A;  5KZT A;  4RK2 A;  3VDF A;  1B5H A;  3PPN A;  4Q30 B;  2QS2 A;  4QFP A;  2XXY A;  4GXA A;  4U1Z A;  1BKA A;  4EUO A;  4P0G A;  1OVB A;  2NVU B;  4HCW A;  2XXI A;  3IL1 B;  3ODB A;  1Z7N E;  3SES A;  4DZ1 A;  4FIM A;  3IB0 A;  4PQJ A;  5JK4 A;  1LFH A;  3PPP A;  3N5L A;  2OWT A;  1L5T A;  1IXG A;  1BP5 A;  4N13 A;  3T66 A;  1Q35 A;  3H4Z A;  2DXR A;  2I0C A;  1LLS A;  3K6W A;  4U23 A;  4ZE9 A;  5I58 A;  4BLA A;  4G68 C;  1B5I A;  2OK2 A;  3KZG A;  3ZSF A;  4EQ9 A;  5B7D A;  3PMX A;  1P1Q A;  5A5X B;  1M5D A;  1D9Y A;  3MVW A;  4OQO A;  4OHN A;  5JEI A;  1ZMG A;  2Y7I A;  3HHF A;  1SW4 A;  1UTH B;  2O1L A;  2Y7P A;  2ZXT A;  3AXF A;  3PUX E;  5H8H A;  4LZ5 A;  2O7I A;  4PFY A;  3CR9 A;  4IGR A;  3CG3 A;  5FHO A;  1SW2 A;  4ONY A;  3SER A;  3KOS A;  4OFJ A;  5DYH A;  4ND9 A;  4BDN A;  1IIT A;  4GOT A;  4R2F A;  4DXU A;  2R71 A;  2OZZ A;  2DE2 A;  1IUD A;  1ZLQ A;  2XX8 A;  3L6H A;  2R6G E;  1SW5 A;  3E9X A;  2G29 A;  1N7X A;  2XD3 A;  1OQG A;  1XHY A;  3MZ1 A;  3FVG A;  5L9S A;  2PX1 A;  1OLA A;  1DTZ A;  2R9J A;  3B6T A;  1P1U A;  3ILT B;  3T93 B;  5F1Q A;  4I1D A;  1HSL A;  1PB9 A;  3LR1 A;  2DOJ A;  3EHT A;  4M4G A;  1RYO A;  2Q88 A;  4PFT A;  2V25 A;  4IO7 A;  3IJX B;  3A3U A;  5CMC A;  4F22 A;  3TQL A;  1M5E A;  1JET A;  2H98 A;  3FVO A;  1PBP A;  4F1U A;  3O97 A;  1N3X A;  5DTB A;  5ISU A;  3DP8 A;  4LQ5 A;  3W9W A;  3TTK A;  5CRY A;  1MQH A;  3KOT A;  1JVY A;  4XIG Q;  3THI A;  4AQ4 A;  3T96 B;  1MPC A;  4KCC A;  4LZ8 A;  3Q25 A;  5TPA B;  1POY 1;  1NMU A;  1A54 A;  1PBQ A;  2M8C A;  3OEL A;  4QFN A;  4R9F A;  3TTL A;  1II5 A;  1LCT A;  2DXY A;  3TTM A;  3USD A;  5ICT A;  2F78 A;  2NXO A;  3GBB A;  1OLC A;  3O66 A;  3DLN A;  3OO7 A;  4QFL A;  4MLV A;  4JXI A;  4KCD A;  4P11 A;  4PET A;  5DVF A;  3LUY A;  3SEV A;  2F97 A;  1I69 A;  3DEL B;  2QRY A;  2Z22 A;  2ZNS A;  3EN3 A;  3OOA A;  4H65 A;  3FD3 A;  1JW1 A;  3FXQ A;  1UIU A;  3KN3 A;  3SEY A;  5KDT A;  2QPQ A;  1R9Q A;  4G68 B;  2KLF A;  1LAF E;  2XXU A;  3GZG A;  1LST A;  3RTF B;  3TTR A;  3IOT A;  3TZA A;  3VLW A;  5I84 A;  5IKB A;  3A3C A;  2DE3 A;  5K2X A;  2G93 A;  1JEV A;  2RCA A;  3CFZ A;  3P7I A;  3TKD A;  4OFO A;  3K4U A;  4F29 A;  2ONK E;  3C34 A;  1JQF A;  1OMP A;  1MG1 A;  3PPQ A;  4I8C A;  4QSE A;  1VFD A;  2ZMB A;  3FIR A;  4KD5 A;  4OYV A;  1IXH A;  4F3P A;  2NWJ A;  1B3H A;  2H25 A;  5I2N B;  1SVX B;  1IXI A;  2OWS A;  3FV1 A;  3PU5 A;  2OCU A;  4OES A;  1LFI A;  1FW0 A;  5KCJ B;  5ELV A;  3R7X A;  1TT1 A;  1URD A;  4F1Y A;  1JNF A;  4FAT A;  2H5Y A;  3O6I A;  3C36 A;  1IXC A;  3U72 A;  4AB6 A;  2I6E A;  3K6V A;  1O7T A;  4U22 A;  1MXX A;  1Y3P A;  4MLQ A;  1H76 A;  3RT8 A;  1OQH A;  3HHG A;  1BTJ A;  3FUZ A;  4QFO A;  2QJE A;  4FJP A;  4QRZ A;  4R6Y A;  3L6G A;  4TOZ A;  4IO4 A;  4DDD A;  1EH3 A;  2D5W A;  3EHS A;  3FXU A;  3O6G A;  4L17 A;  3RTW B;  1Y9U A;  5I56 A;  1AIV A;  4G8H A;  2UVI A;  1AH5 A;  2DVZ A;  2GHB A;  1MDP 1;  3W15 C;  4GLI A;  1US5 A;  1MY1 A;  5L9M A;  4EXK A;  4R72 A;  4OMB A;  4K3F A;  2Y84 A;  1ATG A;  2O1M A;  3Q27 A;  3FVK A;  4ISU A;  1B3E A;  1MY2 A;  2O84 X;  2UVJ A;  1MM7 A;  1SI0 A;  3QYT A;  4R73 A;  4RYA A;  1Y20 A;  3TCG A;  4EF2 A;  1QUK A;  1LBC A;  3TDJ A;  2I3W A;  4RPN A;  4FAJ A;  3MP1 A;  2QL3 A;  5AA1 A;  3S9E A;  5CMM A;  3LSX A;  3MQ9 A;  2P1S A;  2Z23 A;  3OO6 A;  1QUL A;  3M3F A;  4XTC Q;  4RA1 A;  1N3W A;  4IY6 A;  3Q26 A;  3B6W A;  3C32 A;  3PMV A;  5I2N A;  4LP2 B;  3VXB A;  4NWC A;  1PDA A;  2AL4 A;  4JDF A;  1UTB A;  3OXN A;  4F3S A;  1QUI A;  3EHU A;  3OEK A;  4NTL A;  3RN8 A;  3UOR A;  5I59 B;  3O2A A;  4TQU Q;  2HZK A;  5DEX A;  1Y1Z A;  1QJM A;  5ITO A;  3CIJ A;  1IZ1 A;  2X26 A;  1Y3N A;  4P0I A;  4YIC A;  5J1D A;  1YAE A;  2FNC A;  4F18 A;  3FVN A;  2ZYO A;  3OEM A;  1RYX A;  2YJP A;  5KDT B;  1N76 A;  2XXX A;  3MVY A;  4C1T A;  1MXV A;  4F39 A;  1P1N A;  2DSF A;  2I4C A;  4YB5 A;  3RT6 B;  1POT A;  1I6Q A;  2O68 A;  1MY3 A;  2ZYM A;  1A99 A;  1DTG A;  1MS7 A;  2V84 A;  3I3V A;  3G7W A;  3PPO A;  2HCA A;  3FAT A;  3CI8 A;  1USY H;  1LGB C;  1SW1 A;  3RY3 A;  5L8D A;  4OVJ A;  1R6Z A;  4R9G A;  2F8D A;  4N07 A;  4RPO A;  1NNP A;  4OFL A;  3V89 B;  1FQF A;  1MY0 A;  2PBW A;  3TPA A;  4PP0 A;  3LC8 A;  1FTM A;  5DEX B;  4ZZA A;  5EYF A;  4IO2 A;  3G3F A;  3OSQ A;  3LSL A;  1H44 A;  1B9J A;  1ZIU A;  2A5S A;  1ANF A;  2I4B A;  1IIW A;  1B51 A;  2GHA A;  3DM0 A;  3IOW A;  1ELJ A;  1JW5 A;  3MBP A;  1H3D A;  2VD3 A;  4FE8 A;  4YZZ A;  2RC8 A;  2YLN A;  3VLV A;  1TFD A;  3D4G A;  3KEI A;  3GBA A;  3A09 A;  4IY5 A;  1NFT A;  1B1H A;  1B3G A;  1HSE A;  3E3K A;  3IAZ A;  4GWO A;  4R75 A;  1USY E;  5HM4 B;  1H43 A;  3KN8 A;  3KG2 A;  2O69 A;  4WKM A;  3QUF A;  2VP1 A;  1P1O A;  3EPE A;  4GD5 A;  4KYS A;  3ECR A;  3K0V A;  3OD7 A;  1GVC A;  3V5A A;  4JWX A;  1DMB A;  1XC1 A;  4R6H A;  3K02 A;  1A7L A;  3MUQ A;  3MWB A;  1BIY A;  4Q0C A;  4HCY A;  2I3V A;  4H8J A;  4MF3 A;  4R2B A;  3M3L A;  3T9X B;  4F2O A;  1LB8 A;  3HPI A;  2P2A A;  1PB8 A;  1MQG A;  3OO9 A;  4GRK A;  2VGQ A;  4OEN A;  3T9V A;  2REG A;  1XS5 A;  4GFR A;  4YMB A;  2B65 A;  3CSG A;  3HST A;  3TOD A;  1UTB B;  4QSC A;  5I58 B;  1SBP A;  1GV8 A;  2XXH A;  3K6U A;  1JEU A;  4F31 B;  5HPQ A;  3OSR A;  1B32 A;  4Q8R A;  2OBG A;  3TEL A;  4G2Z A;  1O64 A;  4IGT A;  3TCF A;  3TUS A;  1AL3 A;  2PVU A;  4HTG A;  1WOD A;  3U93 A;  3Q28 A;  3V83 A;  3R6U A;  4QHQ A;  1EZP A;  1S9T A;  2F6P A;  2Q2C A;  4LAT A;  2ONR A;  4BDQ A;  4YU0 A;  4ZS9 A;  3T9H B;  4EF1 A;  3JV9 A;  3T22 A;  1ZU0 A;  2DVC A;  4DXC A;  4EQB A;  3K1M A;  2ZNT A;  3G3H A;  3MAM A;  5H8H B;  1NKX A;  4XKQ A;  4HS7 A;  4ELR A;  1NNF A;  4DLD A;  1UQW A;  1MM6 A;  4KYE A;  3TAJ A;  1QUJ A;  3BFT A;  2X7P A;  3FAS A;  5AE4 A;  4R74 A;  3RUM A;  3KJ7 A;  4R6K A;  2F5X A;  1ZTY A;  1FQD A;  1EZ9 A;  2QS1 A;  3UA8 A;  5B70 A;  1B0H A;  2FYI A;  3IOU A;  5CBS A;  1B40 A;  1B5J A;  1XOC A;  3B6Q A;  4JBZ A;  4KI0 E;  1MPB A;  1B6H A;  2LAO A;  3MVZ A;  3UGW A;  1R9L A;  3SKP A;  4ELQ A;  1MQD A;  2F6G A;  4M1V A;  4WEP A;  1LB9 A;  4H6D A;  4EQ7 A;  2HAU A;  5JTY B;  1DOT A;  4XKN A;  1P1W A;  5I2K A;  4GIZ A;  1XVY A;  3VVF A;  4GVO A;  2D21 A;  2HQ0 A;  3PUV E;  4ZEI A;  5H8S A;  3UIF A;  1WDN A;  1B7U A;  4Q5T A;  5HBC A;  4NED A;  4H8I A;  2FA7 A;  5TPA A;  2E1S A;  5FTH A;  3OMB A;  3S9N C;  4F3G A;  3TMG A;  3CSB A;  3E4R A;  4NF8 A;  2XXW A;  2Y7W A;  1B3F A;  3BFU A;  3PD9 A;  3D4C A;  3UK4 A;  3QUJ A;  3OO8 A;  2H9B A;  4IB2 A;  2IEE A;  4GQO A;  3K1P A;  2UYF A;  2YPN A;  4LUB A;  3C9H A;  1LAH E;  4G68 A;  4YKJ A;  2RF1 A;  4F1V A;  4F3B A;  2P0S A;  5L9O A;  1MXU A;  3MJN A;  4RK9 A;  4ZEC A;  4LA9 A;  3H6U A;  1QVS A;  3PGF A;  1OVT A;  1MQJ A;  4I62 A;  3U94 A;  1EU8 A;  2F36 A;  1J1N A;  3FZV A;  4EXL A;  1T0K A;  2XHD A;  5EHM A;  3MZB A;  4OER A;  1NH7 A;  2HAV A;  4G8M A;  4IO3 A;  3MZ9 A;  4THI A;  1WVJ A;  1FQA A;  1QKB A;  2Z8D A;  2Q8J A;  3K2D A;  2ZNU A;  1SYH A;  3F11 A;  3H6W A;  5DVI A;  3IO6 A;  1DSN A;  2PMS A;  3JZJ A;  4XKR A;  1SD3 A;  4LON B;  3IO4 A;  1LBB A;  3PD8 A;  2XX7 A;  1NNK A;  3IOV A;  3PUZ E;  1FCK A;  1MXZ A;  1Y3Q A;  1URS A;  3Q29 A;  5I59 A;  2RCB A;  4C1U A;  1B7Z A;  4ESW A;  4JWO A;  4KYD A;  1I6B A;  3KJT A;  3HCQ A;  3U1O A;  2PT1 A;  3K6X A;  1IEJ A;  2VD2 A;  1TFA A;  2RKM A;  4BDR A;  3IJO B;  2E0S A;  4E0X A;  3CFX A;  4ELO A;  4LVQ A;  4U21 A;  3KN7 A;  4U1O A;  2ZYN A;  1XT8 A;  4UAC A;  1ZKB A;  3C35 A;  4U4S A;  3VE1 B;  5ICQ A;  3E13 X;  1GR2 A;  1GTK A;  1M5B A;  2I58 A;  2DE4 A;  1A40 A;  1OIB A;  2ZYK A;  4PFU A;  1A8E A;  1PEB A;  1TXF A;  1S7Y A;  4LQ2 A;  3H6V A;  1UTH A;  2HFB A;  3K01 A;  2ABH A;  3SDF A;  2B3B A;  2HEU A;  2QS3 A;  4LZ7 A;  3T9U A;  1MXY A;  3O9P A;  4G77 A;  3FGS A;  4YB6 A;  2DP8 A;  2XXT A;  1N0T A;  2ALU A;  5DT6 A;  1B7H A;  4Z0I A;  4ELP A;  2V3U A;  5A5X A;  1JW4 A;  3GLB A;  5I56 B;  2NUV A;  3FJ7 A;  1FQE A;  3SET A;  4RJZ A;  5CBR A;  1YCJ A;  1M5C A;  2AL5 A;  2DS9 A;  2UXA A;  5AA4 B;  4KQP A;  3CRB A;  3HV1 A;  4BDL A;  1B4Z A;  3KSJ A;  3QAX A;  4OTE A;  4DIG A;  3ILU B;  4ZEB A;  2REJ A;  1MH3 A;  4NF5 B;  3LSW A;  4X1D A;  4YB7 A;  4ZED A;  1SYI A;  4O3B A;  1PC3 A;  2UVG A;  2V3Q A;  2XD2 A;  1R1N A;  3M8U A;  3CFL A;  3MP8 A;  1VR5 A;  4O3C A;  4BDM A;  1N04 A;  3H03 A;  1MPD A;  2BJJ X;  4XXU A;  5KCJ A;  3KBR A;  2UYE A;  3GXA A;  3IB2 A;  1VFE A;  2QSX A;  3QXM A;  3FXR A;  4NF6 B;  2F7B A;  1FQB A;  2Z8E A;  1LAX A;  1XVX A;  2GFE A;  3MVX A;  4YKK A;  5FHN A;  3I5O A;  4MFI A;  1D4N A;  3IB1 A;  4DCY A;  5FTI A;  5H8N A;  2H4I A;  3BBR A;  5BUU A;  3S4U A;  3QSL A;  1D9V A;  1SDX A;  2DWJ A;  3JYR A;  2VHA A;  5ITP A;  1Q1K A;  2XXP A;  4NWD A;  3RGY A;  4KPT A;  4JSO A;  3G3K A;  4C0R A;  5AA2 A;  2DQV A;  4JB7 A;  3H6T A;  3PUY E;  3RLF E;  3LBS A;  3DP6 A;  1A55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...