4G4SO

Structure of proteasome-pba1-pba2 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
249
structure length
200
Chain Sequence
LEVCPVPKVEFYSTAVITTKIMNPLFPKNLLQLTSIGEIKTTLFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Proteasome Pba1-Pba2 Complex: IMPLICATIONS FOR PROTEASOME ASSEMBLY, ACTIVATION, AND BIOLOGICAL FUNCTION.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/chaperone
molecule keywords Proteasome component C7-alpha
total genus 54
structure length 200
sequence length 249
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF10450 POC1 POC1 chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4sO01
4G4SO
chains in the Genus database with same CATH superfamily
1NF3A 1Y80A 4MRAA 1J24A 3SYNA 1CYEA 2PR2A 5IC5A 4I1PA 3KIPA 1HT0A 1JZSA 4K87A 1TF7A 4NMMA 2Q8QA 3WLSA 2QMQA 1T2CA 4BQRA 4IO1A 2OSVA 1NMQA 1NKSA 5CCEA 4N7JA 2BWJA 2X5NA 3MF4A 1B15A 2NSHA 3SICE 1SXJA 3I8XA 1J2TA 4OVKA 3H75A 4UAVA 1H0HA 1OX4A 4C1BA 2GA8A 4HYYA 2W11A 3UJNA 3O82A 4KR6A 3I61A 2XPCA 1BRMA 2PHZA 3NJRA 1RABA 2IXBA 2D06A 4PQYA 1V4BA 3MJFA 4OBBA 5CUQA 5AVVA 1VE1A 3TTSA 1EWQA 3CZRA 3N05A 3GZ4A 4Q4LA 4EG7A 3HFJA 3LWNA 2Q50A 5AM1A 1G21A 3GEDA 5KTRA 5HF8A 1OI3A 4EPWA 5CGZA 1FNNA 3LRTA 2R66A 6REQB 1RBYA 1XUOA 4W9NC 3TI7A 4HVLA 3VVCA 2B5VA 5IG2A 5CNJA 4DBLC 5FX2A 2ZAIA 3CN7A 3RAFC 3IUNA 2XWBF 4ZOAA 3DZHA 4L4XA 1I2BA 2B61A 3C7CB 1IMJA 1X80B 1T2UA 2QD2A 4QQFA 2PGJA 4RIFA 1JKJB 4JWTA 2QMOA 1FMJA 3CH6A 3PFWO 3GRKA 4X8MA 5HKOA 2JFNA 5I7FA 3STYA 1WP9A 3KZVA 4IVPA 4YUAA 3QG5A 4Z3OA 2A58A 1F17A 2JZCA 2VUTA 3OCUA 3H2BA 4G01B 3RUIA 4I14A 2HQBA 3ABIA 3TQRA 4KXYA 3LVQE 1QLHA 2HSWA 1SURA 3NEYA 2BTQA 1Q22A 3SSMA 2B35A 4EP1A 3V8RA 5JR3A 3LBNA 3SC6A 1Y4SA 1N6PA 3Q12A 2HV9A 3P26A 4FC7A 1OH8A 3ABOB 2Z8YM 4MP8A 3DL7A 4IWYA 4FMPA 2AIRA 3BMQA 3OPMA 4YRSA 2YMLA 2AUMA 3GPIA 4B6FA 4DLPA 4UHCA 5KVSA 3WLHA 3V3KA 2W37A 3G7SA 4FYVA 4IIUA 1KJJA 4JU8A 2FQXA 2ZRQA 1CQJA 1FDOA 3S29A 4KUGA 5EHIA 2JFFA 1DBQA 5C5DA 4F3TA 1B8NA 5FA6A 4UBIA 1FA9A 3EQ2A 1J1ZA 2H92A 1BDJA 4FK8A 3AFMA 4E1VA 2IUEA 2QJRA 2W6PA 2HWWA 2ZPTX 3UCXA 3VO9A 3MMSA 2JLWA 4I4TB 4JVLA 5TT0A 5TGZA 3ZY5A 1WY7A 3QZUA 2PZBA 4JLUA 2PTHA 5EIAA 5DH9A 3WA7A 1AMNA 4M1EA 4MVJM 3WHPA 5IMSA 5CM9C 3RD5A 1NVEA 1QGDA 4D9JA 4PZPA 2QRPA 4HGPA 2AYXA 3TJMA 4EKEA 4Q34A 3QNUA 1RQPA 5CFLA 1MN6A 1U2TA 1X80A 1QIKA 1I8TA 2ATEA 1I3KA 1EBUA 1DB3A 1NJ6A 2HHJA 3HL0A 4LWZA 1CERA 2Q0HA 1J5PA 2A9PA 1WKCA 3NH9A 3AM5A 2QG4A 1E96A 3DFIA 1UT6A 2Q3EA 2RGXA 3NC4A 2OE2A 1DEAA 4LDNA 1TO2E 3WGLA 1JR3D 1WB6A 1ZH4A 2PRZA 2CV1A 4EKNB 3UHJA 3MM4A 1T8UA 2VLBA 4C3VA 2QV7A 3D2BA 4FMBB 1YUMA 2CWDA 1CZRA 1T8YA 3H2HA 4NNOA 3T1HB 2Y1KA 1V1MB 4JLMA 3L46A 3L4EA 1WULS 4PNZA 1YJQA 3QKSA 3PDJA 1JF8A 1XTRA 2I67A 3MB5A 3N6VA 3NASA 2FPKA 1LSJA 4ENQA 1Z37A 5FQNA 3O47A 3MTEA 3JQDA 4BUCA 2I7XA 4OX9B 1GZDA 3QV1A 1K7EB 1MP0A 1OOEA 1WXXA 4XUDA 3IHWA 4JC5A 2B36A 1PR0A 5L3RA 1HE8B 1GAXA 2PMBA 1EXNA 2FF7A 3EZ2A 4L51A 1ZVKA 3Q2OA 3Q8MA 1FF9A 2VJKA 5DWDA 5IZCA 1KZ9A 2WIGA 3GJ5A 4B0PA 4C21A 4MMXB 1SG0A 1BN7A 5JJIA 3PX3A 2ZRFA 3ORYA 5K8UA 2QB5A 3HHPA 5DNUA 1PQWA 4FNGA 1QWOA 3FOZA 1EQAA 2BM0A 4PVDA 2C82A 1MC1A 1NSYA 4BFZA 3IE2A 2RH4A 4K6OA 3FYUC 1Q0HA 2ZSUA 3LOPA 4QXRA 2AJDA 4QU5A 1PIWA 4U7TB 3ZW8A 4UVIA 2QUBA 1QDEA 2O20A 3F96A 5JATA 1B0AA 1Z5VA 4HADA 3H5IA 2WINI 3FSEA 2R6ZA 4D02A 4HLUA 2HDHA 1RBZA 2H1RA 1D4FA 4II2A 4DEXA 3MHTA 1L3IA 2DOKA 4NS1A 3OE1A 4RDXA 2GOYA 2F17A 3STTA 4Y2JA 1PYOA 3LH5A 1E1NA 3KYJB 4FR2A 3CW8X 2D3WA 4WKCA 1NVMB 5JSUA 3A9SA 1UBRS 4OB8A 3ND8A 4UZSA 4BEBA 3K09C 3LCCA 1XD8A 2ZOSA 5JRJA 2VK1A 1TW2A 1PEAA 4IV0A 1Z8FA 4Q9IA 1HH4A 2NU8A 3TLGA 3W5VA 1AD2A 2PFGA 4ZMBA 2BSQA 3UWPA 3MAJA 2B4RO 1XK7A 1MDBA 5F5LA 5M34A 4PPGA 1XRPA 4WH0A 3SQWA 3ZEAA 4LXTA 3LX8A 1K8QA 1Q7GA 4MI6A 2VPXA 5KSPA 3OP1A 4DE5A 3ADPA 3WLFA 3A2LA 1ECFA 1ZGGA 4NHOA 1F60A 1KMMA 2QUJA 4FDLA 3ZUPA 4HKTA 3ZHOA 1RKQA 1FUUA 5BYKA 1BKDR 4LTDA 1NI5A 4G4IA 3L5KA 1E7QA 3C87A 4PBRA 1FDRA 2HO5A 4RW0A 4NBTA 5TPWB 3AWDA 1KFEB 3R6WA 1LPMA 2FQYA 5FEMA 3NNDA 5IEJA 1MOSA 5A4DA 2G1JA 2OL4A 2XWJI 3V55A 3ZV5A 5BR4A 4PN7A 1P45A 2OBLA 2GRAA 4RLFA 1YDMA 4GI1A 4BQIA 4Z1MA 3EG9A 3H2KA 3UENA 3UJ7A 4X1IA 1XNJA 3K2IA 3FMGA 4C4RA 5E6RB 5UKDA 2DH6A 1A9OA 3FOCA 1IAQA 2QLJA 1HDZA 3F6EX 3OJOA 3R5JA 5BUZA 1XWWA 2Q0SA 1QQ5A 1JR4A 2XJ9A 2Z5FA 5ALXA 3C45A 1NNSA 4GSLA 4NBVA 4TT3D 4PLPA 3II6X 3AKCA 3QXHA 2QQGA 1XC7A 2WOOA 3GNLA 1QIHA 3PEFA 1CS0B 5C4IA 1X7XA 1TFRA 3LO8A 5B3KA 1KARA 2QDXA 2NU9A 4CM8A 3UWDA 4B3DA 4H1UA 3SX4A 2E6UX 3V97A 3ZHZA 1C7EA 4ZVPA 1SD1A 3KQTA 1NUAA 3X2SA 2J4FA 1I6LA 5I01A 4EBBA 3PR3A 2I33A 5EJ7A 4DCTA 1ZH6A 2Q5EA 2XWSA 4ZYLA 1UM8A 2VRWA 3EGOA 1UBFA 5C8YB 5BO5A 2XCSB 1SB9A 4WCFB 3B89A 4GPZA 4BVKA 2A84A 4MARA 4EA6A 1W2GA 1QORA 2ZXEA 4GT1A 1MV8A 3GRCA 4DRXA 4XOIA 4HQ6A 3I1FA 1NXSA 1FXWF 1QO0D 3EUEA 4XD7D 4JELA 5JECA 2ZRNA 2R8XA 3G7UA 3W2EA 3ZK9A 3DEJA 1CD5A 5AI8A 1EP2B 4WOKA 2H4HA 1E92A 1M2WA 1T3LA 3H99A 2EQ5A 2Y68A 3D3NA 3QTBA 4OL0A 2HFKA 4RS3A 2J59A 4EI7A 3EUAA 2WJVA 3FNIA 2Q4DA 3KK0A 4V0OA 4A8HA 2A9JA 3GLGE 4LF8B 3GRFA 2LTAA 3K0AB 2QRMA 3EMDA 5A9RA 1HDXA 2JFBA 3I2KA 1WTCA 2A7XA 3HSYA 3U9LA 2FPIA 2PGOA 1Y3DE 1ZWKA 1L5RA 1UBOS 2R7LA 4MAMA 3NHBA 6PFKA 5A0VA 1PX2A 5L8VA 3ZDCA 3L0DA 4IBOA 4I19A 2QX8A 1MORA 2ZREA 3FGPA 4HJRA 2BW0A 4EL0A 1TIPA 2B1GA 3T0IA 3KCQA 2JAUA 5EIEA 1D8AA 2A30A 3CX8A 1MAUA 3K9HA 2WTAA 3GGPA 4LKRA 3HN2A 5EHQA 5TMEA 5JC1A 3RK4A 4MWOA 1D2GA 2WWFA 4B71A 4BEJA 1U9JA 3R76A 4EVRA 5B4VA 1MNQA 3D54D 3Q8LA 2QQEA 3OIFA 1VBNA 5K3BA 5CBPA 1NPTO 2X77A 3D4LA 2XMCA 2PH5A 3L02A 4FFLA 3AY6A 4S0ZA 5FULA 1W36D 3VTKA 3K8OE 3N2GA 4KQ2A 1KP3A 4JOBA 3P71T 4QBIA 4EABA 1L7EA 4QTTB 3DMTA 3NHLA 1HPLA 1BXRB 1N2IA 2PKYX 1M1YB 4IUBS 2W5UA 5AW1A 4KLRA 2IYLD 4P92A 2QORA 4JB0A 4AECA 1KC1A 1JTVA 3I04M 3IERA 1UEJA 2PSFA 3WSWA 4C0KA 1YQWA 1IN6A 4E3ZA 4A03A 1J25A 2ZU0C 1X8JA 2Y1CA 4O4IB 4OO3A 3DE3X 4ZVTA 5D1HA 1JHRA 2X8AA 3FD8A 2PM8A 3KWLA 3R44A 4HOYA 1M74A 3TZCA 2IBTA 2R6GA 1T26A 3F6BX 1UC4B 4INPA 3Q98A 3C3PA 3S2ZA 3I53A 1Z6ZA 3T35A 3BWDD 3I6ZA 5DHRA 2I7CA 4NEGA 2HA3A 4KCGA 2WB2A 1Z2PX 1HM5A 2WG1A 5ALZA 4KPUA 3ZGVA 2QLFA 3N74A 3TQIA 2R62A 4HSEA 5JVDA 2A5FA 1FSPA 2PN1A 1I3OA 4LQDA 4NYIR 3RWOA 4UREA 1T36B 2AN3A 4QTXA 4DCSA 1F0PA 1BMQA 4YQZA 4D4IA 4P0TA 2ZRIA 3C3WA 1PR2A 5CB0A 5TPZA 3H5RA 3KHSA 3UANA 2NTVA 5U9CA 2OLEA 5DTQA 5HOEA 4PLZA 1WMBA 2FOLA 4IINA 1XZJA 4AY3A 1MH9A 2EKLA 1YKFA 3L0ZA 3LSYA 5BV7A 2EARA 4UMDA 5ADVA 4B40A 5CCDA 4QE3A 4JJFA 2FDCA 2IYQA 2VDKB 2C4HA 2JD0A 2XYQA 5MFPA 2INGX 3TL2A 5D3ZA 3HJNA 4CLHA 1P4HA 2I22A 1EK0A 2IU6A 2K7ZA 3BXGA 3COWA 3PQ2A 4M76B 3E7PA 2OMKA 2OUIA 3QE0A 2VIIA 1SPBS 2G06A 3AEUA 5CW1A 3ZQKA 1IJEA 2VPIA 3AP3A 4RZHA 4QLBA 2V9PA 1DZIA 5LL6P 5JJLA 1RHJA 1U3VA 3KTFA 1P5ZB 4OXNA 4RE6A 3EXFB 2G1AA 3GUVA 4FYWA 3RNLA 3K9FC 2VUHB 3O4GA 4NK4A 5LJIA 3UMGA 4YCBA 1TUIA 3DTVD 1KYYA 1L8AA 2GK6A 3IJEB 4NU8X 5EXPA 5EE3A 5KYWA 1A8SA 3K8YA 1MA3A 2VSOA 5A0TA 4FCCA 4CM3A 3JQEA 3WWEA 1ODTC 4EH1A 1ULHA 1ABFA 4KB5A 5F7JA 2C2KA 3ZOZA 3J81A 4JLWA 2R6JA 2PD3A 3Q88A 3F71A 3N2KB 1B1CA 2PLAA 1DCFA 5KX5F 4GVPA 2GF0A 2ONCA 4BO8A 4M8LA 2PRYA 2WTXA 3VTFA 1FYVA 3DYVA 4FNOA 3WLEA 1CY2A 1KKUA 2PQMA 1TPZA 2F8TA 1A9QA 4G0ZA 1R9MA 4QGFA 2IS4A 3L2OB 1NR7A 1T5OA 1ZLXA 4CQNA 1OBFO 5F21A 1P29A 5K0TA 2G1PA 2YMQA 2X4GA 4NENA 3A28A 5LR6A 3G2OA 1N0HA 1YZFA 4RD2A 2HL6A 2R1ZA 1A7KA 1VRWA 2XDQB 3I01A 2J3QA 4D9GA 3DV9A 3PJRA 4IVQA 4QSHA 1WU7A 3HZOA 5HA5A 4D4HA 2OXTA 2VHJA 2JH8A 5ARCA 2J5BA 4G0NA 2QY9A 3DGFC 1E6LA 4R54A 3I52A 5ENZA 3W77A 5HZKA 5IKOA 4LZOA 1X42A 1UZLA 2HQOA 2WZQA 2YJGA 2I4TA 1FUEA 1X77A 2EDCA 3ESZA 1CQWA 3GRYA 4ZXPA 1UOQA 5HQ3A 1JBEA 1S8FA 3DWIA 4PHFA 4INZA 4TTSA 2HWYA 2DBQA 1WPQA 1H22A 3B5EA 5HF6A 1ZVMA 2AG5A 3AZQA 1TLLA 1ILEA 3D3QA 4AKIA 4WY2A 3C4QA 3DE5X 1ZCJA 2XUZA 1PJ4A 1ZMBA 3F3YA 2J0EA 1UXOA 3G02A 4Y2UA 5COQA 1GZ5A 5I8WA 1GP2A 3IXMA 3Q87B 1HLDA 2C7GA 3VYSB 3WNBA 4L5CA 2NP6A 3L0BA 3KZ1E 3LA8A 2ZLBA 1KU6A 5I9MA 3E3NA 4KL8S 2Q0XA 2EEPA 3K0FB 4FIDA 1IY2A 1O97D 3GA5A 1YZTA 3LBAA 2IYNA 1XAJA 1RIIA 1H0SA 3G0HA 3GFRA 2WYUA 3N3AC 1XAHA 4K6GA 3TSCA 1KJ8A 3MAAC 3RT1A 4BV9A 3F2VA 4NCNA 1XV5A 1Q0LA 3R20A 4P3YA 1V25A 1U2PA 1U3UA 1M6VB 2OKCA 3N0TA 3RC2A 4I1VA 2V55B 1NJGA 5EEGA 1IBMB 1M8GA 1KY5A 1G2IA 4IDAA 1KFBB 5EIOA 4C5BA 4FUTA 2WFMA 3JQ8A 3H5AA 1NE7A 2XDQA 4PS1A 3IT1A 3FNGA 4PS0A 1ZG3A 4RV5A 2PUVA 1GLVA 3ICWA 3SQDA 3EZ9A 4MHTA 4II7A 4P2GA 4B6QA 1SU7A 4PPNA 3T3MB 4RJTA 4AMBA 1M0WA 1L1QA 1JKXA 2GX6A 1LQTA 1QHXA 1EUCB 2GCEA 4K9PA 3SK0A 3ZY4A 4EG5A 3PGJA 3ED1A 4LRSB 3ZY3A 2HIMA 4FHGA 4HB3A 4KKVA 5C5EA 2QGNA 2RGUA 4Q19A 4JC8A 3ZE8A 4EF4A 1NM5C 2F1IA 4OGFA 2PU7A 3EIQA 3HCNA 3MVEA 2ID9A 4ZOBA 3A3OA 2WFZA 1MRNA 1EP9A 4KQXA 4M60A 4F1JA 4MWSA 5H7XA 1TCVA 3OTWA 1ORVA 1I2CA 2FN7A 2FVYA 4YXWD 2D8MA 4TN1A 2ZI3A 4MWZA 3KQLA 3UKDA 4C4YA 1XPOA 1ORRA 2D7JA 3A36A 4D81A 3ANLA 4JJGA 1G8JA 3VHXB 3ONNA 3FNQA 4JOQA 1TMKA 3LQKA 1WUTA 4LZNA 1HETA 1QF7A 2Y2UA 3IQGX 1YFZA 3H87A 3M33A 4E1BA 2BISA 1DHTA 2B1JA 4QBFA 3SJZA 1XQYA 4G8BA 4D46A 3KJQA 2C42A 2O7QA 2J1LA 4I7EA 4Q4AA 4B45A 1NJFA 4DUPA 4CL2A 4Q3AA 5JFGA 1KA9H 3HEMA 1OJ7A 1DAPA 3OZUA 3A9UA 4XJXA 2OA0A 1P72A 4MEJA 4DPKA 2O0MA 2BMVA 3BXHA 1ECGA 3HYRA 1RLOA 2YW9A 3BIJA 1FPQA 1KDRA 3EW7A 5FHQA 3AJ9A 5C8DA 2QOEA 5FBWB 4B73A 1F06A 4YRQA 3T1OA 4HAUA 1B43A 4GRAA 2P68A 1Q57A 3FZYA 1N8KA 2WSLA 3GGOA 2C88A 5AKXA 4RA9A 4ZVMA 1JKMA 3F3KA 3T61A 4HV4A 1CY7A 5T8KA 1OZAA 2P2ZA 3W7BA 4PHTA 4AUEA 2P3SA 1GA6A 4EFLA 4XWWA 3TCNA 3OJWA 4BNVA 1U0EA 3HY4A 4EEZA 3I92A 2ODNA 2A0UA 3NKFA 2AI2A 4N41A 2A5JA 4QL3A 4ASUA 1WUKS 2C7BA 3DXYA 4QICA 5JNLA 4BV3A 1CUVA 2E4YA 2OQRA 1KY4A 2W2XA 3P0HA 3U7QA 3ICEA 1E2HA 3KPJA 4FHCA 1JDZA 1H2RS 3VSEA 1TCCA 5JMWA 3X3HA 3W5BA 5G4LA 1NF2A 5EQFA 1PS9A 1RVV1 1XQ1A 5CX4A 5IJZA 1V16B 4OFBA 4RLHA 1R4NB 3SOPA 3TCKA 2I6QA 3SS9X 1MO3A 1G59A 4A2PA 2CVFA 2V3VA 3MQ2A 2OCBA 5IAKA 3V2HA 2W2KA 3CPSA 3Q6MA 4YJ2F 1Z39A 5HCUA 3RC7A 1E1YA 1P44A 1V2HE 1CNEA 4E46A 5JSHA 2J07A 4LDAA 5IDXA 1NOIA 4RK1A 1M0EA 2RGRA 4CM8B 1LPAB 2CXOA 1GDDA 5FFNA 3H1PA 3FF4A 5FT9A 1UMBA 2BFNA 1ZVQA 2WWWA 3TRJA 4DG8A 1LQ2A 3O4HA 5K1ZA 3I8SA 2XOKA 1M2HA 3JV7A 2W8BA 3O1LA 2VA9A 1J2YA 1ZU4A 2Q4TA 4W1SA 4EMUA 3N75A 1MJFA 2FEXA 3I0NA 3L4SO 2PJRA 3DMHA 1QAQA 2XD9A 3HO6A 4ZI5A 2P27A 2QLMA 3EZFA 1QCYA 5D3MA 1TKRA 2X7JA 4TMZA 5FUVA 1XEXB 4P4NA 3MRSA 4TL9A 3D1JA 3DEAA 3LLUA 4FXPA 1L9KA 3QU2A 4A92A 5F78A 1E2NA 1FFDA 1GTL1 1I36A 4BWVA 1BH2A 2XUQA 1HQKA 1YDEA 4ZEMA 3MTQA 1JQ3A 3K92A 1DLJA 3UCFA 4QUJA 1JR2A 4GQBA 2YJ4A 1GILA 1Z4MA 3DPSA 4DDHA 5CXQA 2WD9A 2QMYA 2VAPA 3DZBA 1F2UB 4JSTA 4QSMA 1IJBA 3U60B 3FH0A 4D8YA 2BFBB 1M6YA 4DZTA 1BJRE 2GK7A 1J49A 1OGYA 2J33A 3KEFA 4ZHQB 1M2NA 2EGUA 5KNBD 3PZRA 2AOTA 5K3FB 1J9ZA 2B3DA 5I7OA 1S01A 2NACA 5JYDA 4IH4A 2HIGA 3AGQA 4DJAA 3OMXA 1SOUA 5G1NA 1H8HD 7AT1A 4IIXA 1UK8A 3B6IA 2IWHA 5BRAA 4E1AA 2E7ZA 2ZTUA 1GUBA 2QE7D 1YNOA 3H86A 3O7MA 4M9SA 5B7PA 2O7VA 1L4YA 4AX8A 3UHPA 4YALA 2D62A 1A9YA 4F5WA 3ROZA 5IDQA 3C4JA 3KWJA 1M1YA 2HLDA 4JMLA 3OM0A 3CSUA 5KWJA 3M7IA 3U39A 3TN7A 2D0DA 3FVRA 3C74A 4EB8A 3LL4A 2D2IA 1PSDA 2GZSA 1G5HA 5CDHA 2YNMD 3LYAA 1JLMA 1Y81A 5TEVA 5J4LA 3RUAA 4QT0A 5K3FA 1WZUA 1ZK3A 2ADMA 2JGDB 3BQ9A 4QIHA 3MCZA 1JJIA 5JAOA 1FP4A 2LCIA 1DQYA 4ZDJA 2P2LA 3PDHA 2PU5A 3KL4A 4G6ZA 2VYFA 3E5NA 3VU9B 1QP7A 4MQBA 1P73A 4QHTA 1VMAA 1F4PA 1KMNA 1T8TA 1H23A 2QAGA 2V6MA 1YRWA 3ZU6A 4KO3S 4F9TA 4LYDA 6REQA 1DAHA 5LMUB 3EPHA 2ZJ0A 4R2LA 1P1JA 5IBPA 3UAYA 1DFIA 1RRKA 2GESA 3E18A 4R2XA 3KJNA 1YVUA 3UV7A 2BHRA 3D5QA 1YUBA 3OTIA 5CPBA 4B3IA 1U2QA 5DT2A 4CBVA 5DHAA 1YAJA 1N3LA 3MJCA 5FKJA 4IOKA 3VMMA 2G28A 3DF7A 4A7PA 4E3WA 5KNDH 4RMJA 4C9BA 3ZY2A 2ZATA 1JPJA 4KOAA 1EE9A 1ZSVA 4GVXA 3T7SA 3ZDRA 4Z2AA 1GGJA 3Q3EA 1MOPA 3RDPA 4IWXA 1UC8A 2OV6A 1QYXA 3WKDA 3MOGA 4QBTA 4PEVA 5K3OA 4R7GA 4JSRA 4MQEB 2H1WA 1UKCA 4RVOA 4YRRA 4B87A 3K30A 3PR2B 2ZSBA 4OYHA 5J5VA 4AF8A 4CKBA 5KINB 3FMFA 4J2OA 2CWWA 3NONA 5F7OA 3JSAA 2JAQA 2F67A 4KSBA 4HAZA 1QIGA 4UOQA 2A1IA 4L8GA 1T1GA 2RAVA 3CB4A 5BSRA 1GFIA 1DUSA 1SVUA 2DR0A 1QS0B 3I28A 3P45A 3WK4A 3TYXA 3VDXA 5EHXA 4PZAA 1EAYA 4RF4A 2AFRA 3DXXA 1V5IA 1COZA 4DQ0A 3G2NA 2GN9A 4MW2A 4RK6A 3L06A 2CL5A 2IZZA 3RFVA 2Y6VA 1MENA 4M49A 4WZ6A 3AL0C 1UIMA 2IU3A 2X19A 3C8HA 5DWQA 3FUWA 1E0SA 4GP6A 3ZLUA 4E12A 4S04A 3RFFA 3ZK7A 1GRCA 4ZHSA 2OVFA 4NYIQ 1RRVA 5EE5B 3VPFA 1WDTA 4YX9A 1CK4A 5EWMA 2HQRA 4FYPA 2TMGA 3IRVA 3OZIA 5EYPB 3LT5A 2PKQP 3AB8A 3HXKA 1D03A 5HS6A 1R8JA 1T43A 3VPDA 5M3BA 2XDYA 5CDYA 2I6XA 4W7SA 1E94E 2PS1A 5K0ZA 4DR2B 4K1XA 3X1YA 2CDAA 1XX6A 4FZJA 4LBYA 4DANA 1XU4A 2C5FA 1NA5A 3JARA 4FFSA 1Z4PX 1CEXA 3HZZA 1HT1E 3M3HA 1OIWA 1S4MA 4G2TA 1G4UR 1VZ2A 1TQ2A 4ZOLA 3O91A 4R0NA 1G8KA 2GZRA 2QMEA 2NSDA 3HCFA 3QPDA 3QPAA 4B5LA 3WNVA 4MUHA 3DYIA 4UTOA 5KJEA 3V8QA 4KSYA 2CVPA 1QKIA 1UIRA 3OKFA 4NU0A 4BAZA 1EK2A 1H0KA 5BW6B 3TZLA 3JZMA 2WYHA 3OEYA 4LYYA 5JADA 3C97A 2IH4A 2V4MA 4DLAA 2ZE8A 4L76A 2F8LA 4MV6A 4L4UA 2VJAA 4YJHA 4TXLA 5DF1A 1Y48E 2CK3A 4DIFA 8OHMA 5DTIA 4H4DA 2GEBA 3SJUA 1EMDA 1BW9B 1ESNA 5FWYB 1PR5A 3H5WA 4LJLA 4M86A 1A5AB 1P9WA 3JARB 2IY7A 1NMSA 3LCUA 4JT8A 2BV3A 3EDRA 4O4JF 4OJQA 2EEZA 4AULA 2I66A 4FQ8A 2QUIA 1I7NA 2FMHA 4Y9TA 1J9GA 2EKBA 1PEKE 3QBEA 5I9SA 2Q46A 2C2BA 1CR4A 1W4BA 4N76A 2W00A 3NC0C 4DKXA 2EDAA 2H1SA 2G5GX 4H7FA 3PL1A 4WT7A 1WX1A 1C7RA 2WVJA 1Z2DA 3KEMA 4JLVA 1O8BA 1B0PA 1EGVB 1PJZA 2WJIA 2KBEA 4UFPA 4MH0R 5FBKA 2O2YA 2VSXA 2HTEA 2YINC 1R2QA 2G63A 2XOXA 3FXAA 4FDMA 1G20A 4K03A 2CJFA 3CEJA 1H2EA 1W4AA 2OD2A 2OGSA 1GAJA 1OC2A 5FLXA 4IDEA 1O57A 4DVJA 1D7AA 4E21A 1ZNXA 3CZAA 3GD7A 4MPRA 1XDZA 2PMCA 3N0VA 2NUTB 2YX1A 3UK2A 3W06A 3PI6A 4WBXC 2ST1A 2EV9A 3RBVA 3SHOA 4E51A 4AMZA 2EP7A 3IAM1 5L95A 3IUBA 4H4EA 4B9AA 4HAWA 4R0MA 3GH3A 4TS4A 4YRIA 4XI9A 3UAOA 4URYR 3BKXA 4HH1A 1IXRC 1KMHB 2PY6A 3UY4A 1YZGA 2IUTA 3EEQA 3JWPA 4IDPA 5F2OA 2CVZA 4U2CA 1GUYA 1OWPA 3JQBC 3WYBA 1V48A 4ZEVA 5AVYA 1X8XA 3BFPA 5I7UA 1YMUA 1GNRA 4XXHA 1ZR4A 1SK9A 1L5KA 1E1QA 5ALMA 1UXKA 2BGNA 3I9OA 4P34A 3UT5A 4AMUA 3AHCA 1O9HA 3CF4A 3H18A 1SXPA 3RLIA 1NUSA 1PR3A 2C5EA 2E49A 2G9RA 2RK4A 4FZ5A 4U39A 1ONSA 2VYVD 2YC2C 4ZV7A 4E08A 2GTIA 3EVAA 3NAQA 3ZGLA 2PBLA 1Y4ZA 2XVAA 2EXXA 2Q3DA 2Z43A 3IULA 4TS1A 1GPNA 3MILA 3HYNA 2GUWA 1LU9A 2C2WA 4PQRA 4RQBA 4ZEWA 4C6RA 2AZDA 2KMLA 5HTKA 3G6WA 3P20A 1ZUWA 3C5VA 3E7FA 4PFJA 4U2GA 2GHRA 2Q1YA 4FBMA 1L0BA 1AO3A 3FJYA 4CMGA 3LUAA 3IIEA 3TQTA 3U1TA 3VOSA 1A97A 1U2EA 2IIBA 5KQPA 5ELXA 3R7DA 3JAKB 3CLSD 3N1UA 4QEDA 3A4YA 4X20B 5LSAA 1HL3A 5JW6A 3LTEA 4L07A 4EUEA 4I1UA 4KR7A 4X54A 5CDFE 1J8DA 4F72A 3B2QA 3CPEA 4Z51A 3EXEA 4R7ZA 1IY1A 1JFFA 1H4VB 1WKVA 2W83A 3R0VA 5EWMB 1IY8A 3OEHA 3TJZA 3LBFA 4BU0A 1RZVA 1XKTA 1GGHA 1TZCA 2IELA 4FWBA 2PSJA 1L7PA 4KQEA 4Q47A 2PUTA 4XDGA 3IUJA 4Z7QB 1CUCA 2O4UX 3V2IA 5JSYA 1LSSA 3WGNA 4JP1A 2CCGA 3DBRB 4U3JB 5SZKB 1L8QA 4E32A 1UBUS 1XTUA 2JGEA 3HVUA 4LNAA 2PT6A 4RDIA 3VZPA 2PSHA 1GTG1 5L3QA 1T2AA 1F9AA 1L8XA 1NZFA 2BRUA 1PFUA 2RCNA 1E9AA 3KBBA 4HYTA 4LZJA 1MOZA 4O0MA 1ESEA 1ZFNA 2G5PA 2X0FA 3V80A 5FDFA 4QQRA 2O0LA 3MYYA 3QHAA 4KLAA 1FP6A 2QSJA 2PMFA 5E4FA 3V4OA 1GWNA 3W05A 4CGYA 5JSQA 4BB9A 5K4HA 5F51A 2J48A 1GZ3A 1OXUA 1PN3A 2QLTA 2VJBA 3BORA 3M4XA 2C2YA 3H2IA 2ORIA 1Y6QA 5CT9A 2GAJA 4FJ1A 5ICGA 1ZPDA 2R97A 3U56A 3V8EA 4J1SA 3AB3A 3OETA 2DZDA 3LV8A 5IARA 5T4HA 2AEJA 2ZBGA 3T52A 4RF3A 2AN1A 5ECWA 4P4LA 3OCYA 3SIXA 5GIPE 3PHCA 3PLRA 4KGZA 3BDAA 1G21B 2WBLC 1XE3A 4PW0A 1KDYA 5LM3A 4RVUA 3E23A 1PV2A 2QPLA 4OEHA 1XQXA 2ZIUB 2O50A 3L41A 2MYNA 3UWOA 1I33A 3H8JA 3CH5A 1HXHA 3MRTA 2FX2A 2R44A 5LXTF 1U11A 3UIEA 2J30A 4M0DA 4BY9E 4F06A 4LPKA 3JQFA 4FJ2A 1OIVA 4BJ3A 2AD1A 2OXIA 3TQCA 1A8PA 2JIZA 4X84A 1C9YA 3WBFA 1U3DA 1ONNA 4FYHA 1UR5A 2BZ1A 1IUKA 2DQSA 1M2KA 2V7WA 2BCGY 4FBGA 4LDRA 4URZR 4KR9A 10MHA 3CF6R 4JLJA 2I3BA 3QLUA 4UUPA 3UPUA 4OGKA 1GZSA 1JG7A 1G5RA 3VH1A 4KPYA 1EFKA 3GOQA 4H1TA 2GPWA 5F35A 4E13A 4YRZA 3ZJTA 3M5WA 3MTIA 4GL4A 4DR6B 2AVDA 4YCAA 3DMRA 5D85A 4CCSA 3CUKA 3PQ4A 2QROA 4IS3A 1X0XA 3WGQA 2J6BA 2XQJA 1YB1A 1I2AA 3AF0A 5FIUA 3RK1A 2O14A 4CQLA 2X42A 2GXAA 3IVXA 1QWSA 4HG2A 2WKSA 4DR5B 3TTVA 1W581 3K09A 4G0MA 1PE0A 1X1CA 5C81A 3FDIA 5TDHA 3CS3A 4PZZA 1ZIXA 1B00A 4R9NA 3OPYI 1NX6A 1L4KA 1PL8A 1V0JA 4JFRA 1PJCA 3DQQA 3O4FA 4MINA 4P33A 3LCJA 2O8FA 4LJSA 1E4VA 4E7PA 2F3UA 1K86A 2G9VA 4HLUC 3GVPA 1OFVA 4UUOA 4X85A 3V4ZA 2UYHA 3DLAA 2D2XA 2IEZA 5AJYA 4DR7B 2HRRA 3GNQA 3WFIA 1N2BA 3UJ6A 2ZS8A 4QM6A 1JMYA 1DCKA 4F8JA 2R2AA 3WZ2A 2WNHA 1NUQA 4ZT3A 3QBDA 4NV1A 3T8YA 1N2CA 3B85A 2VN8A 1VBFA 3LXMA 4B4DA 1KAGA 1A76A 3PDIA 2C2MA 4ONEA 2V9ZA 3WRVA 1TM3E 4Y1RB 2VAWA 4FGKA 2QEQA 4IJ5A 1KTIA 4B3BA 4LTNA 5EHGA 3TR0A 1G38A 1DBRA 3E0QA 4TTPA 3DHWC 4D43A 3ZXYA 1G5QA 2VYCA 5DNCA 4URVR 4X1YB 2AR9A 3B5IA 1SCUB 3QWHA 5AVZA 4BN4A 5KS2A 4HQLA 3SR4A 4CT4B 5I9IA 1EUQA 3KOMA 1G5FA 1JHPA 1Q14A 1JVBA 3PLNA 4HI0E 4KIWA 5DSZA 3OFVA 4HWTA 4MRNA 1ISSA 4J4BA 2IS1A 1V8FA 1RFLA 2EJWA 1OVMA 3FYHA 5B58T 4EGSA 2ZRHA 2Z6AA 4YJDA 3UTDA 5A62A 2Z2KA 3Q0IA 2BKUA 3WVNA 4AJ2A 4B3JA 3KKQA 4R1OA 1UMCB 3H1FA 4HH0A 3ZDEA 2QUZA 5F5NA 4EHIA 4B2YA 1LV7A 3FVQA 2FG5A 4B7AA 4KQ1A 4X9XA 3NTLA 5JWOA 3X1JA 1YL6A 3E9RA 2JIMA 2HGZA 1JPUA 3I4FA 4MUBA 2QNRA 3CUSA 1CIPA 2RJOA 3THRA 1BXRA 1ISPA 3AKEA 3D7KA 1PVDA 3C16C 3PL5A 1U90A 1Z2AA 1WB4A 1S02A 2AT1A 2ZT8A 3ZK8A 1J0DA 5DGIA 4W9MC 1QU3A 2XB8A 4PTYA 4GX1A 2CGEA 5EP3A 5I51A 1DUIA 3K2QA 5FAXA 4K1LA 2WJJA 2X3FA 4YWHA 1V26A 1ZQ1A 1GNVA 4CQJA 4F9GA 4B47A 1DINA 5K6TA 2AKEA 3CH7A 3KSRA 1N3YA 3ESAA 3ZIAA 1V37A 2ZTSA 4Q9LA 5AK3A 5AT1A 3THOA 1Z13A 2ZYAA 2XNDA 2ZWAA 1V7ZA 2AKAB 4HQNA 4J6FA 4CDRA 4HB0A 1FBTA 4OQXA 5K5EA 3RU2A 2ZIAA 4R2JA 3DVRX 2ZJ5A 3B1VA 2DM6A 2H29A 3TKLA 2GHIA 3TLEA 4S1WA 1T4CA 1A04A 3PEVA 4ZGBA 2WV7A 1YZHA 2ZUSA 2O3RA 5E2IA 3QU7A 1GGKA 2D0PB 2YRXA 4GP9A 3DLHA 3CGGA 1VIYA 3RADC 1WP4A 3G89A 2Y92A 3GUCA 3MTAA 4LYAA 2Q21A 3WGZA 5K4GA 4NONA 5IASA 3JQPA 4BFYA 1KIMA 3HBAA 4XYEA 4IFEA 2FSPA 2ZVQX 2IA5A 2PVPA 4PXAA 3V7YA 4F6LA 1T5IA 2GLTA 2L2QA 5F3WB 3LDAA 1VLHA 4RY2A 2F43B 4G0OA 2R6R1 4IDHA 4QOJA 4AMVA 2QU7A 1SZJG 2R1VA 4FEAA 3WIUA 2GBGA 3QLTA 1Z82A 3CF2A 5C8YA 2P9HA 4BMVA 3DXZA 4C14A 1DOHA 2ZJ8A 3FZGA 2QXUA 4QYTA 1WWKA 1VKHA 1HRKA 4LOIA 4KPEC 4D8TA 1JSLA 4P38A 2W58A 4G1BA 2J0VA 4GGOA 2XDAA 1FTQA 5CNKA 1DC4A 4I2NA 5FP0A 5HM6A 5H80A 5HCIA 2R6DA 2PZ8A 3RS4A 3NGXA 3WL8A 5JT1A 2ZFUA 3QVVA 5CXSA 4HWGA 2VBFA 2QZJA 5JJ5A 1KQPA 2ROQA 1N7JA 2F90A 2DG2A 2VWQA 1A5SB 1YZNA 4PSCA 1RAAA 3K0CA 2WF6A 2A33A 3CM0A 4TYPA 4Y0VA 3SZUA 1VTKA 1KOFA 2R6CA 2VHCA 4M1QA 4OMUA 1SOWA 2XKJE 5H70A 1PK7A 3O8RA 4CU2A 1Q91A 2H06A 4QXAA 1JAIA 1V5FA 2H2AA 5THQA 3UT6A 3ABSB 1IHOA 2QJOA 2C9CA 2NSJA 3DC2A 4NNPA 3M6XA 4R5HA 5EXTA 1SUDA 2R6FA 4G0PA 5HUQA 3QJGA 1FJXA 2GT1A 2Y2VA 3OUUA 3W3AA 5GQSA 4BNIA 2Q5OA 2OFXA 3KJHA 4JA0A 3RYHA 4CQMB 1EEHA 2B3TA 2C2XA 2EIHA 2EKPA 2VK2A 1Z0AA 2IYUA 1RI5A 2DAPA 4O3FA 3WL3A 2YQ5A 2Z8ZA 2EWVA 3OJLA 4CV1A 1BOFA 5BXQC 4YRLA 5I7HA 1KEEB 1H05A 1AF7A 2LCFA 3I5UA 4GW3A 2HSEA 1GVNB 3N6RA 1TKBA 4G0UA 4GGMX 5EPEA 1UKZA 2PD4A 4GUDA 4YQYA 4ZCLA 1QFSA 3EIXA 1JTFA 2O8EA 1HEUA 4NAUA 4BB0A 1T1RA 4LK2A 4XPIA 4DC9A 3IAS6 3BIOA 4CHGA 3GV0A 1NFQA 1HT3A 1TM7E 2HDOA 5KBYA 3PDCA 3BMXA 4RTKA 3UC5A 4Z7OB 2WG2A 1EB9A 2V8BA 2G6BA 4HDCA 3J80A 1WS6A 4GNKA 4RF5A 2SCUA 1QCDA 4L78A 5E4TA 5BW5A 1KO8A 3RIGA 4JYAB 2FGKA 1TJ5A 3CG4A 2Q4OA 3FLMA 3TSAA 1OT3A 3D3KA 3MQFA 4G65A 5THKA 3VNQA 1N5OX 3L0SA 4U63A 5D5HA 2EHDA 3IALA 4J49A 2M1XA 4EHJA 4IGFA 3WIDA 4BUZA 1UZNA 4KQCA 4BAGA 4GMDA 2H4WA 2UXCB 2J32A 2VBIA 1NU8A 4HGRA 3GAMA 3ZR4B 4D6XA 3ADBA 3FIUA 1O94D 2XTNA 4MVJH 2QRZA 1CQZA 2TYSB 2OO3A 2XX3A 3IC5A 3ITDA 4I5FA 5AH0A 5AI6A 1Z62A 3GP8A 2LUOA 2BGKA 1CUSA 1V5WA 2VQFB 3DTVA 3Q3GE 4EY5A 1YS1X 3VGPA 1EINA 1EIWA 3SSAA 3O3OB 3T95A 4R4JA 5AUOB 1OXKB 2XZPA 2V5UA 1OTXA 2BI8A 2YYYA 3OUZA 1ZGAA 2V58A 4J0IA 2ZIXA 4C0AC 4CEHB 4RHFA 4WN9B 1L5OA 3RV4A 3R5TA 3ZCUA 3T3DA 5B4UA 1VG0B 2R7NA 2WM8A 1E2IA 2I7DA 3EG9B 3HDQA 5J4YA 3T6KA 4B0OA 5DX1A 5LLDA 1XP5A 1QHSA 4LMRA 1JSCA 4AJIA 4C6TA 3IMKA 4MR9A 3SZGA 3WS7A 3AIIA 1MF7A 1D2HA 2JGIA 2NOAA 3MXTA 3PXCX 4W7IA 3VNSA 3VR4A 4ALKA 3OECA 3ZNQA 1XZIA 3LNTA 4EJ6A 2HJHA 4IRMA 4PO9A 4XPIB 1J23A 2FK8A 1A4IA 2WA2A 3K70D 5JDIA 3OCVA 2IHTA 3A6FA 3CONA 3E81A 3GUYA 3P0EA 3PUWA 1CJMA 4C0QC 5KJ1A 1SK8A 4GOKA 3WQHA 1ZK2A 2PV7A 4L3WA 2NVUB 4HUQB 2QLBA 3DLCA 4F4UA 2P4SA 4YAUA 3NETA 3AR8A 1NXQA 2W6ID 3GT0A 3JQ6A 4H17A 4NOJA 4J0JA 2BY4A 5CMLA 1WBDA 2J5RA 2ZIZA 2O2EA 2YV1A 3CB2A 4L4SA 3U7FB 4NXMB 3BX1A 1CQXA 4RYDA 1A2BA 1R88A 2FKNA 2JIBA 2WV9A 2EHJA 3BRSA 2FA9A 4M0LA 4EA8A 1X7ZA 3QE3A 2BMWA 4NBNA 1K7YA 4YO8A 1EFUA 2Q5CA 1K2VN 1NJ1A 3PICA 4HNHA 4A0FA 2IHJA 3NBUA 1LTQA 2Z6UA 3OM8A 2IJGX 3HEAA 1KI8A 3DG9A 4GL2A 1K68A 2H0QA 2ACVA 3Q9NA 1SQSA 5H59A 5FNZA 1HOTA 1QGUB 4TLEA 2G9UA 4YJ3F 3RGGA 5AW4A 1ZIYA 3SXUA 1FYEA 3SIPA 2CL0X 2Q6LA 2NT3A 3DBLB 3R75A 2JGJA 5DHTA 3TGLA 4YDQA 1ZM7A 4OHUA 1KEEA 4IKOA 1L9XA 5IXYA 2JJMA 1F8YA 5DB4A 1PKXA 2XEXA 1C1HA 2N47A 4PG4A 5CVVA 3SEAA 4HH4A 2X6QA 4Q12A 4N54A 3M4NA 3PJEA 3EB9A 4Y6SA 4YRTA 3RTAA 2KBFA 4RD4A 4EPVA 4B80A 2YWBA 4Z4QA 2AHOA 2P91A 1CLEA 1EXWA 1YAHA 3KEQA 3OJXA 4W8OA 3VU8A 4DM7A 4IZOA 1DRVA 4RETA 2C0QA 2CBXA 4MUYA 4B76A 4J03A 4F9EA 4IXWA 1BXKA 1IH8A 3DLPX 3VO8A 1XAIA 1D09A 1O95D 1VJ1A 1WOYA 1KXZA 2IY9A 2QL5A 2BFAA 4IMJB 5DBFA 4FEGA 4MV3A 3U4MA 1JHDA 2XF8A 1L4FA 2VPTA 2RHLA 1ZW6A 1U04A 1O1YA 4HCJA 1P39A 3BHJA 3LKDA 4WZBB 3DC7A 3ZWNA 1DIBA 1GITA 1PBTA 1X7YB 2V0NA 3AFGA 3NWOA 1E62A 1FYXA 1XJWA 4AWXA 5FWNA 3REOA 1GHTA 1T9CA 2FJUA 2JCYA 3L92A 3RVJA 4EX6A 4XM1A 3PNKA 4LC0A 3VXKA 1D5CA 1NW9B 3Q7TA 1Z2NX 1C29B 3HB9A 4RMIA 4U6QA 2Q07A 1J22A 3LQ4A 3OO0A 4J3NA 4JBGA 3OAAD 2ZPAA 4A9AA 1QHHA 2XCTB 5FUYA 3B48A 1I4DD 4OGGA 2PZAA 3MRVA 3N8KA 4KPUB 1EFHA 5IANA 4GX2A 1J39A 3L6EA 1FVHA 3MT9A 1P7ZA 2VDUE 3VI4B 4A2QA 3HU2A 3M81A 1Q7CA 2FUG6 3LOQA 1H5UA 3BTUA 4Q1EA 1K4KA 1X7YA 1QRUA 1OTHA 4JZKA 1L6IA 5DW3A 3WJAA 3S55A 3HN6A 3PFHA 1OI2A 2GAFA 2PX3A 4JMPA 3GCZA 3OJ0A 4C0SA 4ENUA 4XVUA 4HQ0A 1GARA 1O94C 3AP2A 2W71A 4CV3A 1G3RA 1BCRA 1TVKA 2WU3A 3AI7A 5HG0A 3IT0A 4ZOLF 1EA7A 2GZAA 2O4CA 5BUQA 1M1ZA 4TVBA 2YUTA 2C83A 4BMZA 4EMSA 1GRVA 3X1KA 1I2DA 4U7HA 4PGHA 2R79A 3FTQA 1Y1RA 6AT1A 4MDEA 4KX3A 4LX0A 6NULA 3IHLA 4CKCA 5KTNA 3ROGA 2BC9A 2EZUA 3JD2A 4EITA 4C30A 4C7BA 2C5GA 2V74B 1YIOA 1W1WA 2JD1A 3GT3A 1USVA 4MNTA 3SLKA 1KFCB 1IE3A 1WXWA 2JDID 4C0HA 1RHQA 4YRGA 1DFGA 1SUSA 5HE8A 3T9FA 5CT8A 3AJEA 2IXFA 1CF9A 1B3BA 3WK9A 1FFSA 5MN6A 4EJSB 3I6BA 3NXKA 3ZQUA 5JSZB 1AKMA 1WD7A 4Z53A 3ESXA 3KTDA 3E7DA 3MUNA 1AGNA 3ER9A 4UNNA 1PT9A 1K8ZB 2HWUA 5IHXA 4BUJA 2JHAA 3ASUA 1QF9A 1J0AA 3CNHA 3KSZO 4TMTA 4UAJA 4C89A 1SN7A 2Z8XA 4MSUA 3RHZA 4G0QA 1P0PA 3I6QA 2IGTA 3NGMA 3P9YA 1YRBA 4IXNA 2O7RA 4RO0A 4WGFA 1E2JA 3DZ8A 4U0JA 3E03A 4B83A 1CWUA 3QBTA 3QXSA 3KHKA 4YAWA 1RSZA 3G3EA 4I9GA 4RK5A 2YJ3A 3CEHA 3UM9A 3UT0A 3PGKA 1EWTA 2A9VA 4DA7A 5JQGB 4M1TA 5TJ9A 2PSDA 2YIVX 2JA2A 1B23P 1PJQA 2GARA 2YYAA 1NFFA 3CWQA 1R5OA 3SR3A 3AKZA 1NPYA 1T4CB 4RKEA 4OAOA 3IOMA 5ILQA 5LYJA 3A70A 1L4UA 2AQIA 5AI9A 3TDNA 4BZWA 2EW8A 1E3EA 3GZTB 3RUCA 3AILA 4DNPA 4RPJA 5DM60 1O6FA 3JR7A 4HGYA 2NV2B 1TUBB 4ZYTA 1I6MA 2GFQA 1Z07A 3AF1A 3NUGA 4TWZA 1FNBA 2DB3A 2Q3FA 4JEUA 3M9LA 4XUCA 1NNLA 5SICE 2XRMA 3WGHA 3RHTA 2II6A 2IDZA 3HYCA 4C06A 1RM0A 1J7JA 4N82A 2VBCA 2QN3A 4GPBA 4CG1A 1UT8A 5KSZA 3KQUA 5DCUA 1D4OA 4CKBB 1BEZA 1FQJA 4NCJA 1C7IA 1KIFA 1YBAA 2P6PA 3F9RA 4IHJA 5KYKA 3TNLA 1Q83A 3M83A 4CU5A 1XTTA 1YR8A 1UPFA 4D3ZA 4PCUA 1M8FA 1XJ5A 1Q3KA 1TZBA 2DRIA 3TTWA 2J3DA 2QQ0A 4YLGA 4HWRA 3V8VA 5KJFA 1JR6A 1MX1A 2P2DA 3D6TB 3FVTA 3TEFA 3ZJYA 2GTHA 4AG3A 5BV2P 1E4OA 1KERA 1UBGA 5B1HA 1ISRA 4UJ3A 3TW4A 5L45A 3OFSA 1PUIA 4KMOA 5KVCA 1U0BB 3P0IA 1JSRA 4Q6BA 1Y3IA 4UHDA 5JANA 1SXJC 3KVRA 3QQPA 5K0FA 2CLDX 5GVRA 3VOTA 1F2UA 1U8CB 3ZQ4A 5KAPA 4D9CA 2XRFA 4PCLA 1PVVA 3KJFA 1KJWA 5JSKA 4CYMA 4FEEA 5AKYA 3QJ5A 1SWVA 1D3AA 1YZLA 3OOEA 1BEEA 2D1FA 2FZKA 1WB9A 1I1HA 1OY1A 5D5PA 3R6TA 4IGAA 4YHBA 5AP9A 5F12A 3R3WA 1Z68A 3JVEA 3HKDB 1BX3A 1FXUA 1G2QA 2JARA 4FWIB 2DPGA 4ER0A 5AIBA 3QBVA 3INTA 5A04A 3N5CA 4MVYA 3NFRA 1M76A 1YQUA 4WHMA 1PS8A 2RJ3A 4GWLA 2WUWE 4HK4A 2A9RA 5FUBA 3ZJ5A 1T4GA 1NLYA 4P5DA 3RS0A 4BGEA 3GCGA 1SBYA 3ZE2B 4EHFA 3QOWA 3FETA 2ZWOA 3SBOA 3BM5A 1DAMA 3TLGB 2HAEA 2UXDB 1O54A 4JROA 1NWCA 2PGXA 3CLRD 1KP9A 3N9IA 3LSTA 4UBLA 5JSFA 4URUR 1OX5A 1XEWX 2WFLB 5ICCA 5A2QA 1MJGM 3TRFA 2F48A 5CDUA 2BT4A 3QMVA 2AQ8A 4OQQA 5K7SA 1GCUA 4CKCB 2E85A 1V1RB 3ZBUA 1NXOA 2JGDA 3KOUA 4CTOA 1ZK4A 3IH5A 2I4IA 5C51B 5JAMA 3RYFB 1TA4A 5LA6F 4DJTA 3L6DA 4E22A 2HK8A 3HPQA 4QHSA 2ZZMA 5K99A 5IVDA 5L6MB 2P1DA 3V1UA 3AUSA 1ZGHA 4I9FA 4OHZA 5EMMA 4ITRC 4OA8A 1GOTA 1H9AA 1QHEA 3P7MA 4H3SA 3MMZA 2BFPA 2QTVA 4OLJA 4DWWA 5BNWA 1V9LA 3QYFA 3RC9A 1XCLA 2ZAYA 3WIOA 2JKZA 1ZJZA 4OQDA 1TEZA 4UQLA 1RM3A 1W5TA 2AMVA 3H5OA 1MZVA 1X70A 3AW9A 4MVJA 2H4XA 2EW1A 1KYVA 1XRQA 1DIAA 3C3DA 3H9EO 2IY8A 3DXFA 4JC4A 3FDZB 4Y2HA 3NHFA 1M1XB 1ZBQA 4HAYA 4F92B 1X0VA 4XE5A 3AV0B 3RTEA 4JI5B 1U02A 3E15A 3OZFA 1DT3A 3EPJA 3AUAA 3UW3A 1ML3A 4RJIA 3ZE0B 2H6EA 3QU9A 4ZAGA 1XPRA 4TWAA 3OX3A 4ZQIA 4WJLA 3NPAA 1P1CA 1NNEA 4CDGA 3SC3A 2CXQA 4GSKA 2J3EA 5DIFA 1EE2A 2MDTA 3K9BA 5GPBA 4PYIA 3TXYA 4AKGA 3T3PB 4KI0A 1VHDA 2B2CA 1XN4A 1OH5A 2XNJA 3LZ6A 5CX1B 4IQGA 1NWHA 1I7PA 3N8IA 2SHKA 5B2ZA 1PAUA 5IRCD 4MX8A 3LTNC 1Z2CA 1A8QA 3EVEA 1ORTA 2ZEJA 4MYSA 3QI7A 3WYDA 2VK8A 3ZYZA 2V3WA 1HSZA 4EB0A 4W5QA 1FIUA 3BSFA 3RVKA 1S6YA 1V3UA 2ESRA 2FLWA 2FVXA 2J9ZB 1PGOA 1UC5B 2QY6A 3CRW1 3LE8A 4L16A 3K31A 1A88A 1YNSA 3ODGA 3OC0A 1E0DA 4RZSA 3R8CA 4PWYA 5KWVA 3HGMA 1UJ6A 3VX4A 2WR8A 3LUGA 4S12A 2EFGA 3I4CA 2Y8EA 3PQFA 4TV8A 1D6MA 1PBNA 2EX0A 1NW4A 4NBRA 1SBHA 2VHXA 4TTTS 5SYNA 5HZGA 4QGHA 3THXA 5KX5B 2ZJFA 5SY4A 3IB6A 1ML4A 2ZXUA 2E21A 2RBEA 5EVJA 2ZJBA 3FUVA 4YN3A 2C1ZA 1BHQ1 2XMDA 2O57A 1COWD 2YMMA 5EJ6A 5JJBA 5A4IS 1TEVA 3WG9A 4OXIA 1YQTA 4W82A 2BEUB 3SXUB 3EBOA 3T7CA 3TVYA 4NG5A 3UC9A 3RWBA 4X6XA 4V39A 5BURA 3GLIE 1VE6A 2Z4RA 3ES9A 1UBJS 1FUIA 2HUPA 2QX7A 4LZLA 2CY0A 3UK7A 3N2GB 5HDQA 2IW3A 4R9SA 2C99A 3LYHA 4BMCA 4P1ZA 2IS6A 1LJ8A 3SZ3A 5C2JB 5TE9A 2ZULA 1JU9A 4Z0NA 4H2DA 1CRQA 3DDOA 4O29A 4KJZA 4QFDA 4BO7A 1NZJA 3RGWS 3A7EA 4GYJA 4XM0A 3ZCQA 3TBHA 4KQMA 4EX7A 3NYWA 4ETIA 3UGTA 3ZDFA 1RPJA 4NE9A 4B3FX 2WIDA 1RHUA 5FWYA 1Y3HA 4AJNA 2AFHE 2ZDHA 2VTBA 4JI2B 2QD5A 3NH6A 3GJ0A 3IKJA 1G6HA 4LSMA 5HCNA 1L5NA 1WPGA 1JSXA 3SYTA 5EJ8A 3CC8A 4N0MA 5F5XA 4DKJA 1FQOA 3L4BC 2A5LA 3BSYA 3DB1A 3I5MA 4Q21A 5E7IA 3TBFA 5YASA 2B21A 1HO3A 4F3NA 1GUDA 2Q1SA 2XTMA 3HI6A 4V2IA 4BLRA 5AVXA 1Z25A 2FN3A 1WUHS 2Y1EA 2YZKA 4JAVC 3K0HA 1XMOB 5E4JA 3MW8A 4C6TB 3V7NA 5JALA 5A7FA 2NV0A 1U2ZA 1PNVA 2FZ4A 5K0NA 3T3HA 4NQZA 3SSOA 1N6NA 1PJ8A 3AJRA 3FR8A 3K9LA 4JY7A 5FQOA 1RPTA 2QT1A 1QGYA 1QRRA 2XLCA 2Z9BA 3CHYA 4IMPA 3O2QB 3PPVA 5J59A 1B93A 3T3EA 3HFRA 1N32B 4XJTA 1GPLA 3RROA 2VJYA 4M7RA 5JH7A 1U7OA 1P5FA 1VCNA 1IN8A 1ZWLA 2H0RA 2W98A 3BZWA 2GXSA 3DE7X 3DDWA 3K32A 4FONA 5DVZA 2VXCA 5FORA 1KVTA 4YRJA 3AFOA 4HDOB 3DDHA 4HFMA 4AJKA 5FCDA 1R27A 2ORED 2O2CA 2AJLI 3JWJA 5HMLA 3WMFA 4X64B 1T5LA 5JDCA 3I4LA 3UWKA 3NTOA 5E2BA 5KOHB 1NVTA 2PWZA 2OG1A 1KDZA 1D2NA 2HI0A 1BQ3A 4BX8A 5LFAA 1F5SA 3MJ4A 1JILA 2OHFA 1DNPA 4UCXA 1E5LA 2XUGA 4R0VA 3FDZA 4H59A 3VAYA 3Q7SA 1QMGA 4KC0A 2VAVA 2RE8A 1JIXA 4G5RA 4N40A 1XZAA 4BDSA 4UNRA 4OHOA 5T4BA 4UOEA 1C3JA 3KTAB 1NP7A 2BBSA 1MZPA 3BB3A 1SCAA 5F76A 2O8DA 4CXMA 4DLXA 4NZNA 3VU1A 4F4DA 2O2JA 1O4VA 3RB8A 1CE8B 1J6UA 4TV8F 1QQTA 4TSFA 4U6NA 5ESXA 1JEJA 6ADHA 1TMGE 1ORIA 3Q5EA 2QV0A 4JXJA 1ZM4A 3GLKA 3OIGA 4WW0A 5JD4A 1JXOA 2C8JA 4N3CA 1X1DA 4ND1A 4MV4A 4UULA 4LCBA 1XZGA 5LBIA 1I94B 4Y2SA 1JG3A 1TX4B 2BCEA 2VEOA 4FYYA 4P31A 1OHHD 2OB2A 4ZYYA 1EX9A 2BFEA 4K9LA 4I50F 2X8JA 2WU1A 4O2AB 2IV7A 3SX2A 2RHTA 4ERXA 2BMDA 4IOLA 1NPDA 3ZD7A 1G41A 2GF9A 2ZYRA 3I76A 3G0GA 1C3OB 5CTAA 4AUMA 1IK4A 2G7MC 3EIUA 2DR3A 3L79A 3K5IA 4ND4A 2NZUG 1QVWA 4JHXA 4GKVA 4UU0A 4R8VA 4EY6A 4MV9A 4LMBA 5D8DA 5U4QA 5KKCA 2D1TA 3S5JA 4ND6A 4BP3A 2ZRDA 4R83A 3RJTA 1N5IA 1ZN2A 2Y1GA 4RWZA 1J2EA 3BIXA 2DWUA 3TEMA 4NBLA 4OI2A 1U7HA 4H4CA 4OIMA 1CLUA 2CLLB 2QRNA 2IV3A 4H3HB 4KIFA 3LWBA 1J9EA 1KSHA 2JDIA 2JGMA 3AYXB 4FHZA 2P1RA 3K0BA 1WNTA 4FWTA 2ZB8A 1DJMA 2VDJA 1SVWA 3T3OA 2QA5A 4C5CA 5B57C 1AXEA 2CUNA 4LRXA 1YOBA 1Z0JA 2RK6A 1MABA 2M2IA 1U3WA 3QUBA 1SOMA 1G8GA 1W0KA 1E2QA 4TMYA 5CK4A 4AJEA 2DQ4A 4FMCF 4R7TA 2O8BB 3ADDA 5KWIA 1TJ3A 3ETJA 1F1BA 1YFLA 3L4BA 3L6OO 3ORSA 4ARZB 3IDQA 1C9EA 5EOVA 2H0AA 3AVQA 2AR0A 4P9NA 4DLKA 2Z83A 2OAQ1 4M38A 5CB4B 1HK7A 5CG2A 2VF4X 4DDWA 4EJ0A 1RYMA 3Q7PA 3RG8A 3GAAA 4JI4B 3JQAA 3PFFA 3DEHA 2AE2A 4JOSA 4KXUA 1W35A 2Q7DA 4AP6A 4E0BA 1GV0A 2VH2A 1SULA 4HJXA 4R5MA 2HIHA 1K27A 3LPCA 4LC1A 3C8MA 4MS3A 5KHAA 4GLLA 4TPKA 4YJ3A 2YOHA 2BPOA 1IY0A 1KI2A 3OPVA 4OOEA 5DOZA 2N1BA 1HQCA 1VL0A 2K2QB 5BN3B 5LIRA 1NQOA 4WK4B 1FTGA 4DA0A 1IC6A 3QEKA 4NABA 2X0JA 1Y3BE 3H5LA 5JC8A 2EWMA 2YN0A 5F23A 1T4DA 2QVZX 3G23A 4BRWA 4WBNB 3CN9A 5BW8A 1UDCA 1XOIA 1GD1O 5KNDA 2NUPB 3MWLA 1O87A 4YT2A 2QM3A 4ANFA 1USUA 3A6GA 2I9KA 3A04A 2QNIA 1JU4A 1P2DA 4IGIA 3LCVB 2HU2A 1E1CB 3F5DA 3X1MA 4BTEA 4AU1A 1UBEA 2DT5A 2Z4SA 3M6MD 2CNKA 3AB7A 1RR6A 4HGQA 2H11A 4HWOA 5BN3A 1JDTA 2PUAA 1J2UA 4GLOA 1LDNA 3SG0A 4KRGA 2WAMA 1ADGA 3IXQA 3BOSA 4WRRA 2EF0A 2CDRA 4OHBA 1GUZA 1WJGA 2AQKA 4DV6B 3SAJA 1ZHOA 1DG1G 1Z29A 4BZQA 2OMEA 1KEKA 2X2FA 2HMAA 3NS7A 5JXJA 4LIPD 3OX1A 4IJQA 4K2AA 2W2QA 3FZQA 1ODJA 3D6AA 2QI9C 4K7JA 4PCAA 1O96B 4REOA 1MXHA 2NXNA 2IP1A 2QVYX 1RKVA 4MKZA 4RA9B 3MWKA 2OT3B 3QUAA 4B84A 1R74A 2A0YA 3K96A 2UUPA 3W2FA 1P61B 4Z4GA 3IUEA 1EFRA 1R6XA 3GFOA 5IJ9B 1QRSA 3S68A 3QUTA 1I24A 4CLXA 1XD9A 4U02A 2YBDA 5EIHA 4BXOA 2QR3A 6LDHA 3GJ3A 2HF8A 2POCA 2O2IA 2YIDA 1ZJ6A 3F9IA 3HU1A 1N8NA 2G0NA 2XOKD 1OBHA 2C9MA 1SBCA 3G9TA 1SCQA 2P79A 1K97A 1KQ3A 5ALTA 4ZT7A 1G8HA 3MGCA 5FHRA 4DREA 2VP2A 1ZA1A 2JBAB 2CHQA 3HVHA 1KE1A 3ZGOA 4A26A 1I3NA 2Q9UA 3ZCSA 2YRWA 3OPXA 5EMKA 1SXQA 3GRVA 2Z3WA 5J2UA 1QP8A 3GPDG 4E4YA 2FWNA 1IBRA 1RHKA 1E7SA 4Y2YA 1LA2A 3DD5A 4A16A 2EJVA 2WYVA 4OHFA 4R51A 1EWRA 1JJAA 2X9GA 4IW3B 4P35A 5FV7A 4F6CA 3RU7A 4XJSA 1KKMA 2E18A 3I37X 3TH5A 4ENWA 3CVOA 1E3DA 4D8XA 3IBSA 2EYQA 3B3GA 4R01A 3TINA 2IPAB 3GGDA 1ZM9A 5AW5A 3CR8A 5FO0A 1EG2A 1ZR2A 4RIIA 1FS5A 3LT2A 4QRDA 3ROFA 2O6LA 1TM4E 1TZ2A 1SKAA 3D43A 3NKLA 3T4UA 3AHJA 4X8HA 3WYGA 4DJ5X 2PUCA 2WKPA 4FZ3A 3RSQA 2EQAA 3BDVA 1LWOA 5L4LA 3I9NA 1RJGA 5JZMA 5DM4A 2ZU6A 3VYVA 2X5XA 3TE6A 4PAGA 2O8BA 1RWQA 1DAKA 3NCTA 2DHEA 4GD3Q 1JIJA 3BHNA 1IB6A 1MO6A 1YK1A 1ZOPA 2XHZA 2Y9PB 3RUHA 5EJAA 4KHZA 4RU1A 1H93A 1E9DA 3U9SA 4P3KA 1PUXA 4RPLA 4F1WA 4HRAA 5ALPA 4FNAA 4IDOA 3ZY6A 4D0SA 5AKEA 1QKKA 1BYUA 1UZUA 2P9JA 3FTCA 4PRZA 1HOXA 1T36A 2J3KA 2C2GA 2YFQA 3EVFA 4HQOA 4A6PA 4D80A 5BR1A 1G3QA 3BK7A 3JYPA 2HN9A 5CCBA 1N4DA 4QUDA 1ZD8A 2B4AA 3HM9A 1P0CA 3GMIA 2NQTA 4X1OA 5ED4A 1BN6A 1F2DA 4WA7A 3RIHA 3FNEA 3K8QA 2HA2A 5GM1A 2V59A 3U31A 3FCCA 4COKA 3MC1A 3BDIA 3TVDA 1GKIA 4POOA 1W88B 3VC7A 1O0CA 4F7WA 3OD1A 1E6KA 2NYRA 1UJ5A 2B4QA 2ZSFA 1P0IA 3JQBA 4DYHA 4CIDA 3CW2A 4Y2VA 4M7PA 1TJ4A 1H94A 5LLTA 3WTBA 2VJLA 3DOEA 4QG7A 2BFEB 1Z35A 1AK9A 1Q7BA 3M6IA 5JWRA 2HLDD 1SHLA 1YONA 2DPMA 2R1VB 3DZGA 4WOBA 4OHRA 3KKMA 3CZCA 5LA6B 2O23A 4ZTUB 1OAOC 1L1FA 2V1XA 4F4JA 1CXZA 5JS1A 2BMEA 1YBHA 1QK4A 1B8VA 2PZEA 4XCQA 4V2UA 4BLWA 5FI5A 1ZH0A 2REQA 2L17A 4BKQA 5E8JA 4BQNA 2GILA 1DEKA 1JDSA 4GZLA 3REGA 1W73A 2DFLA 3S1SA 1DUVG 3WLKX 3AI1A 2QIOA 1XJCA 1YB7A 3M4ZA 3LGSA 2JK0A 5ADWA 3CLUD 3DZCA 4XX0A 4HVTA 4KFTA 4EF6A 1FK8A 1IUNA 4LXIA 1Z56C 1G0NA 2F8SA 3C7TA 2GBPA 1QQ7A 3TAXA 3GT7A 4MKHA 3SZRA 3UKOA 3GVIA 2GJ4A 1Z38A 1Z4QA 3C43A 3HGTA 1U2SA 2JFXA 3D6VA 3OCZA 4MVJE 3T1NA 4E5NA 1KH2A 4ZYWA 1EWKA 3LCRA 2D59A 3M34A 1S9DA 2CC2A 3NNSA 4G5FA 1IQRA 3B6ZA 4RIEA 1G2OA 1MFZA 3WWCA 3N6XA 2QVLA 3TQHA 2CE2X 1JVNA 2IYSA 2IZOA 3KDAA 1RAFA 5D6NA 1VM6A 4QXOA 4HSGA 3T12A 1E9RA 1XFDA 2R8PA 4Z54A 4QDZA 2IOFA 5T67A 4GLJA 1IRXA 2VHYA 3R3SA 1IOVA 1E6CA 1WSBA 1P7YA 2F43A 1UAYA 3F7NA 4QBHA 1RP1A 1PGJA 3H19A 3R9XB 3OA0A 5A1JA 5T57A 3DBLA 3VVBA 3NYRA 3A6DA 1GCGA 2R11A 5IBCA 2J6CA 1RAEA 4Q3OA 2GD1O 2Z5GA 3ZBQA 5IJ0B 1CUZA 1YB4A 4POAA 3L01A 4AZ0A 1NTOA 5HGXA 3GGGA 4CL3A 1GTZA 1ABBA 4DLYA 3QKRA 4FDUA 2XA9A 4JT2A 4UZEA 2ZROA 2AJTA 5DNAA 4YA6A 1HEIA 4DFDA 4H1WA 4OHPA 1G20B 3DS8A 2O07A 4Q93A 2GEJA 1CB7A 2WAXA 3UJ8A 4YT4A 4JBXA 1UEIA 2GLUA 5C7IO 2BHTA 4XAQA 2BFCB 2REQB 3NV9A 4ZDIA 1NDQA 2I2CA 3OIUA 1W19A 4MA0A 3RRJA 1RVDA 1Y0BA 3V4LA 2BR3A 1QR2A 4G25A 3V7FA 1PJSA 4ZZIA 2BFDA 4RZ3A 1T0HB 3LGAA 1OZFA 2QAJA 3D6UA 2OQ2A 4GXRA 4IRXA 5BQFA 2HK6A 3QBJA 1SZPA 3UATA 3ROPA 4C7JA 4Z9BA 2VDWA 3AU8A 1Z7WA 2ERCA 3NDJA 4WVLA 4YAJA 4ZCRA 1CRPA 5H9VA 3G1UA 2GZ1A 5TS2A 4RYLA 1HE1C 2ATVA 2WFLA 3A1EA 5TQ0B 5C8XA 4IGEA 4J7UA 1U2DA 3VZQA 1CUWA 3FPLA 3PQ8A 4IH9A 4XDYA 5E9WA 3QUSA 3CZQA 4ARAA 3DTNA 4UAUA 2BH9A 3RC1A 4X1KB 2JANA 4H7HA 5L3ZA 2PH3A 1XTJA 3FRHA 3S1AB 5AVUA 3LZCA 4TXJA 4DDUA 3GP3A 2EGGA 4G84A 3VR3D 4A36A 2YJ6A 3TDMA 3SC4A 1QRDA 3ICCA 1UF9A 5JPDA 4O5AA 4RK4A 3KE8A 4G85A 4GWKA 4N39A 1OFHA 2FRVA 2H59A 4LNUA 2V7VA 4GR9A 4ZQHA 4DDKA 4G63A 4DZRA 1AKEA 4KLZA 4JX8A 4MGKR 3ZZ0A 3VJKA 2UZIR 4C01A 3QVMA 4MS4A 3MCUA 1MB0A 4KNYA 4V0LA 3D5TA 2V7EA 3U5TA 8ATCA 2NTNA 3EA5A 4QUKA 1XQ9A 2H4FA 1QIEA 3B1YA 3CSSA 4BQPA 4WFQA 2EGHA 4NULA 4DCPA 4LF9B 3K1AB 2QSYA 2O59A 2QX4A 1EIZA 1WF3A 2R8YA 4ZAWA 1XVUA 1JA1A 1P3DA 1S0UA 2H2DA 4CJXA 2OB1A 2H5EA 1A7JA 1GAEO 2ZBRA 4I5IA 3WP0A 3FY4A 2XUHA 4TT3A 2O1XA 3U17A 2HMTA 3JR3A 1MT3A 3M89A 3A6KA 3DW1X 3AOEC 2PBFA 5CEJA 4DJEC 5KOIA 3OX4A 3AVTA 3E2MA 4YEDA 3OTOB 4LZAA 4QU9A 2G82A 1M66A 5LD2C 1N3BA 1A9RA 4FP9A 3KC2A 2IIQA 1DDGA 2W0MA 1ISJA 4B8YA 3GP5A 2AVNA 1LSUA 3KM0A 4PGMA 4I1SA 3SP1A 4A91A 4R2MA 2QUKA 1JLSA 2BI7A 2MWMA 2QTHA 3HA5A 2IVZA 3OSUA 4RD0A 1ZJ4A 3HY6A 2X0EA 1YVDA 3ZCVA 4F4FA 1B2LA 1UAGA 3ZHXA 1DADA 2IHBA 2WUDA 4OQPA 2R3SA 4UW9A 4X90A 3PLAE 2ECFA 1G2PA 3EMBA 3B36A 4I36A 5HJ7A 2P2GA 4XWTA 2RB4A 2QJFA 3ANSA 1BX1A 3F74A 1T5SA 2BFFB 2DPYA 4S1TA 4BLVA 4RMNA 5ALRA 4OB7A 1LXCA 2PWYA 3OA2A 2K4MA 5HX7A 4V0SA 1MX3A 2OBMA 4KLNA 4EJSA 4DMGA 4GXQA 3DLBA 3M8KA 4DLRA 2R87A 1E4EA 4C2BA 2I65A 4BQQA 4BX9A 1PZNA 3K5HA 2O8VA 4O4LB 1KPHA 1NW8A 4NVRA 1FNSA 5HJ5A 2PRJA 4FFWA 4GKBA 1ZX1A 5KCZA 5IM4F 3IPYA 3L1HA 1NQXA 3PQEA 5TQVA 5CAEB 2BBWA 3MT0A 2JZOA 2LNDA 4LWPA 2OHGA 5DSXA 1QB7A 4EY3A 3CBGA 1JQAA 3V48A 5F2EA 4BFSA 4BPBA 4P0PB 1WG8A 3QE9Y 1V1RA 1U6KA 1AKQA 4H77A 3HBFA 5CLQA 4M0EA 1D2CA 4MUNA 1UUFA 2H5LA 3DVAB 1WCWA 2WHQA 3G82C 1SCNE 5GZ6A 3IKMB 3G85A 4BC1A 4DMKA 3F3SA 4TKMA 2AG8A 4YO7A 1U31A 3PQ6A 4I6GA 1TCAA 1KHTA 3ZG6A 1KQOA 5KSYA 3CF0A 1EFPB 1PW7A 5AI4A 2G7ZA 1OIXA 3TMKA 1O96A 3VHRA 2HSDA 4AZTA 2PS3A 2WA1A 5G02A 3EY9A 3ACCA 4NYMR 4CT5A 2WD7A 1Y7IA 4KSCA 3B9QA 3EIHA 5JWHA 4Q3DA 3DNFA 4C2AA 3C15C 3GB9A 3EZNA 3VV2A 3RRBA 4YMHA 1UDXA 3DA8A 2GO7A 5SV2A 1MAHA 4BLTA 1FVOA 3WLQA 1NYLA 3VSBA 3BGOS 1XYVA 4NZPA 3TW0A 3ZDZB 5BQOA 1DELA 1LGYA 5HXAA 1E3WB 1HR0B 3AERB 4HDRB 4OYYA 2RIPA 1GO2A 3D8HA 5AK0A 3IESA 1NV9A 4MUMA 3IILA 4I8DA 3TLAA 3OQ1A 1EB8A 1CW2B 3CX7A 1XRNA 3R74A 2Z09A 3P1JA 1X8LA 5SZIA 4ND5A 1GCAA 1C1XA 2CZCA 1BD3A 3V6MA 5JD5A 5CVUA 1CV2A 2ZI5A 2HA4A 3QHPA 3ND6A 5DHQA 3BS4A 4BNFA 4FFNA 2MMGA 4KDFA 4ACAA 1YF3A 1EGAA 1JFLA 1ZH8A 2EL9A 4G9EA 4LBVA 1KK2A 2A9OA 1BG6A 1G9SA 3KLBA 4K6MA 3M6LA 4KYUA 4NFLA 3NIBA 3JQGA 2XE4A 3VR2D 1Y1SA 2OOKA 3GJRA 4HH3C 2Z30A 1MW8X 3LP5A 1N2EA 4QVGA 4QWWA 2X40A 1G7RA 2X1LA 3GPCA 1JG4A 3ZU4A 3T1TA 3U7HB 2ENUA 2XGMA 4GOND 1CUHA 3BIWA 5M5BA 2ZYHA 4IFBA 1Y7PA 4F5ZA 3ID6C 1HDCA 1R5JA 3CSDA 3ED5A 5T7BA 1ZS9A 2A0WA 2ZWMA 3IEKA 3O3MB 3EEOA 4WNAB 2F9FA 4UDYX 3Q40A 2PX8A 4I50A 4N7MA 5F9HA 1SM4A 3C0KA 3LC0A 3GFSA 1E1RA 4UU7A 4WE3A 5C80A 3VKGA 2FUCA 1TUBA 1JALA 4B2IA 1PL6A 4L73A 1E1CA 4FM9A 5HMMA 2EKQA 3FCAA 3AM1A 1H9CA 3NRCA 3U4HA 4EPXA 2FUNB 4X63A 5GONB 4KW7A 1E6EA 5DLEA 4PX9A 1ZGCA 3PWTA 2G76A 1UMCA 3PGVA 4NDZA 4R1MA 2FCAA 4HTAA 3FCUB 4PAMA 3U7JA 4AKEA 5IHPA 4G26A 2ATXA 4ZIRB 1H2HA 5AICA 2XQKA 3VHLB 4BECA 4MRSA 1YACA 4L5JA 1ISFA 4Q02A 3UMCA 2G9ZA 1NXWA 3TM5A 4LRWA 4WSOA 3W3AH 1PJ2A 4ABYA 1JNYA 4ZKDA 2WHYA 4Z4FA 2O9JA 4PZ9A 2YQ4A 1AS0A 2FFRA 2H9IA 2WSIA 2M6RA 2OCLA 3E9MA 5KMGB 4AJHA 5BT8A 4LGYA 4UFNA 4WBSA 1FP2A 2B8NA 2GEVA 3C5EA 4FN4A 1RFGE 2H48A 2G5CA 2OCPA 3NC1C 1KS2A 3DLTA 2BAGA 5AHRA 4RS4A 3DWEX 2IOHA 4LJ8A 2W8BB 4KVGA 2CJXA 3QI2A 4I4TA 4TTVA 3H9GA 2E4VA 1TF2A 3RV3A 4DMHA 4KN5A 4IWNA 1REQA 4MUGA 4YK7A 3QPCA 1PT5A 2NU8B 2VJPA 1AQNA 1NBWB 1U6JA 2FMXA 3DCYA 2JBHA 3G0CA 5KQMA 2CLKB 2AJCA 1NBME 2A9QA 3IV9A 4JU9A 1E6UA 1QH8A 2VF7A 4M6WB 3RHSA 3CVUA 4HMPA 3ANNA 2WMOB 3BGWA 4KE6A 2HLPA 2QX6A 4I55B 4WOPA 4W1QA 3I5YA 3U5ZB 1U0GA 3OZWA 4AO6A 2Z5VA 5HK8A 1JQDA 3QXXA 4U9HS 4DV5B 4PF1A 1IQUA 3OZSA 5H5JA 3E6AA 3SBXA 1ZK1A 2B98A 4C3UA 1XDUA 2RI6A 4BBAA 3BGIA 4K6HA 4MJXA 2PUJA 3RF6A 3TAHA 2P78A 5JMPA 1JIKA 3LIIA 1TU3A 3QOXA 5KTOA 2OFPA 1LK7A 1M2VB 4CGZA 3UK1A 1PW5A 1USWA 2GVDC 2WILA 3ESYA 3NUQA 3OZBA 4FYIA 2E82A 2VOEA 5AW7A 5CYOA 4YAGA 2LD4A 3PNOA 1TDJA 5I9NA 3EDCA 5K6RA 4X71A 3A1TA 2FAXA 3T06B 3QVKA 5B4TA 4MGYR 1W4RA 4CF6A 3SF8A 2YXBA 4BO2A 1K08A 4RTLA 1AMOA 4W9RA 2CFOA 3GNSA 4OM7A 3E35A 4JVNA 1M6EX 2Y0PA 5DW0A 1YQDA 3JATB 3HJGA 1RWWA 3H8VA 4IQ8A 4LZZA 4OGWA 1KIAA 3W5CA 5G0WA 3C7DB 2C92A 2FZWA 2OYCA 3C1UA 3AHFA 4XJVA 2AOXA 5BYBA 4GDFA 2XQVA 4GE3A 3GLFA 4QUGA 1SOVA 4WQMA 4E7OA 1OVGA 1LKZA 1P7PA 4M9XA 3VR4H 1H6DA 1VIDA 1LC0A 3QA9A 2JLRA 2EJUA 2ORYA 3HRKA 3C3EA 1GZ7A 3IAUA 3SYKA 3TS1A 4EFMA 4F71A 2OHHA 1INLA 3RHFA 5EXDA 3T7DA 4AY2A 1IOZA 3E5HA 4RCZA 3WLTA 5AFSA 2NT4A 3J81k 3VR6A 1K6IA 1X2BA 4REQA 1QTQA 1LZLA 4MICA 1DTEA 2OV2A 1KYQA 2NXCA 2UVPA 2V6JA 2XNSA 3K2EA 4NIMA 1EE1A 2ZI4A 2QDKA 4QAJA 1UBLS 4P80A 4PXSA 5HIAA 3IOYA 4YJKA 1RI1A 1DMSA 1SBZA 4KQ9A 2WDPA 4NJMB 1OB2A 3CZPA 3A11A 1NF8A 3V1MA 2HMVA 2A1TR 3I2HA 4NH0A 3B12A 5A6SB 1HLPA 1S8OA 3G0BA 4P4SA 2I6SA 2UAGA 1ZRMA 1IEVA 4EB6B 4CIXA 1X7WA 2OKGA 2IOFK 5KQLA 1T24A 3DKRA 3GFFA 3O1JC 4BTLA 2M9MA 3FYTA 3PWSA 4JYBA 3C1TA 2CKMA 4IVNA 2KJQA 3DOHA 3LF1A 4TLCA 4XR4A 1WB5A 2EFDB 4PYRA 2B99A 3E9QA 3QX7A 4LXHA 3DDNA 4ZI2A 3ME5A 1RE0A 3EGDA 4MGEA 4FINA 4DUYB 4LGCA 3QFFA 1VI5A 5BSMA 1VPDA 1G4HA 4KQJA 2FFBA 2G9NA 4J7CA 4YFVA 1EX6A 2ICAA 2RC5A 4A1OA 3IEMA 3O0DA 3UWSA 2YICA 4JUFA 1SC1A 2OCGA 1C0PA 4MXDA 4RFSB 1L5YA 4MAAA 4P4SB 5B30A 2V7XA 2QP3A 1S5PA 5ALQA 5E4YA 3B1KA 3ZD6A 4HEHA 4M4SA 3I2FA 2HIAA 3EXIB 3GUZA 3WYFA 1QK3A 3VPSA 2JFVA 1JHXA 3HPRA 3W3ZB 5JZBA 4MGHA 3UK6A 2YWRA 1P7WA 3CVVA 1LDYA 1GM5A 4X6YA 2IBMA 2FKAA 1B1AA 1QG6A 4Q66C 1R5NA 2OP0A 2XODA 1T6YA 3NKVA 3PC4A 4LOHA 2WSSA 1TD1A 4RVHA 4IAOA 1SELA 1P17A 5DO9A 4LZPA 5EE0A 2HPHA 1FRFS 3EGIA 5I3ZA 1OYOA 1EHCA 2LW7A 3A4NA 4CW7A 3CX4A 4X5OA 4WJZA 2VBGA 3U7QB 1XDBA 4J0QA 2VDNB 5EMJA 4IUCS 2IYTA 3GX1A 5JXHA 3PXAA 4R84A 3NCHA 4JBLA 5B3AA 3TDKA 3CLRC 4CZ2A 5KNLA 5K8CA 4YRDA 4MKRA 4HN2A 1H1LA 1YS6A 2LR0A 2ZDGA 2YXPX 2ZJAA 3MBOA 1U63A 2VHEA 1P9RA 4N9QA 2Y67A 2K87A 4W1PA 1QHHB 1OZGA 4AQ7A 4PLCA 4QPDA 1PCXA 1ORDA 3CNLA 2BEUA 4WY5A 3ZTWA 3HWX1 3T3NA 3HB5X 1ZRNA 1VYVA 3L7CA 4YMGA 1VCIA 1J56A 2XMPA 3W04A 2IUYA 1EP3B 3Q3JB 1UCFA 5PGMA 4A0HA 1U1IA 4KE7A 1H85A 1BFKA 2L69A 3H3JA 3WSTA 1JJBA 5K09A 3O3CA 4PG7A 2V1UA 1H8ED 2H31A 1C3XA 3A2NA 2VXBA 1I2ZA 1K5DA 4YP5A 3NHPA 4EGJA 3H9BA 2CDBA 5KTPA 1TNDA 4MAFA 1WXEA 2B69A 2HA5A 3B60A 4C05A 4D1YA 5AMXA 4DDVA 4WACA 5DNWA 1TMYA 4YREA 2YHUA 3JVVA 1NL3A 2VHUA 3O8NA 3VYWA 4RH1A 1JA9A 4J16C 4RFLA 2WPDD 3D3WA 4CE6A 4BNMA 1JI0A 5LWQA 2SNIE 1P9LA 4CUZA 3NBXX 4MVJG 1Y8CA 4YLYA 4HEJA 1LX6A 3GJXC 4ZD6A 1OAOA 1PHPA 2C7PA 1SKYB 1UDRA 1BWRA 1S8NA 2Q7XA 4FXOA 2ZYTX 2VOJA 2BJVA 2B8JA 2D0IA 2XQGA 4W9NA 1YIDA 2GS9A 2PZJA 3HR7A 3G6KA 3O03A 3RARA 3RS2A 4N48A 1XGKA 1X1EA 2AXQA 1BKSB 2NSLA 3DNPA 2E5FA 3OWHA 2JCVA 1XCMA 1LC3A 2BSXA 4L0DA 3RU9A 2JGLA 3EHDA 2NZYA 2Q3MA 3MAGA 2PQ6A 3ICQB 1NVXQ 4DPLA 3BVPA 1Q0QA 3BCSA 3WAGA 1FFXA 3FBGA 4IIBA 3GLSA 1AURA 1IOWA 3P9ZA 2IGBA 3G49A 5DXJA 3A2KA 4AI6A 4J4TA 1FB5A 1H2BA 1N8SA 3D6HA 1DJPA 4ZYXA 7YASA 4DBZA 2I78A 1F3LA 3LUPA 3QENA 5FPQA 3KDSE 5KWSA 2X9QA 3RODA 2MIIA 1RQXA 4G0XA 5JHGB 3NQ41 3L8GA 2IZ7A 2V6IA 3PEUA 2DERA 3EGCA 1Y7HA 3URMA 2R7KA 3HKCA 1ZL0A 3I12A 4EUKA 2AKYA 5AYVA 5HFNA 3VR4D 4NYMQ 4H35A 3WMRA 1HMYA 2VKTA 4D4GA 4KXXA 2HKIA 4U5XA 5ENDA 5AW6A 1FP4B 3D4PA 4L5IA 4EYSA 2GFIA 2Z2YA 3FGZA 1QQAA 1NXVA 2PGAA 4Q01A 3TRKA 1U81A 3MGKA 4HNGA 5T8KC 5KYUB 4AZ3B 1PG2A 2HTFA 3LD9A 3T41A 3T7KA 2QPAA 2NO4A 1ESZA 3UAXA 2ES4A 1W29A 4WNIA 3U0VA 4NJEA 4MPDA 3B8EA 3AGPA 4P84A 4UEQA 3WV4A 5HRAA 2ZE5A 2RAUA 3EY4A 4AB1A 2QG9A 3E8MA 4YMSA 3TLYA 3ZZTA 3DE6X 4D2IA 1OFTA 4X95A 1WXHA 2C4UA 3R7BA 3S1LA 3E05A 4S24A 4RNCA 5CBPB 4JXZA 3TTUA 2G17A 3Q3HA 2ZM6B 4P22A 3RTBA 2QU8A 3P27A 1BU8A 2AOWA 1Y63A 2HRDA 2OBXA 3GA0A 4IDBA 4XVCA 3VR6H 5KYUA 1SC3A 3CE9A 1RMTA 3ABQB 2G07A 1SCDA 5B6IA 4P3PA 4G1VA 4QO7A 4CL0A 3O8OB 1E64A