4G4SO

Structure of proteasome-pba1-pba2 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
249
structure length
200
Chain Sequence
LEVCPVPKVEFYSTAVITTKIMNPLFPKNLLQLTSIGEIKTTLFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Proteasome Pba1-Pba2 Complex: IMPLICATIONS FOR PROTEASOME ASSEMBLY, ACTIVATION, AND BIOLOGICAL FUNCTION.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/chaperone
molecule keywords Proteasome component C7-alpha
total genus 54
structure length 200
sequence length 249
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF10450 POC1 POC1 chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4sO01
4G4SO
chains in the Genus database with same CATH superfamily
4B3XA 1WNFA 4BQNA 4TPKA 4D1YA 4CMHA 3FNBA 4JB3A 3ZU4A 1V25A 5BWOA 3E48A 5F78A 4QT0A 2PO5A 1GPH1 2HUNA 2Y4OA 5DM60 4C88A 1U0OC 3P4XA 4PEVA 1EXNA 4FLFA 3IBFA 4ZIRA 1TUEA 4J76A 3GG9A 1GOTA 2E0IA 4IDCA 2BFWA 4O5AA 2H7XA 3P2KA 4L4YA 4PCVA 4ZJPA 1D4OA 1YK0A 3TZKA 3HFJA 1QZXA 3BD6A 4AZVA 1SZPA 2IEIA 4MTLA 1TYEB 4RPJA 2AEFA 4FE3A 3OZRA 5JZMA 2PUAA 1MQ9A 4YMVA 5CIQA 3TSZA 3DTNA 2VT6A 4FDUA 5ALIA 3SI7A 3IIEA 5CDGA 3BXFA 3RTDA 1QYWA 2HJVA 5BN3A 1QYXA 3E8SA 4L85A 1HV8A 2BP7A 4G5QA 1AKYA 1WRBA 5K6AC 3Q6MA 1EUCA 1U8AA 2W11A 1UJCA 2ERXA 2P9CA 2GTPA 3BS4A 4ZT2A 4KQCA 1XZKA 1SKUA 3HWSA 2LUOA 2HUPA 3SR0A 4R54A 3E70C 2JDID 3U4MA 3PR2B 3VDRA 1M2VB 1BOFA 2RKOA 4I2VA 2HJSA 3DWEX 3LGXA 3MMPA 3PFBA 2NUAB 4G0WA 1S01A 4PSCA 2WHPA 1ZJZA 1G7CA 2XLBA 2QBYB 2RB4A 2X9QA 1VE7A 5KUTA 3BRSA 5FA5A 1U0BB 4LSMA 3WY9A 3K71B 2FMIA 4MVJA 1TK2A 4WJZA 4PXSA 1T2NA 5FBWB 2CVHA 5ILQA 1FDWA 1RU3A 2QOEA 2DQZA 2F3SA 4X41A 5EFOA 3UGQA 4B2YA 3Q3VA 1CEEA 5AI6A 3R9WA 4C4OA 4LYEA 3RYIA 3KKNA 5D5HA 4YCDA 4D4JA 2ZYIA 1Q91A 4BVJA 1JG7A 4NV0A 3M4JA 1PS9A 2ZBGA 2NGRA 4JA0A 4K2HA 1YHNA 1MRZA 3I0MA 3T8YA 3N6RA 4V0LA 3NX4A 1EP9A 4M0EA 4OM8A 2ZJFA 2CD9A 1ML4A 4YMTA 2O05A 4LE1A 1A04A 3TOCA 2JIZA 4HUJA 4F3KA 3F4LA 4D9FA 2FJ0A 2Q0SA 4G0OA 3L6BA 1C9EA 2QORA 4Q3CA 4C5AA 3DQQA 2OV8A 3LRPA 3K96A 1CV2A 4UBKA 4XEUA 5BNFA 1VIDA 4EBFA 5T3UA 4BGUA 1Z0IA 1QWOA 4NZ9A 3FCXA 2DH5A 3EPKA 3GVHA 3QE2A 2NZUG 2O54A 3LY5A 3MILA 5EKDA 3DUFB 4GLJA 1Y6GA 4JOQA 3G5TA 3COZA 1EFPA 2XJ4A 5J4VA 4XTRA 3ABSB 3V46A 1YR3A 1GZ3A 2FPXA 1E9CA 4J4TA 4TKUA 2OQVA 3BIOA 2IW1A 4XOUA 1GTSA 1XLUA 1CFZA 2NIPA 1AF7A 1WB5A 3OZFA 4BP1A 2C4NA 3MFYA 5CB8A 2DGDA 1DFGA 1V47A 2C5AA 3MG9A 4L57A 1J33A 3I32A 1NTOA 3AI2A 3N2KA 4RSRA 1UUFA 3JAWB 4QDOA 4ZODA 3T0GA 2DWUA 1KY3A 1TMOA 4BTVA 3FCCA 1XC7A 2BEWA 4K0RA 2A9QA 2HTEA 4KIGA 4Q6BA 3BHMA 3QWFA 4PICA 3GA7A 1SUWA 3X2EA 1M2NA 1UXJA 1O77A 2ZITA 1RR6A 3PIRA 3ZZ1A 1L0BA 3JQBA 4NESA 1FMTA 4YTEA 1U5BA 2XBUA 3WQSB 5JUWA 4OOFA 5FWAA 3OLVA 1FXWA 1FQKA 2J3JA 4QL3A 3SS9X 1U2QA 1ZXBA 3AJ9A 1GNTA 1J8MF 5A3QA 1RMQA 3CGGA 1AHNA 3MVEA 2AX3A 4G4SO 4D8YA 3ZVRA 2J7KA 2W6MA 4EYOA 5KYXA 2RD2A 2JHGA 4KTTE 4Z5XA 2PE5A 1TU3A 4N0QA 1YRHA 2BGGA 2PSHA 1Z18A 1LC0A 5CLHA 1QH1A 4JI1B 1SCQA 7REQA 3R0XA 4D4IA 1W2HA 1V3TA 2WP0A 4FONA 2YYSA 1CNEA 1WDLA 2WSSD 1C8KA 2HSDA 4CN8A 3W2HA 2X8JB 1D2EA 2CW5A 2GZDA 2IF2A 2YQ4A 3KQPA 5EMMA 1E2IA 1KFCB 1LVUA 2F90A 3CEAA 1RI2A 2QKYA 4C03A 2YWXA 3Q3JB 3I3SR 4I1IA 2NU9B 3RAGA 4ZEWA 5LXTF 2JI6A 1JLLB 3TX6A 1F3OA 3LZ6A 4LCEA 1PWEA 3U4QB 3MWKA 3Q8XB 2PFKA 1Q0LA 2A1UB 2RJOA 3X43A 3MUEA 5E9WA 3LHFA 3FKJA 3S44A 5K0TA 2CL5A 2WIFA 4ZALA 3ZGZA 3NUQA 5IABA 4YP7A 5DPMA 1W73A 1OH8A 5CH8A 2CYCA 1NX9A 2UVPA 4C21A 1SXIA 1YASA 3E1GA 1Z4IA 3I45A 5ALHA 3ZCUA 3ESQA 4R8VA 1QRSA 2ZBEA 3U1TA 2QZ9A 1V8DA 2HMUA 3BFXA 3ORSA 4JJKA 4W9RA 3EXIA 3WDSA 4TLCA 2QM3A 3HCRA 3QRWA 3ABZA 3PDCA 2BHTA 3S7TA 4JLNA 5LQNA 4P36A 3C3EA 4CTKA 2PIDA 3GP5A 1BKSB 2FK8A 2G0AA 1Z28A 2K7ZA 2X2OA 3JZMA 4G84A 2PX5A 4V0NA 3S28A 1CDEA 1CTQA 1CLEA 1RRVA 3JVVA 3QIVA 4YXFA 3JQ7A 3BGVA 3BOSA 4YIHA 2EEZA 1XD8A 1CC1S 1WSWA 4DM3A 4UTNA 1CJCA 1DOAA 2N75A 4I6GA 3MYRA 4ALLA 3ECCA 4DIEA 3LVBA 2JBWA 1QVAA 1JXMA 1JU3A 2ODPA 3AU8A 3I9V1 4W8GA 4W7SA 1NVAA 3ZLVA 2EJBA 1IY8A 1RYNA 2BEWB 1KFJB 2X76A 2ZIUB 3Q85A 1ZH4A 4HOYA 4IXTA 4L51A 5LZ4A 4ZVTA 3W5HA 3KE9A 3ZXUB 1TW3A 4A2WA 2AN9A 5BNWA 5FOVA 4PC2A 1BDIA 1KXZA 4E94A 2ZVPX 3KVRA 1GGEA 3L7YA 2QZ4A 4GOLD 3HKBB 5L95A 4GI1A 3ROQA 3SQWA 1M0SA 4QQNA 2LTAA 3UHOA 2ZAGA 3QU7A 3SLGA 5DGIA 5JBIA 5BQOA 3FVVA 1EAMA 3AI1A 1ISJA 2B21A 3G0DA 3FJ1A 2WSBA 5DWDA 4ZCTA 4B87A 3K8OE 4GI7A 2Q1SA 4G67A 3GLIB 1KSGA 3IEXA 3EFHA 4RULA 2VVTA 2VNJA 4ZAVA 2GJAA 3ZV4A 2HSJA 3BULA 3G79A 4CMEA 4H08A 1QS0B 2Z3WA 4OL9A 3UA3A 2OG2A 3H05A 2YWRA 1OWPA 5L7TA 2WMNB 1KGSA 2XDQB 1FSFA 4LTDA 1UK6A 5E1MA 1QIKA 1YXMA 2EDAA 4TWZA 2BGLA 4UW9A 5FI1B 5KTKA 1DKLA 1JH9A 3M6MD 1DQRA 2R6FA 1JR3D 3H2JA 4IRMA 4JIMA 4HG2A 3OCWA 2C4HA 3SYLA 5FF9A 1E79A 1ZVVA 4YJHA 1XK7A 1MZPA 1PT6A 3L01A 4BGEA 1M76A 2IYRA 4GRAA 3H86A 4EA9A 1D2GA 1QMGA 5JNSA 1KJIA 1X42A 3RANA 5KJ6A 3WB9A 3OOHA 5FB3A 4IKOA 1Y80A 2HBYA 3QKUA 3U7QB 1ZP6A 1BIFA 2IZ6A 3IC5A 3DMHA 4J6EA 4TWRA 3HA2A 4I50B 1Z6YA 4LJRA 1FSZA 2UZIR 2H0RA 1QTNA 1SU7A 3BL8A 3DWIA 5DP1A 1PE0A 4D9JA 4LHWA 2W2TA 1TZBA 3WHIA 1P44A 1V3QE 1IN5A 1WO8A 3T61A 4HN2A 1DC8A 2X22A 3GLHE 2QTHA 4QREA 1NI4A 4MVJD 4Q19A 3U6BA 4FR2A 2Z56A 4C3UA 1VHWA 4FHDA 4HO1X 1G8HA 1XJQA 4I6EA 4OXRA 1K7EB 2VXBA 4J0GA 2FEKA 4K6OA 4XASA 1RYEA 5BURA 1YR8A 3L7DA 1WPRA 4QBKA 2ZI5A 3AEUA 2QSJA 3KJFA 1U0SY 2NX2A 3SZMA 1UH5A 4F3TA 1NUTA 1BHSA 2QA5A 2M6SA 3I64A 1M34A 4KYUA 1ZA1A 5CA1F 3PQ5A 1K3UB 1QS0A 2RMKA 1NVBA 2G0NA 1RCFA 1NBWB 2YOHA 1KY2A 2HDHA 3IEUA 3RSSA 3FLAA 4BWFB 1COWD 4CXMA 2Q6VA 4JX9A 2QZPA 3ZYCA 4FFMA 1A9SA 1HTWA 4L5BA 5KQRA 1SBNE 4BNJA 4OO3A 2XSZD 1N6OA 1T3GA 3L8YA 3RIMA 3UYLA 5DBGA 3NB0A 2EF0A 1EVJA 3NYWA 5A5EA 4IIFA 1W88B 3W1EA 3PSAA 5EWJB 1MZVA 2CXTA 1SCKA 2W6IA 3GUCA 1GQQA 1IB0A 1KJ8A 1ORDA 1PNOA 3NAGA 4RMIA 1UWKA 2L2QA 4CKEA 4ZFNA 5A4JA 4X1IB 3QXSA 4I4TB 4MQEB 3E2IA 1A4IA 3GQBB 4JJFA 3GEMA 1SXGA 1HE1C 5EG5A 1AXGA 2OBBA 2ZIAA 1RQLA 4AKGA 1UC5B 3HBJA 2EFDB 2VNAA 3IUSA 3QTTA 3CLRC 4LRTB 3OHMA 3KFLA 3WL6A 4A2CA 1KI9A 2JHFA 2ZJ8A 2C5FA 1M2EA 4X44A 3CLSD 4OXQA 1U2SA 2PVCA 5GGYA 3TLZA 1VZ2A 3RAJA 3U7RA 4UQLA 3DLPX 4N7JA 3R9XA 3SJAA 5EE5B 1TT5A 3UF0A 1PJZA 3OQHA 5EIXA 1P9LA 1YKFA 3SAJA 3SFVA 2DULA 2GASA 2G1PA 2ZSEA 2J6HA 4AMUA 2OFXA 4B48A 3NZEA 5JS7A 1IIRA 5EN4A 5CIYA 3D6TB 4IIVA 5EY5B 4D7AA 1S2DA 3FWHA 1GFWA 4E12A 2WZBA 1GSHA 2OM2A 3JD2A 5HFNA 1PJBA 2D13A 1FLAA 1R37A 2WQZA 4XM1A 3QQPA 3GLHA 1U9YA 2DHCA 3AY0A 3ZX4A 4FC7A 1KQFA 3AHHA 1RLMA 3JD0A 2QSZA 4X85A 3UT6A 4D43A 3R40A 2CFTA 3WYFA 3G17A 3NAMA 1A9XB 2VOEA 1G21B 2YQ5A 3S2EA 1V2HE 4BGDA 2OGZA 4FCVA 4ZVRA 1GZSA 3KUKA 3SIRA 4KR0A 3AEUB 4BMPB 2PUWA 1N5OX 3E9NA 3FYUA 4UEJA 2Z8XA 2O57A 2A1UA 5C5IA 5H9WA 2H4ZA 1P45A 1YJXA 5BYAA 1XTQA 4O1MA 3CVUA 5G1NA 2Z9CA 5JZSA 3JQDA 5JMOA 1ZC3A 5E2AA 1L4HA 2QD3A 3OE7A 5FADA 3ZDZB 3WGVA 5CFLA 4JEMA 3AKEA 1O96A 3DTVD 3DYIA 2ODTX 3KJXA 4IJQA 3S68A 4AJPA 5DK4A 2HT6A 3RTCA 4YX9A 5LA6F 2VDLB 1SHJA 1Z5UA 1C3OB 4OP3A 4KPGA 1V48A 3JQFC 1IUOA 5ALNA 2EBUA 5I7RA 2E5LB 3OBBA 1YJBA 4MVXA 4NQZA 1RVDA 2H08A 4UHEA 2I0FA 3FSJX 5JNWA 4GI2A 1XPOA 1IJFA 1RP1A 2X0EA 3WFJA 1W5SA 2Q6TA 2J45A 5EGNA 5LC1A 1OZAA 3PPIA 1S96A 1GYPA 2MYNA 4O6VA 5K3OA 4C01A 1J06A 1ECFA 4L5AA 3QKSB 4XCXA 2PBZA 4WNAB 2VJPA 3Q88A 5KPDA 3R8FA 1CPYA 3EF3A 4EPTA 5I8WA 3K1AA 3RIHA 2OCBA 4WEQA 4KC0A 3LKZA 2JS7A 3LL7A 4AX4A 3DZJA 5A3JA 1JNYA 2VDPB 3RU7A 2D5BA 3U9SA 5LQAA 3PXGA 3QLVC 2ZUTA 4CQNA 1JWBB 4YCSA 1V8OA 1OHHD 3HH8A 1R9JA 4A9AA 1FE8A 5B1IA 2Q5FA 2XXBA 4Y2UA 4E88A 3RS7A 2VBGA 1X7WA 1P75A 1N2BA 1VI2A 2VZLA 4L2IB 1VLJA 3AUSA 4ND4A 5FHRA 4EHIA 4HAWA 5A4FS 2AMVA 2FVYA 3E3MA 1R0BA 3H2HA 4AP5A 4E1BA 4R2MA 1BGWA 1JR3A 4QEDA 3L1HA 4HAIA 2OHOA 1MO6A 3I4LA 3IDFA 3LP8A 3OEYA 1WXWA 3HS3A 4HYYA 3DP7A 4LQ4A 3G2JA 1Z38A 1E4OA 3AX6A 2WKPA 2A5DA 5T5QA 4DLLA 2DH6A 2M1XA 4N03A 1GPAA 4O59O 1Q1AA 4ETWA 4WVFA 3M6AA 4EY5A 2J9XB 1JMYA 3P0RA 1QH0A 1TVMA 3W5VA 1D9ZA 1KIFA 2HW8A 3NP7A 2C5EA 1PFYA 1LPAB 2GA9A 2J46A 4BJHB 2OFPA 2HH9A 4JCOA 4LHZA 3TPCA 3C8DA 2J9RA 1M1YE 4JC8A 2Z0MA 1NJ5A 1QX3A 1KNQA 1EX6A 1TADA 3ZJYA 1P6XA 4I7EA 3FMFA 1XEWY 4UUBA 3D31A 5AK0A 3L4EA 4RD6A 1UFKA 5FWXA 3TZLA 2W70A 1AUVA 1ISGA 121PA 1QG2A 2BFDA 4FGWA 4MV1A 3IR7A 4PR0A 4AYXA 3DULA 1BCRA 1MCZA 3E4DA 1OH5A 3DT9A 5FYQA 1GL9B 2H9AA 4C6RA 1Q19A 3A6JA 2BI7A 1RI1A 3T7TA 5JAIA 4JB2A 2VNIA 1A72A 1KEKA 1BU5A 1MMFB 5JNRA 1WKCA 2D74A 1U2ZA 3Q72A 3MJEA 1SO8A 1BROA 2QX7A 3MJVA 2WWHA 3WRYC 4ALNA 5IF9A 2NPIA 3JWGA 2P7HA 2GZHA 2O48X 4X90A 3P71T 4B3IA 5FBVB 5FO1A 5HYVA 1MV5A 1QBKC 1XE3A 2FOIA 4FOLA 5HJ5A 1I6WA 3ZK8A 2XITA 1I7LA 1M33A 4EJ0A 4W5NA 1J1IA 1V16A 1IPEA 3GJ0A 5LCXA 2I1WA 4RMHA 3T9FA 2YWDA 2ZB2A 3IBSA 1X86B 4EGCB 2BTQB 2BUAA 2OVFA 3AESA 3LHIA 1N8KA 1NW3A 4HQRA 5G3YA 3ZCTA 1MOQA 3M1LA 5E9QA 4OU4A 3REQA 1AKTA 4I36A 3U3KA 5DWQA 5ITZB 3KYBA 3K70D 3FTEA 2X8JA 2XRFA 3HABA 1QHIA 1F1BA 2OCYC 2Y66A 3NEYA 2CXUA 1ZDMA 1OTXA 4JGGA 2GN6A 1FLDA 5DRTA 1CKEA 3F49S 3HMKA 4Y30A 3F6PA 5CX1A 4RLHA 4UTPA 3VDMA 4LRSB 5DHAA 1C3VA 4PG4A 3QVWA 5A4AA 5H4GA 3DEHA 4ZCLA 4HS9A 4Q3OA 4B80A 1J1ZA 1H1TA 3A7DA 3WK5A 5AM1A 1IN8A 1SOVA 3A10A 2ZM6B 4YB8A 1SR8A 3V7WA 5HIAA 2Y1FA 3VI4B 4TTJA 1NYLA 2JHCA 1A8QA 4EG4A 3NONA 5BSMA 3E7XA 3TXAA 3K5WA 2MJLA 4K9LA 1KVRA 3N2IA 3EGEA 1JHUA 3DBRA 2PAFA 4LJYA 3NTLA 4E46A 2E6UX 3OTIA 1U3WA 4R40A 4C5CA 4NDZA 4NJEA 4HS4A 5C81A 3OEWA 4CDNA 3RYHA 2OXRA 4AKTA 2QUIA 2GKOA 1UM9B 1YR7A 5CGQB 3W7VA 1I2ZA 1KHTA 1GZ4A 2NO9A 3VPSA 3D6FA 3CH4B 1SPXA 4E5PA 5D6NA 2C31A 3LXMA 4B8ZA 4EUSA 1CS0B 4KO3S 4NABA 4ZEVA 5F7XA 5J2UA 1Q3TA 3VSDA 1JU9A 2Z5FA 3T0FA 1RWXA 2C2XA 2WJIA 3Q5EA 3UT5B 4XI9A 1F2DA 2JHPA 2PH1A 3N8NA 3O26A 4EB6B 3TLGA 1RHJA 1JFFB 2GETA 2ISCA 4ED9A 2ZRCA 1WMAA 4G86A 1V4NA 5ALJA 3WLNA 1RQ2A 2AMFA 3M6FA 1QH9A 2LXNA 3VDNB 1PV1A 4F8JA 2GZ2A 1QUEA 5AHRA 4Q93A 2NO4A 5JXJA 1LWNA 5KWIA 3K8YA 3EG9A 2BELA 2IY8A 2JANA 2JCGA 3QHQA 4I0WB 4M1ZA 2ZSFA 3NHUA 5BN4B 3HO6A 3HJTA 4JOSA 1ODFA 4ZREA 3IJ5A 1NKVA 2A78A 2W22A 2QTCA 4J0EA 1YCHA 1PYDA 3QEMA 1L4EA 4HLQB 2YJGA 4L08A 3LWDA 2DMRA 3ZEIA 5C3MA 3JD4A 2O8DA 1T2AA 1D2MA 4MR8B 3MOGA 5F98A 4M1SA 3IDSA 5JI3E 1AKUA 3JQ8A 1HL7A 3HCAA 3NC0C 3FX2A 4E7PA 3IESA 2AN1A 1B41A 4D42A 4RA9A 4S24A 1A5BB 3OVMA 1EFRA 4JU8A 4TWIA 2BR5A 2J0VA 3WIOA 1P19A 2D5CA 2FN3A 1WVGA 2VJMA 4L9SA 4B9AA 1QUFA 4ESOA 3CYFA 1JR4A 3HWWA 2GERA 2HRZA 2ODEA 5CLIA 3I3OA 1KIAA 1XZJA 1T43A 4DABA 2WKQA 1UAAA 1QG6A 2FW6A 1X92A 5HF8A 4MUBA 3CVJA 2H1OA 4X7RA 4ZVUA 1QQ5A 2HNKA 3V2GA 1EHYA 5HOEA 2H85A 3GLVA 1M2VA 2PD3A 3KOOA 3KT8A 1M8KA 4PC3A 3DH0A 4WH0A 5FL7A 4ZZ2A 2GXUA 1E9EA 1VCHA 1W34A 3SG0A 4AZ3B 3TSCA 5LYJB 2IF0A 3PG5A 2CLOB 4O2AB 2RI6A 4G89A 5LWQA 1AMNA 3RJZA 1Z7YA 2RHLA 1UEIA 1YS7A 1U4OA 2O20A 3CX3A 4WADA 5ALYA 1I94B 1AK9A 3F9CA 1U0TA 1ZCJA 1B73A 2V6MA 4JQOA 1Z0JA 4MQMA 5DLEA 5UKDA 1F2TA 4MGYR 3TD9A 2ZTUA 3W3AD 5LA6A 1M2FA 2HIMA 2J4DA 1KPHA 5K4AA 4Y3UA 5SICE 4YJDA 2P9EA 3AO0B 1I33A 2G4VA 2HPZA 3FPJA 1V43A 2ZU6A 4PNHA 5H59A 4Q02A 4N0DA 3URMA 5JHGB 2IBSA 1M6YA 2HJ9A 2JGLA 2WT9A 2XH8A 3BERA 2JJQA 2GPNA 1XJ0A 2OXCA 2Y1OA 3K0CC 3MSXA 2PYDA 1NE2A 3M8KA 4QBTA 4YAEA 2BFFB 5HK8A 3SGLA 1HFEL 1PFGA 2FZLA 2YJ3A 3BF7A 3L7NA 5ALOA 1VKJA 5KI6A 5KNBA 3G2IA 4L3VA 1F48A 4HUQB 1RJDA 2GRAA 2C4VA 2Q27A 1FNNA 1K8QA 2CDRA 2P5YA 3N6XA 3Q4GA 2AKAB 4MAMA 5IM4A 3FOFC 1DZ3A 3O4FA 4XUGB 4YJ3F 4KEAA 4NSNA 4B73A 1T5DX 3ZLTA 3EG9B 3X0DA 4RPIA 3WQBA 3WB0A 1BHO1 1SIUA 2OYSA 4NCXA 4BFZA 1XSEA 2BFCB 3LOPA 3M33A 5B6IA 1K8YB 4Z51A 4ZYLA 4EUEA 1GTMA 1FYDA 3B3JA 1DAFA 2FSPA 1OXBB 2V59A 4TOIA 4Q9LA 1J99A 3DXXA 3WNQA 4AS3A 3CRQA 5JFGA 2YMPA 4DXHA 2BT4A 3KB8A 2C8LA 4UE2A 1KI6B 1BU8A 3DMYA 5F76A 1V35A 3DOIA 3R7NA 1U7OA 4XYGA 5C5DA 2EOAA 1Q17A 1UADA 4KMOA 2ZLBA 2H00A 2PX4A 3UAGA 4B7UA 4BNFA 4C0HA 4YRMA 3C8UA 4YRLA 2O0JA 2WD7A 1EDBA 4J0CA 3SKVA 3GP3A 3O94A 5D7BA 4AZ0A 2IELA 4UXHA 4EK9A 2XCRB 3ZLJA 1G8AA 1C0EA 4A8TA 3MTGA 3FKQA 4TV9B 1JLMA 1X3SA 1PTKA 4I4NA 3TOVA 2X58A 3K0KA 2PT9A 1VBMA 4V0ME 1T9BA 2GI4A 1IUKA 1BS1A 1FMJA 2GPYA 3OEHD 3H8SA 5HQJA 3FHJA 4XCQA 4R5MA 4CYMA 4KU4A 2FN4A 3NOQA 2ROQA 1AGYA 4MQ5A 4HNAA 4MIKA 2G7ZA 4AJ2A 3F73A 3QE9Y 1P2GA 3IP5A 4JJEA 3THOA 3QUQA 5KU1A 1G9TA 1XZDA 5BWLA 2AJTA 1NJ2A 3OTQA 4DIDA 2PUBA 2A1IA 2JF0A 5LB4A 3DLTA 3WGQA 1U28A 3PJEA 5IXSA 1ST3A 4INZA 2P2NA 2CDBA 4KI0A 4CEIA 4LMPA 5HKKA 4NULA 3PD7A 3GLSA 4P4SA 1CXZA 1OMOA 1XCJA 5IBPA 4G8DA 5SY4A 2XXAB 4Q9KA 2OMKA 4ZGBA 4PHTA 4D8WA 2I2DA 3Q41A 4F8YA 2IT1A 1T1GA 4RDIA 1WZUA 3EEFA 3OU6A 2O7RA 4OQEA 5CU7A 4ZQIA 2H07A 4CNBA 1MLDA 4WESA 1SH7A 2QIOA 3BEDA 1GZDA 4P1ZA 4UNRA 3EW9A 4US0R 4W9NA 5BW5A 2HPHA 4BAZA 1EU1A 1IBKB 4A6PA 4JXJA 5H16A 2XOEA 1RWWA 1IYZA 1W6UA 2IHYA 3L7AA 1YDGA 1I3KA 3PHLA 1Z4JA 3H2KA 2CHUA 4FMPA 4PGHA 4QLOA 5DXFA 1RWPA 1MG0A 3F7OA 3SM3A 3SSNA 3P4YA 4ZJZA 4DRXB 1LA2A 3D3EA 2VP5A 2C8KA 5JALA 3M4ZA 4Q47A 2YINC 2R1ZA 2IYTA 1SG0A 4AKSA 5K8UA 3VFDA 2VAPA 2WSSA 4IXDA 1UKAA 3M49A 4P4TA 1DX9A 1FW8A 1NW9B 1PV2A 2ZS7A 4GBGA 3PXBA 3UUGA 2PXAA 4G3XA 3WKCA 5GIOE 2JFUA 2WP8J 3LBFA 4OX9Y 7MHTA 4F46A 4MVJM 9GPBA 2J3QA 2Q3MA 3KEFA 3Q0TA 2RHJA 1GITA 3MT8A 1SCUB 3I8XA 1TIKA 1CERA 1LQTA 2NU6B 2VK1A 3WO0A 4ARZB 4DJ5X 4GL4A 3CUSA 4F7WA 1WP4A 4NNPA 3NHAA 2XYQA 3UJHA 3M4NA 1TZ2A 3SFTA 4G8JA 2ATEA 4LI0A 1CEQA 1J8YF 2QUJA 4LQDA 1IBRA 4MX8A 3QLTA 2J33A 3TN7A 2R6GA 5C8YF 3FMOB 1JL3A 4R1LA 5B1SA 1DE0A 5GV8A 3D81A 2Y9MB 1OZHA 1UOEA 2NXWA 4Q18A 2O7VA 5J2TA 4K7JA 4PNPA 4I55B 2NUBA 4TMWA 3M6LA 3NBQA 1XEWX 1F0KA 2IUYA 5LKRA 3NPAA 1E1NA 3W2GA 5B3JC 2R6JA 1FFEA 4Q4LA 4CM4A 4BRZA 2X19A 3EPLA 1E3MA 1YACA 1SU6A 2G67A 2NO6A 4IY1A 4LF4B 3KYCA 4KVAA 3SD7A 3WLFA 1J22A 1IM8A 3F4BA 3FLBA 1X7WB 3C6BA 3P2EA 2JRLA 4MEAA 4MVCA 3DVRX 2QU8A 3VUEA 3GRZA 4DEYA 2J5BA 3RC1A 4KPYA 1XLTA 2IDZA 1M9NA 1DG3A 2Y8EA 4CKXA 3ZX5A 4BO9A 2D4HA 3EOAI 1K6JA 1PBTA 3WLLA 1C8BA 5L7YA 9MHTA 2ZJAA 4AP6A 2CHQA 3TLMA 4BVGA 1I01A 1L7QA 1XPJA 3S2FA 4I9FA 2A9JA 1XQVA 2IXTA 4B8WA 1ZXXA 2AXQA 1C81A 3GW8A 2AEJA 2R9VA 3ZHRA 4QLBA 1P2FA 3DKKA 3TLAA 3ZI7A 3I6IA 4J90A 1N9ZA 4C07A 2FFHA 4W5HA 2PZAA 1G4HA 5K0LA 2YJTD 3VZPA 2QY9A 5BN1A 3N87A 1J2TA 2GM3A 3MWGA 1ND5A 1R0WA 4FX2A 1QFMA 4BQPA 4CKBA 3DZDA 2IGTA 1JSZA 1UWLA 2CMDA 2XVAA 2XYHA 3K1TA 3KSMA 4HRXA 2IHBA 4P54A 1EJ6A 1HDYA 2BBSA 5DTQA 5EINA 2I66A 2ZYWX 4MUHA 3LU1A 4ZAZA 3V48A 4DJFC 1FJXA 1DJLA 3QV2A 4DUPA 2H0QA 5IMSA 4PYOA 4X1KB 1MC5A 2OCPA 3GN1A 4UMFA 5CDSA 5CD9A 3OTWA 4EEXA 1ZCFA 4DSNA 2HK9A 1Y34E 2J30A 3IRUA 2JH8A 3MHPA 3OCVA 5B7GA 2C3PA 1DV2A 2ZJ0A 2PLNA 2OTCA 4XLTA 2D2XA 1BMDA 4XFKA 4GM4A 4EGAA 2VHVA 3DBLB 4DC9A 2PKQP 2O3JA 2C57A 5H70A 4NCJA 2P2YA 2ZTSA 1V37A 4JT9A 2WHYA 1LSJA 5BN4A 2DFTA 3ILVA 3JXEA 1FDRA 4TV9A 3RIEA 3WOVA 4Y0NA 1OR8A 2EZ9A 3BC1A 4DOMA 4FR0A 2ZXFA 4AF6A 4O4LF 4JSTA 1L4MA 1VJTA 1V3VA 2EKPA 3W34A 1XJ5A 4N4AA 3VV3A 2BI4A 3F78A 1QZ3A 2AZXA 4EJFA 4BC0A 1N2EA 3EOBI 2ZI7A 3JTMA 4EJSA 3ZXSA 1U8XX 2PL9A 2WTXA 3OCZA 3KPYA 1W19A 2AH5A 2OESA 4JODA 3KQWA 4QX6A 3WJAA 4C7BA 3ANXA 2A0UA 1L5GB 3G9TA 3HVKA 2Z2ZA 4JBLA 1Q92A 2PUEA 2AYZA 4DNFA 5KMGB 3O4VA 3IV7A 3MOIA 4BO6A 5T67A 1U7UA 2HHJA 1TKBA 5AJVB 4DS3A 2ZROA 3S5UA 5KCZA 4OI4A 5NULA 1RM5A 5AM4A 3RUDA 3WYBA 1RC0A 1Y63A 3B1ZA 1RYYA 3JQQA 3HLKA 4JJ6A 5DV9A 3VAAA 1UAYA 1JPNA 2VNSA 3H2BA 4HEJA 1RWNA 4G5SA 4Z1MD 2CLDX 3NV9A 4BZPA 5G40A 5JVDF 4O4JB 4RZIA 2Q3DA 2VDVE 2WJYA 5TMPA 3RIXA 3C3KA 3T35A 3AM5A 5G3ZA 1KYQA 1DTWA 1P4RA 2CN1A 4X6UA 1PEYA 2AQIA 4DKXA 1UMDB 4DV6B 3G0CA 1WCYA 4J2HA 3RUIA 3ZYZA 2CD7A 3R6WA 5IVPA 4S2UA 5JWHA 3CQ9A 1EFDN 1PK9A 4ZU3A 4Y2GA 4H3KB 4NENB 3A9CA 2BC9A 4I1SA 3ZI0A 1I3NA 2FX3A 3LFHA 1JHXA 3QVJA 4PO1A 4B5KA 4ZGWA 1E1CB 2ZIZA 2YWHA 2O50A 1JPUA 4HV4A 4OJMX 3FA2A 4HDQB 2NP6A 1UPCA 3O3MB 5DNUA 3IPLA 4G4IA 4DLXA 1TCUA 2I71A 3K35A 4U7HA 2X6TA 2FR1A 3RK1A 3X1JA 3MN1A 1DKPA 1NGSA 5HCUA 5HJ7A 3DNPA 1UL1X 1KI1A 2F3PA 2J3LA 4DMGA 4PN3A 2XNSA 4ZCRA 1C1XB 1A8UA 2VF2A 3A26A 3GEBA 3JAKB 4OLHA 5BRJA 4NEGA 1S4QA 1B76A 3QV1A 4UVHA 5T6MA 3OPYI 2SICE 1BXRB 4FILA 5DMHA 2I22A 4I50A 3TL6A 3UJDA 1KS9A 2QRQA 5FNZA 4YJGB 4R2KA 4ZVPA 1TI7A 1N4DA 3IAHA 1FVOA 3ZE0B 2EV9A 5A5FA 1R0KA 3S2UA 3C4VA 4TV8B 2PFSA 4N3CA 3RREA 2YJ6A 3I53A 5JCPA 4V0OA 3UYKA 4GKKB 4CM5A 3P9KA 1ZGGA 1CQXA 3IX7A 3NVMB 1G5HA 1QHHA 2G40A 5IZCA 3EGIA 1J0XO 3AG6A 3KHTA 5LDGA 1E9RA 4MEJA 1BH6A 4LX0A 421PA 1QGOA 2GXSA 1ZAYA 4WVLA 1MO5A 5LVAA 4PSUA 2FR0A 1Y4UA 1Z0SA 2B4YA 4Z4FA 5AMXA 3DLIA 3K92A 4GC5A 2BTEA 3UC9A 3ZIAD 5AUOB 2O7SA 3DDHA 1DMRA 3VDXA 2BGJA 4YCNA 1S3GA 4FFWA 1TD9A 3GGDA 2XB6A 4DAOA 5IMBA 4H27A 4CIXA 4XVUA 4MYRA 2XNJA 3PJGA 4IRUB 3W6PA 4CL3A 3BL5A 1G8JA 2DQ4A 3TTUA 4KYVA 3SDSA 4OCZA 4NFYA 4EW6A 1FB5A 4YT4A 3VSBA 1NSYA 3FKSA 4XJXA 4PGMA 3W2FA 4Z4HA 4PU0A 3V32A 2E6KA 3RNLA 1YFLA 4J0HA 1I8TA 3IB3A 2O6HA 2V45A 2FOXA 3QEOA 2PD4A 4IJVA 4D9MA 1QRTA 2YXPX 2J87A 4ZMRA 1CG6A 3M2PA 3GGPA 3OPYB 5I7HA 5KTMA 1IXKA 3U7GA 3E58A 3IELA 2HY7A 3PJFA 2Q41A 1EHCA 1U0FA 1NW6A 2GHQA 5MFZA 5IJZA 2W7TA 3LDFA 5CB4F 1ADBA 1FVHA 1F8XA 2GAFA 3TGPA 1HNWB 3EXFA 5A02A 3Q9NA 1Y6ZA 4NMWA 3NXKA 1JTEA 3PKZA 4JGIA 3WSWA 2G9VA 3DEAA 3LQFA 1UKCA 1FRFS 4GPD1 4H4DA 4BQEA 4FUTA 2G8NA 4EMTA 1XTVA 3E9ZA 5KTPA 3I28A 3R7AA 2OY0A 2XTMA 3S1AB 2BUBA 4IG9A 4L4XA 1O5OA 1O6BA 2CBGA 1YQQA 3L8GA 2O9JA 4EF5A 3JQFA 3I2JA 1EVLA 5CFOA 5ES4B 1M7BA 2IC5A 1CRPA 4JHXA 3VYUB 2I4NA 1NF2A 2UVPB 1DBRA 2WE7A 2WUDA 1U8ZA 3LKVA 4IOKA 1R4NA 5E8RA 5TPZD 4CQMA 4I1PA 2X0KA 3JWIA 1W1IA 1Y1QA 1C3EA 4TTAA 3ACCA 4IGKA 1RWOA 3WKEA 4CKZA 5ITZA 1Y8QB 4X84A 1YQ9A 2DLNA 2KS6A 1K4YA 2VJBA 3GRAA 3R3JA 1DEAA 2BR4A 1YTUA 1GG8A 1NJGA 2X8AA 1Z7WA 3QVUA 4KXFB 2AN4A 3VXKA 5DM70 5EPEA 2YNMD 5M5BA 5F77A 3G0BA 2I9KA 3RYCB 1K66A 2GZRA 4L78A 3AWDA 1MQAA 1ULBA 5AJXA 3HXMA 1VCIA 4YMWA 1EUCB 1L4UA 1W29A 1ZM3A 2JFHA 3L0PA 3LK7A 2QRMA 3RT9A 2YIMA 4CQMB 3RRMA 1D2CA 3D0QA 4ZARA 2XGOA 4OHXA 1KO4A 1NWHA 2IV2X 4E09A 1R9GA 1E98A 2W2LD 4NF2A 4ALIA 4FU0A 3IURA 2HMWA 3MT9A 2OP1A 4K26A 1QB8A 1YZGA 4LV6A 2N47A 3FBGA 4OK5A 3D6MA 2NSLA 2EAUA 3BMQB 4QARA 4EG5A 4ZYXA 1CJBA 1P0IA 2JKYA 3QJYA 5H80A 5M3BA 5B3LA 1EXVA 3OSZA 3M3HA 4BQRA 3OZTA 2ZJBA 4I5FA 1N6RA 4NCNA 2B8NA 4ZRMA 1I9CA 2W2NA 1JQ5A 4EZBA 4LZPA 3B85A 3ORQA 1JT2A 2XY4A 4UUOA 1A9QA 1BFKA 1PZMA 2GT1A 3AFGA 3ORYA 4MYCA 5DHRA 2BV3A 1E3QA 2IEAA 1ZOIA 5EHIA 4CR6A 4F84A 3D8BA 3AP2A 2ATVA 4QDUA 3VPBA 4Y6SA 3UJCA 1JIKA 1SD2A 4B6PA 3GA0A 4C05A 4YRZA 4N54A 4JLJA 1E2EA 4N3GA 2P90A 4DG8A 3L1VA 2ZCUA 2N1BA 3UJNA 2AFHE 3R23A 3PEEA 2GLXA 3N2KB 2J6IA 3OPYA 3T7JA 1OXKB 2P11A 4QULA 4X1IA 3ONNA 4FI3F 1Q1QA 1KWGA 1PSDA 1Z0UA 2J0QA 2ZTHA 1RAGA 2HFJA 3VYWA 3TEMA 2VUSA 1EZ1A 4JOBA 1GG2A 3QYAA 2ES4A 1E2BA 1TECE 5EHXA 1DRJA 1HPLA 3VX3A 2XZLA 4IW3B 4B3DA 3EIEA 5FLYA 3RRYA 4AMBA 3IIIA 1KFKB 3LMKA 3RDPA 3Q2KA 3KT3A 1VZ3A 1ZUNB 1R4MA 1JPJA 3EA0A 2QLJA 1CZOA 4UBJA 1XTUA 2WQ7A 1GARA 1WCIB 3RFVA 3W5JA 4IZIA 1MOPA 3WIEA 2CVPA 5ECGC 1DTSA 2P62A 3N5CA 1WUKS 1SUDA 2H16A 4D74A 1P0PA 3LH5A 5BUCA 1HWYA 1GEEA 2D1TA 1T9GR 1P5FA 3WGLA 4DADA 5JRDS 4OQPA 5D86A 1Q50A 5GONA 5BMOA 3DVLA 1AF4A 2C42A 5ALZA 5H9VA 4DMFA 4DB4A 1F4VA 1X2BA 3K0FA 4C87A 3EEQA 3FNFA 4EFLA 3HFGA 4CUKA 3GJ8A 3IERA 2POQX 3L3BA 1COZA 2JW5A 3EIFA 3VNRA 4DCTA 5IVDA 3VOTA 1X9HA 5CNMA 1LW6E 1XOIA 1GQFA 4PYQA 4FYVA 4IZHA 1P1JA 4MCJA 4O4JF 1KE1A 5CCEA 4X91A 4FBGA 4H7FA 1E7SA 1GRCA 3H2SA 1JHOA 1NQTA 2G07A 3RS0A 1J2RA 1Q1EA 1KSFX 4P5PA 5H7XA 5LPNA 2XMPA 4F5YA 1JKXA 4BNNA 5BR8B 3KBOA 4DR1B 3G9XA 3CR7A 1GU1A 2ATCA 3OLYA 4J0FA 4KGVA 4R2HA 1NOKA 3EFOB 1G5RA 1E6MA 1UOQA 4P7JA 1AKVA 2OEPA 1GFZA 3C5HA 4FMBB 3LP6A 1GCIA 2XDQA 1ISFA 3D6HA 4BLTA 2QX9A 1DEXA 1Z4NA 3PFFA 4WFQA 3T4UA 1XRSB 4Z54A 3W5AA 2JLVA 3BCRA 2C3MA 3AB3A 1W8DA 1UINA 1YQTA 4ZCMA 2MOKA 3A58B 3R9KA 4L6AA 4BNVA 4CTJA 3OTHA 3ICWA 1CZRA 1NOJA 2CUTA 1CUVA 3BCHA 3A4NA 2Z1NA 5E6SB 2PTHA 1H6BA 2FWIA 4CN9A 2OP0A 2FXVA 2HK7A 4RD4A 5CITA 1ZBQA 5DM1A 4UUNA 3VVMA 4D81A 3LI2A 2OSVA 5JQGB 4ZDKA 3P9PA 1QCYA 4CM4B 3JX9A 5JSUA 3GFSA 4UDOA 3BIWA 2VHEA 5CVEA 1L1EA 5EUBA 3WBKA 1R9NA 3BJRA 1TPYA 4A0QA 5J1TB 3CBQA 1IMOA 2ZE7A 3HKBA 3AKCA 3ITEA 2WTUA 2H8GA 3EIOA 2HMVA 4OJTA 5JC8A 5CYGA 5TMBA 1U8YA 3CF0A 1RE1A 3A3OA 3U7IA 4B2IA 1MU0A 4D6YA 4BO4A 5T3YA 3E7FA 2JASA 2OLKA 4I1YA 2I29A 4RV4A 4Y1RB 3W5CA 1E61A 4XTCS 5FLXA 1O0BA 2WVHA 3CS3A 3C6XA 3SZOA 2VTDA 1GPUA 2GNOA 4G5OA 2J9YB 4TM7A 1SUIA 4Q9JA 2FH5B 5J43A 4PPQA 3BZBA 5AHWA 5TLSA 3K9NA 2C2HA 4LBYA 4A36A 1CR4A 1H85A 3LDGA 4CFSA 1GL3A 4JKOA 1AQYA 4DM7A 1IK6A 1TK3A 2IKQA 2FUKA 4R71A 5HP4A 1H23A 2IEBA 3C7AA 1Z3IX 3T54A 2H31A 3GMDA 4QYSA 3HSKA 3MUNA 1PVDA 4KRYA 4LNAA 1IZZA 1G6Q1 1HE3A 4POAA 2FZWA 1UBKS 4RD1A 5DLYA 3HPQA 5IM5A 2G04A 4WNIA 2JBHA 4OG2A 3A32A 4EMUA 1W87A 4EY8A 1KO5A 3PKIA 2PL5A 5IBCA 4GE3A 4OKSA 2CSUA 3ID6C 1YS2X 3D7MA 1I2DA 1VPTA 2XKKA 3TFQA 2XNHA 1PJCA 2YNMC 1V8FA 2QTMA 2R68A 5JADA 2JVIA 4OVKA 5E6UB 3H5TA 3I5YA 1B8UA 5L45A 1CUYA 3WGGA 2A0WA 4CQMD 2G0TA 2UZ1B 3LUGA 2P7IA 3M5CA 2O8BB 2I4MA 4LS3A 4IILA 1PGJA 2HA4A 4CGZA 1PTJA 2G7MC 3HBLA 4I1RA 3H5IA 4RK0A 4PRKA 2CFOA 5D2CA 3PLRA 3ZCSA 3PUHA 2CNWD 2DETA 2X0RA 2J09A 3Q0EA 4IL5A 4RGYA 1CR0A 2PR2A 3WC4A 5D84A 3LC2O 2NO5A 4NG4A 1AURA 1MUUA 4E6PA 2NYUA 1TPZA 2HMSA 1HT3A 3R7WA 1LZKA 3CCBA 2WKWA 3L6OO 4YJHB 3F2IA 4P38A 2H54A 4RD3A 1T13A 1KTIA 1T0IA 1V3UA 3KHUA 4YT8A 2O8CA 2PS9A 3O7MA 4PPFA 4XWGA 3IDOA 1L3BA 4ZTZB 1OXUA 4PWZA 1S3IA 1AY0A 3GHYA 5DM2A 2HQBA 3KEMA 3O1IC 4E1VA 3EASA 1EDOA 5HR5A 4PS0A 1Q14A 4HGPA 1B8PA 3X1XA 1POWA 1Y7TA 2ON6A 2FSSA 3HUUA 4K1LA 4MKGA 2R6CA 4HLUA 1FUKA 4Y9TA 1JJAA 3E2MA 1KETA 4BC1A 2ZB4A 3E4CA 4E6EA 5BRAA 1P4SA 1T9GS 1DIGA 2QLNA 1NULA 4RHUA 3WNZA 3CVYA 1H65A 1HURA 5CA0A 3TLCA 4DCJA 3CGWA 5TPWB 2H1FA 1U2GA 1E6LA 4E4TA 1DAIA 3IOMA 4XSVA 4ERXA 2Q6IA 2WWRA 2D6FA 2FWRA 3PZBA 3OQBA 1EE9A 5CRIA 5LP6C 3IXLA 3GT3A 1E1QD 1PG0A 4E08A 3DE7X 3FUWA 2JBAB 4QDTA 1DUIA 3CSSA 1KEEB 1JR3E 2FB9A 2P9TA 1GUFA 3F3SA 3NNDA 4ZT4A 2EP8A 2YCLA 1UKBA 2X6RA 4JVOA 3SLKA 1XZIA 3W5IA 5HS4A 1HRDA 3OICA 4KLAA 1BTOA 4YP5A 5KQPA 3F97A 3VR2A 1UBMS 3TNLA 2ZCJA 2G28A 2AQ8A 1SCUA 2YV2A 1XKLA 5LQUA 3OIWA 2CVFA 2HC9A 4B3HA 4QNMA 3UJ6A 4UBLA 1VKHA 4ADSG 4UJ3A 3A25A 5KNCA 4I2NA 3FPKA 1TXGA 5I01A 5IDXA 5JXWA 4ZQBA 1CY7A 1NNI1 4A10A 3RROA 1D6JA 3C3MA 2R4TA 5U1PA 4D98A 3UB3A 1WW3A 3E8MA 4YR9A 2XCUA 3NDJA 1Z9BA 2VR1A 4ZI2A 3L40A 2X0IA 5A7GA 4BJ3A 5ITVA 1BXRA 1VA4A 4PX2A 4EGQA 3TUZC 4L5JA 4LHXA 1YFJA 3L1UA 1MPTA 2FRVA 5KOHB 1UBCA 1X7XB 5LQCA 3AUUA 4RTKA 3HVIA 3TWOA 3U4QA 3O91A 1DJQA 2B94A 2C95A 4AJLA 4P92A 1G2QA 4URZR 4OQXA 4J0JA 4C7JA 4DYHA 2PGJA 1JIVA 3LDHA 1AIPA 4ACAA 5LYJA 3GRPA 2VWHA 2B83A 3ET4A 7ADHA 5A6VA 4R16A 3A9RA 5TF0A 3QOFA 3DPIA 4RFSB 1RRCA 4IJ6A 3EZYA 2AW3A 1ZL2A 2CYAA 4BO3A 1C0LA 4AJ1A 4C0KA 5EHGA 4AZTA 1E5DA 4O2BF 1JB9A 4IEIA 4B2PA 3TR6A 3IDAA 1C3XA 3ZGYA 2XGMA 3SX2A 5AVUA 2PH3A 1M7HA 2HQSA 2YOFA 1H3FA 3AIMA 5FUBA 1NIPA 5TQ2B 4E4RA 3A6FA 4NMMA 1K92A 3PQ6A 3ICOA 4L02A 2B1IA 2I2CA 3DCJA 2C03A 1CQJA 5HS6A 4HDCA 4JR0A 1X1RA 1U5BB 2PRIA 3DB2A 1JJVA 3V8EA 3REFA 2IEGA 4UZSA 4M36A 1V95A 2YBEA 1OZ0A 3ASZA 3B1VA 3PEFA 3PNBA 4G1EB 5WRFA 4E15A 5KQGA 1J9EA 3IMGA 2XYGA 1XI2A 2J7PA 2VSNA 5JI2E 5DSZA 2QWXA 1FLNA 1D04A 3PKJA 4N5DA 1FY2A 4Q4AB 2EX4A 4F6CA 1KK1A 1H6AA 2B3TA 4GX0A 4WACA 5ALQA 1XKTA 3DAPA 3NKFA 5D8DA 3WHPA 1STOA 5BN5A 2JFQA 4GX5A 5D6OA 2P2CA 3LE8A 1PJAA 1SCDA 1UEJA 2R8ZA 3ZDXB 2H06A 4LJ8A 4HSGA 3P52A 1NJFA 1XA4A 2PLWA 4IVQA 1W1WA 3WMEA 1QIFA 1L8QA 5KPJA 2PVSA 3G7UA 4FIDA 3NGXA 1O3YA 2PLAA 4IDBA 2RAVA 1OLSB 4QSMA 2FSGA 1M2OB 4WMLA 4BP8A 1JKMA 3U56A 5JANA 4J0KA 5MFPA 2GVNA 2VQFB 2NQ2C 5ECWA 1DQPA 3BKWA 1JA0A 1EBBA 1JHPA 1P18A 1WXEA 4LRUA 4Q4HB 4DEXA 2PN1A 3IVGA 4DJTA 3A4VA 5JWRA 3EN0A 3ZD6A 2JCVA 2J4CA 4KO1S 4BIIA 2XYPA 1DBIA 2VTEA 1JMVA 3GDWA 5JH7B 3QVKA 5J4KA 1NMZA 2Z95A 5T4EA 1MGOA 4IHAA 5B7NA 4EP1A 3FFAA 1KDTA 4FGSA 3WISA 3GB9A 5KSPA 4YN3A 1EB8A 1V7ZA 3G2KA 7GPBA 3S55A 3ESRA 4XD7A 4C0SA 3A37A 5LZ5A 2RK6A 2RAPA 7AT1A 5KTNA 1FRVA 3F74A 2R3SA 2O0HA 3K9BA 1SHUX 1E3SA 3OJ0A 4FCCA 3VZSA 2V7WA 1Q0ZA 1XZEA 4D44A 1F60A 2VAMA 3I05A 2BM1A 5L8VA 1P2BA 5CX1B 1MHPA 4UAVA 4YRJA 1MEJA 2PH5A 2UUOA 3QHAA 3WWYA 3FR8A 3CEHA 3EQ6A 1RKBA 3LQ4A 1GYQA 4IZOA 4LWZA 3GDGA 3RUAA 3A4YA 4YQFA 3TQQA 1T9KA 3HUDA 3ITNA 1XD9A 3W4KA 1YBAA 1VL6A 3PRHA 1QFJA 3AXSA 5IWAB 3IQHX 3BD7A 3ETGA 3AEKA 3NH9A 1LNSA 3AUKA 4HQOA 2VJDA 1MB0A 1OJ7A 3GGOA 4CV2A 3EIXA 4QGBA 1EK5A 5JAZA 2ANCA 5KOHA 4OPMA 3WNCA 1MC4A 4JV5B 4ZZIA 1VJRA 4H15A 1SVWA 4BEJA 1TM5E 1A76A 4X8LA 3UB4A 3HVUA 1LGYA 2PZ8A 3QPUA 1AX9A 5KJEA 2RGGA 4URVR 1KBZA 4R9UC 1CUXA 1NTRA 2F3UA 3QLUA 5HEKA 4CMAA 1VMKA 3EOZA 5CDTA 4NK5A 3T3MB 1W59A 3LT5A 3EUWA 1JKJA 4I81A 3WBFA 5IVHA 1H4SA 3T4EA 1CUAA 2PGNA 1N6IA 1Y1TA 1TU4A 4KE8A 2B2CA 3M1IA 2V9CA 5KWSA 1A5ZA 3AW9A 2GM9A 4Q9AA 4WA8A 4L7VA 5TY0A 2VHTA 2OGWA 2NSDA 2A67A 3H5WA 3FSRA 4HDAA 4PQYA 4RPGA 5CVJA 3WK8A 1WHTA 2R6HA 4PLWA 2ODQA 3PE3A 3GLKA 4PLHA 4E2XA 1QHSA 3TZ6A 4TKMA 1EA7A 4LF6B 4NONA 4N18A 4PQRA 3EVFA 3H9QA 1U1EA 4K28A 5EEGA 3THYA 4C29A 1SULA 2ZRQA 3EDCA 2OQIA 1VCNA 3MW8A 1KEEA 5KJ1A 2QT9A 3BBLA 3C1AA 1IMJA 3IOCA 3FMGA 3QVOA 3SE0A 3WXMA 4DT1A 1AQJA 4E1AA 2Y76A 2AOVA 4FJ0A 1XL0A 2PDAA 2I4LA 5IUJC 3GLGE 4Q7QA 1NPDA 1TZJA 2LIVA 4P22A 4KDRA 2RONA 3FAZA 4ZOEA 1G42A 4D3SA 2DOKA 2CCGA 1U6KA 4J1QA 2QTBA 4XE5A 4CIAA 5DYTA 3CE6A 4B3BA 4MITA 5BRNA 3N8HA 1PAUA 1VJDA 2GGSA 2VHZA 3JVEA 5BR1A 3E22B 3F47A 4RHCA 3IE1A 4Q1VA 1CUWA 1OAOA 1USKA 4PLYA 2B99A 3F67A 2G17A 3YASA 2AOXA 4M1OA 2YS7A 5KNDA 1NVWQ 5TPZA 1JDBC 3R3XA 2MYTA 4Y1RA 2QJTA 3IH5A 5CW2A 1LDNA 5DGDA 2Y67A 3VV2A 1TUBB 3R5KA 4UTRA 3SFZA 1LTKA 1O97D 1QB7A 3LECA 1EVEA 2NNWB 4MB0A 5D7NA 2Y68A 4KQ9A 4UXJA 3LW7A 4A92A 3BGDA 4GWGA 4PNEA 1GQ2A 2Q3BA 2GMWA 2P3QA 3II6X 1VC2A 3E9QA 5FORA 2W6JD 1UT8A 4B81A 1E60A 4IG4A 2HRRA 1KYVA 1SZDA 2V7EA 3AINA 2LPMA 4RW0A 3TXYA 6ABPA 4R7GA 3CUUA 3CF4G 2XTZA 2Q3FA 2FY8A 1P73A 4X3OA 2IU3A 2HSGA 3EDMA 3SMVA 3V4FA 3OWXA 1W8IA 1U98A 1IM5A 1HX7A 3DXYA 2JFZA 3CA8A 5JHHB 4DC0A 3NTRA 1OI3A 3VR3A 1B16A 2GRJA 5LZ8A 2QAGC 2BFEB 3SDBA 2AHRA 3RM3A 1SVMA 3DEKA 3BMOB 3NWEA 2JLZA 4DVJA 2JI8A 5DDIP 3C5VA 4OHVA 2QD4A 3DQZA 3NRBA 4RHYA 3T5TA 3VHRA 1QK3A 1YKSA 2J41A 5DI3B 1KMHB 4POOA 5B1EA 4KWEA 3RVQA 5M04A 1VE1A 1L1RA 4FYXA 2IPMA 3GJ5A 5JIBA 3ELBA 1ESZA 1GKUB 2AC4A 3NALA 1FNDA 1XCBA 4FJ2A 2ID9A 3K9LA 3GIWA 4HEA1 3WLSA 4C2UA 1KKUA 4X97A 1NBME 2VKTA 3D4NA 2WJVA 5ESDA 2H92A 3QNWA 4O63O 3AVXA 2XKBA 1SD5A 4Z4QA 3RS3A 3PE6A 3R24A 3E5HA 3SX4A 2BMAA 3A1FA 1JF8A 4CF6A 3HA3A 5JJBA 3UAWA 5F3RA 1W581 3C1OA 2CV1A 2PH7A 5JVDB 1XQ9A 2GK3A 1J8QA 2AE2A 5FWXB 5AVRA 1LJUA 4MS3A 3R3YA 4PXAA 5AHKA 3SJZA 1X1DA 1SZJG 3HCFA 1Z6QA 2JJ2D 2JVKA 2VDRB 3PUWA 5CTAA 1CZUA 5P21A 2YN2A 3OC0A 3KQVA 3WP1B 1Z12A 3MMSA 1CY0A 1BQEA 4F3YA 1V5GA 2FSFA 4DJJA 5LFAA 3GI1A 3T1YB 1QPZA 3HJAA 2DP4E 4GD3Q 3I76A 1JZSA 1B0ZA 4NI5A 2Z8YM 4URFA 4CF3A 1RE0A 1HQDA 2BGWA 2PUCA 3KUXA 1J0CA 2I6TA 3SC3A 2ZQYA 2CNKA 1X19A 4V0KA 1ODJA 2BFMA 4M8LA 2Q9UA 3JQGA 3HZOA 4MR7B 4UQOA 2HI0A 3UOGA 1PLLA 2RG1A 1YMQA 3NOVA 3K2IA 1VE6A 2EZTA 1AGXA 1PL8A 1W49A 2P69A 2QY6A 1W88A 3I12A 4FBMA 1CB7A 1YRAA 3VR4H 1WEHA 4CUJA 4HWKA 3R7FA 1J8FA 3URKA 2YY7A 3R5SA 2PG3A 1XDUA 1NUSA 2COUA 3F8TA 3W77A 1OT3A 4YUWA 1OLXA 5I7WA 2B2NA 3Q87B 4YS6A 4JFAA 1ZD9A 3DD1A 1Z2CA 2Z2XA 1S2NA 1B15A 4B17A 4H7IA 3UAXA 3IHWA 2ODAA 4GMDA 4XR4A 5KNCH 4ZT6A 4XWAA 2OG1A 2ZSDA 4KOAA 4KIFA 4LGVA 4KK3A 2V7BA 1AXRA 3H1AA 4B3GA 5IKEA 4YDSA 4CU5A 1NLFA 4EY3A 1B8OA 4BTEA 2DBZA 2MYUA 4LNUB 1NI4B 2O2SA 3CZRA 1G2IA 1KPIA 1NHGA 2XNCA 2ZSUA 4KQMA 3KKQA 4MS3B 4LNHA 1BGVA 4HUTA 4DUZB 4YPOA 4R1SA 1E1LA 2H1IA 5JVDA 2F2TA 3AUJB 1TEXA 3AY3A 3DS8A 3N28A 3WFIA 2ZUVA 4TTTS 1YZKA 3N8KA 5A7FA 1O0CA 5F4BA 1IZ8A 2WAMA 3B9RA 3ROKA 4F92B 1EK2A 3I73A 2C7PA 2V9PA 3R0ZA 2CFSA 1GZUA 2GBFA 4H4CA 4GUAA 1WTAA 3N76A 4I46A 3DMNA 1ZOOA 1UDBA 4DQVA 3L04A 2R44A 1E1QA 3N8IA 4YMSA 3CNEA 2B37A 3RG2A 1OAOC 3RQIA 1RRFA 1JDVA 2AG8A 4RKEA 1FC0A 1T8SA 2QJRA 4L4UA 3SK0A 5IN4A 3PTAA 2VP0A 3LT2A 3QEMB 4Z2YA 1NMSA 2WVJA 2EX1A 3O6VA 4NBNA 1NFQA 3KOYA 4HK4A 4K3UA 3WDMA 4LPKA 2E55A 4YFVA 2ZRNA 5HWSA 3BXOA 5AW3A 5CFZA 3OQIB 5AKLA 3RRNA 2R1TB 3TB6A 4NZYA 1DZIA 1T1RA 5ALRA 3NU1A 5LM3A 5AVXA 3QELB 2A14A 2JEYA 5BSVA 3ABOB 3KBBA 5E7QA 1KZGB 3QMVA 1B42A 4FDLA 4B33A 1Z62A 1QHYA 3TSAA 4QGSA 3K20A 5JDIA 5IVKA 3IEVA 3QEBZ 3AEYA 1XRQA 2G25A 4RABA 3AVPA 3SNHA 2M9MA 1A95A 2Z4TA 5F7JA 2HHHB 5JYDA 2IH2A 2DHRA 3ONVA 1YL7A 3CH7A 3AR3A 2C07A 1Z7EA 4FD2A 3V00A 5A2QA 4BMDA 2NVUB 3X1WA 1OH6A 3THXA 2FW0A 1O0SA 4HH3C 4BYGA 3KDPA 5KTSA 4EQ6A 2HYDA 2B30A 2QN9A 2V1XA 4J3FA 3SC2B 3CW8X 8ADHA 1NBMA 1SOAA 2JJMA 1SN7A 4GMFA 1IIBA 2JD2A 1T0BA 2OK7A 3L8DA 3OSUA 4WKPA 1RLIA 2WWWA 4I50F 4B79A 4DJEC 5CFPA 3EGVA 2GLTA 3ESXA 2XW6A 4LKOA 1SVOA 4QNRA 2QNRA 4E3WA 4QFDA 1WDMA 1B6SA 3VO1A 1KL7A 4CLOA 1SUAA 1F2UB 2F1HA 2P75A 5IARA 5KZMB 4ZMBA 3ZQ4A 1ICIA 1K6EA 2DBVO 2ZJYA 3BUSA 4MUEA 1E3JA 3DGEC 5FFNA 1Z5VA 1JDNA 1Y9ZA 4MAAA 1F9AA 4G81A 4L9WA 4F38A 2M98A 2YFKA 3CO0S 2WMOB 1W47A 5ARDA 1JYFA 1O1YA 1VSVA 3HXOA 1H69A 4OXNA 4OYRA 3C16C 2FZVA 3UJ3X 2QT0A 3ISJA 4G01B 2FPRA 1OTYA 2WUGA 5KSWB 1L9KA 3OE5A 1KRWA 1OA0A 3M6WA 1NN3A 4TTSA 1HEYA 1ZWKA 3QU5A 2DPXA 4G65A 4LYJA 4RQBA 4YAFA 1FXUA 2ZFUA 4WXHA 5DBFA 3SQNA 2VJYA 3QJGA 2Y2VA 5C8YA 3EBLA 3O8BA 1PN3A 3IBYA 3CF4A 1A7UA 1U31A 3F3MA 3WLHA 3WIVA 1KA9H 1P1CA 4ABYA 3R3WA 1BCRB 2DWPA 3D1VA 4JI6B 4RK1A 3MYYA 4C0XA 1HYQA 2CKMA 4D8XA 4RTPA 1LF5A 1UCFA 2CUKA 3E5RA 3K6JA 4TXMA 2CYBA 5HJ2A 4IOMA 4QO7A 2BGIA 3QU2A 4U7JA 2WY2D 4KV9A 5JD6A 5JSZA 2GK6A 1Q3KA 2RHDA 2G70A 3FZYA 1TM7E 2O7QA 1C7EA 4PN7A 3OZIA 1O57A 4HFNA 3L18A 2CXOA 2OM6A 1AGPA 2AJDA 2C2GA 4PGAA 2I2BA 1P3Y1 4LXHA 2JLCA 5CNIA 1UOPA 3T3IA 4NBVA 1N1DA 4OP1A 1L5MA 3IAEA 3VAYA 3T9AA 3I0NA 1DJNA 4XQ9A 4AY6A 3JALA 1NQUA 3BVPA 4EJ6A 821PA 1RAAA 1MC8A 3JAWA 1U1GA 4X8OA 2ZAIA 2X42A 3B3GA 2VEDA 4HZGA 4I1UA 3WWPA 1FTNA 4NU6A 2JRCA 3T7EA 5HPYB 1N9KA 1XVTA 3E82A 4TSFD 5ITSA 5JSHA 1WR8A 1RZ3A 4QPJC 5KCMA 4BQQA 1V11B 2VHXA 2I4RA 4PTYA 1P4JA 2ZJ7A 4RS3A 4V38A 2CHGA 1R0SA 1MO2A 2CNDA 3L5KA 3DUFA 4RF2A 3HQ4O 3IUQA 4PYKA 1ZK2A 2IITA 2PRYA 1EQ2A 3STHA 1R7RA 2P4SA 4OB7A 3U3DA 1ZK3A 5HIIA 2HF7A 4M88A 2CB9A 3OM9A 1AHHA 1J5PA 3IA2A 1KAMA 1LK7A 2C58A 3G0IA 2FPGB 3I5MA 3L49A 1LNQA 1RW4A 2IZOA 3ZV6A 4KB5A 4QUKA 3BIFA 1WXFA 1P91A 3C7TA 4TQ9A 2IU6A 3HZZA 2CLHB 2OMEA 2ZB8A 4IH9A 5A5GA 4JC5A 3UMCA 2GN1A 2J67A 3F98A 3O8DA 3H2ZA 5IT5A 3DW1X 2JJYA 3GARA 1MGPA 3M1AA 5F33A 1ZN7A 2JHAA 3BIXA 1W5AA 2P5SA 4MI9A 3REOA 3WTBA 5HF6A 1KI8A 1OWLA 4YXWD 2HJHA 1UKZA 1CVIA 4N3NA 4LG1A 4GGPA 4W4TA 1PF7E 2WUWE 2ST1A 5H83A 4TRJA 4CHGA 2OORA 2WFLB 1IE3A 1XO1A 1WW2A 2VH5R 2WTAA 3BD8A 4ZHQA 4K9SA 1A8HA 1D07A 1M6EX 3FJYA 2Y71A 1S0UA 2C88A 2HWUA 5FKJA 4F86A 1JU4A 4NU0A 2R66A 3LGSA 2PAAA 4GP7A 5CPBA 4DDMA 1ITZA 2DKFA 3LC0A 2RGAA 4KX5A 2NU9A 2N42A 1KKMA 3N0RA 5DWVA 3P2IA 1AKQA 3OT1B 1F4PA 1Y8CA 5EJMA 2OPHA 4A27A 1P3DA 1R4AA 3ESCA 1GA1A 2P3LA 2AFIE 4IHKA 5FOXA 1YQEA 3S0JA 2CV2A 4DV2B 3ZJVA 5JLAA 5F5LA 4RYLA 1CQWA 1U6JA 4CT4B 4FLEA 1PZNA 2Z5LA 4PZYA 3C14C 4QXMA 3AGQA 4ALJA 3WA7A 1WZEA 2ZRDA 3C43A 5B1HA 2ADOA 2X7XA 4QSHA 5J2TF 3ZZNA 2IVFA 4B0OA 4DNOA 3E53A 1EESA 1CULC 2QRJA 3H16A 4GICA 1VKNA 1PD1A 4WOJA 2G76A 2LCFA 2GLUA 4GYKA 5FAKA 3UUEA 2UYCA 2C2BA 3BHJA 2IHJA 1GQRA 1PJQA 3BQMB 5LJLA 5E0OA 1R0RE 3GCWA 5DM4A 5EJ2A 5TNXA 5LLSA 4YAJA 1VP9A 3RAEC 3IMFA 5HW0A 4KR2A 1IWBB 4EI8A 2X15A 1C9YA 4GAEA 4LGMA 2I8CA 3TNFA 4AFNA 4ARBA 5IT0A 1I3OA 1FP4A 2GK7A 3GNSA 3HB9A 3PC8A 4KBYA 1JB1A 3AJDA 2IHNA 1LVHA 4PBTA 1L7NA 1RIFA 4E30A 1M8FA 2WK1A 4JT8A 1FUIA 3Q8LA 3I1YA 3OHSX 1XVLA 4AJKA 3DV0B 4HQNA 4TUYB 1OPXA 4B75A 4ETNA 3C8ZA 4DCMA 2MR6A 8ATCA 4QJBA 3JQBC 5HRCA 3RFUA 2AEMA 2YOGA 1QU2A 2K2WA 3A3KA 3KT0A 3LP5A 3RRBA 1M34E 5IZ4A 3GEGA 3TLBA 3CRZA 3HKEA 4LJ7A 1J07A 3CLSC 1P0QA 1WOMA 1YQXA 3W6NA 1JEEA 1JNXX 1CFJA 2A5LA 1FTWA 3I1FA 3WHLA 4AUNA 3MBOA 1IY9A 4GRIA 1SQ6A 4F72A 1GFSA 3DLBA 3GEHA 3U16A 4HQKA 1AZSC 1HYGA 2QROA 4RJIA 1G3QA 5EVJA 1Y6JA 4TSKA 1FU4A 4LFBB 2R6ZA 4GKVA 1U1CA 2AXNA 3JQ9C 3M5WA 3A36A 4HDNA 1Y4AE 4JUBA 3HLTA 6LDHA 3JVUA 5AI9A 3JW8A 2A5JA 3HJBA 3NEJA 4PG7A 1Z34A 1QPGA 1UBEA 4B4VA 4DA7A 4XA8A 4DB2A 3KIPA 3U7JA 1QYVA 2JGDB 2WSIA 3ISVA 3E84A 4IF4A 3O8RA 4W1QA 5K45A 1J56A 3LFTA 3P32A 4LCBA 5DHQA 3EMKA 3LHDA 4X1YB 3KR1A 3OPQA 5F1YA 1MEEA 4OI1A 1UMBA 3EC2A 4Y67A 2FMTA 4B2LA 1DV1A 4LOLA 4YBRA 3LCMA 2D5IA 3GFOA 3UMVA 4BWVA 1RYMA 1I1OA 1LEHA 3JPWA 5EXEA 2PS0A 2AX4A 3L77A 4ENSA 1GDTA 4ZXPA 1LLUA 1SU8A 3MWJA 1QTRA 5DKFA 3N8GA 1NVEA 2XB9A 4LY0A 3WKDA 4Z7JA 2XR1A 4MDFA 2P4QA 4UFOA 3SZLA 4DRXA 5BQPA 3ANMA 1S3FA 4H9GA 5CK4A 4PG6A 2QMUA 4RY9A 4B74A 5IX8A 3KUDA 4Z3OA 4AURA 3IEIA 1T29A 4MW5A 2VSYA 4ITRC 2OO3A 3BMCB 2FTKE 3B6JA 2PKEA 4RHTA 1C7RA 3FTNA 3QJ5A 1E7YA 4DSTA 1DI0A 1T9HA 5P8WA 3RWBA 2FUEA 2HD4A 1YMUA 4FUQA 4ME6A 2QXTA 1E8MA 3TPZA 5ECDA 1OC2A 4XVCA 4N5HX 1VSBA 1BQ3A 4BY9E 3L8ZA 4GI5A 2AJCA 2VKQA 5CVDA 5GM1A 3LQYA 2R84A 4DVGA 2XZTA 4LZWA 3UH1A 1TF2A 3BGIA 3KYCB 5KTOA 3I5XA 1U1IA 1EK0A 1X38A 1OA1A 2V97A 4KXQA 4MW7A 4A2PA 3PWZA 3OX3A 1H0KA 2RSLA 5CM9C 2YJNA 5K0GA 1NG9A 2F43A 2VDUE 4PQGA 4JJ7A 5HIKA 3V9PA 4L0QA 5KIAA 5IM4F 1U3DA 4WDQA 4EPRA 1LTHR 1KRHA 1MVOA 2ZS8A 3PQCA 4M76B 5LUBA 4QGHA 3P5BA 1RM3A 4UEQA 1C4OA 4UTXA 3VH4A 2FU5C 3H4MA 4IXWA 4N6GA 1RABA 1Q0QA 1VGQA 3OMLA 4MA5A 1KXJA 2PKXA 3WGZA 5L3ZA 2XKJE 4EFMA 1YC2A 3PUIA 3OKPA 3B7GA 5IP5A 4A1OA 3FPCA 4GZ6A 4IVRA 4URXR 1YO6A 1P4GA 2FKNA 1CRLA 1QRUA 1GU7A 4O2AF 1VOTA 2WNSA 3H5VA 1DARA 2IDMA 2B8WA 2H51A 3WVNA 5DE3A 3KRTA 5DNYB 3PQ2A 3RC7A 4BX3A 3MBIA 1GAJA 1EJ0A 4U8HA 1T6ZA 5B4UA 1QTQA 1Z22A 3A2LA 4EX6A 1O97C 3HVRA 1F5NA 2WF7A 5HUQA 1QOQB 2XE4A 4DV7B 5E1DA 1FVXA 5EXXA 3UCFA 1OV4A 1Y98A 2Y0DA 4MQUA 4D99A 2ZSKA 1H2WA 2G36A 5CVCA 4KRGA 5JD5A 4X95A 1EB9A 3JQAD 3B6MA 5EYPA 3USES 4U9HS 5AH0A 2LWIA 2QYOA 2I78A 2CUZA 4ILEA 1R4ZA 4NBRA 3ZWXA 4J1SA 4AO6A 4M21A 2GNAA 5F1PA 5HMLA 5LL6P 3KCNA 2OO5C 2CXRA 2VUIB 4NK4A 3EHEA 1CZHA 2DJ5A 3N8DA 4KNVA 5A1JA 3AF6A 3HUFA 2Y05A 4FFVA 4MPTA 4RELA 2Q28A 5DYWA 1N5LA 4BFXA 4HI0E 1E3LA 1ZRMA 2QJFA 1HK7A 2A9FA 3TX2A 1RQNA 1QF9A 3DM5A 4Q9DA 4ASUD 2YJZA 2P6OA 2Z8ZA 1ISPA 5TGTA 4NHOA 1DKUA 3D64A 3PHBE 4IHJB 2JFFA 4JLWA 1AB5A 3I9V6 3IEPA 3MXTA 4P4NA 5GPBA 5FNVA 3RK0A 2A5YB 4AK9A 4D97A 5TVKA 4U2FA 1T4BA 4D45A 1FRZA 1FPMA 1MPXA 5FTKA 3FZEA 1E0DA 5HE8A 4BE9A 2R1VB 1THGA 1C0IA 2XCSB 2A3NA 1RYBA 2F67A 2FPPB 4H1TA 2OV3A 2YWJA 3HO8A 4IWXA 4RLFA 4REQA 5JNUA 4CL2A 4WN3A 1E7MA 3ZJ4A 4DXDA 5HDQA 4X3CA 4BZQA 3GPBA 4IDQA 4PAOA 1XLTC 1FXSA 3DTYA 4KN5A 4DPMA 4CTMA 2PY6A 1CRQA 1KFBB 4N39A 4J29A 2DE0X 1MJNA 1YU9A 2B1GA 2H6EA 3U44B 1DL5A 5PNTA 5AVYA 3ZOZA 1V1JA 3MRXA 5EJEA 4BGVA 3P7MA 3A28A 4M87A 1PDVA 4K2AA 2PNFA 2PZJA 2QJOA 1Q77A 3WB2A 4BL5A 2JJ8A 3IIMA 4NDNE 4PX3A 2VP3A 2X41A 1NW5A 1QO0A 1XWIA 2E87A 3INTA 1G8GA 3D8NA 3ESZA 4OH7A 4PZ9A 5D51S 5TMDA 3UC5A 4FW9A 2VPWA 1PR6A 3LQKA 3O21A 1TYCA 4YPVA 4ER5A 4ZV4A 1WNTA 4UKDA 2TYSB 3WKAA 4DGSA 4ZI7F 1FRQA 3U17A 1IXRC 1KDRA 2Q4DA 3DYVA 3JYPA 3Q9LA 1KI6A 4PWYA 4Y7CA 4BLWA 2MMGA 3RRFA 2R6R1 1H94A 3ELWA 1HY3A 3L4BA 3PQEA 4OBXA 1KMQA 1PJ2A 2OSBA 1EFVB 4COKA 3OIDA 5BSHA 1M6NA 2Q5LA 3MJRA 1X9IA 2IPAB 3CNNA 4MKXA 2AOTA 4MUKA 5AO9A 4GC9A 3VOAA 4AJ4A 4ZVQA 2ZDGA 4FBLA 4NCIA 4F6LA 1EFKA 2VF7A 1PWYE 4K6CA 1YL5A 1Z4OA 2RH5A 1R50A 1PFUA 3QVTA 2GSWA 1JV2B 2CDNA 2HCTA 4M49A 2NTNA 4NMLA 4W1SA 2PPLA 4CM6A 2A6PA 5F12A 1W0JA 2WINI 4MWBA 5JQWA 2H52A 4MVJH 5EC8A 3TVYA 2PGIA 1KEUA 3CX6A 2ISSD 2PL3A 3FVWA 3LX5A 4JVLA 4GKJB 3T99A 1TQ2A 4ZRNA 4TV8A 1N5MA 2P9JA 1F3LA 2I2XB 1JDSA 2Y0PA 4H3HB 3NTXA 1YVPA 4AMGA 4WERA 3U80A 2QPLA 6CHYA 1EE2A 2APJA 2FWAA 3A14A 4CKCB 1I4TD 1JYSA 1JQJC 1N2SA 3CX7A 3NBZC 3IR5A 4RH0A 5K9ZA 1BSVA 1WZ2A 2M6LA 1XCOA 1Z68A 3E05A 3TK1A 2QG9A 3IAS1 1ZD5A 1PR9A 4S1PA 3IODA 4HMPA 4DR7B 4Q4AA 2W4IA 3AH8A 1SUBA 3UG7A 5FH9A 1GGMA 1H2AS 2GZAA 2VP9A 2ACWA 2SKCA 4FDMA 4TL8A 3C3XA 4YMIA 4LHYA 1QDUA 1CE8A 3EK2A 4Y1GA 1GUBA 1QORA 5HQ3A 3OAAD 4YUYA 3C6QA 5AUPB 2AE1A 1BXGA 1GQYA 3I6MA 3OQ6A 2XLCA 2I3DA 2O4CA 5D01A 4PRZA 3V55A 1ZNWA 1GV1A 2BONA 3L8FA 1G8PA 2OHXA 4LMAA 3CCCA 3DB1A 4JI4B 5ECYA 3FVTA 1K3FA 1TVKB 3F6EX 3T5AA 4ROSA 2PRZA 4LSWA 4WZAB 1YJCA 4I5GA 2X0NA 3CRNA 5ES3A 3U4GA 4F6RB 1VYTA 4NE7A 1KY4A 1C9DB 4JGBA 5ARBA 1VYVA 2BCJQ 3DKIA 5KYKA 2EFEB 3GBVA 1PWHA 2P68A 4TMKA 2BI8A 5H1YA 4EKYA 2GH1A 3AC0A 2FAXA 1FFWA 4A7PA 1E4EB 1K5GA 4R81A 2ZKLA 2HU5A 3GX1A 2VCHA 4LSZA 3ECAA 4IZ6A 3UJ7A 3SJCA 3W78A 3MJTA 4BAUA 4CCYA 2RBEA 13PKA 2XMQA 3LM8A 4DNXA 4HDSB 1YZHA 3NEPX 4E2ZA 2KLBA 1OB2A 1E92A 2VSFA 3BPSA 2ORED 3FYUC 1TRHA 2NUTB 4IVNA 3DWFA 2VQ3A 3X2SA 3A1CA 2I4OA 3EXEB 3SYKA 2H2WA 3BK7A 4JJAA 4HVCA 3ZWWA 1W48A 3V7FA 3FF4A 1LSOA 4RZSA 3TH5A 4XD7D 4DMUB 1H0SA 1TQDA 4RYDA 5CH3A 1A9OA 4N48A 4AJNA 8OHMA 3DZIA 1MV8A 3C98A 3LD9A 3L9WA 3ZHSA 1CW2B 1XKXA 1TLLA 4KH0A 4R41A 5FPHA 4C78A 1DRKA 1THMA 2L69A 4D96A 3EGWA 3O4RA 4KVZA 4UVIA 4DREA 1Y5NA 2OYCA 3EGXB 1K9VF 1N2CE 1B3BA 2QUZA 1R0YA 3I23A 1QOPB 3B5IA 3R20A 4HB0A 5DBEX 4YXWA 1RKXA 1K08A 2R1UA 1ONOA 4NS1A 4CQJA 4D5EA 4NE2A 1UBLS 4A82A 2NM0A 2W6ZA 4NOLA 3F6YA 5BWNA 4RADA 4K6MA 3OIVA 3S5JA 4YAOA 1QQBA 3Q9SA 5HQTA 2RJ3A 5AKKA 4GVPA 3PXDA 3CINA 1DC7A 4AUKA 3KAQA 2PU5A 3A9TA 3EPPA 4N12A 3CN9A 4P3PA 4S1NA 5DASA 1I7QB 4JKIA 2VQ6A 2F9FA 4HAVA 4BVKA 1U7WA 3DEIA 4DBVO 2UUBB 3C4QA 3KLMX 1EX9A 3D54D 5ADHA 1YBFA 2V0GA 1U2DC 3EQ2A 5G0UA 5IAAA 1H2HA 2VDKB 4ZXFA 2A9VA 2FLKA 3VPCA 4KDFA 5ESXA 2Z8YA 4TYPA 5EJAA 4FGKA 2XB2A 1N92A 4J3JA 4R3UC 3SC4A 2BW0A 5HCIA 1FP7A 4H6XA 1KTVA 4WLFA 1UMCA 2VDJA 4PCUA 5BR4A 3UOWA 2XE7A 2FSVA 2I6GA 4OI2A 2IBTA 2FWBA 2UZAA 4N5NA 4DA6A 1DJMA 4YWHA 3GK3A 4H59A 3Q5DA 5DN9A 3ZXIA 5JY1A 3AHIA 4X45A 2JAPA 1IEQA 4GR9A 3PQ8A 1X13A 4PE5B 3R7SA 4YJ3B 3GCXA 3I9NA 3W9BA 1CF9A 3EJ6A 4K3VA 1EZZA 3PYXA 3BKXA 1OFUX 1SRRA 1WEKA 2NQTA 4FZ5A 3Q7IA 2BTQA 3FDIA 2GPSA 3E9MA 3H8JA 1YIOA 1UFOA 4NIMA 4GXTA 4QXOA 3S1LA 4WNAA 1HTBA 3DJFA 1DHRA 3OZGA 1K89A 2WIAA 3P9IA 3QKSA 4IICA 1RPJA 3GGCA 3DKRA 2QGZA 1TJ4A 3I2HA 2JJ1A 2OR3A 4ZVKA 5JCOA 3OOWA 1PJLA 4PAGA 2JKVA 4LY6A 1IG0A 4GQBA 4U6NA 1JHMA 1Y0BA 3A06A 1FBTA 4WCDA 2IW3A 4KKXB 1DLJA 4RVCA 3U9TA 2BZGA 5L6LB 3QVLA 1JIQA 3NWOA 5C8YB 5TGZA 1PT8A 3VA7A 2Q9BA 1DAPA 1C29B 1JP7A 2WG0A 1XFAA 5FNVB 4CG0A 4DDKA 4MUNA 5BSEA 2K5UA 4IYRA 5FUMA 1BFUA 4B6OA 1KERA 4JT2A 1PBNA 1NVVR 2PKQO 5GADl 4GPBA 2I55A 4PM4A 4FHEA 5C7LO 1DP4A 1M54A 4KXXA 3BA6A 1Z4LA 1Q57A 3HGMA 2P30A 4LVCA 2QQ5A 1QU3A 2ODWA 1UKYA 4R6WA 2F8LA 1X77A 5JZOA 1NASA 1T35A 1YQGA 3AF2A 5JR3A 1KARA 5HKOA 3A1DA 1UBSB 1DQZA 2IYVA 3RC3A 2V9ZA 1U0EA 3N58A 3CBGA 4P08A 2BKVA 1I80A 3VO2A 1VPDA 3AYZB 4I8XA 3PHGA 4DRYA 2RE8A 4FVTA 4BLQA 2BL4A 1R8JA 2GJ9A 2YH2A 3D7NA 4O2AA 4INJA 3NWPA 1LKZA 1P5HA 2H63A 2IBMA 2QU7A 3QLEA 4LYAA 3LRXA 2DHQA 2W2KB 2JZCA 3G3EA 3H1FA 1Z6TA 5G2OA 4BMXA 3C1TA 4FNOA 5K2MA 2FG5A 3AF3A 4D41A 1DTWB 1LD3A 4HX5A 1XL1A 3H1GA 3FGOA 5F73A 3ZXYA 5DN6D 3PTZA 1VKRA 4HWGA 2O8EA 3R5TA 1NV8A 1R5OA 3HV0A 4DR4B 1FFHA 2ZDHA 1G41A 2X5OA 3W2TA 2DCMA 3ZBTA 1HDRA 1IXYA 4WUTA 4UBIA 1ELOA 1JEYB 2CMHA 1Z0AA 5DGXA 4H7JA 5EQJB 3IAUA 3JQAA 5B3KA 1L7PA 1M1NB 1XCLA 4UU8A 4Q66C 3G85A 4OHWA 1JFLA 2C94A 2PCJA 3D02A 3NUZA 4TSFA 5LBUA 4KN6A 4WCFB 4BX9A 5HZMA 4KSCA 1JGTA 4WFIA 1F0PA 2ZBQA 2W58A 3AFHA 3MOSA 4JQZA 4YJ2B 4JXKA 3U3MA 2DG2A 3RJMA 1C9JA 4HVLA 2QRVB 3VU0A 1XU7A 2YV4A 1FYFA 3THRA 1BJRE 1U9IA 1QMPA 1ZSVA 2I6SA 4GSKA 1UDAA 4L22A 1ESEA 4HF7A 4CMCA 5K2OA 2AMYA 2ZW9A 3HR4A 2I3AA 1GSIA 2OT3B 1UDRA 5BW8A 4GOKA 3D6UA 2BFOA 5IXYA 3PHHA 3R8XA 3ZIUA 1IAQA 4AQ7A 3AVUA 3HGQA 4UD2A 4DARA 1GSAA 1C5KA 4DW8A 2VAWA 1G3MA 2I03A 1LH0A 1H4TA 3L7JA 4R1TA 1E0SA 4XH9B 1QK4A 4FP9A 4X20A 1E2FA 3I92A 3MQ4A 4RZHA 1JQ3A 4IIYA 4RY0A 4E13A 3OM1A 3HDQA 4G0QA 1X0XA 4ECAA 1RRPA 1U7XA 2H1RA 2IYNA 4ZOQI 2IH5A 1XQ6A 1LDGA 3LQQA 4NAUA 3NAQA 2D1FA 3UW1A 1G59A 3LA8A 3O84A 1LLCA 5LZ7A 2ZBPA 4F2GA 1D5WA 3KJIA 4FB4A 2OBYA 2AF3C 3WSVA 3G0GA 4DWOA 4J4HA 1QGYA 1BC5A 2V6FA 3B78A 4RZXA 5J3JA 2GD1O 1QG4A 5K8CA 1R6UA 5BNIA 1H8EA 3CG4A 3ODPA 4LVOA 1NW7A 5C8VA 1AU9A 2GEJA 2X6QA 2NXCA 3HPRA 1N2ZA 4FGUA 4H18A 1HXHA 1D9XA 4RDCA 2A35A 5JRJA 2XCTB 1NVGA 4RQTA 1WABA 5LXTB 1DQYA 3JASB 4US2R 4G5XA 3QUTA 1MX5A 3BWYA 3EDOA 1DKNA 3L7KA 2FCRA 4PNZA 3CWQA 1IWOA 2Q2OA 2W42A 3D0RA 3KPVA 1IH8A 1WCIA 4LJLA 1RRKA 4DBLC 3SQMA 3PX2A 3UH0A 3ZWDA 1HUQA 4MV4A 3CONA 5LOVF 1JQDA 3PWTA 2IE0A 4M2LA 5E7MA 1IQRA 4ZN6A 1A7KA 3VPGA 1NVKA 2YFHA 4ACBA 1EFUA 4MWTA 2ZAMA 2Q29A 4D8VA 1ZMTA 4XB2A 3C2QA 1CNFA 1RIIA 1TCAA 2XT9A 2HLDA 5AWFC 4OF4A 1V1RB 2PFGA 2REOA 2PQ2A 3CEJA 4FYYA 2CSXA 3KQHA 4W5RA 3QMPA 5BVHB 4J07A 1V1MA 4V3CA 4ZQHA 4MINA 4EMBA 1ZJWA 3IVAA 4OOEA 3PHIA 3MHTA 1BVYF 2B4TO 3A0UA 1ODKA 1RRGA 2VWQA 1YRYE 5AXAA 2NQ8A 1AVTA 2WJJA 2HCBA 4AYWA 1PWXA 3QVXA 5HSGA 5FEUA 4HC4A 2WG2A 1PDOA 4NBLA 1PGQA 3H0KA 3IUYA 1LFDB 3LXRA 4IDFA 1EUYA 1T3LA 2QZSA 4K9NA 4N5MA 2RGNA 2GTHA 1WDTA 1VRVA 3C87A 2B0JA 3ETEA 4JUIA 2NV0A 1HSZA 1RJ9A 1XN4A 5HCNA 5HTKA 2IS4A 3MB5A 1A2BA 1ML3A 1H5NA 1A88A 4L4SA 3DMRA 1ZMRA 3QPCA 3WKBA 1CZNA 5B1DA 2B82A 3AM4A 4PZAA 1GKKA 2NU6A 3JARB 1K4MA 4ARZA 4AW9A 2QTTA