4G4SO

Structure of proteasome-pba1-pba2 complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
249
structure length
200
Chain Sequence
LEVCPVPKVEFYSTAVITTKIMNPLFPKNLLQLTSIGEIKTTLFSFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLCGQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome component C7-alpha
publication title Structure of a Proteasome Pba1-Pba2 Complex: IMPLICATIONS FOR PROTEASOME ASSEMBLY, ACTIVATION, AND BIOLOGICAL FUNCTION.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/chaperone
total genus 54
structure length 200
sequence length 249
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF10450 POC1 POC1 chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4g4sO01
4G4SO
chains in the Genus database with same CATH superfamily
4X65B 5AOBA 2ZULA 3IUYA 4PWYA 1KKUA 1WBDA 2XJ4A 4LJYA 3KZ1E 3WAJA 3EYWA 2IU6A 2Y1OA 3QHQA 1TYDE 5FADA 2IP4A 1RXIA 3ZGYA 3U4DA 2FZLA 1MMFB 2EXXA 3OJWA 4JJKA 4RL6A 3MM4A 4XI9A 1FW6A 3WGVA 3O8OA 4JLMA 1Z8DA 4K28A 1HC7A 3E53A 5DYGA 2X8WA 1MGPA 3C5EA 3NWEA 2HLPA 2WJGA 3VU9B 4F2GA 1WW3A 5TRTA 2EZ8A 4Y1FA 2C4VA 1K4YA 5DNDA 1PNRA 1HKHA 3GRUA 2I7TA 3RGWS 1I80A 4UARA 2J7PA 1NYQA 1YC2A 4GO1A 4FNAA 4H6XA 5CX1B 1NJSA 2OFXA 3FPHA 1XVTA 1SG9A 2P2YA 3H2HA 3SE7A 3TNDA 2Z9BA 5JXHA 1QE5A 2O7VA 3PXEA 5AHRA 5DDIP 1FU4A 1D1QA 3TL3A 2C2KA 2QE7D 5C31A 5KQRA 4EHJA 4FZ5A 4ABTA 4FFBB 3NO4A 2CLKB 3Q3IA 5EIOA 3W1VA 1BVHA 5FFMA 1KSGA 4FEGA 3IX7A 1YGYA 1AD2A 4ZQBA 1PWYE 1T8TA 4C76A 2P5UA 4B82A 5LMCA 2NTNA 1U3DA 3OKAA 2OV6A 2HRQA 3HSKA 1NFQA 3AF3A 1JIVA 3ZDRA 4ENUA 4D8XA 4WBNB 1MABA 4CQLA 1LDYA 2XCUA 5IK2A 2NSDA 1EP1B 2QMYA 5G2OA 3SLRA 3A37A 1OX4B 4PAOA 3UENA 2PIDA 1NNLA 2BGRA 2YVLA 4JLNA 1JHDA 4EFNA 4UUOA 2F3UA 1CVLA 1UQRA 4H7HA 3DMNA 4D9BA 4LRWA 4C6TA 4KPUB 1Z56C 4XGIA 3FMGA 5KU7A 1FS6A 3F8SA 1EQUA 1M6EX 2BGNA 3OJ0A 1BGXT 1RQNA 2PX4A 4H3SA 3ZHBA 4EYSA 1SCAA 5DF1A 4ZHSA 4KQHA 1MIOA 4LYEA 1M1XB 1V1RB 2J6CA 3P8ZA 1O6FA 5HG0A 1C3XA 2F62A 3KQSA 5CAEB 5GINE 3I5AA 1YB7A 5DHAA 1ISIA 3LRXA 3M3DA 4TV8B 1XPUA 3DOHA 4PFJA 4TWIA 1NDQA 2SNIE 3BL6A 4KQ6A 1X8LA 4FE7A 3B60A 1F0YA 4F21A 1W76A 1K8XB 3BH7A 4II7A 2FPPB 3TSWA 1F14A 4PU0A 1CY0A 1HFKA 2VYFA 4C1NA 4MGEA 1FTYA 2I2XB 2OLJA 2OXIA 5JMTA 3AM5A 3OP4A 4K9KA 4F93B 1YFKA 4S24A 1JBQA 3PK0A 4O5OA 2JIZD 1FFYA 1JG7A 1CFJA 1ZFNA 3OU2A 2A7QA 1QIJA 5D3KA 4B73A 1WETA 5HE8A 3H1GA 1XT6A 3BRWA 2D8AA 3OA2A 4I14A 4K1XA 1CW2B 1XZKA 1H5UA 1JTVA 1MRNA 1R9GA 1YRAA 2AW3A 3B1FA 4GR5A 4MW2A 4R54A 2JFYA 2VNHA 4II3A 4MRVA 4GXNA 4ZU6X 2QQ5A 4JUFA 5THQA 2E21A 4DR6B 4RLHA 2B25A 4BFUA 3HJNA 4EGFA 3OX4A 3FLAA 4Z99A 1JR6A 3OLYA 5EHQA 1UZAA 3J81A 4DNFA 5AMXA 3DLAA 2IJGX 3RARA 4ZJYA 5LXTF 4EF4A 3K70B 4G85A 5IM5A 2WPNA 2JCBA 1S5PA 4NY1A 1JN0A 4J0KA 4E21A 4LKRA 1JFFB 3R9XA 4IYRA 4M99A 3ZGVA 1BCSB 2GJAA 1PS9A 3EG5A 5LB4A 1OREA 3AEKA 1ZR2A 2H06A 1RKBA 1DZIA 2J09A 4FDAA 4FEYA 1UK6A 3OM9A 5FF9A 3U7QB 4B7XA 2ZIEA 4YY3B 2PCLA 3N7TA 3CZ5A 4Q3OA 5ERXA 4PX2A 2EP8A 4L2IA 1PO7A 2QLFA 3O3CA 3UN1A 4D9JA 2VF4X 4L85A 2BEJA 4OLJA 3RBZA 5J4LA 1E7YA 4JSTA 4QNNA 4L1KA 4XJXA 3SZRA 2DFVA 3A9UA 3AO0B 1NUTA 3E22A 3RT9A 3RU3A 3URKA 1Z18A 1WUYA 2QN7A 1PHPA 2C3PA 2QNRA 2VF2A 4BRSA 2B5OA 2WLTA 3H0CA 1KGSA 3HZRA 1IN8A 5F3WB 4A8JB 1PQYA 1FFDA 1OPXA 1C1DB 3IP8A 4OEHA 2WM9B 1EBBA 3QXJA 4E3ZA 2AI3A 2J0UA 1ONBA 2KBFA 4LX8A 5ALGA 3ZY3A 2O8CA 2GASA 2Q5IA 1AN9A 2CY0A 2XMGA 1W36B 1GZ5A 1R27A 5KTTA 1J23A 4I1IA 4OQDA 3WMGA 4YRSA 3BFJA 2MR5A 4BTVA 3W6UA 5LD2C 1U0BB 1OV4A 1BMTA 2A9OA 3GYGA 2OGZA 2FN9A 1BWPA 1VP3A 3ND8A 2JHAA 1O0BA 1H9BA 3JD0A 5MF6A 4IFIA 4B84A 1GM5A 3CTMA 3H3JA 1HYQA 3ILHA 3QEJA 4KK3A 1XMXA 1MAHA 3OLQA 3LUHA 4DCPA 2KPOA 5E2IA 2D5IA 3E9RA 3I73A 4GNRA 4CLOA 2PUAA 2R5NA 1SVSA 4GMDA 1UJNA 4MWOA 3WGKA 2JGDA 1QX3A 4V0QA 3GW8A 3QPWA 4HRYA 4UU8A 2OBBA 4YRQA 1SKMA 4JD5A 1C41A 4N4AA 4TYPA 2PG3A 421PA 3BHJA 3JQGB 3JD4A 5DNAA 1UKBA 3ZVRA 4IQ4A 2X6QA 4WDRA 2H17A 3E70C 1GARA 1GEEA 1Z0AA 2RB4A 2A9KA 1SH7A 2WFLA 3BRSA 1T6NA 5JROA 2RKBA 2VP2A 3GMIA 2C7BA 4LYFA 3IAFA 4TMWA 4C4ZA 3IE1A 2XCQA 4KH0A 5TLSA 4RJJA 1RI2A 1T4CB 2PJUA 2P2ZA 2COUA 1MDFA 2H1WA 2JASA 2O6LA 1ID1A 3HKBB 3IDAA 2P0AA 3QE4A 5LWQA 4EG7A 1VKJA 4AQYB 1H0SA 1NATA 1RACA 2ECQA 4F2HA 5DNEA 1RPNA 5GONA 1U3TA 2ORIA 2JIMA 1EWQA 1HDCA 4RMJA 4L9SA 2JI9A 4RVNA 3FUCA 2BFEA 3TRIA 3HB9A 3OFJA 1GCOA 4IQGA 2F3RA 4QWWA 1DINA 1GPKA 1PT7A 4CIBA 4X90A 1Z73A 3M6WA 4ZI3A 4PYKA 5CRIA 1LVHA 2I2CA 2HWUA 3ACBA 5AM0A 1CDDA 2EW1A 1JNYA 2XB9A 3I30X 4LQ4A 4Z1MA 3G2KA 3QPAA 2Z95A 3LWNA 2QRZA 4JUDX 2R1VB 4UEJA 5EZYB 3WKAA 2XGGA 4CTOA 3ID6C 2UZAA 3KOZA 1E3TA 3DHVA 4PHFA 4R1TA 1JHPA 1SEVA 3QENA 4EITA 4LF6B 1E3MA 3ZV7A 5F77A 4HRXA 1WBBA 1BEZA 3PC8C 2IEYA 2MYPA 1IUNA 1L7RA 4UNRA 1UBFA 2AD5A 2YN4A 3DL4A 3G9ZA 1TYCA 1Y3HA 3E82A 2OHFA 3I2HA 5F1KA 3A58B 2O4CA 2RH9B 3GROA 4EB8A 4ER0A 5IWCA 1J56A 4RF3A 3EXG2 2PFSA 1HQKA 2AJCA 3E7XA 5F98A 4ZIRB 2FE1A 1GSIA 4MV5A 4ASUD 4DNQA 1LPMA 2YNMC 4AJ9A 4Q3KA 2AEFA 1M2WA 4AXBA 1QRRA 2FSUA 2R2GA 4OBWA 3FPFA 3RUCA 3T7KA 5JMWA 1C8VB 1V1MB 3BDVA 1E66A 1TZKA 2JIOA 1WQ1R 1CVRA 4FDLA 1PJSA 2ACEA 1JVBA 3CRRA 1YTUA 5L4NA 4BO6A 5KHOC 1YHYA 1ANKA 1Q3HA 4N6NA 1ZIDA 1SKQA 4RSRA 3JARB 3ZJVA 1L4YA 3LSTA 4E4RA 5J1TB 3X1YA 1E7MA 1UJ6A 1FTSA 1T8RA 2FFBA 4B48A 4CZ2A 2NN3C 1PF7E 2AXEA 4BBAA 5IU6A 5C1PA 1DAIA 1VLHA 5DN6A 3HC7A 1EM8B 4LZWA 4W8OA 3E8MA 1G63A 4WMLA 1DKLA 3RW9A 3BCHA 3WLAA 2IUYA 2Z57A 1E3LA 1U9JA 4AC9A 1AT1A 1KYVA 3LBAA 1FL9A 3BHMA 1U3UA 4Z2AA 1FBTA 5BR1A 2ZYDA 3DTVA 3TQRA 1I7QB 4MRNA 2ZXFA 5IM4F 1E2BA 4WACA 2NZYA 3IAHA 4LDJA 4E70A 2CFRA 3FWNA 4A8HA 4BQQA 4O4HA 3AI1A 3AJDA 1Y8RB 2B61A 4F8YA 1TC1A 4RC9A 1KZGB 2PGNA 2VAPA 3D3NA 3JQAA 4FHCA 4LE0A 4MUJA 4UZFA 1MDBA 4G23A 4LHEA 4M8KA 1C81A 4QNRA 4MQ6A 4EHFA 1YQEA 1E5DA 1X1BA 2GBGA 5JQWA 5AESA 4KWIA 4KVZA 3TE6A 4AO7A 2H4YA 3H84A 4FT2A 4C29A 1QYCA 4BCDA 3H2BA 2ZBGA 5SYNA 5NULA 2WZBA 3TW8B 4BFYA 2CLMB 2VDKB 3QPDA 4PANA 3GR6A 2XE7A 3SVLA 1VYVA 2QPTA 3PFIA 2JRLA 1Y5RA 3LO5A 2YWRA 1ZNXA 4ILKA 2ZRDA 4N1AA 1X1TA 4DCNA 1TA0A 1ZLYA 4E6PA 4HPWA 1RYDA 2H1IA 2HQBA 2O8DA 3U7IA 1TZ2A 1GA4A 3ZD6A 3ELBA 3LUCA 3WLKX 2ZRJA 2AG8A 3KB1A 2Q2WA 4XGKA 2VOEA 3ABOB 2X58A 4LRXA 4MV8A 4DANA 3BGDA 2O8FA 3FUUA 5FKJA 1YQWA 3RKUA 2I87A 3CW9A 1EU1A 1S2LA 1UBEA 3R5FA 5CXQA 1E1YA 1ULTA 1XGKA 1T6XA 1P6XA 1PQ4A 4ND6A 4ZMRA 5KYTA 2XAAA 3GVHA 4RVOA 3I6QA 4K40A 5H82A 3G89A 3IVCA 3C15C 2KW5A 1JWBB 1RRGA 1DFGA 3BCRA 3M49A 4LY9A 5KAMA 3AFOA 5LQSA 5L45A 3RYCA 3OZAA 3DHYA 2F59A 4ZO9A 4JH0A 1AM4D 4M1WA 3LGSA 4K9NA 4DGSA 2PUCA 2X4DA 3QLUA 4HNAA 4AQDA 1ZN8A 4J1SA 3HA7A 4JC8A 4NKRA 1AY0A 1ETUA 3K5WA 4FC7A 4WXPA 1K6XA 1IHUA 2C20A 4AQ7A 1IBKB 1Y3IA 2Q9UA 1PVOA 3DOCA 2P6PA 3HCFA 2VTEA 2BGJA 1HA3A 3P26A 4HAIA 2IPLA 4NK4A 2E48A 1T0PA 1USWA 2I8CA 4U7FA 3ROTA 4HQ0A 2WV7A 4LZZA 3WWDA 3UC5A 4M87A 1KWKA 4RPJA 4ZCQA 4ALLA 1MV8A 2ISCA 4S1WA 5L3QA 2DLCX 3EIFA 3PEWA 3V7FA 4FFNA 4IUBS 4N3NA 5I6DA 4WZAA 1TW2A 1VPTA 2DWPA 2I62A 1CUYA 3H6GA 3P4UA 1JA0A 3D0RA 1Z0FA 1TAGA 4G37A 4HUQB 2COEA 4X1KB 1UFVA 5CPFA 1WVIA 2VJAA 1INLA 3C3KA 4AJIA 3L0SA 3GJ3A 1E2FA 3HN7A 1IUOA 1WCXA 4JX8A 5KJ6A 2D74A 2EFEB 3FVRA 4G0ZA 1K66A 2P8JA 3WISA 1X0VA 3D0OA 2VZLA 4ACAA 3O95A 5SZHB 1AKUA 1TU0A 4B3BA 5AVRA 1KWGA 1L5LA 2X0IA 2H2IA 1ST3A 1F2TA 1YDFA 2XOXA 3D7KA 1E20A 2G5CA 3OCVA 2Y4OA 5FHQA 3W4IA 3M2TA 3ZJ5A 1PT6A 4L7VA 3UK7A 2V1UA 2EERA 4IDNA 3QVJA 1THGA 1XN1A 2E6UX 4WKOA 2DH5A 2BR3A 1CZUA 1T3LA 3ADKA 3L4BC 1U2QA 2YV2A 1DAMA 3M9LA 5ERGB 3RSCA 5TMBA 1AKMA 5PGMA 4JT2A 3IEVA 4G4JA 2ALJA 3I1JA 4MUNA 5G0VA 1TKCA 4L57A 3HBAA 1MC4A 1NVEA 1GNLA 1QS0A 1HZJA 1NYTA 1US8A 2M6SA 2VDVE 1LPNA 3GUUA 3LA6A 4JOCA 1YE8A 2GM4A 4RVDA 3A4VA 2IY7A 3L8EA 3EIUA 3OJXA 4N48A 1PKEA 3UO8B 1J42A 4YAKA 2X3UA 1E1KA 3ZDFA 2O3JA 4NP6A 3A8TA 4ARIA 2GA9A 1JIJA 3LOUA 2CXXA 2JH8A 2SKCA 2W6NA 1HWYA 4JB3A 1BU8A 4ATNA 3TECE 1D0IA 4PLZA 4BZWA 3C3BA 4HDSA 3K0HA 1RMQA 2BSXA 2PMFA 4BAGA 2DBRA 3A1NA 3MGBA 2QZZA 3L1IA 2CVHA 2BFWA 4GPIB 4W5QA 3SZGA 3FTNA 3QEKA 5BQXA 7MDHA 2R8OA 2F17A 3QFRA 1X1RA 2XNCA 1U1CA 4FEAA 2WZDA 1IN5A 1FRQA 4OAQA 1KFCB 3PV0A 4MIEA 2Z43A 4YJ2A 1Z3CA 3AUXA 1V7CA 3S2SA 3GZ4A 3EWSA 1TT5B 3PNVA 4G0WA 4H2DA 1PSZA 1VCNA 2OXTA 1D7AA 3LVFO 4KLNA 4I99A 2J30A 1IN7A 3Q7EA 2J3DA 2ZPUA 4RTQA 4JSRA 3UVEA 1LVGA 2PZGA 4UTOA 1EDBA 3NHFA 3ZWOA 3DZBA 3C3CA 3WWCA 3ZZMA 2VDWA 3L41A 3VYRB 2IIPA 1A8PA 5CVCA 4OAPA 4OL0A 5EJ2A 1QCYA 1J20A 4RLFA 1KR2A 1V71A 2GYUA 3PUWA 3RHFA 3OF2A 3HFJA 1H3NA 3CUWA 3KDSE 3M5WA 3GP5A 4YCMA 5AVUA 1LSSA 4Y1RB 2QVGA 2I2WA 3ZIAA 4G6ZA 3U5TA 2A5LA 2HJ9A 1K9VF 1RJEA 2R5WA 4OSEA 4NJEA 1SIOA 1N4DA 4I50B 4KXQA 3PEYA 2IOYA 4M9ZA 2ID4A 2PMBA 2B36A 2QPLA 5AHWA 5DMXA 4IG9A 2BFPA 1H2XA 2ZRNA 3KQMA 3DXZA 4CYMA 1G21A 3F4BA 1PZHA 4P8RA 4D9HA 5JOQA 1NUPA 5KPDA 3KKQA 2FEKA 2IYRA 4O4LF 1PR3A 1VBNA 2CXTA 2BW0A 2RBEA 2YRWA 2BF4A 3QGMA 3H1PA 4UM8B 1OJ7A 1P77A 4X6LA 5CA1F 2A5DA 3VOSA 1WMEA 2AG5A 2G0AA 3RSHA 4DIOA 2FPIB 3FCAA 3K0BA 4EKIA 4AMVA 2CWDA 1F06A 5KTOA 1SUIA 1M5RA 5DM4A 5IJ0A 1YQGA 3RODA 1KYQA 1Y1KE 2P7IA 1P2GA 2ZRFA 5LQNA 4IO0A 4M7PA 2Q62A 2H9IA 4FS3A 4YQZA 1U2RA 1O96B 4WLUA 3BQNB 3GK3A 4O2RA 2WD7B 2RKOA 3ZLVA 1Z6XA 3ZU5A 1U8TA 3U1BA 1KOJA 3AYXB 4G5FA 4JIGA 4YXFA 2G77B 5E95A 3QKWA 1VCIA 1Y7LA 3MUOA 5AH0A 2QU8A 4ERNA 4OREX 4JR2A 3IXQA 1Y4SA 2IH5A 1L4MA 4TXNA 4FGJA 4UNNA 4YVFA 3TQTA 4X97A 4EJSB 1K8YB 4X66B 3AVYA 3GPIA 3HKCA 2BBWA 5ICSA 3DP9A 3V4FA 4BMYA 2B9VA 5EVJA 2HIMA 1ZLXA 2DUWA 3BHNA 3AR7A 3DBHA 1Z5GA 4QUGA 5DGXA 1QQAA 1DTSA 1E1CB 1SA0B 3B6MA 4JKIA 5LKRA 1WW2A 3MINB 2O2IA 3L7YA 4LIPD 2HRCA 3H75A 3HBNA 1DT3A 5KDLA 3U3XA 4EB6A 1X7HA 3IT3A 3NIDB 3RG8A 4GQAA 1M2OA 1U7TA 1KEVA 2M6RA 3PVSA 1EUCB 1PJ8A 3ZX5A 1NN3A 2QX7A 3MERA 4QSMA 1U2EA 4WCDA 3C6BA 1PR1A 1YKGA 2YXEA 3CS3A 3QEMA 1P4GA 4HDRA 3T4EA 2QYOA 3NZEA 4JB2A 1D4AA 1TF5A 4BFWA 3IPLA 1P18A 1EH5A 2IXTA 3EJ6A 4MCJA 4X1IB 3RSOA 3F3MA 5CFLA 3WMFA 3PGMA 3FNFA 1KO1A 1CZHA 3TINA 1AKWA 5DHTA 3RROA 2YRXA 4C04A 3ZHVA 3DQQA 4XZ3A 3T3GA 4OQPA 5KYWA 3TAHA 2PX8A 2Q5QA 1XCLA 5IDQA 1SOAA 3B2NA 1MCZA 3GA7A 3KKEA 5JEDA 1GOTA 1QVRA 5TPZD 4F4IA 3KPVA 1RPAA 5B2FA 2UVPA 2HQOA 1QP0A 1LS6A 3LDHA 4OIFA 4FFWA 1F8YA 3UJ7A 2X6RA 1I2BA 6CHYA 3CVVA 2BI4A 3PR2B 10MHA 1R0BA 4JI2B 2AZMA 5HE9A 4EZIA 2FAXA 4ZQGA 4YRPA 4JU8A 4ZAXA 3U3RA 3NAGA 1P4AA 1TQ4A 1FQOA 2GLXA 2GJ4A 3EA0A 4KYUA 2VUIB 1CZNA 1PV2A 1E5LA 2W9XA 3W3ZB 4F2WA 5I8WA 2HFJA 4R9SA 2P6OA 4MS1A 1OA0A 1TW3A 2I9KA 3KYCA 4FHZA 3JQ7A 2WM2A 4BNZA 2PEZA 4G0YA 2CXUA 5EIBD 1XL0A 3M6IA 4QRIA 4OPMA 4FWTA 4BKQA 1SURA 1M8JA 5JMOA 2QW1A 2DR2A 3HP7A 3IURA 2R4TA 3N76A 4JL8A 2YMLA 3CINA 1P61B 1KBZA 1S6YA 5JBQA 2P9YA 4QGHA 3T7IA 2NXEA 1ZJZA 1CJVC 4OHKA 3REGA 4BX9A 3GV0A 1ENPA 1LQUA 4PSKA 5BSEA 4WLVA 2Q4EA 4NYMR 3RUHA 4UHJA 2YS7A 2DUMA 3WO1A 5KNDH 5CA0B 2IHBA 2IKSA 4CEHA 4O4LB 2GPWA 1FPQA 1Q2XA 2ZGVA 3KKPA 4NSNA 4S1TA 5D5HA 4RIEA 2YV4A 3SIPA 3HKDB 4L8LA 3DAPA 3CEAA 3MYRA 1LNQA 3PUKA 4MWTA 2QZJA 4YP7A 1EDOA 3FCSB 2ACKA 3IMCA 3IEMA 1G3MA 2FEXA 3PFNA 4FSHA 7REQA 2HZBA 1IHPA 3WTBA 1MX9A 1SQSA 3MWJA 1E4EA 2X5KO 4TXJA 3V97A 3VMMA 1GHTA 2IDZA 4JGIA 4B4KA 5HJEA 4UNPA 3CYFA 4L8WB 3RSSA 3ZWNA 4E12A 4TM7A 4F84A 5BOSA 3MZ0A 3OEHA 1RSZA 3MTEA 5DBGA 3TW4A 1KEZA 1LX6A 5DCWA 1DELA 1U0FA 5JH7A 4OFZA 1KS2A 4HYTA 1U5BB 4G97A 4UVIA 4KE7A 1GXSB 4Z9AA 4LCJA 1CB7A 2FOXA 2G7MC 2GJKA 1G41A 4H7JA 4WSOA 3O91A 1BVRA 4TS9A 4IDDA 5FI5A 1UJ5A 1VXOA 2N0SA 4INOA 5IAEA 3G88A 5J5AA 5UKDA 2OG2A 3QUQA 3TZ6A 2B1IA 1RTTA 2ZUCA 3I37X 2RH8A 3ZG6A 2NXWA 2CNWA 3MS4A 2OCKA 3GRZA 1TKRA 3N2LA 1SD5A 4JUCA 2JGIA 3RQSA 3WHKA 4B3DA 4DCOA 4KRGA 3ORRA 3RRNA 3OOWA 3C8MA 3D6TB 3KKOA 2VAVA 4FZ3A 2GAFA 3QHPA 1PR5A 2ECPA 4PCLA 5I9LA 1SVMA 2AMLA 2XUPA 4WK0B 2AWNA 3PCXA 2GTHA 3LQQA 5A3JA 1JHRA 2VHXA 5EZQA 4B6RA 3IR5A 2Q9CA 1G66A 3MIZA 2WFZA 4GOND 3GD5A 2BF7A 1GLGA 4NBKA 2HHAA 3INYA 4RJIA 4GLLA 4NDNE 2WWIA 1VB5A 4IKEA 4MO2A 4O63O 1GUDA 2IP1A 4UFOA 5AHOA 3LK7A 3EXEA 1U2ZA 3KZOA 3DBOB 2HJVA 5CT4A 3T5CA 4Q24A 5SICE 5FWNA 3AY0A 2VS1A 3WJ2A 4DPLA 5J59A 4FGUA 1TEHA 1TM2A 2XB6A 3ZOZA 4TMYA 1IQPA 3QOFA 1Z2NX 4F5YA 5FLXA 5F64A 4MR8B 4WY2A 1E8MA 3VYTB 4ARUA 4PGGA 5LB2A 1T0BA 4GSLA 4Q1BA 1E9VA 2D0OB 2VDRB 3V48A 3WJ7A 1IU9A 4ZHQF 2R60A 3UATA 1O6GA 3N2KB 2GTPA 2ODNA 4DILA 3PTLA 1UAYA 1V6SA 3MJSA 2PL9A 3K2QA 3ER6A 3QXXA 2VJOA 4GP6A 5JNWA 4E33A 2VRCD 4X6YA 3ADDA 1OBOA 2A35A 4RBNA 5KAPA 2WSSD 3V7NA 1RXYA 3KJEA 1R6BX 2AOUA 4RGVA 4H60A 1F2DA 2B37A 4OTZA 4CCYB 4EGCB 5A1TA 2I2BA 1WD5A 4B87A 1YR2A 2VHTA 4DSAA 5DI9A 1QHYA 2WHEA 5P8WA 2IS1A 3EN0A 3L77A 1HEYA 3E7WA 1GL7A 2WVGA 4D9KA 3ETCA 3JRXA 2IHTA 2H48A 2H7VA 2QRNA 2C4TA 2D2FA 3TLKA 3T0FA 5C81A 1UDXA 1Y3BE 3A1SA 1XP5A 4MRRA 1JR3A 4AJOA 4EPXA 4XKJA 5AFSA 4C7OB 4YJHB 4OJMX 1XZLA 3I09A 4MRMA 3USES 1XYYA 2AQKA 3QEOA 5HUJA 3TNJA 2B5WA 4W8HA 1L1QA 1CEXA 2V3CC 3LUFA 5BN3B 4OLBA 4Z7JA 1N5JA 2PKEA 1BFUA 2XY4A 4WNAA 5EWJA 4M4SA 2JBAB 5E3IA 7GPBA 2XB2A 1Y37A 2H3EA 4J9VA 4MP3A 2R85A 4J2TA 3IMEA 5E4JA 1CVIA 1N6HA 2TMDA 2JNWA 3SHTA 4OHBA 4UDYX 4R1LA 1ULUA 3V4OA 4KAXA 2JS7A 3W3AA 4AN4A 4L0QA 2DHDA 3ORQA 2AMFA 3KSZO 1N6KA 1PEKE 1SVOA 4AF8A 2O2XA 1CZKA 5CFPA 5FD8A 2ERYA 1F7VA 1ECCA 2YDYA 2AR9A 2WP8J 3BMQB 1USVA 5EJ5A 5JYCA 2J4FA 1GPH1 4G5YA 4C06A 5ES4B 3C97A 1Z68A 3D6FA 3DBLB 2QI9F 3GZNB 1G98A 2X4GA 3KJHA 1IJFA 3OFNA 2J08A 4EP1A 2B7LA 3JWPA 5JCXA 4V0OA 2JFQA 1ZDMA 5BVGA 1GUYA 2YRFA 4MVJM 1KK0A 1KRHA 2JGFA 2J3IA 2R0QC 2HR1A 4KWTA 1O97D 1QYVA 4YPFA 4YQYA 3SSMA 1Y3CE 2ATEA 2Q7XA 4V39A 3ZKWB 4BECA 4OH7A 2HSEA 3B70A 3MOIA 2Q0QA 4K6GA 3GCWA 3T5MA 3OF3A 5JQGF 2UUCB 3T94A 1JF8A 4U8HA 3OM8A 3I9MA 1J5PA 2K2QB 4NZOA 3W9BA 5B7PA 3I1IA 4MIYA 1A50B 4QU5A 1JMVA 3JASA 3V8RA 4X62B 3N8HA 3I04M 4B3MB 2X1MA 4XPIB 1B42A 2HMYB 4A6EA 2FEAA 1Z8HA 1UBNA 4ZOEA 1ML4A 3LPAA 1H6AA 1ECLA 1N2JA 2EKPA 4UM5A 3R7SA 2OLEA 3RAPR 1O1YA 4ZO6A 5BMVF 1JG3A 2XVXA 3G8CA 3N28A 3ZQKA 4YCJA 4E46A 1NW8A 3HDHA 4HJRA 4JEHA 1ZGHA 3QWHA 1FVOA 2ETVA 3SFVA 4WL0A 1B00A 2QM0A 1OPRA 2WT9A 1S3GA 3AEQB 4M46A 3PQEA 5DMHA 2V5UA 2AOXA 2G07A 1IHYA 3E9DA 4X1YB 4RXUA 1M2VB 2O20A 3O83A 3VPHA 1TVMA 1CSEE 4QOSA 3FYTA 4IIYA 2NO0A 3LX8A 4E2WA 3LWBA 4CMGA 2FVXA 1F48A 2QUBA 4G0MA 3GNLA 4KO8A 3VU3A 3FKQA 4GEGA 4XIFA 2NP7A 2P6NA 3BJIC 3SC4A 3UIEA 1E0DA 1NYLA 4J49A 4PXSA 2DBQA 2PYZA 4RABA 1Z36A 1A9RA 2GHIA 5E0KB 1E89A 3X3HA 1RYBA 2PZLA 1KOLA 2J7KA 2HMTA 3EK2A 1J22A 2ZSAA 4QG7A 1Z17A 2PWPA 4O1IA 1JKJB 2YWCA 1UR5A 1M0WA 3WGLA 2D5LA 1E3SA 2PRYA 3ZXYA 4YCSA 4GX2A 3JQBA 1VKZA 1A9OA 1Q15A 3KUUA 4ZOLF 4D5EA 3CMCO 1VA5A 2NM0A 4D0LB 1OFTA 1YSCA 4BZQA 2FPPA 3JYNA 4M9UA 1O03A 3DV0A 3PWTA 3DMYA 4IL5A 5J3JA 4YN3A 4HUTA 4BQFA 5JJKA 4MVJP 1YB6A 2GOYA 2H1RA 4YRBA 2O23A 3HGTA 5AKHA 1Q0QA 4HR7A 2PIAA 4URHA 4BLOA 3KX2A 3GT3A 2EJTA 2C54A 4QU0A 4KR0A 3FBWA 1IRXA 4AKHA 2FP3A 2DZDA 4BYMA 1XCJA 1T10A 5AW5A 3W9SA 4GS5A 4RJKA 4D4MA 5IKPA 3W6PA 1RQLA 1V37A 1TXGA 3L6OO 1TZJA 4JHXA 3FDFA 4MUHA 1JBKA 3FOEC 1ZK0A 3EUFA 3O1IC 1CPYA 1WDWB 3U4QA 1V7QA 2XBUA 3W78A 2I54A 3H18A 3ZS9A 2BZSA 3VDMA 1KE1A 4TLBA 1JWAB 1GKLA 5BW8A 3E4CA 1GZ7A 1AQ6A 4TYWA 1WWKA 1E98A 4C6RA 1W2GA 2B6NA 4OCZA 2JD2A 3WQQA 4OQ4A 2I4RA 4Q9HA 5KNBH 4CEIA 4WCFA 1HE1C 3EGDA 5C53B 3PUXA 3OC0A 3IAUA 1A5TA 1N33B 1PDWA 2C1ZA 3PD1A 2QN3A 3E9ZA 3S40A 1Q74A 3AUUA 4IMJB 2ARKA 2DT8A 2OXFA 3QXCA 3AF4A 3Q12A 2FA9A 4BRZA 1Q21A 2JI7A 3R23A 4HPJB 3LQ4A 3R7FA 3DW3X 2B8WA 1KS9A 3ONWA 3QVMA 3FFTA 1WULS 4R1QA 5AXDA 1UMDA 2XZPA 1SUCA 4KSCA 2NUBA 1YCHA 2R6ZA 1NE7A 3RIMA 1SKBA 4BV3A 1ZONA 3A27A 3L9WA 3GLGB 1P1CA 3SX0A 4C43A 2QHXA 4GKJB 2N3ZA 5DLEA 5IBPA 3KBOA 1RHKA 2HSWA 2V9CA 4KDCA 1Z75A 4NE9A 2XF2A 4WH0A 2IV2X 4GZ5A 5CPBA 1JNXX 1ONPA 2H1VA 2PA3A 1Q6YA 4NTZA 3VR6A 4LTMA 3D6JA 3WK6A 3C87A 2UZ3A 4MLDA 5KYNA 2GN8A 5JXGA 2HBZA 5FAKA 1RYZA 2AOTA 3JPWA 3IA7A 2FWAA 3HFSA 1L8OA 4O4IF 1XROA 4R9NA 4C2TA 3MMXA 1L7QA 4GF5A 4CUZA 5FTMA 4CW7A 1PUIA 1CQPA 1PIWA 4DBVO 1U8UA 1B76A 5CVEA 1C0IA 4IJQA 1UZMA 2OQIA 1OWNA 1IM8A 4NABA 1ZN7A 4FOLA 1AG9A 5JC1A 2E49A 1V43A 4F12A 3QLUC 4K81B 1ZA2A 3H2ZA 2E37A 4AIRA 4RZXA 1HL3A 3BD8A 4FFSA 2DSNA 4AJEA 3KTOA 5AW1A 1YJBA 5AOAA 4OHFA 1GVNB 2FPSA 4Q4AA 5IAAA 2V6IA 3LZ6A 1XIVA 3OIVA 5LJLA 1S2NA 5K51A 1ODIA 3PFBA 3ZHQA 3ZJYA 5F73A 3IKTA 1H23A 3FNRA 3W2HA 4LVOA 4IZIA 1Z0ZA 4DUZB 2ZIGA 3EQ7A 4NMLA 2EEZA 2IPXA 4OBBA 2GN1A 5BXQC 4RV9A 1LLQA 1UFQA 2C2XA 5LNK6 1FA9A 3V46A 4D9FA 3JQEA 1VE1A 2P0YA 4EH1A 5KC9A 3KYJB 2QV7A 4KXYA 5AT1A 3USCS 4R3NA 3DMFA 3HJRA 5CG2A 3QNWA 5AUNB 3KXIA 4UCWA 1QTNA 5JFTA 3DT8A 3PSHA 3HXTA 1LJ8A 4I55F 1CQJB 1T4GA 2OMEA 2C7VA 3OX1A 1KC3A 4XR4A 4XUEA 4Z3KA 3DVRX 2JGNA 5IARA 4AP6A 3BMNA 1VJ5A 2DOKA 2IF2A 3OE7D 2BE7A 3IOMA 3LT4A 4A5OA 3J81k 3ABRB 1NQUA 1MVLA 2XADA 3DWEX 4RQBA 1C0EA 4RMNA 3NX4A 3QNMA 4A9AA 4DARA 4EYEA 4MRPA 1Q0TA 3AHIA 3UAZA 5AVKA 4MPPA 4OM8A 1CF2O 2X23A 2ZJAA 3Q9SA 4QGBA 3K1ZA 1CP2A 1V47A 1TK2A 3O31A 3FYHA 5LXTA 4LFAB 1P2BA 2W6CX 2QVYX 3CB4A 4RU1A 4WZBB 3F5DA 5FI1B 1J97A 2FXIA 2VT3A 4NVRA 4C03A 4ZYVA 5AVVA 1QQ7A 4HNSA 5G1PA 2UAGA 4ZYLA 3PBKA 2IU4A 1YZ3A 1XRNA 3OQIA 1Y9AA 1GO2A 2AFHB 1M7BA 1NU8A 1ORHA 1A8HA 1U0SY 3KXPA 2B98A 4PZZA 4BO4A 1PBTA 1OLSA 3F1KA 3VAAA 1L2TA 2FJUA 1NUAA 2VKTA 4Q4DA 1Q1NA 3L0PA 1H6BA 2E9SA 2PH7A 2WT4A 3K7EA 4G36A 5CT8A 1H1TA 5AICA 3BGSA 3W9YA 3IAS6 3RYFA 3LVQE 4UD6A 2ZSFA 3F1LA 2DFNA 3N53A 2SKDA 1BVUA 5CIWA 1Q0UA 5AIAA 1UKYA 3FTDA 5AQEA 4A8TA 1A9XA 5TE9A 5IDWA 4QNMA 3IDQA 1HKUA 3WZ2A 1GCUA 1ISGA 3DDUA 5FBKA 2GPAA 4URFA 4YT5A 1U3CA 4IV0A 4DGQA 5EUMA 4EARA 3B38A 4WZZA 4RNCA 2OILA 1KU6A 3RIHA 4M53A 4CIVA 2XWQA 5A6VA 3L8CA 3E9CA 3EOZA 3FWZA 3KDAA 2X5XA 2A9FA 5K0ZA 4DR3B 1UDRA 3DL2A 5F2EA 5H02A 2NTVA 1UFRA 2HSDA 2Y9MB 5EKTA 1BA3A 2O8BB 4Y2QA 1YR7A 4HQNA 4MRSA 1E6UA 1JZTA 4B6JA 5K8CA 3ADCA 2D1RA 1TMKA 1HDXA 1RNLA 4B79A 4P53A 3R7NA 1PP4A 3D1VA 2W0MA 4YJDA 2QT1A 5L8VA 5JWOA 1Z8FA 3H19A 4MVJG 5JJCA 4TKUA 3CF4G 5DYTA 3BTOA 4KMSA 4L5AA 3E9YA 3EHEA 5K45A 5LPNA 2B8TA 4EPVA 3DLPX 2UYCA 2PGIA 3FX2A 5TJ9A 2EFYA 1P75A 3AW9A 4KRFA 3PLRA 2WD8A 3OH8A 1YQDA 2IXEA 2V0CA 2AFIE 4DUYB 5JU6A 4FKMA 4P5EA 1ORVA 2FPXA 3HB0A 2H4FA 3ANMA 2ECFA 4NX2A 2ZS9A 4WOPA 3SQWA 5HSGA 3F6PA 4Z0TA 4BKUA 5TX7A 2X5JO 5DHQA 3UXYA 4DE5A 1I94B 4M6WB 4QDZA 4B40A 1G0OA 2OD7A 3DE0X 4N9WA 3T3IA 4Z4CA 3G0OA 4J7UA 2DFDA 4Q7EA 5BN5B 3P0FA 4AX8A 2PUWA 2HHLA 2KHZA 4PLYA 3SXPA 3R3XA 3V4VB 2ZIXA 5EJ9A 1C29B 1PDVA 2V45A 2BCEA 5K0NA 3CG4A 2ZWIA 3K0FA 3DM5A 5FPPA 1L5YA 1NNEA 2WTXA 2YZ2A 1PNQA 3QELA 2BTEA 2NUPA 1T26A 3KXKA 2XDQB 2JLQA 4KZPA 4HNVA 5IHPA 1CCWA 4MEBA 4OP3A 2J3MA 4IW3B 4RESA 3ZHCA 1KJWA 4ZI2A 4P84A 2D2XA 1MG5A 3O0TA 4DLKA 2CHQA 1YASA 3K2BA 1ZNWA 2C00A 2FFJA 2AL7A 5C5EA 1RCFA 1YK1A 4D0SA 1E9FA 3SY8A 2BMVA 4BX8A 1FLDA 2N42A 2O0HA 2F9LA 2CXQA 2F1HA 4Z49A 1UOPA 2A14A 2C4WA 2AK2A 2F43A 3TIGA 2VWPA 2CNBA 5JNUA 1NLZA 4UBNA 4BQEA 4IIJF 3T0GA 3ZQUA 5T3YA 3KPJA 2ADMA 5E6RB 2WE7A 4ZT4A 2YXNA 3U3OA 4UASA 5JI3E 1DLJA 5HMMA 1L5HA 1IH8A 3ML1A 4PAMA 4X1KA 4LWQA 2HDOA 3FGNA 4MUKA 4XQCA 5DFAA 3U3KA 3UMFA 2IUFA 4BBJA 5IZ4A 2FZ5A 1D09A 2C94A 4D42A 3O26A 4EFMA 1RE0A 3S99A 1S9DA 5FX2A 2Z58A 4QJ3A 2WYIA 3IL2A 1UEIA 1Y80A 4GLOA 4E2YA 1D2HA 1JXQA 1QSGA 3Q6MA 5CDUA 3GNTA 5SY4A 2RK6A 5JRJA 2Z2XA 3D4OA 3I32A 5KC8A 2JFBA 2Z30A 4MYCA 4ZRDA 2QL7A 3AVWA 4UOEA 1J9ZA 2FW8A 3VC2A 1QQ6A 4R8KA 1T91A 4JMPA 4RD0A 2ZJ4A 5FTWA 1E2KA 1KAHA 1BU5A 3CX6A 3DWFA 2I99A 3FNBA 1EVEA 4MI9A 2P7HA 2WUEA 4TL8A 1CQIB 4N01A 4AAYA 5LIRA 4KAAA 1GRRA 4ND7A 4DMFA 5FA8A 4UEQA 4HGPA 3E23A 4PZUA 1B7GO 1JJVA 1TYEB 2YOGA 4Z3DA 2Q3CA 3T41A 3WWEA 4PX3A 5EEHA 2Q3EA 5IM4A 3UTCA 2R68A 2VP9A 1RLUA 4JVSB 4E5SA 4G8CA 4Q82A 5KX5F 1YR3A 4AMZA 3KKNA 1QQBA 5J4KA 4H15A 4AO8A 2XQJA 1D9XA 4NYJR 1KETA 4Z7OB 2ACVA 2HX1A 3OFKA 4LOHA 5E6SA 3IQEA 4JQOA 1DIOB 2ZK7A 4AZWA 5ALXA 5DU2A 2Q41A 1DQPA 1O9HA 5EZ6B 4IVQA 3F9CA 1L7VC 3HL4A 3IGFA 4JLDA 4L5IA 4AY3A 4UBLA 1MBZA 2MR6A 4RELA 5DBFA 5BSWA 3V1KA 2B20A 2X0RA 3WOVA 1ZK3A 1F5NA 4DYVA 4HQLA 5IP5A 1XJWA 2KE5A 1B41A 2R96A 2JGMA 5AKZA 5IYZF 4QOIA 13PKA 2IYTA 5HKKA 2R2AA 3GH1A 3S7ZA 4LZAA 3STUA 1AVTA 4ME6A 1CR0A 3ZI7A 1TE2A 1OYVA 4B6QA 3GGGA 3RRXA 3DLHA 1SCNE 4HLQB 2YWGA 5AOVA 3QFTA 5JZSA 5HP4A 2DHQA 1C7ZA 8GPBA 1LPAB 4N5HX 2FOLA 2XA1A 3BDIA 2Y2VA 1PTJA 2QX6A 4RJLA 2AN4A 3ILYA 3WYNA 4YYEA 5KYXA 2BGIA 4MQ4A 3C6QA 3F74A 4U39A 2PSJA 4PN3A 2GCGA 1ULZA 4L4ZA 1S3IA 2GPYA 3GFSA 1TLFA 4N18A 3ROXA 4IXMA 4B32A 4EYKA 4CN8A 4F9FA 2EKQA 2R8BA 4HWRA 4L22A 4V1CB 4BKOA 1RPZA 5KNCD 2PQ6A 3WE7A 3S81A 4PGMA 4L5YA 1AHIA 2Q0XA 3WYDA 5A4IS 4J91A 4RS4A 2VI5A 1GUBA 5DXAA 2WUWE 3CO5A 5AJYA 3FR8A 5L3SB 4WOBA 2O2ZA 2H5LA 5MGNA 3HYTA 1LI4A 4M9CA 1U9YA 4ND8B 4UM9D 1PEYA 4W1RA 2PUBA 1R0WA 2VPTA 2C9CA 2RHBA 1Z62A 3PL1A 3EVGA 4QC2A 1OU4A 4OYRA 1SPXA 1K86A 5ELLA 2JLUA 2FPIA 2QGNA 2EDCA 1QXSA 5LYJB 4CMIA 3WQRA 1ZJ6A 1I3LA 1SXIA 1OXTA 2CSXA 3ACDA 1CX9B 4D79A 5F7OA 3MTIA 4P4UA 1QHXA 2XBLA 2ICAA 3T1TA 1YONA 2GARA 1VLVA 3FSGA 5AK5A 4AF7A 5BORA 1U9IA 4BNGA 5ELMA 2EBHX 1UQUA 5F2NA 2GBPA 1M1YE 2OLKA 4G5HA 3KOOA 3O8QB 1XDUA 5FORA 5LBTA 1JFSA 5LA6F 2IPNA 2EFCB 1T0JB 5KVSA 3GIWA 1YBAA 4UE2A 2D00A 1FE8A 3KLOA 3L7AA 3ZBQA 1YOVB 4L5CA 1JQ3A 1IBRA 3LHIA 4XIYA 4XWAA 4ZALA 4ZMBA 5IWAB 4KKXB 3KE9A 1JJ7A 4KNVA 5JSZB 5J4VA 4GKBA 4JU9A 3CKLA 4ND4A 4OXKA 5IDXA 3EMBA 1LLCA 3G9TA 2GJSA 1C3OA 2VVTA 2MINA 3NWJA 4RY9A 5B6IA 1ZRNA 1RQ7A 2HIAA 1DCFA 2PPVA 2P4SA 3LHFA 4G1BA 5IBQA 3C3MA 4YACA 4F7DA 1HNWB 2AEJA 2OTCA 5EMJA 3OOYA 4LRSB 3GRYA 1AGYA 2F2TA 2VQDA 3NBQA 1EVKA 1L5RA 5AHKA 3ERCA 1IEQA 2QL5A 2VF7A 4IG4A 5DEOA 2A94A 3HCEA 4M76B 1H85A 1N2SA 3UA4A 3ZCRA 2HJWA 1TUBB 1NUHA 3DE1X 3DQPA 3HVIA 3KTFA 1IN6A 2HLDA 5I7WA 2Y3IA 3LCUA 2FG7C 5CTAA 4N3CA 3QP9A 4ZO8A 5ISMA 3HCRA 1CY8A 2W4IA 3BKXA 5AD1A 2YJGA 4O3MA 4EJFA 2GZ3A 4I3HA 4EF6A 3HACA 3F7OA 1N2BA 3GGCA 1NJGA 1PDOA 4KMMA 3SM3A 1EX6A 1MT0A 5KQMA 3DVAA 1RWWA 3K96A 1JBEA 2Z2ZA 1VPLA 2D1TA 3FNIA 3PGKA 5ARDA 4BFTA 1FX0B 5ED0A 4C78A 3M70A 3EEIA 1PGOA 2ABWA 2GAIA 2P9FA 3DLIA 3GT4A 1L4FA 3PFGA 5K3CA 3VH1A 1I7DA 5GOZA 3P71T 4NG4A 4U7DA 4HNRA 2C9MA 4H0FA 3HU1A 4B2YA 1BEEA 1P1IA 4XW2A 4Z4FA 1TU4A 3T5GA 3DC7A 2QW8A 3I5MA 2IZZA 2ZJOA 3SOZA 2WHXA 3BSFA 1GYQA 2NVUB 3JRWA 2ZR7A 2Z9CA 2W5UA 2PY6A 4BUJA 5C7OO 1W88B 4M54A 5DHSA 3OICA 5E4YA 4BPRA 3CEPB 5HA5A 2G4VA 2VPPA 3MAJA 4MW1A 2WG1A 5CCEA 1QHEA 1E2NA 1KO8A 1PZNA 5LDHA 4NXNB 1H6CA 2LDXA 4UHFA 4O4JB 2NACA 1R88A 2Q28A 1OOEA 3T5TA 3CH5A 3RK0A 3V6LA 5BUZA 4DUPA 3P5SA 4PPGA 3Q15C 3F7TA 3DOFA 2QE7A 3IV7A 4JV5B 2ODWA 1VJ0A 4O4LA 3IQZA 1W0KD 1E7QA 1IEVA 4CL2A 3PUZA 4YJFB 1NN1A 1EFCA 3AU9A 3KCNA 4MH0R 4OY3A 4V02A 5CA1A 3WHLA 4Z7NB 5EJGA 3VZRA 4KUGA 4LJ7A 1G8PA 3C6KA 3T7SA 1MW9X 3TXXA 5AM3A 4R31A 4CMAA 2OYCA 1IONA 2VYVA 2PH5A 3X44A 3ELUA 1SJ9A 2L82A 2J5BA 3CRZA 4BDTA 4YCNA 3WIBA 1GY8A 1KC1A 3EVAA 3TZBA 4BEVA 4HNQA 1WP4A 3GH3A 4DCCA 4PZEA 3K9BA 1KXZA 5ILGA 1BA2A 3G5MA 5FNVF 3HYNA 3CLVA 1W49A 4F8EA 3I5UA 3ICPA 2HF8A 2PR7A 4NEGA 2FUG6 4L0DA 3FJYA 5EIFA 2IYSA 4P80A 5HJ5A 4B09A 5DN9A 1T2DA 4C1BA 2QVCA 3NHZA 4AZ0B 2JHPA 1X9GA 1XUOA 2GZDA 1GZHB 3URMA 5KBYA 3P19A 3AVTA 7YASA 4S05A 3RSQA 3D8RA 3BXHA 5IUJC 3M3PA 5FPHA 1KQFA 1MQ8B 4DSZA 3IBSA 1CJUC 1ZH2A 4IH9A 1AKRA 5F5LA 3RC7A 4F8JA 2JCVA 3KSDO 5JYEA 4MQFB 1E9DA 3HABA 4XWKA 4ZAYA 4JI1B 3R76A 2HCFA 2P9JA 1QHHA 3MWGA 4H7KA 1Z5UA 4JVOA 4F56A 5D6OA 3NBXX 1DQZA 4PO3X 1OLXA 1T2VA 4WNCA 4ZOBA 5HGJA 4ZZ1A 2HH9A 1WCIB 5CBKA 2JIZA 4DA8A 1NN0A 2O50A 4KJZA 3TIIA 3ZTWA 4BVAA 1ZD2P 4QBGB 2VHZA 3E5RA 3E1GA 2NNLD 4PINA 1FLNA 3R6LA 1CUCA 3O3NB 3KL4A 3MB8A 4JT8A 5KTSA 1CERA 4XRRA 1LA2A 2RKWA 3P1JA 4PCUA 3QF4B 2PNFA 3C3PA 2J0SA 3KQYA 3N2KA 3GVCA 4II2A 5E6UA 4EVQA 2YUTA 3SJUA 2ONKA 3UK6A 4U2GA 1Z63A 5G3ZA 3A9TA 1JR4A 1MB2A 1ZM7A 3LVRE 1KVUA 3HJUA 2Y76A 2JLRA 3VVLA 1KGDA 2JZOA 3FFWA 5IMBA 3D7LA 5E1BA 3NWPA 3E3MA 4W9NA 5B7GA 1WZ2A 3FNHA 3CSDA 4P82A 5BT9A 3WP0A 1D4OA 4QQNA 1TVKA 1GQQA 1M2NA 3MYYA 5IN4A 2X0EA 3OJOA 1EWKA 2H7YA 3QFFA 2ZRMA 4WI1A 2IWHA 2MSWA 3SDSA 3DG9A 4A1OA 4K46A 3I9KA 5HX7A 4LHXA 3NU1A 2V7EA 3WK5A 3KQKA 3DCIA 4TOIA 1IWOA 2GM9A 3EH2A 4P3KA 4X20B 3OCXA 3EZ6A 4ND1A 2GILA 5EVCA 1A4UA 4NULA 2ZAMA 1KHTA 4F38A 1WE2A 5ARCA 2AJ8A 3GLIB 4WLOA 5KS2A 4P0TA 1UK9A 4ZJUA 3DAHA 1W85A 4DLWA 3AF6A 5TQ0B 5EYPA 4HGYA 3R8CA 1A8UA 1M76A 3S5JA 1W35A 3ST7A 4MYHA 2PZMA 4L08A 4I3FA 3VNSA 1SHKA 2XUGA 4IXTA 4Y6RA 2POCA 3KFLA 3ROZA 4TVSA 1Z29A 2J6BA 4HZUB 1YQXA 5IXYA 1Q19A 3QVOA 2LTAA 4JWTA 2GM3A 3QTBA 3ND6A 3TLCA 1IZZA 3KKMA 4ZEXA 3TLGA 5K4HA 1U63A 1COZA 3U48A 3UFBA 5C9ZA 1OXVA 1N9GA 2Q4RA 4CIAA 4MUIA 4IO1A 5KHLB 2QN2A 3ZHRA 1I0ZA 2HCTA 4Q5IA 5SYAA 3WQBA 3ZDYB 5TF0A 5IW8A 4V1CA 1I13A 2CXNA 3RS7A 4F91B 2JDIA 3PGA1 4ARSA 4GXQA 4MVWA 2H4HA 5CYFA 3OHSX 1X13A 1F0KA 2CBGA 1K8RA 3UWMA 1X1DA 1U7PA 2Z6VA 4OX9Y 1T2NA 3IOEA 3EASA 3LXXA 5FPKA 2XCLA 1T3TA 4YWJA 2H54A 3HDTA 2QJRA 2I80A 3WSVA 3WA7A 4HY3A 5AI9A 1NW9B 3GPCA 1S7GA 3EMKA 3EE6A 2HU5A 3WGTA 1DEHA 1M34A 2W2KA 2AJBA 3MWEB 3KOMA 4IKOA 1Z25A 3TN7A 5HCUA 4L8VA 1PWHA 3K6JA 4H7FA 4IQFA 2OOKA 2C58A 3ADOA 5KYUB 4D26A 4QJIA 1L5OA 3NAZA 4HUJA 3ZNQA 4DHEA 1WXQA 3PRKE 2XUDA 2E5FA 2ZAGA 3ETJA 2WTUA 4DA7A 1TJPB 1UK7A 4EX6A 3U44A 3B13B 2NPOA 1XQVA 3DOIA 3A3YA 3EF1A 1BE1A 2OHIA 5SY9A 2Y6UA 3TUIC 3ZHUA 2GO1A 2FGKA 3GN2A 2DY0A 2JIBA 1YBMA 2QG4A 1P31A 2L18A 3NVDA 4M7OA 3FPSA 5AVOA 4BMCA 2YWDA 2P4EA 3L46A 4LOIA 3LHKA 5I7AA 2IYWA 3E0QA 1C3EA 4ZHQA 1ONNA 4RTNA 1ID8A 1NQAO 3CNNA 4LJ5A 1F6DA 2YVUA 1ACJA 3GLHE 2DQKA 2HTEA 1ZVMA 2F90A 4CJXA 4C0SA 1U8AA 3CUYA 4QREA 3C98A 2CLHB 4QAJA 4FILA 3ZLTA 1QG4A 4O5AA 1IOVA 4C01A 5B4VA 3B6KA 1WMAA 4MVXA 3LX4A 1J7KA 1R4NB 3EMDA 4MWZA 1KZ4A 4N54A 2I4TA 2H52A 1U8YA 3L0OA 1BMFD 4LRUA 5J2TF 1XTSA 1RFGE 3RGGA 1GPWB 1XBTA 1E2JA 1M5UA 3GLQA 5AJUA 1JYSA 2E1RA 1QCCA 2VNJA 4FXOA 5I9SA 2CE2X 3CT6A 4TYNA 1EGVB 5D3ZA 1UKEA 2RIRA 4OJYA 1ZHHA 4YLGA 1RVV1 4ASUA 2GEKA 1QHIA 1B23P 4CR6A 1UL1X 1OHHD 4I1OA 4OHRA 2WABA 4UUMA 1PSWA 1QYRA 1KE2A 3CRNA 4G0NA 2A1UB 3BE8A 3PZRA 3IIIA 1PGJA 4B6FA 1YA8A 3DZKA 1KXJA 3PKZA 1TQHA 1YV9A 1XQ6A 4IDAA 3DUFB 2OWDA 1B14A 3KJZA 4HCJA 4C3OB 3HKEA 3TX6A 3E0XA 4JVMA 2P6RA 3H3XA 4IS2A 2FSFA 2V6FA 2A0YA 2VHYA 1YB5A 4JP1A 3I6IA 2ZBFA 4R68A 1A7JA 3WP1B 3M8KA 3FDZB 2G25A 1CE8B 1YHZA 2DKNA 4KE9A 3FYUB 4X3PA 1NJ2A 4CIDA 2PLNA 3AR5A 1UBOS 3BXEA 1CFZA 1QX4A 4OHPA 5AUOB 2NP6A 1RXUA 2VUTA 4AY6A 3EVCA 3PB3A 3D64A 4Q93A 3DKKA 1J39A 1YGPA 5K99A 3KWLA 4H08A 2ZKIA 1RP1A 4DR5B 1C30A 2AX3A 4Z7QB 3ESDA 1SBCA 5GJWC 1P6QA 1NASA 1RWKA 3ODGA 4J6FA 2I9PA 1HE3A 3O4RA 2BHSA 5JD6A 2NU9A 3IHLA 2MSEB 4B1FA 2ISSD 3I4LA 5HR5A 2WICA 4AY4A 4YONB 4BBZA 2XNSA 1ZGJA 3H17A 4W82A 3PUVA 5CJPA 3IAS1 4WEOA 3UV3A 2R8PA 5THXA 3C6ZA 4YMHA 3C1TA 2HF7A 1DAHA 4GGOA 4ZDIA 4BQRA 2PWZA 2ORED 2JLVA 1TIPA 1PQWA 2DWQA 4E5DA 2ZJ1A 5ALWA 4MWCA 3WGYA 3FOBA 3T8YA 5A5FA 1GUFA 1Z5WA 3F5MA 3LOPA 1NG1A 2GN9A 1RJ9A 2OZKA 1PGNA 3MAGA 5JQGA 1HTTA 2H92A 4KIGA 4LOKA 3SG0A 1OU0A 4DV6B 3CVYA 3ZDAA 4CKYA 4G0OA 1C8LA 1OROA 3DYVA 3OU6A 4OQZA 3A6GA 3K72B 1IOLA 3D8SA 4MW7A 4OQEA 4XPZA 5I48A 4ZGWA 5LOVF 1J0DA 2VDUE 3U4AA 1UBUS 4C0AC 1OIWA 1WCV1 5BNIA 4DC9A 4YJ3B 3FYDA 4Y8VA 2BDTA 3BILA 5ITSA 1R0KA 4M88A 5CLFA 4C0JA 4TMZA 4Q05A 1E2QA 2HMVA 5BMVA 1SZPA 5JADA 4UE3S 4I1SA 4KEAA 1M2HA 2DQYA 2Q1UA 2YCLA 4LOLA 4NBUA 1FUKA 1LW7A 4NR0A 4UBOA 3WGNA 4DEYA 1OILA 2REOA 4PCAA 5DCUA 1ZL2A 2WSMA 1NKTA 5ALYA 3QYFA 1U2SA 3AOGA 4WERA 4GXTA 3GX1A 1J9EA 3OPYA 4KC0A 1R8XA 4MS3A 2A0WA 3AETA 3IALA 5K0LA 4MVJH 1N2OA 3DC2A 1SCDA 4Z9YA 4XJTA 2B6HA 4Z8YA 4OA5A 4RHFA 1IUPA 3NYIA 3UXEA 2UVQA 4AZ3B 1ZW6A 5SZJA 1LW6E 1N2CA 2J45A 2FZGA 2O48X 4S35A 1ZIOA 5D87A 2RD2A 1VLZA 3O5AA 4K26A 1XZGA 1I7NA 2QX8A 3TM4A 3UGTA 3C39A 5J2TB 2CV1A 4MCHA 3WOHA 2A6PA 1XD8A 4YJGB 3HRKA 1XHLA 1L5NA 2HUPA 4BLSA 4CQMD 4JZYA 1IJKA 1E1RA 2O57A 4CKBB 3BBPA 3ZD8A 3R7AA 4HQRA 4ZOLA 5GMOA 1SC6A 3WNDA 3P2JA 4LDZA 3RLIA 4GM4A 4IPTA 1SCBA 4NHEA 1Y89A 2IHYA 2NQ2C 3GCXA 3OFVA 4MUEA 1A96A 4NH0A 4WKGA 3V4RA 4K7JA 1FNBA 1M72A 1WLYA 2RMKA 3FXAA 3OPVA 3BMOB 5IC6A 5KVAA 1P73A 3D1JA 4OQFA 1MO6A 1DADA 1QORA 2IHUA 3IUJA 1NW7A 4TWZA 5IBRA 2DY1A 3THOA 5BNWA 2YVKA 1QHNA 3QKSA 3NC1C 4IS3A 5JAUA 1ZD9A 5IUKC 1A9TA 5A9SB 1P0FA 2VPYA 2VZEA 1KP3A 4IDBA 1I6KA 4HYYA 3UB2A 2WIJA 1J5EB 2ZYSA 3M1IA 1JVNA 2LWIA 5HF5A 1CYEA 3FMVA 2H1CA 1AZTA 3I58A 2G9UA 1NBHA 3QVSA 3ZVLA 1JQDA 5BW5A 3HV2A 1MO4A 8OHMA 1OJLA 1KI4A 2FR0A 1YJCA 2PKCA 3RYIB 4IX1A 1G42A 5H70A 3WV5A 3E5MA 1VDMA 1QZTA 4DKJA 2Y71A 1ZGAA 4IUCS 2BN4A 4YHBA 1M1ZA 3Q5GA 2ZTMA 4IIGA 1VSUA 1PJCA 3PNBA 4R51A 1ZRHA 2EJVA 2BZ1A 3AM4A 2ZVJA 5DH9A 3LM8A 3B7PA 3PXUA 2GCIA 4GWKA 3VHQA 1G16A 4J0IA 4L4SA 3HU2A 4KMRA 1FIUA 1I1NA 3I1FA 4HXEB 3BK7A 2FLKA 2XQGA 3DFZA 2X9VA 2XRFA 3L8DA 4N5IX 3U62A 4Z4QA 3MN1A 4FWBA 2ASEA 2WMNB 1KDYA 3D2BA 3GEBA 3SJAA 3CKKA 1J2TA 2EFHB 3ZIUA 1R0CA 1DP4A 3DAFA 5F12A 2O06A 2GZ1A 5AW9A 1DCTA 2OHOA 4BWGA 2H57A 4ZAZA 5CB0A 1MB3A 4BE4A 2GN0A 3HY4A 4HAVA 4RA6B 2Q6KA 4B80A 4DWJA 2IIBA 3EXHA 3H5WA 2CVPA 3P9IA 1HDRA 3RYHB 4ZGBA 2ZJ7A 1NXOA 1U65A 2HNKA 3AM3A 3EDOA 2ZLBA 3CURA 3QW4B 1P17A 4IRMA 5DRYA 5DTJA 1CQXA 2BEVA 1T9KA 1AA9A 1YHNA 1JHMA 2B2CA 1YC5A 1NMQA 2BHTA 1GNRA 3G5AA 2XNHA 1T1RA 1UF9A 3CLUC 2WWTA 2A5FA 1RHMA 2DQZA 2R44A 4FYVA 4TQ9A 5A5DA 4NCNA 1E0KA 3OECA 1W1UA 3D2AA 3DMHA 1QO9A 2HF2A 2VXYA 3C7TA 2O1XA 2HN9A 1O3YA 1CRPA 1A9PA 2W70A 1PTJC 1XP8A 3RJMA 4ARBA 1V11A 4O4IA 2VTDA 1PFWA 2RGEA 3WQSB 4CM5A 3AEUA 1FLVA 3THYB 4TVBA 1FYDA 2QAIA 1ZQ1A 5K0JA 2XCSB 2CKMA 1V39A 1YL6A 3SZLA 1GKKA 4BX0A 3JYQA 1PNTA 3ECSA 2O2SA 4PPQA 1G6OA 4CXMA 5HMLA 3LKDA 2Q8PA 4MV6A 2C7QA 3A4LA 2FQYA 2ZBRA 1P60A 2EL9A 3IOYA 3LXUX 4L4UA 4NS4A 3T15A 3NG1A 5T41A 1GAJA 2C0PA 5BWMA 4NC9A 1YK0A 3KLMX 1P5FA 1E8NA 1LF0A 1A8SA 2QE6A 1WZNA 1PWZA 2ZYRA 3MGKA 1IEXA 4LHYA 5FTJA 4DCVA 1IY8A 2FSPA 4Q1AA 3CXUA 5LQDA 5FBQB 1EXWA 1ICIA 3PCRB 4Q19A 5ALZA 1SVKA 2HDWA 4ANFA 3AK4A 1DDIA 4AO6A 1XRJA 3NI2A 2IL1A 3HR4A 1A4IA 4QUIA 1AK1A 4TKVA 4Z53A 5EIHA 1FYEA 1O9GA 5LDGA 5JT1A 2AJLI 2VR1A 3AKDA 1SNYA 2P5TB 3F9IA 1G5IA 2AYXA 3HR8A 3N8IA 4FGSA 2F9MA 2P2SA 3LUJA 4Q39A 1Q1QA 2JVKA 1U9IC 2PRKA 3AVOA 5CB4B 2Q1YA 5T6MA 1NPTO 1QH8A 1MEOA 4LCBA 4I55A 1JECA 5J40A 3RFTA 1Y98A 3LP5A 3GYBA 4LEIA 1ND6A 4A16A 2QAGA 1DWUA 1T9ZA 1Y5LA 3QKRA 3FOFC 1EZ1A 1KDOA 2Q45A 1JEJA 2XDQA 1LQTA 2P5YA 1E7RA 3IPYA 5L7YA 2WZCA 2YVAA 3NCTA 1QP4A 1JPJA 4DCGA 2VQEB 1XU9A 2CZQA 4I4TB 2F64A 3EZ9A 3M4NA 1NWHA 2YWHA 4OJKA 5KMGA 1IWPB 4K2AA 4PXYA 1CUWA 1PD1A 3H5VA 2VRBA 4TS4A 2PSFA 1BH6A 1QYDA 3H5IA 2FFRA 5CXSA 5T4HA 5IJ9B 1I24A 3ISTA 2PEYA 4DV1B 1E1NA 2VXCA 1JKIA 1OY1A 2PN1A 3C8DA 3ZDCA 2P9ZA 3VH4A 4CDGA 3UK2A 5JXWA 5B4UA 2YUIA 3OT1A 1NPYA 2QBYA 2O0MA 3HG7A 3CX3A 1BWSA 4JB0A 2PS1A 3GPLA 3MTJA 2WFAA 5KJ1A 4NBVA 1EP3B 1B8PA 4P7FA 1RWBA 2B8NA 1EI9A 1EHIA 1RLJA 1AB6A 3G2LA 1E2DA 3I64A 4M98A 1XMOB 1DFHA 4X24A 1P7WA 1MC5A 2VUHB 5E7IA 4YHHB 1LDBA 3AF1A 2I4NA 5B64A 5ER6A 3VHRA 4ZKEA 4AMUA 5F23A 3JCZA 4NS1A 2D3TA 1DQYA 4JC4A 4CTJA 4EG8A 2H4XA 1FLAA 3ZDZB 3TTXA 1ZD3A 3I9LA 5TPZA 1O4VA 4OMCA 4FMCF 3QFCA 4CR7A 4IIBA 1CF9A 4M0FA 4JXZA 2EDAA 1RBQA 1BHJA 2ZB3A 2Y0PA 5BSMA 2LPMA 2GWRA 3X1ZA 4AXXA 4Z6KA 1E1QA 5BR7A 1NMZA 4K9PA 1UK8A 4E14A 1QVWA 1ADFA 1YULA 5HDQA 3STHA 1UBTS 1E6KA 3DVSX 1HSZA 1DXYA 2ZB4A 5D7NA 1VJTA 1DWQA 4IWNA 4JP5A 4GG1A 1KPIA 1OFHA 2AYZA 5B58T 4MDYA 3OQPA 2DC1A 1ENOA 4K9LA 3ENKA 1PZFA 3ZC3A 1IXZA 1IATA 2YOFA 3DF7A 4HLCA 4LZOA 3UXHA 3HJHA 3EVDA 1TQDA 1C9DB 3FRJA 3HV0A 3RS0A 3L4JA 3WDLA 1OZFA 3A36A 1XZJA 1YQTA 1WF6A 4GGMX 1YDWA 4ZAGA 3RG2A 2WYWA 3O4GA 1X80A 4P54A 4XQ0A 1QCZA 1DOZA 3VYVA 1WOYA 2IP2A 1FXWF 4L9WA 3DCYA 2ZJ2A 4N0EA 1SCQA 3A2LA 3W5AA 1UAAA 1Q84A 5L4LA 4QPJC 3DWGA 2ZPAA 1A97A 2OFPA 4FBGA 3TRDA 1AGRA 4YRIA 1RJGA 4JUBA 2RGNA 4XM2A 3OM0A 2XVZA 4DV2B 1NM5C 5EOVA 3NHYA 3RR2A 3E5NA 3H1FA 4PHCA 2E4XA 1NQWA 1MZVA 3QU9A 2ZG6A 4OXQA 2OKGA 2R62A 1UC8A 2XXAA 1JQAA 3LJKA 4FN5A 3QA3E 4KV7A 3N07A 2DHRA 4WKNA 3ROGA 4RK6A 3PT9A 4G26A 1NP7A 4X54A 4RHTA 1GL9B 1W96A 2YW9A 3UZUA 4C4AA 4BO7A 1G8SA 1UXJA 1Z3IX 3A4MA 2H2AA 3EZFA 4ZT5A 5A7HA 5F4BA 3R6TA 3FI9A 3EXIB 3I45A 3J80A 1NAHA 1M6VA 2CFIA 2OBMA 5KSPA 4N6OA 4TMFA 4GPEA 4G89A 2DR0A 4EY6A 1XWIA 4KAFA 2VCYA 3FGZA 3E61A 1AB5A 3T9BA 3ZCQA 4KMOA 3WYFA 4E4TA 5CYGA 1JDBC 4EKEA 5JS1A 2EGUA 2WA1A 4E88A 2YHUA 1QH9A 4H3HB 1VL0A 2IIVA 2HA5A 2QY9A 3EARA 3EDYA 4JYAB 3EFEA 4CM6A 2I6TA 4AULA 2NAPA 4R9UC 4X63A 5EJ8A 1NXTA 5BRAA 3ROMA 3PF8A 2VHQA 3IPCA 3NATA 3KQUA 1T34A 1B3RA 3N2GA 3AESB 2OAEA 2V6GA 3TZQA 3I4CA 2YFHA 1JW9B 4GPZA 2QTMA 3OUZA 4R2IA 3Q9NA 4J94A 4CF6A 4Y2XA 1NRJB 2IYZA 4JIMA 1MTOA 3OQMA 4IIJA 4IGAA 3WBBA 3H2KA 3IDFA 3U6KA 4MZXA 4LZJA 4KSYA 3GPBA 4B4DA 3R6DA 2FUG1 3Q6IA 5D6NA 2VA8A 4BIIA 4F3RA 2PMWB 3S1LA 2D4AA 1GQYA 3RVKA 2OM6A 3V33A 2R87A 3G2OA 4R9VA 4UUBA 2RGWA 4HADA 2FMHA 1LDNA 4DT1A 5BW6B 1CJBA 2XMBA 3A9RA 5HF8A 3W9UA 1QKJA 1KK3A 1YDGA 2UZ1B 5L40A 1MPTA 4O59O 1AS0A 1GZVA 1E63A 2WSSA 5E9QA 4KHPB 2YASA 3KQPA 2IZ6A 3W5UA 4RTOA 4X95A 4TRNA 3TLBA 3W7AA 1YVPA 4W9NC 3FWKA 2CJFA 2RONA 3EZXA 1G6KA 2HT6A 2JARA 3PNOA 1PL0A 5CLHA 1XB2A 1H0RA 3UHAA 4AZVA 3UNXA 4ZQIA 4B7UA 4QGSA 1CS4C 1XO1A 3DTNA 2YVQA 2P62A 1P2TA 3P0JA 4YYZA 5KKNB 1XZEA 3AINA 4OO3A 2B9EA 2GWHA 1WUIS 3H1BA 4CMCA 4OFXA 1RMTA 1JAYA 2VIIA 2D0DA 3BIWA 3HXPA 4E5PA 1EFTA 3P2EA 4J0FA 4JBNA 1QF9A 2E89A 3FOWA 1FNSA 2XE6A 2Q5CA 1CETA 3K8OE 1E5XA 2H7CA 2IHKA 3IJPA 4JDUA 4XTCS 4CMEA 3ER9A 1OLOA 2AKEA 3VPBA 1ETHA 5LD2B 4LQDA 4QJBA 1G8FA 4NECA 3MUNA 5KX5A 3UPTA 1OB2A 1FNMA 4RYDA 1V8PA 1L9XA 2NO9A 1K9SA 3T95A 5LQCA 5MN6A 2CLFB 1RWOA 1A3CA 3VNAA 1G5QA 2XGSA 3EEBA 4RIIA 3UQZA 1H0KA 4OQLA 1SFRA 3W8FA 3KUXA 4LZNA 4NEHB 5BUSA 3L06A 3OI7A 1CP3A 4KQEA 4R3WA 1R10A 1AN0A 4ARZB 1ECGA 2GHRA 3PD0A 4Y67A 1L5FA 4UPEA 4QFDA 1YL7A 2QUAA 4ZTZB 1NR1A 1CR6A 1NHGA 1FX0A 2JK0A 5IYZA 5C2JB 3MVEA 1TECE 4RHYA 1ZM4A 4XFDA 4X8HA 4GE0A 1Z6YA 2NT3A 4MKRA 4BB0A 1XN4A 2XI4A 2OSVA 2XHZA 4DV3B 5C34B 4G9BA 1JHQA 3KSRA 1Q5PA 4H77A 4NBNA 3UUWA 4GDFA 1V95A 2IOHA 4Z4HA 2HQSA 4PZ0A 1SVIA 1DKNA 1U80A 2ZRPA 1GSHA 2G4CA 1VGVA 1FFWA 1FSFA 4ITRC 4ES6A 3GJ8A 1J8MF 2WI8A 3L1JA 3OO0A 4UBJA 3AU8A 1F9AA 1T1EA 2AZXA 1G9SA 5JCOC 4OI1A 1Z4OA 3IBCA 4QO8A 2XGJA 3HN6A 1DX4A 5FJJA 3EFBA 2BH2A 4R2KA 2FR8A 1V25A 3CNQS 3AMVA 2YN0A 1TZMA 3ESYA 2OBLA 4EDFA 3AUYA 2C8VA 3KKLA 2Z4SA 3H83A 3BYZA 1U3VA 4CF3A 1BRTA 2I55A 1E79D 4IZHA 4YJFA 5H68A 5KWIA 1VI6A 5D1HA 2Q7DA 4ZVSA 1T0IA 1Z0DA 5EA2A 5FV7A 1NU6A 3C48A 3DDHA 4BNTA 2J9ZB 3SM9A 2Z98A 4I1RA 4QYSA 1N57A 4QM7A 1WPXA 5GVRA 2OCLA 2P2DA 3KTDA 5CNJA 2AZ4A 2OY0A 3UOAB 2OGSA 1KZYC 3V1TC 3JSXA 4E1AA 4UFNA 1UOEA 1NBME 5MDHA 1R0XA 5KWSA 4HDMA 4IHAA 5EXEA 3LYHA 4PG7A 4TL9A 4X6UA 3HVRA 2LE0A 1GG8A 4NOKA 4CEIB 1X39A 2JVIA 5LA6A 3VYWA 4URVR 1UC5B 5FPSA 4JGBA 3D8UA 1PZMA 1RU3A 3B3JA 5A3QA 3HYRA 2FVYA 3W2IA 1FFGA 3IQHX 1PTKA 4EWLA 3TXAA 3PQ7A 2RG1A 1E59A 1ZJJA 3FTPA 1EUDB 4NEQA 5ESDA 5C5DA 3U60B 3T6KA 4GYJA 2NUTA 3TLZA 1ZKDA 2GEDA 1GRQA 4DWOA 3GRPA 2VJPA 2HL6A 3KM0A 3ECCA 3MJTA 4RIGA 3T3MB 4ZCIA 1F6BA 1C1HA 4F3NA 2SCUB 1K6MA 4ALIA 2OCDA 2AE2A 2DMRA 2AOVA 1DPFA 2PRZA 1KPGA 4IDGA 4OBXA 1W30A 4RD3A 5E8RA 3UMSA 2BELA 7AT1A 4B75A 2AXNA 4KFUA 5G53C 1H0HA 4ZYUA 4RNDB 1KARA 4UQLA 4ETWA 2BTQB 2B82A 2WUFA 4HLNA 2QN6A 3MUFA 2DTXA 1JZQA 2IHZA 1TA4A 4J1NA 4ENQA 5AW3A 1XLTA 3T12A 2XYVA 3GDFA 3RTAA 1E9EA 2BCGY 3CJQA 4IHKA 5A02A 1Q7BA 1XU4A 2VL7A 4KO2S 4L72A 3TR0A 4XYBA 5EFOA 3EUWA 2W2PA 4D25A 1N1GA 1SU6A 1U8ZA 1XZMA 2W8ZA 1Y1SA 3GT0A 4QQRA 4F1JA 2VQSA 1SO8A 3PIIA 4NG5A 2R6GA 3IQXA 4O1HA 3GNQA 2O3TA 2EJBA 1M3SA 2HREA 4DCUA 4YT8A 4WLEA 2PKQP 1M7GA 4AK9A 1IQUA 2V3WA 3EDCA 3JQAD 3VGJA 4GM0A 4AWAA 4BFVA 3FUTA 3R09A 3UMJA 4LF5B 3D2LA 1JG4A 2ZRIA 2CJWA 3B9PA 3WA6A 2K4MA 3N7UA 4UUQA 4D4KA 4TPKA 3LTNC 3CEMA 4QBKA 1Z08A 3ZY2A 2H51A 1TD9A 3H8JA 1ZH6A 3LE8A 3EH1A 3JVIA 1CG6A 3SSAA 4LDPA 1H4TA 2XHEA 1W5BA 4YRCA 2GFQA 2JFGA 3HY6A 1E32A 3HPQA 4MYUA 1S1MA 1VSVA 4O2AB 4HK4A 2ZUTA 3U56A 3BSWA 1WKCA 1WQ4A 1YBHA 2AF4C 5MGBA 2O6HA 3TLAA 1ZCAA 3TIXB 2YQ5A 5KOIA 1NUSA 3WBKA 3JZFA 2X7HA 3VVCA 1KMHB 3NBMA 1UXHA 5DYWA 4MV4A 2QTWB 4QARA 1PLJA 1VA4A 2XOKD 4J8PA 4EVRA 5CDGA 2ROQA 4EVSA 1YCDA 4WNYA 2DSTA 4P58A 2PUVA 4HXYA 3ZHXA 3GLFE 2ZSIA 4D9EA 2ID7A 4IJWA 3RBAA 2J0EA 3JD2A 4HI0E 1QHFA 3WSWA 1EBFA 5TQ0A 4E4YA 4MR9B 1PV1A 1BJRE 1Z4MA 4YRDA 2ZI6A 1J8YF 4INPA 3EBLA 4IRUB 221PA 4PR0A 3SEFA 1JUDA 3ED5A 1YIAA 1I5RA 2ILTA 1XJQA 2ZTSA 4WTOA 5EEGA 4YRRA 3BIJA 1PD0A 2W6QA 4HEA6 4PLGA 1IBSA 2WIBA 2QMOA 1BHSA 1U2GA 2PVSA 2R3SA 3K20A 3T3HA 3X1JA 4CV3A 5A3RA 4DTIA 1BVYF 1HE5A 2OAP1 2WQ6A 4KK4A 4OHCA 3UOGA 4QM6A 2IDKA 2OV4A 2QSZA 4F6CA 2RHMA 3H5NA 2KX7A 4TGLA 5G4KA 3VPFA 1T4DA 1UBRS 2EX4A 3CWZA 4KIJA 4LZPA 5FNVA 3V7UA 2JFWA 3G85A 3VKWA 4A6DA 4PQRA 1TDJA 1YZFA 4I2VA 1JQEA 5DGIA 1T8SA 4V0SA 5G4LA 3RRMA 821PA 1AUVA 4CI0B 3Q2IA 4NPCA 4EI7A 1JAXA 2LD4A 2IU3A 1XD2A 4NCIA 3EYAA 4OI0A 4Q12A 4KITB 1ISMA 2GGSA 5CW2A 4YPVA 3HEMA 3W04A 4BQNA 1DI0A 4OHMA 3FUVA 2O8VA 3R5SA 3BULA 4G01B 2YXLA 4S0ZA 2V58A 5TR9A 2YWEA 3OLCX 3THRA 2BM9A 3FGPA 3WB0A 1JA9A 1N0IA 1P74A 2PRJA 1OI4A 3AEYA 3L7JA 3G7UA 1Y33E 2C4MA 2XEXA 3BE4A 1YRYE 4FFMA 4DDTA 1DBQA 1DRVA 4HFMA 2IPAB 4WFIA 4KRXA 2FQ1A 4CHTA 4CKZA 3QUAA 4RJ2A 1ECPA 1KZ9A 3OZGA 3B20A 3UCFA 1HEUA 3EZYA 1M8GA 3L1VA 3DZDA 4BAZA 4JQYA 1QCDA 4N8EA 5A4FS 2XTZA 2EP5A 4JK3A 2VJMA 4P83A 4EHLA 4EUSA 1VTKA 1TT7A 4EG4A 5EGNA 4BFCA 2HF9A 2PLRA 4KXFB 4WW0A 3RHSA 3MFQA 1JT2A 2Q9BA 4F45A 4ZI7B 4FJ1A 1YQQA 1LLDA 3D7NA 4DLLA 2VHWA 1B8VA 1TVEA 1KAEA 4NBLA 4MKHA 3O90A 3EGIA 2CUNA 4O33A 4YMIA 4RANA 4NCAA 5DI3A 2PBZA 3PGJA 4OOFA 3NYRA 1KL7A 3PRYA 4QXPA 3OIUA 3S8MA 4ED9A 4OXXA 4IFBA 3HZHA 2K87A 1MXFA 2W6MA 2G7ZA 3EISA 1BS9A 4QQKA 4PZAA 4FDMA 4EPTA 1A4RA 3ER8A 4UKDA 1HLPA 4MYDA 4BVGA 5CT5A 4O02B 5A3SA 3T7DA 1X1QA 2CB0A 3EGXA 1EFDN 1EUZA 1ZNQO 4QATA 4Q9NA 3TO5A 4E5UA 4FR0A 3SYTA 2VQ6A 3NM5A 3ES9A 4PO1A 4NAHA 1FDIA 1KMNA 1RP7A 1KHHA 4LAFA 4E5YA 4DMRA 3OX2A 4JC5A 1DC5A 1E3QA 4UNSA 2J8ZA 4BQIA 2VZ0A 2AD1A 4IIFA 3NVKI 1I3KA 2BMAA 5INTA 3IUPA 4CG3A 3VDXA 1ILEA 1DX6A 4J1TA 5L6MB 1UM8A 3FNEA 3MWLA 1N7GA 2QD4A 1XFDA 3LBFA 2Y9PB 1SD2A 2J9FA 3DPUA 2ZBPA 3G17A 3OZCA 1VCMA 3OD5A 4CKCA 4EI9A 4YRGA 3F73A 1DQNA 1PT5A 3LPDA 3EXHC 1G20E 2AT1A 1KEKA 1LPSA 3GUVA 3RRJA 1B93A 1F5SA 1VZ2A 1Y1TA 3JYLA 2C7PA 3IV9A 5CK4A 4WXRA 1IG0A 3R1IA 1CE8A 2D54A 4YBZA 1CUSA 1NMEA 3EY9A 5CUQA 4DDVA 3EXG1 5NLLA 1C7EA 5B1EA 4W5OA 3GEHA 1F4PA 1K4MA 1F8XA 3GMTA 2EGHA 1KFKB 3DOJA 3DOOA 4BGVA 2PUGA 2QZPA 4XE5A 3TB4A 1P29A 3CUTA 5G0TA 3I62A 3HJCA 2GSWA 4IIVA 1IXRC 2X19A 3DP7A 3ZYZA 1YOBA 2NADA 1NI4B 2ZI9A 3QFHA 1PJLA 1EFVB 1QZ3A 4NYMQ 2ERXA 1C80A 4FP9A 3FFBA 4DBLE 5J5VA 1DTWA 3H9BA 1YS6A 2IUSA 2IYFA 2FP4A 2NU6A 3HDVA 3O4VA 5B3LA 1A8IA 3TQHA 2WB2A 1QG0A 4CCWA 1EE1A 3R5JA 1CKEA 4B43A 4UATA 4IX9A 3HLKA 5KVQA 3R44A 2QLMA 4WXMA 5JLAA 3SEAA 3IIEA 3H8VA 3TB6A 5EWLA 3G0GA 4ZCPA 2HMSA 2C8LA 4BFXA 1X1EA 3ZGXA 1K75A 1AUPA 1WTCA 3D0KA 2YMQA 4HX9A 4IDOA 2CLDX 4WPGA 2H18A 2BPOA 1KAQA 1N1MA 2QXUA 3KAKA 3I8SA 3VR5D 3ZGZA 3LXMA 2AI1A 3A6EA 3BORA 4BVFA 4MR7B 4PHGA 2XECA 2GZSA 1E2MA 3B78A 4RDIA 4ZVLA 1R6UA 3BFXA 3H5LA 5PNTA 4KO3S 5AJZA 2CMKA 3THXB 1JEYA 1E60A 3QIVA 2KI5A 4RGBA 4R8MA 3UEOA 3OTGA 5JBNA 2NO4A 3CZQA 3WDKA 1EP9A 4Y6SA 1YBFA 2GA8A 5TB5A 4WAUA 3IEKA 4C7MA 4WLNA 2IODA 1QGUA 2EJUA 2J9RA 1NONA 6ADHA 2XDWA 1JS1X 5JJ5A 3AR3A 4OHOA 2HU7A 1FSZA 4OL9A 3CF0A 4PQFA 2FRDA 2XKAA 2Z8YA 3MD9A 4OYHA 4U5XA 5K2OA 4BNFA 4C4PA 2Z6QA 1GZUA 3QMMA 2IYNA 1CNFA 1Q0PA 4AG6A 3PGXA 3R3VA 4UHEA 2ZUEA 1DG3A 1HETA 1BW9B 1CUIA 2TMGA 4R6WA 4WVFA 2IEIA 3A1VA 1VLQA 2WJHA 2HOQA 3IVRA 2GFIA 4TTIA 4XEHA 5J2TA 4AKIA 4GXRA 1I36A 1P0IA 5CFNA 2BEWA 4RH1A 3AL0C 3G49A 1T8WA 2ZR9A 2J0QA 4KTTE 1IE3A 3LPCA 1WCWA 4V0ME 1XA3A 1W93A 4ARVA 5CD1A 1N5KA 1BXKA 2RFLA 1KPHA 3WR5A 4E51A 4EMSA 4ENTA 4EY4A 5ICMA 5FJIA 3O9VA 1VL1A 3WKEA 2A7XA 2YMMA 1P1BA 1YI0A 2Z56A 4Y7CA 4YJKA 2UYQA 4KLZA 4MDEA 4YO7A 4DFDA 1ENYA 3SWWA 1GGKA 1ZXXA 2R65A 3PHIA 3MQ2A 4IFEA 4NZMA 4Q9DA 2TRSB 1RWXA 2WRZA 5KSZA 2H1OA 1AXEA 3C3YA 1NQOA 4TLCA 1MEJA 4Q37A 4R9RA 2G1UA 1C1YA 3RSZA 4AYWA 1T3HA 1D7OA 3N7AA 5DWDA 3CZCA 2VDQB 2C95A 4J0DA 1BOFA 3QSGA 3DQZA 3S2FA 2VH1A 4GI3A 1MX5A 5EIBC 1Q3TA 1PJZA 1YH3A 4EJ0A 1N8KA 1XF1A 1UPTA 4I08A 3NNSA 4GLJA 1TM3E 3I05A 4UCFA 3TMYA 5C8XA 1TMOA 2YN2A 2B4YA 3DNMA 5IZCA 1E2EA 4J0HA 4G0PA 4HEHA 3C70A 2C4NA 1RXCA 4JT9A 4RZQA 4UMVA 5CVTA 1OBVA 4RQUA 3H5RA 3KAPA 4X3OA 4B34A 1L4EA 1MABB 1VBFA 4CQLB 5JAQA 2VLIA 1XAIA 2CDAA 2E18A 2GZ2A 3BJZA 3MS7A 2GYVA 4C0QC 1WPQA 1OWLA 4KACA 2Z2JA 4MVJI 1E2HA 1YCGA 3UV7A 3F98A 2V55B 3MUEA 2FEPA 3ZWWA 4AKSA 1Z07A 5DOVA 4EA8A 3I28A 3GO4A 2RGNC 5ALQA 3SQXA 2X40A 3H04A 5DXFA 4BNHA 1QU3A 4YAFA 3MIIA 4IP0A 1DRJA 1Z16A 4B9EA 4C6TB 1NIPA 3X43A 2JJQA 3QMWA 1J6UA 1MFZA 1W34A 3HR7A 3PA6A 5CVJA 5JSKA 1MIOB 5LOVA 2CNWD 2ORWA 4FOSA 4WRRA 3R9WA 1GAXA 3A3OA 3K5HA 2ZSHA 2UZIR 4JJ8A 5FFFA 2ON6A 4F2PA 1B2LA 3KFXA 3OETA 2GFHA 2ZAIA 5HBGA 3GP8A 1D2RA 3KEGA 3QBVA 1I4LD 3DBVO 3EFHA 1TA9A 2IZOA 2KM1A 4UZSA 1GN8A 3Q9UA 3FHCB 4INJA 1JFLA 3NIWA 4Q1VA 4Z54A 1T24A 2ZREA 5DBEX 3R77A 4LGYA 4FS8A 5FBHA 2FMUA 4C7JA 3DUWA 2WJIA 3OIYA 2ZIWB 3NGMA 1XFAA 3Q7SA 4CPDA 3QE0A 2G1JA 1QR6A 1W8DA 4K6MA 1L4HA 3ESBA 5KNCA 1FUYB