4G4WA

Crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
108
structure length
108
Chain Sequence
AKRVVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
molecule keywords Peptidoglycan-associated lipoprotein
total genus 42
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4wA00
5EB1B 1OAPA 3LDTA 3S0WA 3WPXA 4G4VA 2AIZP 3IMPA 4B62A 3OONA 4ZHVA 4R40B 4G4WA 4G4YA 3TD3A 1R1MA 4B5CA 4G4XA 5EB0A 3CYPB 3S02A 2ZVZA 2N48A 3TD4A 2ZOVA 4G4ZA 3CYQA 4G88A 3TD5A 2HQSC 4ERHA 3S03A 3S0YA 3S06A 4ZHWA 2LCAA 2ZVYA 3WPWA 4PWTA 2MQEA 2W8BC 2L26A 2ZF8A 3S0HA 2KGWA 3KHNA 4RHAA 4ZHYB 5EAZA 2K1SA 2LBTA
chains in the Genus database with same CATH superfamily
5J2TB 2UZHA 5JCOC 5HP7A 3V3TA 4X20A 5GANK 5J2UB 3JASA 3U0OA 2HRYA 3IKEA 4EB6A 1Z5VA 1NQ3A 4YJ2A 5KMGB 3J80M 4ZHQA 5ITZA 4BVRA 5BMVA 4X1YA 3UT5A 3QHDA 3G4SF 1X25A 2HVYD 1W59A 2OHWA 5IJ9A 1CN7A 2LBWA 1JY8A 4BT6A 2CSLA 4DRXA 1N8RH 3F0DA 3OW2F 2KGWA 1GO0A 4I55B 1TUBA 1U43A 3CB2A 1PF5A 3JATB 2UYNA 3CC2F 1YJWF 3HAXD 3HKBA 1KNJA 4WBNB 5CB4A 4O4JA 1H47A 5LYJA 2F9ZC 2PMPA 1Z5WA 2H8EA 3CCSF 4ZOLA 1VQMF 1VQKF 3TD5A 5EO3A 1VQPF 1QVFF 3ESJA 4O4IB 3VYTC 3RYIA 2R751 2LCAA 3CC4F 1GZ0A 4FFBB 3B6NA 3FD6A 1JFFB 3ERNA 2V9YA 3JAWA 5CA1B 5LP6A 4ZHVA 4R40B 1K8AH 4ZHQB 3K12A 1COMA 5GIPC 2B33A 2H6LA 2CW4A 4G4YA 5BMVB 3G6EF 4IIJB 3LYBA 3ZP7A 3M4SA 1M90H 2YYEA 1H48A 3VO8A 2Z01A 2FGYA 1M1KH 3WJPA 5LXTB 1UFYA 1YHQF 4TV9B 5HY0A 1W2BF 4HNAA 3CCMF 4O4LA 2R6R1 3L7QA 2AIFA 2VGNA 3OBWA 3CCUF 3ZOPA 4EI8A 3FPIA 1Q86H 3WPXA 3CCVF 2VAWA 1ZWZA 2UYKA 2VAMA 5EZYA 4E6EA 3Q8HA 1IV3A 3VTIC 5MN5A 3HJWC 2UYJA 3D54A 4TV8A 1CK2A 2OZBA 4EB6B 4ERHA 2OTLF 1U40A 3S06A 1ODEA 3HKBB 4B46A 1YITF 2RB9A 2W8BC 2FC3A 5JQGA 2HP0B 5EYPA 1W5BA 4TUYA 3F0FA 5GIOC 5IJ9B 5MN4A 3CCJF 3QUWA 1W3EX 1SA0B 5GONB 4X1KA 1NJIH 4XCQA 2VXYA 1VK3A 1Q7YH 4X3LA 3IEQA 5KMGA 2QA4F 2Z1EA 3M84A 3P10A 3CYQA 4X1YB 1QAHA 3EORA 3KE1A 3S03A 2IG8A 3HWUA 3DDNA 2ZVYA 3HKEB 1SZQA 3RYFA 4HNAB 1E7KA 3I56F 3T80A 3CC7F 3VMFB 3E1YA 5LOVB 2HP3A 1VQ5F 1GX1A 2CHTA 3JALB 3JATA 2HS4A 4WBNA 5EIBD 5CB4B 1K73H 1KQSF 3UT5B 4B62A 3N2KB 3WJRA 4TV9A 1W42A 4G4XA 3ZP4A 1XRGA 1IV2A 1RLGA 2OTMA 3V7QA 4BT7A 3VYUC 3CPQA 4X20B 3R0PA 3RYIB 2QTPA 1VQVA 2ZODA 4F6RA 3CMAF 2KG4A 1IV1A 4U3JA 3WGMA 2HP0A 4NWOB 2HS0A 5EYPB 5JVDB 3RA6A 5HWEA 4C82A 1CLIA 2Z1UA 5DCVA 3SIVA 2GVIA 3BYQA 3PAFA 3GHZA 5GONA 3VOBA 2BTUA 2JNBA 3F0GA 4G4WA 3I55F 5C8YA 3JAWB 5CA1A 3RYHB 2UYNB 3M1XA 3TD3A 1QU9A 3O85A 4ZK7A 4YJ2B 2EWCA 2BTQB 3CCQF 3MQWA 2LBXA 1KNKA 2RHJA 3C9TA 1J7HA 1K9MH 1RLUA 5G4UC 1Q82H 5LOVA 2GZLA 3I3FA 5JCOA 5EB1B 4O4IA 3VOAA 4X3MA 4G4VA 5KX5B 2RHOA 3OBYA 3LWOC 3WGLA 4O4HA 5IJ0A 1FNKA 3NMUC 5LXTA 1Q8RA 1IPAA 4BVQA 5EIBC 2WALA 5AVMA 5LP6B 3F0EA 5LA6B 3LWVC 3HKCA 5HXUA 2I6DA 4X1IA 1SDSA 2BTOA 2G9IA 2RHLA 2Z1TA 2CWJA 4ZI7B 3LWPC 1W581 5EZYB 4FFBA 3F6MA 5JQGB 3RYCA 3LDTA 3CCLF 3J7AR 4BW0B 2CZWA 1JD1A 1DBFA 1RQ2A 1FSZA 4M8IA 5HY4A 2CVLA 2RHHA 2IAFA 3C9RA 4YJ3B 3S02A 4U3JB 2AMTA 2ZVZA 5FNVB 3CCEF 3HKEA 1X52A 3N2GA 3VCZA 4ZHWA 3J81M 2DYYA 1JN1A 1H7MA 2MQEA 2PHNA 4BT2A 3QTYA 1VQ8F 3JARB 4TV8B 1TVKB 2LBTA 3V4DA 3FFMA 1PXWA 1OAPA 5KX5A 3WGKA 3FBAA 5JH7A 3CPWF 5HY2A 1FNJA 3N2KA 2Z1FA 3RYFB 1XBIA 3HTNA 3K0TA 4O2BA 5HY1A 4C81A 3D00A 3TD4A 3NK7A 4G4ZA 1FFXA 3JALA 3V7EA 1W5AA 1YIJF 3S0HA 2VAPA 3RE3A 3E20B 3LMEA 4BVTA 3E22B 3JASB 3WGJA 4BT3A 2HX0A 4EI9A 1JJ2F 3G71F 1R1MA 5IYZA 4B5CA 5EB0A 4LCKA 4O2AA 1VQ7F 3RYHA 4BVSA 5JVDA 3N2GB 3KJKA 3HKDB 3VYSC 3RYCB 2HRUA 4LNUA 2IQQA 2GLZA 3IR9A 3JAKA 1TVKA 5GINC 3ZO8A 3CG6A 3HKCB 5LP6C 2H8CA 3ON1A 4DXDA 1RA4A 2QEXF 1S72F 5GAPK 1IV4A 2QI2A 3OONA 4KWEA 1RQ7A 2CHSA 3IEWA 1XHOA 1U3PA 4O4HB 5IJ0B 5FLXM 4NUTA 2ZOVA 3JAMM 5C8YB 1YJ9F 4ZI7A 1QVGF 3LWQC 2UYPA 3NVKE 3P4EA 4IHJA 4X1IB 2L26A 5FNVA 2KTVA 3E22A 2K1SA 1VQ4F 1X7PA 3C9SA 3MBMA 1UI9A 3VIUA 5J2TA 3CMEF 2HS3A 1XV2A 3N4YA 3RA5A 1Q81H 5ITZB 2Q1YA 4C8EA 3CCRF 1VQNF 4C8GA 2KTUA 4B45A 3DC2A 3K14A 5JH7B 2P6YA 1W55A 3CXCF 1W5EA 4I50B 1GO1A 5CA0B 3I7TA 2I6RA 4BT4A 3WPWA 3WXMB 1VHAA 2BO1A 5G4VC 1W40A 1VQOF 2ZF8A 4O4LB 4DRXB 3KHNA 3JCMM 2VGMA 3MCAB 5FJ4C 1KC8H 1FFXB 1QD9A 3MCQA 1VH8A 4U39A 3IMPA 3HKDA 3ELCA 2YXZA 3C8LA 5B8FA 3K2XA 4O2BB 1YJNF 4I4TA 5HXZA 1W41A 2N48A 4C8IA 5J2UA 2HQSC 3GTZA 4TZZA 3LFOA 4ZOLB 3IKFA 5LA6A 5IYZB 4PWTA 2ALEA 4C4WC 5HP8A 4TUYB 3S0YA 3WGNA 1SA0A 3S0WA 2AIZP 3N4ZA 1T0AA 1NMUB 3JARA 1TUBB 4I55A 2Q1XA 5MN6A 3PLAC 2ZAUA 3CYPB 4NQ3A 4YJ3A 4BY9D 5CA0A 3GYQA 4G88A 1DT9A 4LNUB 3NK6A 3MDOA 3AGKA 1YGYA 1VQ6F 3D01A 1W57A 1U3LA 1VQLF 4RHAA 4X1KB 3VI6A 4IIJA 2DT4A 2OTJF 3KIZA 5A2QM 1YI2F 5EWRA 3FD5A 3SIUA 3CD6F 1ONIA 3KJJA 4I4TB 1T0KB 3NVIB 2NMUA 3C9UA 1JFFA 3JVHA 4O4JB 5LYJB 3JAKB 1VQ9F 1W5FA 1OFUA 1YQNA 4F6RB 5IT9M 4EI7A 3WJQA 4O2AB 1KD1H 3LWRC 1X7OA 3P0ZA 4ZHYB 4IHJB 4RQOA 5EAZA 4BT5A 4I50A
chains in the Genus database with same CATH topology
5EB1B 1OAPA 3LDTA 3S0WA 3WPXA 4G4VA 2AIZP 3IMPA 4B62A 3OONA 4ZHVA 4R40B 4G4WA 4G4YA 3TD3A 1R1MA 4B5CA 4G4XA 5EB0A 3CYPB 3S02A 2ZVZA 2N48A 3TD4A 2ZOVA 4G4ZA 3CYQA 4G88A 3TD5A 2HQSC 4ERHA 3S03A 3S0YA 3S06A 4ZHWA 2LCAA 2ZVYA 3WPWA 4PWTA 2MQEA 2W8BC 2L26A 2ZF8A 3S0HA 2KGWA 3KHNA 4RHAA 4ZHYB 5EAZA 2K1SA 2LBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EB1 B;  1OAP A;  3LDT A;  3S0W A;  3WPX A;  4G4V A;  2AIZ P;  3IMP A;  4B62 A;  3OON A;  4ZHV A;  4R40 B;  4G4W A;  4G4Y A;  3TD3 A;  1R1M A;  4B5C A;  4G4X A;  5EB0 A;  3CYP B;  3S02 A;  2ZVZ A;  2N48 A;  3TD4 A;  2ZOV A;  4G4Z A;  3CYQ A;  4G88 A;  3TD5 A;  2HQS C;  4ERH A;  3S03 A;  3S0Y A;  3S06 A;  4ZHW A;  2LCA A;  2ZVY A;  3WPW A;  4PWT A;  2MQE A;  2W8B C;  2L26 A;  2ZF8 A;  3S0H A;  2KGW A;  3KHN A;  4RHA A;  4ZHY B;  5EAZ A;  2K1S A;  2LBT A; 
#chains in the Genus database with same CATH topology
 5J2T B;  2UZH A;  5JCO C;  5HP7 A;  3V3T A;  4X20 A;  5GAN K;  5J2U B;  3JAS A;  3U0O A;  2HRY A;  3IKE A;  4EB6 A;  1Z5V A;  1NQ3 A;  4YJ2 A;  5KMG B;  3J80 M;  4ZHQ A;  5ITZ A;  4BVR A;  5BMV A;  4X1Y A;  3UT5 A;  3QHD A;  3G4S F;  1X25 A;  2HVY D;  1W59 A;  2OHW A;  5IJ9 A;  1CN7 A;  2LBW A;  1JY8 A;  4BT6 A;  2CSL A;  4DRX A;  1N8R H;  3F0D A;  3OW2 F;  2KGW A;  1GO0 A;  4I55 B;  1TUB A;  1U43 A;  3CB2 A;  1PF5 A;  3JAT B;  2UYN A;  3CC2 F;  1YJW F;  3HAX D;  3HKB A;  1KNJ A;  4WBN B;  5CB4 A;  4O4J A;  1H47 A;  5LYJ A;  2F9Z C;  2PMP A;  1Z5W A;  2H8E A;  3CCS F;  4ZOL A;  1VQM F;  1VQK F;  3TD5 A;  5EO3 A;  1VQP F;  1QVF F;  3ESJ A;  4O4I B;  3VYT C;  3RYI A;  2R75 1;  2LCA A;  3CC4 F;  1GZ0 A;  4FFB B;  3B6N A;  3FD6 A;  1JFF B;  3ERN A;  2V9Y A;  3JAW A;  5CA1 B;  5LP6 A;  4ZHV A;  4R40 B;  1K8A H;  4ZHQ B;  3K12 A;  1COM A;  5GIP C;  2B33 A;  2H6L A;  2CW4 A;  4G4Y A;  5BMV B;  3G6E F;  4IIJ B;  3LYB A;  3ZP7 A;  3M4S A;  1M90 H;  2YYE A;  1H48 A;  3VO8 A;  2Z01 A;  2FGY A;  1M1K H;  3WJP A;  5LXT B;  1UFY A;  1YHQ F;  4TV9 B;  5HY0 A;  1W2B F;  4HNA A;  3CCM F;  4O4L A;  2R6R 1;  3L7Q A;  2AIF A;  2VGN A;  3OBW A;  3CCU F;  3ZOP A;  4EI8 A;  3FPI A;  1Q86 H;  3WPX A;  3CCV F;  2VAW A;  1ZWZ A;  2UYK A;  2VAM A;  5EZY A;  4E6E A;  3Q8H A;  1IV3 A;  3VTI C;  5MN5 A;  3HJW C;  2UYJ A;  3D54 A;  4TV8 A;  1CK2 A;  2OZB A;  4EB6 B;  4ERH A;  2OTL F;  1U40 A;  3S06 A;  1ODE A;  3HKB B;  4B46 A;  1YIT F;  2RB9 A;  2W8B C;  2FC3 A;  5JQG A;  2HP0 B;  5EYP A;  1W5B A;  4TUY A;  3F0F A;  5GIO C;  5IJ9 B;  5MN4 A;  3CCJ F;  3QUW A;  1W3E X;  1SA0 B;  5GON B;  4X1K A;  1NJI H;  4XCQ A;  2VXY A;  1VK3 A;  1Q7Y H;  4X3L A;  3IEQ A;  5KMG A;  2QA4 F;  2Z1E A;  3M84 A;  3P10 A;  3CYQ A;  4X1Y B;  1QAH A;  3EOR A;  3KE1 A;  3S03 A;  2IG8 A;  3HWU A;  3DDN A;  2ZVY A;  3HKE B;  1SZQ A;  3RYF A;  4HNA B;  1E7K A;  3I56 F;  3T80 A;  3CC7 F;  3VMF B;  3E1Y A;  5LOV B;  2HP3 A;  1VQ5 F;  1GX1 A;  2CHT A;  3JAL B;  3JAT A;  2HS4 A;  4WBN A;  5EIB D;  5CB4 B;  1K73 H;  1KQS F;  3UT5 B;  4B62 A;  3N2K B;  3WJR A;  4TV9 A;  1W42 A;  4G4X A;  3ZP4 A;  1XRG A;  1IV2 A;  1RLG A;  2OTM A;  3V7Q A;  4BT7 A;  3VYU C;  3CPQ A;  4X20 B;  3R0P A;  3RYI B;  2QTP A;  1VQV A;  2ZOD A;  4F6R A;  3CMA F;  2KG4 A;  1IV1 A;  4U3J A;  3WGM A;  2HP0 A;  4NWO B;  2HS0 A;  5EYP B;  5JVD B;  3RA6 A;  5HWE A;  4C82 A;  1CLI A;  2Z1U A;  5DCV A;  3SIV A;  2GVI A;  3BYQ A;  3PAF A;  3GHZ A;  5GON A;  3VOB A;  2BTU A;  2JNB A;  3F0G A;  4G4W A;  3I55 F;  5C8Y A;  3JAW B;  5CA1 A;  3RYH B;  2UYN B;  3M1X A;  3TD3 A;  1QU9 A;  3O85 A;  4ZK7 A;  4YJ2 B;  2EWC A;  2BTQ B;  3CCQ F;  3MQW A;  2LBX A;  1KNK A;  2RHJ A;  3C9T A;  1J7H A;  1K9M H;  1RLU A;  5G4U C;  1Q82 H;  5LOV A;  2GZL A;  3I3F A;  5JCO A;  5EB1 B;  4O4I A;  3VOA A;  4X3M A;  4G4V A;  5KX5 B;  2RHO A;  3OBY A;  3LWO C;  3WGL A;  4O4H A;  5IJ0 A;  1FNK A;  3NMU C;  5LXT A;  1Q8R A;  1IPA A;  4BVQ A;  5EIB C;  2WAL A;  5AVM A;  5LP6 B;  3F0E A;  5LA6 B;  3LWV C;  3HKC A;  5HXU A;  2I6D A;  4X1I A;  1SDS A;  2BTO A;  2G9I A;  2RHL A;  2Z1T A;  2CWJ A;  4ZI7 B;  3LWP C;  1W58 1;  5EZY B;  4FFB A;  3F6M A;  5JQG B;  3RYC A;  3LDT A;  3CCL F;  3J7A R;  4BW0 B;  2CZW A;  1JD1 A;  1DBF A;  1RQ2 A;  1FSZ A;  4M8I A;  5HY4 A;  2CVL A;  2RHH A;  2IAF A;  3C9R A;  4YJ3 B;  3S02 A;  4U3J B;  2AMT A;  2ZVZ A;  5FNV B;  3CCE F;  3HKE A;  1X52 A;  3N2G A;  3VCZ A;  4ZHW A;  3J81 M;  2DYY A;  1JN1 A;  1H7M A;  2MQE A;  2PHN A;  4BT2 A;  3QTY A;  1VQ8 F;  3JAR B;  4TV8 B;  1TVK B;  2LBT A;  3V4D A;  3FFM A;  1PXW A;  1OAP A;  5KX5 A;  3WGK A;  3FBA A;  5JH7 A;  3CPW F;  5HY2 A;  1FNJ A;  3N2K A;  2Z1F A;  3RYF B;  1XBI A;  3HTN A;  3K0T A;  4O2B A;  5HY1 A;  4C81 A;  3D00 A;  3TD4 A;  3NK7 A;  4G4Z A;  1FFX A;  3JAL A;  3V7E A;  1W5A A;  1YIJ F;  3S0H A;  2VAP A;  3RE3 A;  3E20 B;  3LME A;  4BVT A;  3E22 B;  3JAS B;  3WGJ A;  4BT3 A;  2HX0 A;  4EI9 A;  1JJ2 F;  3G71 F;  1R1M A;  5IYZ A;  4B5C A;  5EB0 A;  4LCK A;  4O2A A;  1VQ7 F;  3RYH A;  4BVS A;  5JVD A;  3N2G B;  3KJK A;  3HKD B;  3VYS C;  3RYC B;  2HRU A;  4LNU A;  2IQQ A;  2GLZ A;  3IR9 A;  3JAK A;  1TVK A;  5GIN C;  3ZO8 A;  3CG6 A;  3HKC B;  5LP6 C;  2H8C A;  3ON1 A;  4DXD A;  1RA4 A;  2QEX F;  1S72 F;  5GAP K;  1IV4 A;  2QI2 A;  3OON A;  4KWE A;  1RQ7 A;  2CHS A;  3IEW A;  1XHO A;  1U3P A;  4O4H B;  5IJ0 B;  5FLX M;  4NUT A;  2ZOV A;  3JAM M;  5C8Y B;  1YJ9 F;  4ZI7 A;  1QVG F;  3LWQ C;  2UYP A;  3NVK E;  3P4E A;  4IHJ A;  4X1I B;  2L26 A;  5FNV A;  2KTV A;  3E22 A;  2K1S A;  1VQ4 F;  1X7P A;  3C9S A;  3MBM A;  1UI9 A;  3VIU A;  5J2T A;  3CME F;  2HS3 A;  1XV2 A;  3N4Y A;  3RA5 A;  1Q81 H;  5ITZ B;  2Q1Y A;  4C8E A;  3CCR F;  1VQN F;  4C8G A;  2KTU A;  4B45 A;  3DC2 A;  3K14 A;  5JH7 B;  2P6Y A;  1W55 A;  3CXC F;  1W5E A;  4I50 B;  1GO1 A;  5CA0 B;  3I7T A;  2I6R A;  4BT4 A;  3WPW A;  3WXM B;  1VHA A;  2BO1 A;  5G4V C;  1W40 A;  1VQO F;  2ZF8 A;  4O4L B;  4DRX B;  3KHN A;  3JCM M;  2VGM A;  3MCA B;  5FJ4 C;  1KC8 H;  1FFX B;  1QD9 A;  3MCQ A;  1VH8 A;  4U39 A;  3IMP A;  3HKD A;  3ELC A;  2YXZ A;  3C8L A;  5B8F A;  3K2X A;  4O2B B;  1YJN F;  4I4T A;  5HXZ A;  1W41 A;  2N48 A;  4C8I A;  5J2U A;  2HQS C;  3GTZ A;  4TZZ A;  3LFO A;  4ZOL B;  3IKF A;  5LA6 A;  5IYZ B;  4PWT A;  2ALE A;  4C4W C;  5HP8 A;  4TUY B;  3S0Y A;  3WGN A;  1SA0 A;  3S0W A;  2AIZ P;  3N4Z A;  1T0A A;  1NMU B;  3JAR A;  1TUB B;  4I55 A;  2Q1X A;  5MN6 A;  3PLA C;  2ZAU A;  3CYP B;  4NQ3 A;  4YJ3 A;  4BY9 D;  5CA0 A;  3GYQ A;  4G88 A;  1DT9 A;  4LNU B;  3NK6 A;  3MDO A;  3AGK A;  1YGY A;  1VQ6 F;  3D01 A;  1W57 A;  1U3L A;  1VQL F;  4RHA A;  4X1K B;  3VI6 A;  4IIJ A;  2DT4 A;  2OTJ F;  3KIZ A;  5A2Q M;  1YI2 F;  5EWR A;  3FD5 A;  3SIU A;  3CD6 F;  1ONI A;  3KJJ A;  4I4T B;  1T0K B;  3NVI B;  2NMU A;  3C9U A;  1JFF A;  3JVH A;  4O4J B;  5LYJ B;  3JAK B;  1VQ9 F;  1W5F A;  1OFU A;  1YQN A;  4F6R B;  5IT9 M;  4EI7 A;  3WJQ A;  4O2A B;  1KD1 H;  3LWR C;  1X7O A;  3P0Z A;  4ZHY B;  4IHJ B;  4RQO A;  5EAZ A;  4BT5 A;  4I50 A; 
#chains in the Genus database with same CATH homology
 5EB1 B;  1OAP A;  3LDT A;  3S0W A;  3WPX A;  4G4V A;  2AIZ P;  3IMP A;  4B62 A;  3OON A;  4ZHV A;  4R40 B;  4G4W A;  4G4Y A;  3TD3 A;  1R1M A;  4B5C A;  4G4X A;  5EB0 A;  3CYP B;  3S02 A;  2ZVZ A;  2N48 A;  3TD4 A;  2ZOV A;  4G4Z A;  3CYQ A;  4G88 A;  3TD5 A;  2HQS C;  4ERH A;  3S03 A;  3S0Y A;  3S06 A;  4ZHW A;  2LCA A;  2ZVY A;  3WPW A;  4PWT A;  2MQE A;  2W8B C;  2L26 A;  2ZF8 A;  3S0H A;  2KGW A;  3KHN A;  4RHA A;  4ZHY B;  5EAZ A;  2K1S A;  2LBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...