4G4ZA

Crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
120
structure length
120
Chain Sequence
MELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein Omp38
publication title Enantiomer-dependent amino acid binding affinity of OmpA-like domains from Acinetobacter baumannii peptidoglycan-associated lipoprotein and OmpA
rcsb
source organism Acinetobacter baumannii
molecule tags Peptide binding protein
total genus 39
structure length 120
sequence length 120
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4g4zA00
2ZVYA 4RHAA 5EAZA 4G4YA 3TD3A 1OAPA 3S0YA 2K1SA 4G4XA 4B62A 3CYPB 4R40B 3IMPA 4G4ZA 4B5CA 4ZHWA 2W8BC 2ZF8A 5EB0A 3TD5A 2L26A 4G4WA 4ZHYB 3OONA 2LCAA 5EB1B 3WPXA 2LBTA 1R1MA 4G88A 3WPWA 2MQEA 3KHNA 4ERHA 4PWTA 3TD4A 4G4VA 3S06A 3CYQA 2KGWA 3S0HA 3S03A 2HQSC 2N48A 3S02A 3S0WA 4ZHVA 2ZVZA 2AIZP 3LDTA 2ZOVA
chains in the Genus database with same CATH superfamily
3CCRF 4O4LA 1KD1H 2ZAUA 5KMGA 3VOAA 3ZP4A 2PMPA 1X25A 4ZI7B 4I55A 4ZK7A 2LCAA 1VQ8F 3N4YA 5LA6A 3CPWF 4BVQA 3M4SA 3VIUA 5HXZA 3IEWA 4X1YA 3VTIC 2P6YA 4I50B 3UT5A 4C81A 4EI7A 4NUTA 2KTVA 3I55F 1W2BF 2WALA 5EYPA 5EZYB 1W59A 2CVLA 2BO1A 3J7AR 3CYPB 3G4SF 3P10A 4O4IB 5EB0A 2CHSA 5IT9M 3HKEA 2YYEA 1CLIA 3HKCB 1GZ0A 2HX0A 2KG4A 3JALA 3GYQA 5A2QM 3RA6A 1X52A 2UYPA 3VI6A 4G4VA 1YGYA 5MN4A 4IHJA 4U3JB 1YQNA 3HKDB 3QTYA 1IPAA 1FFXB 5CA1A 3C9UA 1YIJF 1QVGF 5ITZB 2OTJF 3CD6F 1JFFB 3L7QA 3LDTA 4X20A 3JCMM 1JJ2F 3RA5A 2QEXF 4TV9A 3HTNA 1NJIH 4EB6B 3IR9A 2H8EA 3JARA 2LBWA 3DC2A 3M1XA 2CHTA 2L26A 5JQGB 5G4VC 3OONA 5C8YA 3CCVF 3RYFB 3CXCF 5HY0A 2B33A 1SDSA 1TUBB 3WJPA 4HNAB 4X1IA 3EORA 3B6NA 2HS3A 2IG8A 3MDOA 4TV8A 2DYYA 5GINC 2CSLA 3I7TA 3LFOA 1K73H 5KX5B 3F0GA 3V3TA 3N2KA 1RQ7A 1U40A 3J81M 3PLAC 2VAPA 4O4HA 1YJWF 2LBTA 1FNJA 4IIJA 5IJ9B 1DT9A 3KHNA 3CCSF 1XBIA 4TUYA 3TD4A 4DRXA 1IV2A 3VO8A 3PAFA 3S03A 5BMVA 3CCQF 5J2TA 5JVDB 1W5AA 3I56F 4YJ2A 2QTPA 2AIZP 3F0DA 1IV1A 2UYNA 3P4EA 5LYJA 5LP6A 1NMUB 3LWQC 1VQ9F 2Z1FA 5J2UB 5MN5A 2W8BC 5CA0A 4ZOLA 2HP0B 5FNVA 4ZHYB 4ZHQA 1VQ6F 5GONA 1Q8RA 5CB4B 3HKBA 3K12A 1VQMF 3JAMM 3S06A 4M8IA 1CK2A 3E20B 3SIUA 2HQSC 2HRUA 2N48A 2I6DA 4ZI7A 2VXYA 1Q82H 4RHAA 2PHNA 2HRYA 3FD6A 1PF5A 2Z1UA 5JCOA 3JASB 1IV3A 3LMEA 3WPXA 1Z5WA 1W42A 5EZYA 3ZO8A 3NMUC 1W57A 2Q1YA 4O4IA 1W41A 5JH7B 2ZVZA 3V7EA 1GO1A 2KTUA 1OFUA 3HKCA 5LOVB 1W40A 4X1KB 1ZWZA 1W55A 4WBNB 1U3LA 2CW4A 3IMPA 4U3JA 1X7PA 4B46A 2EWCA 3HKDA 4BW0B 3O85A 5MN6A 1FFXA 5FLXM 3K14A 5ITZA 2RHHA 1RLGA 3D54A 1JFFA 3GTZA 4EI8A 2ZODA 3HJWC 1VQOF 3WJRA 4O2BB 1SA0B 4PWTA 4EB6A 3CC4F 1RLUA 3C9TA 1YI2F 5FJ4C 3N4ZA 3OBWA 5JQGA 3BYQA 5EO3A 3F0EA 3RYCB 4U39A 3KJKA 1Z5VA 2Q1XA 4NQ3A 3RYFA 2RHLA 4NWOB 4BT6A 3F6MA 3ESJA 4KWEA 3HAXD 4R40B 1TUBA 2ZF8A 3VYSC 4HNAA 3E1YA 4O2AB 3NK6A 3AGKA 1H7MA 3I3FA 5LP6C 1QU9A 4XCQA 5LXTB 3CCJF 3CC7F 2FC3A 5IJ0B 5KX5A 4C4WC 1YHQF 3C9SA 4LCKA 1M90H 2BTQB 2R751 2OZBA 3JATB 5IJ9A 3RYIB 1U3PA 1COMA 1ONIA 2AMTA 1KNKA 3G71F 2JNBA 1GO0A 2LBXA 5DCVA 2RHOA 3SIVA 1CN7A 1IV4A 5JVDA 3LWVC 5HXUA 2HP3A 5EIBD 1VQVA 3LWPC 1UI9A 1TVKB 5J2UA 1PXWA 1H47A 4EI9A 3S02A 5JCOC 2HP0A 1FSZA 4I4TB 3MCAB 4X3LA 2UZHA 5CB4A 5IYZB 3J80M 3C9RA 1JD1A 1VQ4F 4F6RB 2IAFA 3FPIA 3OW2F 3TD5A 1YJ9F 3MCQA 3CPQA 1FNKA 1JY8A 3CG6A 3IKEA 1ODEA 5EIBC 1QAHA 2KGWA 3K0TA 2OTMA 3KE1A 4BT5A 2BTUA 3VYUC 2DT4A 4B45A 3JASA 1QD9A 3WGNA 2ZVYA 2OTLF 3JAKB 2H6LA 1K8AH 4BT3A 2VGMA 3WXMB 4G4ZA 3KJJA 3ERNA 2AIFA 2QI2A 1VQPF 5JH7A 3N2GB 4I50A 1VQKF 1VK3A 5EB1B 1RA4A 3WPWA 5LOVA 1YITF 3CMAF 4LNUB 3RYHB 4X1KA 1UFYA 4RQOA 2HS0A 1VH8A 3JAWB 3M84A 4BT4A 2UYKA 4WBNA 4FFBB 4ZHQB 4YJ3B 3IEQA 3S0WA 4C82A 3WGKA 2NMUA 4G4YA 3LWOC 3E22B 4O2BA 3FFMA 1SA0A 2K1SA 3ELCA 4C8IA 3CCUF 3K2XA 4BVTA 2R6R1 5GIPC 4G4WA 3WJQA 1KQSF 4O4JB 5HWEA 5AVMA 3RYCA 3ZP7A 3RE3A 2GVIA 3LWRC 4O4LB 3VYTC 1Q7YH 4DXDA 2G9IA 5KMGB 2V9YA 3GHZA 3CCLF 3DDNA 4I55B 3NVKE 2RB9A 1KNJA 4ZHVA 4O2AA 2Z1EA 2Z1TA 1VHAA 5LA6B 4E6EA 3CCEF 1Q81H 2UYJA 4C8EA 2CWJA 3TD3A 2GZLA 5LXTA 2VGNA 3QHDA 4X1YB 3U0OA 4B5CA 5IJ0A 1XRGA 3UT5B 1KC8H 3FD5A 3CC2F 3CMEF 3IKFA 1J7HA 3P0ZA 3MBMA 5EYPB 3JATA 2MQEA 5HP8A 1S72F 3VCZA 1Q86H 3RYIA 2YXZA 1E7KA 3WGJA 3HKEB 3ON1A 4X3MA 3S0HA 2QA4F 4BT7A 3V4DA 3JVHA 4C8GA 2ZOVA 3JALB 1X7OA 1W3EX 3CB2A 2HVYD 5G4UC 1DBFA 5HY2A 3S0YA 4IHJB 2F9ZC 4G4XA 1TVKA 4ZHWA 5CA1B 1VQ5F 5HY4A 3KIZA 4BY9D 1VQ7F 4X20B 1NQ3A 1QVFF 4I4TA 4TV9B 1GX1A 2BTOA 4G88A 5IYZA 4ERHA 1YJNF 3JARB 1W5BA 3CYQA 4F6RA 2RHJA 3C8LA 3VMFB 4BVSA 1T0KB 3FBAA 3G6EF 1SZQA 1U43A 2IQQA 5C8YB 3LYBA 2I6RA 5EAZA 1T0AA 5GIOC 3HWUA 3WGLA 3F0FA 5GAPK 4B62A 3QUWA 4BVRA 4X1IB 2Z01A 5HY1A 1JN1A 2H8CA 3R0PA 1RQ2A 4TV8B 3WGMA 5EWRA 3JAKA 3OBYA 3Q8HA 3T80A 3N2KB 2HS4A 4O4HB 1VQLF 3NK7A 3N2GA 4IIJB 3MQWA 1K9MH 4TZZA 3CCMF 1OAPA 1H48A 1M1KH 4TUYB 3D01A 4LNUA 4DRXB 3RYHA 2OHWA 1W581 5BMVB 5HP7A 3JAWA 1VQNF 3ZOPA 5J2TB 4FFBA 1W5FA 4YJ2B 2VAMA 4YJ3A 1W5EA 2UYNB 5LYJB 2ALEA 5LP6B 1R1MA 3D00A 3NVIB 4BT2A 2VAWA 5GANK 2GLZA 5B8FA 3E22A 1N8RH 2FGYA 5CA0B 4ZOLB 2CZWA 5FNVB 3VOBA 3V7QA 1XHOA 5GONB 4O4JA 1XV2A 3HKBB
chains in the Genus database with same CATH topology
2ZVYA 4RHAA 5EAZA 4G4YA 3TD3A 1OAPA 3S0YA 2K1SA 4G4XA 4B62A 3CYPB 4R40B 3IMPA 4G4ZA 4B5CA 4ZHWA 2W8BC 2ZF8A 5EB0A 3TD5A 2L26A 4G4WA 4ZHYB 3OONA 2LCAA 5EB1B 3WPXA 2LBTA 1R1MA 4G88A 3WPWA 2MQEA 3KHNA 4ERHA 4PWTA 3TD4A 4G4VA 3S06A 3CYQA 2KGWA 3S0HA 3S03A 2HQSC 2N48A 3S02A 3S0WA 4ZHVA 2ZVZA 2AIZP 3LDTA 2ZOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVY A;  4RHA A;  5EAZ A;  4G4Y A;  3TD3 A;  1OAP A;  3S0Y A;  2K1S A;  4G4X A;  4B62 A;  3CYP B;  4R40 B;  3IMP A;  4G4Z A;  4B5C A;  4ZHW A;  2W8B C;  2ZF8 A;  5EB0 A;  3TD5 A;  2L26 A;  4G4W A;  4ZHY B;  3OON A;  2LCA A;  5EB1 B;  3WPX A;  2LBT A;  1R1M A;  4G88 A;  3WPW A;  2MQE A;  3KHN A;  4ERH A;  4PWT A;  3TD4 A;  4G4V A;  3S06 A;  3CYQ A;  2KGW A;  3S0H A;  3S03 A;  2HQS C;  2N48 A;  3S02 A;  3S0W A;  4ZHV A;  2ZVZ A;  2AIZ P;  3LDT A;  2ZOV A; 
#chains in the Genus database with same CATH topology
 3CCR F;  4O4L A;  1KD1 H;  2ZAU A;  5KMG A;  3VOA A;  3ZP4 A;  2PMP A;  1X25 A;  4ZI7 B;  4I55 A;  4ZK7 A;  2LCA A;  1VQ8 F;  3N4Y A;  5LA6 A;  3CPW F;  4BVQ A;  3M4S A;  3VIU A;  5HXZ A;  3IEW A;  4X1Y A;  3VTI C;  2P6Y A;  4I50 B;  3UT5 A;  4C81 A;  4EI7 A;  4NUT A;  2KTV A;  3I55 F;  1W2B F;  2WAL A;  5EYP A;  5EZY B;  1W59 A;  2CVL A;  2BO1 A;  3J7A R;  3CYP B;  3G4S F;  3P10 A;  4O4I B;  5EB0 A;  2CHS A;  5IT9 M;  3HKE A;  2YYE A;  1CLI A;  3HKC B;  1GZ0 A;  2HX0 A;  2KG4 A;  3JAL A;  3GYQ A;  5A2Q M;  3RA6 A;  1X52 A;  2UYP A;  3VI6 A;  4G4V A;  1YGY A;  5MN4 A;  4IHJ A;  4U3J B;  1YQN A;  3HKD B;  3QTY A;  1IPA A;  1FFX B;  5CA1 A;  3C9U A;  1YIJ F;  1QVG F;  5ITZ B;  2OTJ F;  3CD6 F;  1JFF B;  3L7Q A;  3LDT A;  4X20 A;  3JCM M;  1JJ2 F;  3RA5 A;  2QEX F;  4TV9 A;  3HTN A;  1NJI H;  4EB6 B;  3IR9 A;  2H8E A;  3JAR A;  2LBW A;  3DC2 A;  3M1X A;  2CHT A;  2L26 A;  5JQG B;  5G4V C;  3OON A;  5C8Y A;  3CCV F;  3RYF B;  3CXC F;  5HY0 A;  2B33 A;  1SDS A;  1TUB B;  3WJP A;  4HNA B;  4X1I A;  3EOR A;  3B6N A;  2HS3 A;  2IG8 A;  3MDO A;  4TV8 A;  2DYY A;  5GIN C;  2CSL A;  3I7T A;  3LFO A;  1K73 H;  5KX5 B;  3F0G A;  3V3T A;  3N2K A;  1RQ7 A;  1U40 A;  3J81 M;  3PLA C;  2VAP A;  4O4H A;  1YJW F;  2LBT A;  1FNJ A;  4IIJ A;  5IJ9 B;  1DT9 A;  3KHN A;  3CCS F;  1XBI A;  4TUY A;  3TD4 A;  4DRX A;  1IV2 A;  3VO8 A;  3PAF A;  3S03 A;  5BMV A;  3CCQ F;  5J2T A;  5JVD B;  1W5A A;  3I56 F;  4YJ2 A;  2QTP A;  2AIZ P;  3F0D A;  1IV1 A;  2UYN A;  3P4E A;  5LYJ A;  5LP6 A;  1NMU B;  3LWQ C;  1VQ9 F;  2Z1F A;  5J2U B;  5MN5 A;  2W8B C;  5CA0 A;  4ZOL A;  2HP0 B;  5FNV A;  4ZHY B;  4ZHQ A;  1VQ6 F;  5GON A;  1Q8R A;  5CB4 B;  3HKB A;  3K12 A;  1VQM F;  3JAM M;  3S06 A;  4M8I A;  1CK2 A;  3E20 B;  3SIU A;  2HQS C;  2HRU A;  2N48 A;  2I6D A;  4ZI7 A;  2VXY A;  1Q82 H;  4RHA A;  2PHN A;  2HRY A;  3FD6 A;  1PF5 A;  2Z1U A;  5JCO A;  3JAS B;  1IV3 A;  3LME A;  3WPX A;  1Z5W A;  1W42 A;  5EZY A;  3ZO8 A;  3NMU C;  1W57 A;  2Q1Y A;  4O4I A;  1W41 A;  5JH7 B;  2ZVZ A;  3V7E A;  1GO1 A;  2KTU A;  1OFU A;  3HKC A;  5LOV B;  1W40 A;  4X1K B;  1ZWZ A;  1W55 A;  4WBN B;  1U3L A;  2CW4 A;  3IMP A;  4U3J A;  1X7P A;  4B46 A;  2EWC A;  3HKD A;  4BW0 B;  3O85 A;  5MN6 A;  1FFX A;  5FLX M;  3K14 A;  5ITZ A;  2RHH A;  1RLG A;  3D54 A;  1JFF A;  3GTZ A;  4EI8 A;  2ZOD A;  3HJW C;  1VQO F;  3WJR A;  4O2B B;  1SA0 B;  4PWT A;  4EB6 A;  3CC4 F;  1RLU A;  3C9T A;  1YI2 F;  5FJ4 C;  3N4Z A;  3OBW A;  5JQG A;  3BYQ A;  5EO3 A;  3F0E A;  3RYC B;  4U39 A;  3KJK A;  1Z5V A;  2Q1X A;  4NQ3 A;  3RYF A;  2RHL A;  4NWO B;  4BT6 A;  3F6M A;  3ESJ A;  4KWE A;  3HAX D;  4R40 B;  1TUB A;  2ZF8 A;  3VYS C;  4HNA A;  3E1Y A;  4O2A B;  3NK6 A;  3AGK A;  1H7M A;  3I3F A;  5LP6 C;  1QU9 A;  4XCQ A;  5LXT B;  3CCJ F;  3CC7 F;  2FC3 A;  5IJ0 B;  5KX5 A;  4C4W C;  1YHQ F;  3C9S A;  4LCK A;  1M90 H;  2BTQ B;  2R75 1;  2OZB A;  3JAT B;  5IJ9 A;  3RYI B;  1U3P A;  1COM A;  1ONI A;  2AMT A;  1KNK A;  3G71 F;  2JNB A;  1GO0 A;  2LBX A;  5DCV A;  2RHO A;  3SIV A;  1CN7 A;  1IV4 A;  5JVD A;  3LWV C;  5HXU A;  2HP3 A;  5EIB D;  1VQV A;  3LWP C;  1UI9 A;  1TVK B;  5J2U A;  1PXW A;  1H47 A;  4EI9 A;  3S02 A;  5JCO C;  2HP0 A;  1FSZ A;  4I4T B;  3MCA B;  4X3L A;  2UZH A;  5CB4 A;  5IYZ B;  3J80 M;  3C9R A;  1JD1 A;  1VQ4 F;  4F6R B;  2IAF A;  3FPI A;  3OW2 F;  3TD5 A;  1YJ9 F;  3MCQ A;  3CPQ A;  1FNK A;  1JY8 A;  3CG6 A;  3IKE A;  1ODE A;  5EIB C;  1QAH A;  2KGW A;  3K0T A;  2OTM A;  3KE1 A;  4BT5 A;  2BTU A;  3VYU C;  2DT4 A;  4B45 A;  3JAS A;  1QD9 A;  3WGN A;  2ZVY A;  2OTL F;  3JAK B;  2H6L A;  1K8A H;  4BT3 A;  2VGM A;  3WXM B;  4G4Z A;  3KJJ A;  3ERN A;  2AIF A;  2QI2 A;  1VQP F;  5JH7 A;  3N2G B;  4I50 A;  1VQK F;  1VK3 A;  5EB1 B;  1RA4 A;  3WPW A;  5LOV A;  1YIT F;  3CMA F;  4LNU B;  3RYH B;  4X1K A;  1UFY A;  4RQO A;  2HS0 A;  1VH8 A;  3JAW B;  3M84 A;  4BT4 A;  2UYK A;  4WBN A;  4FFB B;  4ZHQ B;  4YJ3 B;  3IEQ A;  3S0W A;  4C82 A;  3WGK A;  2NMU A;  4G4Y A;  3LWO C;  3E22 B;  4O2B A;  3FFM A;  1SA0 A;  2K1S A;  3ELC A;  4C8I A;  3CCU F;  3K2X A;  4BVT A;  2R6R 1;  5GIP C;  4G4W A;  3WJQ A;  1KQS F;  4O4J B;  5HWE A;  5AVM A;  3RYC A;  3ZP7 A;  3RE3 A;  2GVI A;  3LWR C;  4O4L B;  3VYT C;  1Q7Y H;  4DXD A;  2G9I A;  5KMG B;  2V9Y A;  3GHZ A;  3CCL F;  3DDN A;  4I55 B;  3NVK E;  2RB9 A;  1KNJ A;  4ZHV A;  4O2A A;  2Z1E A;  2Z1T A;  1VHA A;  5LA6 B;  4E6E A;  3CCE F;  1Q81 H;  2UYJ A;  4C8E A;  2CWJ A;  3TD3 A;  2GZL A;  5LXT A;  2VGN A;  3QHD A;  4X1Y B;  3U0O A;  4B5C A;  5IJ0 A;  1XRG A;  3UT5 B;  1KC8 H;  3FD5 A;  3CC2 F;  3CME F;  3IKF A;  1J7H A;  3P0Z A;  3MBM A;  5EYP B;  3JAT A;  2MQE A;  5HP8 A;  1S72 F;  3VCZ A;  1Q86 H;  3RYI A;  2YXZ A;  1E7K A;  3WGJ A;  3HKE B;  3ON1 A;  4X3M A;  3S0H A;  2QA4 F;  4BT7 A;  3V4D A;  3JVH A;  4C8G A;  2ZOV A;  3JAL B;  1X7O A;  1W3E X;  3CB2 A;  2HVY D;  5G4U C;  1DBF A;  5HY2 A;  3S0Y A;  4IHJ B;  2F9Z C;  4G4X A;  1TVK A;  4ZHW A;  5CA1 B;  1VQ5 F;  5HY4 A;  3KIZ A;  4BY9 D;  1VQ7 F;  4X20 B;  1NQ3 A;  1QVF F;  4I4T A;  4TV9 B;  1GX1 A;  2BTO A;  4G88 A;  5IYZ A;  4ERH A;  1YJN F;  3JAR B;  1W5B A;  3CYQ A;  4F6R A;  2RHJ A;  3C8L A;  3VMF B;  4BVS A;  1T0K B;  3FBA A;  3G6E F;  1SZQ A;  1U43 A;  2IQQ A;  5C8Y B;  3LYB A;  2I6R A;  5EAZ A;  1T0A A;  5GIO C;  3HWU A;  3WGL A;  3F0F A;  5GAP K;  4B62 A;  3QUW A;  4BVR A;  4X1I B;  2Z01 A;  5HY1 A;  1JN1 A;  2H8C A;  3R0P A;  1RQ2 A;  4TV8 B;  3WGM A;  5EWR A;  3JAK A;  3OBY A;  3Q8H A;  3T80 A;  3N2K B;  2HS4 A;  4O4H B;  1VQL F;  3NK7 A;  3N2G A;  4IIJ B;  3MQW A;  1K9M H;  4TZZ A;  3CCM F;  1OAP A;  1H48 A;  1M1K H;  4TUY B;  3D01 A;  4LNU A;  4DRX B;  3RYH A;  2OHW A;  1W58 1;  5BMV B;  5HP7 A;  3JAW A;  1VQN F;  3ZOP A;  5J2T B;  4FFB A;  1W5F A;  4YJ2 B;  2VAM A;  4YJ3 A;  1W5E A;  2UYN B;  5LYJ B;  2ALE A;  5LP6 B;  1R1M A;  3D00 A;  3NVI B;  4BT2 A;  2VAW A;  5GAN K;  2GLZ A;  5B8F A;  3E22 A;  1N8R H;  2FGY A;  5CA0 B;  4ZOL B;  2CZW A;  5FNV B;  3VOB A;  3V7Q A;  1XHO A;  5GON B;  4O4J A;  1XV2 A;  3HKB B; 
#chains in the Genus database with same CATH homology
 2ZVY A;  4RHA A;  5EAZ A;  4G4Y A;  3TD3 A;  1OAP A;  3S0Y A;  2K1S A;  4G4X A;  4B62 A;  3CYP B;  4R40 B;  3IMP A;  4G4Z A;  4B5C A;  4ZHW A;  2W8B C;  2ZF8 A;  5EB0 A;  3TD5 A;  2L26 A;  4G4W A;  4ZHY B;  3OON A;  2LCA A;  5EB1 B;  3WPX A;  2LBT A;  1R1M A;  4G88 A;  3WPW A;  2MQE A;  3KHN A;  4ERH A;  4PWT A;  3TD4 A;  4G4V A;  3S06 A;  3CYQ A;  2KGW A;  3S0H A;  3S03 A;  2HQS C;  2N48 A;  3S02 A;  3S0W A;  4ZHV A;  2ZVZ A;  2AIZ P;  3LDT A;  2ZOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...