4G56A

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
626
structure length
617
Chain Sequence
b'RVSSGRDVACVTEVADTLGAMANQGFDFLCMPIFHPRFKREFYKEPAKSRPGPQTRSDLLLSGRDWNTLIVGKLSDWIKTDSEVSRIRKTSEAAMQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHVGHHSTMFWMRVPLMAPNDLRDDLIENEPGEERTWIWWHNFRSLCDYNKKIALAIEIGADLPSGHVIDRWLGEPIKAAFLPTSIFLTNKKGFPVLTKVHQRLIFKLFKLEVQFVISGSHHHSEKDLCSYLQYLEYLSQNSPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQILMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQVTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDDGVSIPGEYTSYLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFHHPNKDDVIDNNRYCCLQYRVDLNTVLHGFAGYFNTVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPMREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hsl7 protein
publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transferase
total genus 169
structure length 617
sequence length 626
chains with identical sequence C
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4g56A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4g56A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4g56A02
2ZWAA 2EJUA 3T7RA 3GRUA 1WG8A 4FS8A 3KHKA 1UFKA 5F2OA 1QAOA 2XISA 3V8VA 5CD1A 2YXLA 3C6MA 2IGTA 5DXAA 3QOXA 5K03A 3BT7A 3TQSA 3TFWA 2V7EA 4GOOD 3EMDA 4QVGA 1XIGA 2IDJA 3EVEA 3DMGA 5B7YA 5DTQA 4KVZA 3KQSA 5LQUA 3F4KA 4YUVA 3KQPA 1NBIA 2JH9A 2XYRA 3MCZA 2X7WA 2ORED 3OBEA 4PONA 1ZGJA 2UYHA 2QUMA 3R9XB 1WY7A 3OU7A 5KQSA 3P2EA 3KCJA 4KIGA 4RTPA 2ZLBA 3BANA 3R0QA 4U7TB 5KQRA 2QUNA 5H02A 3DULA 3OFJA 1JSXA 4RTSA 2FK7A 1XLEA 2ZVJA 2FYTA 3CJRA 4YTSA 2OZVA 2ZFUA 4GEKA 2XIMA 3I53A 7MHTA 3VNLA 1O1HA 4YUZA 5K0JA 5DWQA 1R18A 1YFJA 2C7PA 2H11A 4OA8A 3CNYA 3UJ7A 3C0LA 5D1HA 5K0GA 2R3SA 2Y1XA 2NXEA 4FP9A 3LCUA 2GH1A 4P7FA 2NQHA 4LNCA 4M36A 1QAMA 1SQGA 2ZIGA 5DTRA 3QC0A 2Q41A 3U3HA 4LWPA 3G2QA 4PYJA 1JQEA 4X61A 3GXOA 2VDUE 1XYCA 4C06A 2ERCA 5AVNA 4FSDA 3IV6A 7XIMA 5BW4A 3MTIA 1NW6A 1ORHA 4ZTBA 4ZBCA 2VP3A 1H1DA 3P71T 1G60A 1S5MA 2AOVA 1VBFA 1XYBA 4R8SA 5FHQA 4AZWA 3JU2A 4CKCA 1CLKA 3HM2A 5CVJA 4OQDA 3NDIA 3FPFA 1KYZA 2X7VA 3P9CA 3SSOA 4YMHA 3M0VA 2VS1A 3PS9A 3TC3A 5HEKA 3GNLA 9MHTA 3NTVA 2LD4A 3K0BA 3PX2A 3VC2A 3B3FA 3LX6A 2G0WA 1QTWA 4ER0A 4QE4A 4L7VA 1RI2A 3G88A 5FADA 3OZTA 4P7GA 2HK1A 1A0CA 1XIEA 3TMAA 3THRA 5TNVA 3TLJA 4E2ZA 4A8IA 3FUXA 5K09A 4BLVA 1Y8CA 3G5LA 1ZG3A 1VE3A 2ZULA 1XLAA 1D2HA 4X41A 4DZRA 4XUCA 5EIFA 4HC4A 2PXAA 3M0HA 3UWPA 1EJ6A 4C04A 2QULA 3ELUA 2IH5A 4GJIA 3VC1A 4IWNA 4PWYA 3RODA 1SQFA 2OY0A 3HA3A 5U4XA 3I9FA 3EMBA 3FPGA 1M6EX 3UJBA 3ITVA 1WS6A 1KIAA 3LCCA 5CUQA 3EGVA 1XIMA 1TW2A 2PX2A 3PVCA 5DM4A 2HR1A 2AOTB 2ZBRA 4XCXA 1XIHA 1XLKA 4E30A 3M4XA 1JG1A 3BWCA 3AY0A 3BKXA 1N7JA 3AYVA 1G8AA 2N47A 3UJ9A 3UU0A 5K01A 5DRTA 4QTTB 3C6KA 3P9IA 3Q87B 5EEHA 1I6NA 1RJDA 4F84A 1XIFA 1D2GA 2HWKA 2O05A 1XLJA 1XLDA 2F8LA 2ZDSA 4RSRA 2BM9A 4HGYA 5ICEA 5EMLA 4HTFA 4BP1A 4DCGA 4NECA 3LKZA 3TOSA 3G8AA 5K0FA 3DXXA 3QOWA 5E1DA 2ZWVA 1XYMA 4QE1A 2WK1A 5KS2A 3SVZA 2HTEA 3HVJA 2OB2A 2I7CA 3OE5A 4C03A 2I57A 2FRXA 1KPHA 3LCVB 5GM2A 1KP9A 3KBVA 3KPVA 1EIZA 3BZJA 3P2IA 4XUDA 8XIAA 4UOEA 1SKMA 2G1PA 4X60A 4ER3A 2G71A 5E8RA 1RJFA 1TZ9A 2ZSUA 2PGXA 3AJDA 4MWZA 3X0DA 3A25A 4PYMA 3KPWA 3MTEA 4Y30A 3FVMA 5LSAA 3BWWA 5KYGA 2NQJA 1JG3A 3KPJA 4DUOA 4PCAA 5EGSA 5B7ZA 4PGGA 1X1BA 5IH3A 1X1AA 1YFLA 1Q0SA 3UVAA 3M70A 3EVFA 4PIPA 2AOUB 3XINA 4IV0A 2HK0A 5EG5A 8MHTA 3T0IA 3ID6C 1P39A 4HG2A 2G4JA 4PGLA 3ELWA 1OR8A 3FTFA 1Z3CA 4YV2A 4P58A 3EGEA 5ICGA 4GQBA 4M7RA 3IEIA 5E8JA 1L3BA 1M6YA 2C7RA 4U7PB 2E5WA 5XIAA 2PVCA 2FPOA 4OBWA 4A6EA 2EJTA 5GP1A 4XSMA 5C0OE 3SM3A 3FTDA 3GWZA 1XLHA 3DMHA 5E9WA 4KRGA 4IKPA 5DX1A 1WZNA 3G89A 2OYRA 5BW5A 4RTMA 2JHPA 3ITLA 1YF3A 3VNMA 3LBFA 1A0DA 3GDHA 2AS0A 2P41A 3IUIA 1QT1A 3SSMA 3C0QA 4GUAA 5JR3A 3GRYA 2EG5A 1D8WA 3I5UA 4IV8A 4AZTA 5EC8A 2Z6AA 3OU6A 4E3VA 1EAMA 3KR9A 3LGAA 1XIIA 4YTTA 5DM1A 3OCJA 5DXJA 1V39A 4CKEA 4PYKA 1SG9A 5E1MA 5FUBA 3ER9A 3PFHA 4OQEA 3FYCA 3MERA 1M0EA 4Q7IA 1L9KA 3FRIA 3O31A 2QRVB 1NW7A 1VP9A 1IXKA 3HNRA 10MHA 1JG2A 4HHMA 3CJQA 3KR1A 3UA4A 3O4FA 4C05A 3QXBA 2ZZNA 6XIMA 2AOTA 4M38A 3NVMB 4G56A 2OU4A 3HP7A 5EHGA 4FZVA 1N2XA 4YUYA 3GIWA 3REOA 2QW5A 1KPGA 2CWWA 4KW2A 3CKKA 2ZZMA 3FYDA 4EACA 3M33A 2J6VA 3UJDA 1R8XA 1ZHFA 4HTFB 3R24A 3MHTA 5EQJB 5CVDA 4QTUB 1JTEA 5GWXA 3RIEA 1D2CA 2HCVA 1RJGA 4EMSA 2ZIFA 3DXZA 3TR6A 3ITXA 1YUBA 4WXHA 5E2BA 4W4QA 4A8LA 1G38A 4RVFA 2PT9A 2IP2A 1X1CA 4RTJA 4E33A 1XDZA 3NWBA 3D2LA 2PX4A 3E05A 3K6RA 4RWZA 5LQAA 2ZIEA 2PWYA 2EFJA 5XINA 1NW5A 3P6LA 2YX1A 4HH4A 5CVVA 5DRYA 3B5IA 1TW3A 4F85A 3SR4A 5FA8A 3ORHA 4QDJA 4DF3A 3PX3A 5EVJA 1NBHA 2YR0A 5HILA 3CQHA 3DOUA 4R6WA 3G5TA 3KQQA 5EZSA 2O07A 1XIJA 2PBFA 1BHJA 2JHCA 3QYSA 5FULA 1P91A 5EPEA 3B3JA 3VNIA 3VSEA 4YV1A 5E9JA 3KR2A 3EVAA 3KBJA 5EMMA 4YTRA 4RVGA 3FRHA 3G2PA 1L3CA 3HCDA 1DXIA 2Z6QA 3T7TA 1XCJA 4GOND 4QDWA 2AOUA 3GCZA 2OKCA 5DSTA 1X19A 5CM2Z 3LECA 2GPYA 4E31A 2QE6A 4Y2HA 1XYLA 5CVEA 1G55A 1XIBA 1JQDA 1XLCA 3SMQA 2P1DA 2NXJA 2UZ4A 1YZ3A 5DLYA 1SUIA 2O06A 3KBNA 2QM3A 4LECA 5EEGA 2I62A 3UFBA 3A27A 4HGZA 5EZQA 3TM4A 1U2ZA 3GRZA 5LQCA 3MQ2A 5HOQA 4YTQA 5K0CA 4CKBA 3EVBA 4BLUA 4DVOA 4ATNA 4O29A 3NWEA 2PT6A 2G70A 1XXLA 2PY6A 4E2YA 3LSTA 1EG2A 5K8VA 4XIAA 5T64A 3KBMA 3LDUA 1NV8A 4E2WA 4AX8A 4ZB5A 3HTXA 4B17A 3UA3A 2EX4A 1PJZA 1XDUA 1JQ3A 3C3YA 5T67A 1FP2A 3R3HA 4ER7A 1RI4A 3FTEA 2QRVA 2OPBA 5D1NA 3AALA 2NP7A 5K0LA 2BH2A 4RTNA 3FPJA 3LBYA 3CCFA 5T6BA 5ICFA 3NDJA 2P35A 2OB1A 4QQKA 4RX1A 2YXEA 5DSXA 4CWAA 2H1RA 1Q0TA 3LDFA 1NE2A 2R6ZA 2JHAA 1BOOA 3PFGA 2PKWA 4AUKA 2BR5A 4E32A 4EKIA 4PINA 1VP3A 1IM8A 5EIWA 4GC9A 4FT4A 2GVEA 3I58A 4R05A 2XBMA 3AAMA 1TPYA 2CKDA 3TKAA 3JWJA 4C08A 1XLBA 3GO4A 5E2AA 3H2BA 1XP3A 2GLKA 3Q7EA 3P9NA 2H00A 4HRAA 3PLAE 2GB4A 1XIDA 3KU1A 3EVCA 3GRRA 3OE4A 3M6VA 3CVOA 5FWAA 2IIPA 2NNWB 4QPPA 1L1EA 3KQTA 2B78A 2VDWA 3HCCA 2V74B 3UJ6A 3AYTA 3CWHA 1FPQA 5GINE 2IH2A 3VNJA 1AQJA 4AZVA 3HCFA 4PYLA 3XISA 4QE5A 2YVLA 2AOXA 4PFHA 3OFKA 4RV9A 3ERCA 5CVUA 3M6UA 1WXXA 1RJEA 4KW7A 2PV0A 3FUTA 4PYIA 3KR0A 1N7IA 4MQ4A 3TM5A 1BXCA 3ITTA 3KKZA 3RW9A 3IYLW 3OZSA 1QANA 1DIDA 1I60A 5F2KA 2YUIA 4XKMA 3JWIA 2FK8A 3UJAA 5FCDA 2IH4A 2AN3A 2NQ9A 4CTJA 5EOVA 3HVHA 5E1OA 3HA7A 1T43A 1DUSA 3TPZA 1HNNA 2GAFA 3UZUA 5KVAA 3ANXA 3ITYA 3BWMA 1P1CA 4OBXA 3UBTA 1ORIA 3FPHA 3P97A 3CGGA 1ZGAA 5H6HA 5HIJA 5K0NA 4DMGA 2C7QA 2JJQA 5DM2A 3U81A 5LQKA 2AVNA 5IKMA 5HZMA 2YXDA 3EVZA 2K4MA 3NVKI 4US6A 3JWGA 4M37A 2CL5A 1KHHA 3BXOA 2O57A 9XIMA 4PYNA 2ZBQA 2G8NA 1XCLA 1F38A 2P3QA 4P7JA 2BM8A 3NW9A 3SGLA 4DKJA 4V0QA 2O0LA 1RI3A 2QY6A 1G6Q1 3FTCA 3IUHA 4QDKA 3T7SA 5EKUA 4J4KA 4BY9E 1R74A 4ZB2A 2BR4A 4OX9Y 3OU2A 3A26A 2I9KA 2OO3A 3NJRA 3DLCA 5MHTA 2GYIA 4A8RA 3KQYA 4QVKA 4MTLA 3KTCA 3UJ8A 4EKGA 3KQMA 4ER5A 5DTMA 4KIFA 4X1OA 4WVLA 2GS9A 4QPNA 3V97A 3E8SA 1MHTA 4RYLA 1SUSA 3BZBA 3MCTA 5DPMA 1RI5A 2A14A 1KPIA 3OPNA 3P8ZA 3HCEA 2ADMA 3B3GA 5P8WA 3AXTA 1HMYA 3DLIA 3KPYA 2PXCA 1P1BA 4POOA 5H1WA 4EQZA 4RTKA 1L3IA 4RVHA 3BDKA 5J8LA 3E7PA 3PT9A 4YV0A 2AVDA 4LG1A 2ZTHA 3DBNA 4C07A 3KPUA 5EKXA 1XJ5A 3M0XA 3BWBA 2AZTA 4RTLA 2B3TA 3WSTA 3QV2A 1EQAA 4OA5A 5DX0A 3CJTA 5FHRA 2HNKA 1BC5A 2IBSA 4KDCA 3DXYA 3LKDA 3DTNA 4KDRA 1FJXA 2XYQA 3LDGA 3KCOA 2FCAA 1XLLA 1VL5A 5DM0A 3P14A 4ZB0A 2CMGA 5FA5A 4DM3A 4R8RA 2P3OA 1O9GA 3DH0A 3KQVA 1NW8A 4V0RA 4QEHA 1NT2A 2I6GA 3A4TA 2BR3A 4PYQA 1DL5A 3HVKA 1MNZA 3MAGA 3OZRA 2KW5A 1QZZA 3CBGA 4MHTA 2FHPA 2IPXA 3HCBA 1I4WA 1QUMA 4PYOA 5XIMA 3M0LA 1YB2A 3I64A 5LQNA 3FUWA 2P3LA 4KWCA 3WQOA 3KCLA 4R6XA 5E1BA 5LR6A 4PCLA 1IY9A 1VLMA 4YUWA 1R6AA 4OVXA 2Y1WA 3KWSA 2PJDA 3PB3A 4RTQA 5ERGB 1PRYA 5FTWA 5B80A 5AVHA 3IHTA 4AZSA 3M0YA 4YMGA 5C9ZA 5CCBA 1XISA 5JUWA 5GOZA 4XIMA 5FQOA 5G02A 3NMUF 3DUWA 5HIKA 2YTZA 1XINA 1EJ0A 5LQJA 5CCXA 4JXJA 2VZ9A 1JTFA 5M5BA 4BLWA 1BKYA 3B89A 2GUBA 4GOMD 5FQNA 3P9KA 1VPTA 3CQJA 2ONYA 5GIOE 5EMKA 1NKVA 1R00A 2P8JA 4GJJA 3E23A 2B25A 2P7HA 3GU3A 4H0NA 2PX8A 1GW9A 2PWPA 2Q02A 5K0EA 2PXXA 4CXMA 3ITOA 1F3LA 3GJYA 2I56A 1QYRA 3LPMA 3HEMA 3C0KA 4BP3A 4GF5A 1ZQ9A 1INLA 2C7OA 2IBTA 5HIIA 5I7GA 2BZGA 1KXZA 1I9GA 1XYAA 1XICA 3HCAA 2XYVA 2AR0A 3TRKA 3TKYA 4GBED 4K1GA 2UYQA 3S68A 2NXCA 2P7IA 6XIAA 2AN5A 4EVIA 2IDKA 3CQIA 2ZW9A 2Z6UA 4F86A 4K6MA 5EHIA 3HA5A 2PLWA 4FSXA 4PGHA 3BGDA 3LMZA 2UYCA 4ER6A 1WXWA 4RTRA 3O7WA 1SVUA 2P40A 3A7DA 2HV9A 4CTKA 3KQOA 2GLUA 5LQRA 5HIMA 2DPMA 1FBNA 2GA9A 5GM1A 3EEOA 3MB5A 3N4AA 2UYOA 2XVMA 2CMHA 3CQKA 3MGGA 3G7UA 3GGDA 3UJCA 5FWDA 1XLIA 1X1DA 3DX5A 5ICCA 3DP7A 1JR4A 3SX0A 3XIMA 5HFJA 1DE5A 4EK9A 2WA1A 4YUXA 2WA2A 3P2KA 9XIAA 1JG4A 1JSZA 1BXBA 2OXTA 5C1IA 1KR5A 5B1SA 1XDSA 4XISA 4QQNA 1XVAA 2PX5A 2HMYB 4FR0A 4E2XA 4EAYA 4GC5A 1DCTA 4Z2YA 5K05A 4HHLA 3PTAA 1A0EA 3EPPA 3BZGA 3FUVA 3JWHA 1UIRA 3VYWA 3U0HA 3TVAA 1KYWA 1G8SA 1UWVA 4DQ0A 1OADA 3KQWA 3EVGA 2XVAA 1S5NA 4HNOA 4K3ZA 2JG3A 2AOWA 2ZZKA 4X63A 3AXSA 2ZCJA 5F2NA 2ZBPA 3ELDA 3FZGA 2PSSA 1QAQA 3QZAA 2ESRA 1DIEA 3HVIA 4FT2A 3A7EA 4QDPA 4ISCA 3THSA 3EGIA 5EMJA 2B9EA 5DX8A 5CIYA 1O54A 4E70A 3FUUA 3ELYA 1K77A 4XSLA 1RI1A 3ME5A 1DE6A 3SSNA 3B7PA 3G2MA 4LWOA 5K0BA 3LHDA 4MIKA 1VQ1A 1FP1D 3GRVA 2NP6A 4YTUA 2IFTA 2DULA 2NXNA 2JH8A 3AWIA 4FGZA 1VIDA 4P7KA 1R8YA 3G2OA 3SXJA 3KBSA 1ZKDA 3BGIA 3BGVA 1AF7A 3G8BA 3R6TA 1I1NA 1XLMA 3IUDA 2AN4A 2B2CA 2ONZA 1NW3A 4HSGA 3DR5A 1XLGA 4DCMA 1AQIA 1YZHA 1O9HA 2G72A 8XIMA 4GLEA 3M6XA 3L8DA 1NV9A 2NYUA 4GOLD 2XINA 4RVDA 4DA4A 3KBWA 4PNEA 5BP7A 3EEYA 2VDVE 2YQZA 3BKWA 5E9QA 2ZVRA 3DMFA 1XTPA 4PIMA 1B42A 3M6WA 3LL7A 1MUWA 1AV6A 4XUEA 3EVDA 4QEEA 1XLFA 3UXIA 4C4AA 1MJFA 4A6DA 3VNKA 5BXYA 3FPEA 3BWYA 3L23A 1YX1A 3BUSA 3M0MA 5DT2A 4RTOA 3C0SA 2QYOA 3ER8A 3NGFA 3VYLA 4A8NA 4HGXA 5GIPE 3CC8A 2OBFA 3GNXA 3C3PA
chains in the Genus database with same CATH superfamily
2CNCA 4P7LA 3GGGA 3ZSSA 4FVTA 2C1ZA 5M5DA 1KBQA 2ZRAA 4IRUB 1YAHA 3WYFA 2VELA 2V2DA 5DI9A 1E1KA 2XA2A 3Q6NA 1M8JA 1AD4A 4OFCA 3LB0A 1ULZA 2V7EA 2DUMA 2OZLB 2JATA 1EBUA 1QE5A 1SZJG 3SZ3A 4QUBA 2J66A 3AMCA 2OV1A 4AY8A 1HMPA 1Z2CA 4OHPA 4MKNA 1RZRD 3NNDA 4K6HA 4ROQA 5KETA 2JAPA 3ER6A 4WBNA 1GPAA 1AZ2A 5K3BA 1K3FA 2YW4A 2WYSA 1AJEA 1XTKA 5I07A 4HQ6A 3WV5A 3ZDRA 1LSOA 5C8VA 4C0SA 1XO1A 4W6ZA 4RKFA 4F72A 1FDZA 1T3LA 2D0FA 4B4WA 3INTA 2JD1A 4P80A 3H3FA 3MCWA 3C3EA 3TRHA 1DBWA 1FXPA 3H70A 1MC8A 3UAXA 4C7XA 5I2UA 4YALA 4NXKA 1IPEA 2PF0A 1I2CA 3OFJA 4MX8A 3MSRA 1V08A 4E4TA 1KFKA 1N7GA 2CLFB 4YIWA 5FEUA 4RK1A 3FK4A 1X7IA 3CJRA 2OZVA 3KTAA 4PNZA 1E1QD 5FPHA 4Y9TA 2V9PA 3YASA 5U1PA 4KGJA 3UZWA 2VQSA 2A9RA 1UWLA 4S3DA 3K94A 1UBLS 3VVMA 5FWYA 3V7WA 4CN8A 4FP9A 1NM5C 5F77A 5DI3B 3KTFA 4D8LA 3OIDA 2DZPA 5AYXA 3GVRA 1RRGA 5BYWA 2QOEA 4JP3A 4XR9A 3AC0A 5FBRB 2E9LA 4MEJA 3CGWA 4YMZA 2BGTA 4IDQA 4UTUA 1E2GA 1HG1A 3HJEA 1OVMA 2VO5A 4IJCA 2PWEA 1WP4A 1I7DA 2OUIA 4LDQA 4ZYWA 2YS6A 5LWQA 2VP3A 1V45E 4JQ3A 3OC0A 1O4UA 3IPLA 1E2LA 5DDIP 3BVPA 1IE7C 1JKIA 4JL1A 2Y5JA 1BYUA 3RRXA 1XEAA 4JDPA 3QKRB 5EMNA 4EF4A 1RBZA 1BRLA 4W9NC 4OTKA 2WTMA 5IUKC 3IUMA 4PHGA 1NY5A 1Q6RA 1W4BA 3VPCA 3VZQA 1XRMA 1KYZA 3OBBA 3UNXA 1NJ8A 2Z4TA 3ARQA 4P8XA 5FBQB 2QUVA 3U1BA 2VHUA 3MRSA 3F6SA 4M7PA 2AQHA 4XZIA 1ZQ1A 1U1DA 3RYSA 4JTLA 1LBQA 1P0FA 3OJLA 4L7VA 4Z1MA 1R38A 4DARA 3N0RA 4WX2A 2OV2A 4HDAA 3PWGA 5J3JA 3AFHA 3ES7A 1P0BA 4Q4KA 2YCLA 3IJDA 5HJEA 1G01A 1L7DA 4ZEPA 1N8IA 4F0KA 3NAZA 3R7DA 1D2HA 5AVOA 1VPVA 1WYIA 1ENZA 1G7CA 4LRUA 5ECGC 1XAIA 4TV9B 1TJ0A 1KAGA 4R9RA 3M0HA 1KDVA 1EJ6A 4C04A 3ONFA 4PPYA 4FFNA 1S8OA 3TW8B 1AA1B 4C4RA 4R85A 2BY3A 2GRUA 2DV0A 5GGXA 2L5HA 2YB1A 1JA0A 3S44A 1T4CA 3UJBA 3ITVA 2V0CA 4FFBA 3LCCA 3TUZC 3G2GA 3IKVA 3PVCA 1GAJA 2A1TS 4KBXA 3WMFA 4N76A 3B53X 3L4UA 1QRSA 5KAPA 3UPWA 3CB3A 1VGRA 1NBEA 1FVXA 2WSQA 4BBPA 2ZCVA 5G1OA 1OD8A 1WKCA 5H82A 3REQB 4K9SA 3SAZA 3BRSA 4UVDA 3EPHA 2ZXQA 3OOHA 3THXA 2YCKX 3KOUA 4PAMA 4Q00A 3WGYA 2YIDA 2FX3A 3O4GA 2XM1A 4UM5A 3IB6A 4CUZA 3COJA 3G1UA 4HMOA 3OA0A 2HMAA 3QVGB 2QZRA 1A5TA 3D0OA 2RHOA 2BM9A 3UXAA 4LHZA 2TRSA 2B8WA 2OO5A 3WZ2A 3SJ7A 1S3FA 5D3MB 2H2FA 2B61A 2Q3FA 3VFLA 2ZWVA 2FSVC 3M64A 1C4WA 3AZRA 2WK1A 3ONDA 4UPDA 2C13A 2C04A 3HYCA 3FXAA 5DH9A 3RCBA 2I7CA 3OE5A 2XN0A 1CZOA 2FRXA 2Y0DA 2GAJA 3IT1A 5GM2A 2HVMA 2AR9A 4HNTA 1C7RA 3QYAA 4YH1A 2ST1A 3LLMA 2NWRA 2VQ3A 3OSUA 1ZGZA 3INYA 1M7BA 4TRMA 5KBYA 5TIIA 4Q24A 4Q4QA 3NOQA 4MWZA 1PKLA 4WNAA 1R3VA 3GVXA 3BMOB 1EHYA 1R0LA 2FKAA 4UWMA 1MB0A 3O9MA 3KE8A 1BXNA 3EDRA 3GBDA 4GY7A 3D1LA 1DX9A 8OHMA 1BWRA 3I9LA 3FMFA 2DH5A 4UR9A 4MUFA 3C2RA 5SV2A 5LNRA 4F6RB 1RRMA 1XZBA 4BJ1A 2MOKA 4M81A 2XT0A 1A8IA 4J40A 1P44A 3JQEA 1E1EA 3WGLA 3NYRA 1JDUA 3FTFA 4CVNA 2ISWA 4QD3A 1SO8A 4AEEA 1TE2A 2FQ1A 2W2LA 1TEXA 1V16A 2VYOA 4RE5A 2ZRJA 4QU5A 1DBPA 3MMTA 1TV5A 2JHFA 5CD9A 2YWHA 2HF2A 4RKAA 5IHPA 4A6EA 5C8BB 3TD6A 4P7BA 1DWGM 1EWQA 5A6BA 2B4RO 4KRGA 4B73A 4EP1A 2OYRA 2VDJA 4UFPA 4GZJA 2IV2X 5H5JA 3F4NA 4L27A 5A8QA 3GDHA 4S2CA 5AB3A 1SKYB 2F1HA 4CQMB 4UEWA 1EZWA 1EMDA 4CNQA 4IV8A 3SFWA 1TIKA 2AAAA 3O2LA 4X8OA 3QFFA 2CCRA 3RS2A 3H5NA 3LGGA 2WJVA 4LGYA 1LYXA 3DBLB 3W53A 1MO0A 1FFGA 1IZYA 1PAUA 3IBCA 4RKEA 1JS1X 2F6KA 4DVJA 3E9YA 5TB5A 1E0VA 4GKVA 3SIXA 1UODA 4Q3BA 2C42A 2W48A 3PT5A 5DYYA 3R44A 2A9KA 1IIHA 2VT3A 3P80A 4IVQA 1CQPA 3UA4A 1J0CA 2VDKB 5EPOA 4K05A 4TUYF 2GYUA 4M56A 1J9YA 2YZ7A 1I10A 2PJRA 3PGA1 1GNVA 1DEOA 1Q0QA 5J2UF 2CD9A 1G16A 4CN1A 1GRQA 3D7MA 1U7OA 5EJ2A 1SCDA 1RHKA 4YUYA 2II6A 4MWCA 1HVQA 5AK3A 3SQSA 2DHDA 1B3RA 4FFVA 1MDRA 1A98A 1BXKA 5KHOC 4NZ4A 4A29A 1W5EA 2J62A 2RGEA 5L3SB 3NL6A 1AQMA 1JFHA 4MVJF 3EC7A 5CVDA 3V8EA 3AIIA 5T7BA 2HDHA 3ED1A 3FBWA 3AUTA 3EQ9A 2JJ2A 2P69A 3TXAA 4P82A 1T9BA 4NYJR 1KEVA 5DN6D 3UR8A 1XCMA 2CVQA 1ZBWA 3UHPA 4PF1A 1NY6A 5FOXA 2VPXA 3FS2A 1J1ZA 3SK0A 4EHKA 5FEPA 1TO1E 2I22A 3VYVA 2VDLB 3AW9A 4U2YA 1DQXA 2R751 2QZSA 4GUDA 2WW5A 2IP2A 1OJXA 1E3JA 4ZSUA 1EGZA 3QLJA 1CKEA 1Q14A 3EHEA 1NW5A 3KXLA 1VEMA 3LBMA 4FGUA 2HJRA 1NVVR 5EVJA 5AKIA 1HDGO 3FDFA 5IM4F 4KBYA 2WJAA 2WB2A 3NS7A 1TTQA 4NJIA 1EU1A 4YBZA 4GE3A 2CE2X 4EGJA 2EG9A 4PCFA 1JLHA 2VCAA 1W85A 1XDDA 3FYHA 3BB3A 1UZAA 4RVGA 1T8PA 3TB4A 3ABSA 5BNFA 1V8DA 2VRKA 4O12A 3GCZA 2OKCA 3OJWA 1HKHA 4E31A 1U28A 5BN4B 2I29A 2XOEA 3WP0A 1DINA 3ZY2A 3RWMB 2ODTX 1WMEA 2R4QA 1H1ZA 4EX6A 3H1FA 2OZPA 1ONNA 3WISA 5LDDC 4UTWC 4K03A 2E89A 2X1MA 3WYEA 4HUTA 4BQOA 1FYFA 1YDMA 3KRBA 4AUNA 2Y4OA 3NOOA 4CQJA 2JKEA 3IESA 3H2JA 3I6BA 1JYFA 4JYMA 3A4NA 4BJ3A 2PGFA 4KEMA 3OFNA 1CX9B 2RGMA 2G9QA 4AYXA 1TQ4A 2FOIA 2HBXA 3EPLA 4GIAA 2YJ6A 4Q8OA 2HU5A 2VUHB 3DYMA 2REOA 1N2CA 3DQPA 4J2PA 4NZFA 2G70A 4X6YA 2BY2A 3RS9A 3RGWS 4EMUA 4AYSA 1W87A 4WLFA 4S05A 2YLAA 3TBFA 1V7CA 3CUUA 4IDDA 3RFUA 1ULUA 2G08A 4CKEB 1GKQA 5BVGB 1BN6A 1XG5A 4P8RA 3C5WP 3KLPX 1E72M 4LX4A 3L8MA 1O0BA 5I9IA 5JEDA 3I2KA 3E2QA 2C7GA 4H1HA 2OORC 1TELA 4MAVA 1DAPA 3CVXA 1XWYA 3PC3A 2BODX 4YQZA 3QOMA 4NEHB 1YCDA 3CISA 2AFHB 4ZQBA 5FUVA 1DUIA 3K6JA 3W7DA 4BUZA 4QFBA 1OUMA 4BECA 5F1KA 2VNCA 4FGKA 1N1GA 1OC5A 3N28A 4F0JA 3NURA 4DI9A 2OC4A 4XQ0A 3PULA 1JV2B 4DO6A 3BMWA 3OT5A 5ECWA 1VPEA 4TYNA 2DF8A 3I83A 3HB9A 4HRXA 2IYXA 3MJEA 1L5MA 4AKEA 1JB1A 4YP0A 2OCKA 4JCCA 3FOBA 1T9HA 4LFBB 2EPNA 3RTDA 3VVCA 1V0NA 2BSLA 4LT9A 2FJUA 3NGJA 3QMPA 5DNYB 4AFYA 2ZS7A 2ZRIA 3R76A 4F8JA 3LU1A 4BL5A 2IDMA 3G2IA 1W59A 5LWHA 4V2IA 1G21E 2ZRYA 3JQ8B 4KQMA 3RVOA 1SBCA 4WAUA 2QGZA 4F2DA 5IT9A 3CH6A 4YJKA 4DMFA 1DC7A 4TXMA 2ACWA 4MFDA 2WU4A 2OEPA 1RYMA 2J7PD 1H51A 1R0SA 3LUKA 3ITCA 2GGEA 4IDHA 5KSWA 4MJ7A 4MLJA 3RJYA 1YR2A 2J9ZA 2WJHA 2DH2A 4AVYA 1BXGB 3VNJA 1Y6QA 3VSAA 4UM8B 3VVBA 1E9CA 2C2GA 4FYMA 1Q0PA 3ZW9A 1JL8A 2RUSA 3LX4A 2FPPB 3MBIA 4PXSA 3H9QA 3WJWA 2E6FA 3SLGA 2VC2B 3SCRA 3ZJTA 4TYQA 4NXSA 5DYGA 2IZ1A 2EPHA 2C5SA 3IC5A 1QONA 2XN1A 1XRLA 1L1FA 4EB3A 4LV4A 2MSLA 2QSZA 4ZYXA 4I8DA 4HOZA 3RADC 4TWIA 4FR1A 2RDMA 3OZSA 1FDRA 3ARSA 5JBQA 1KKRA 1MC1A 2ZSJA 1R10A 1FEZA 4RE4A 4MDYA 3PRYA 4I6GA 1UWKA 3LUFA 2JALA 2D0DA 5FI0B 1OK6A 2QJJA 3CEPB 1EWKA 5CB6A 1MQQA 4HB7A 4FMCF 5FF4A 2EEXA 5DP1A 5CDUA 3GRFA 3MIZA 5IN5A 4F4JA 3ZHVA 2DIJA 1G5HA 4LHVA 2W70A 4D5GA 3HBNA 3F8TA 4OBXA 4IJBA 2JW5A 4FZ3A 1Q7EA 2H85A 5HIJA 3UXYA 3DFYA 3Q8KA 1CHNA 4I55A 2H9AB 3TJIA 4BJ5A 2A59A 4IDCA 5BSUA 3F3MA 2QR5A 2PLAA 3L21A 1KOFA 4M86A 1XZGA 3FR8A 1VKFA 2LKCA 5FRDA 3T4CA 2W11A 1YQEA 3JWGA 1N9GA 1XZCA 2P75A 2VH5R 1LI7A 4BLQA 4C6KA 3N0TA 1HKUA 5BVHB 3I7QA 4HAXA 3N19B 1G6HA 1P29A 4H8VA 2J0UA 4WNYA 4HVCA 3F4BA 2YN0A 4QDKA 3TSCA 3FPCA 4HN4B 6ALDA 1NI3A 5B4UA 1RKUA 4WCFA 1FP9A 3W2IA 4RABA 1VJIA 5KINB 1JPDX 2V03A 4IOLA 5ECVA 1DAEA 3AX6A 1JXMA 3ND6A 4IWYA 5AKGA 3FXYA 3AVWA 4K6AA 1VPLA 4DAIA 4FCTA 2CNBA 1VMAA 3E8SA 2OG9A 4RYLA 2B3DA 2AJBA 5PTDA 1LRQA 5AVQA 1WXZA 5JAOA 3W01A 1LK5A 1EESA 3C3BA 3GLGE 4U7FA 2GO7A 1C9DA 1UZMA 5JZMA 3FYTA 4CKWB 4R3NA 4EOGA 4MA0A 3QTBA 1QBAA 2OXFA 4YP6A 2X2OA 2DSUA 1W93A 4QDZA 3M0IA 1KK1A 4EL0A 4RPPA 1KCZA 4OB7A 1YS1X 2WY2D 5GVJA 4R27A 2GD6A 2XE4A 4LB3A 5DT7A 3DOHA 3ZVRA 4NJKA 3U6WA 3W6NA 3B78A 1Q2UA 4JLWA 7MDHA 1UA7A 3WJAA 1RLIA 2AJCA 3HPZA 3DM5A 4PXAA 1J6OA 2Z58A 2IW0A 1EDGA 1GONA 1Y89A 2PD3A 4OBRA 4KDRA 3NV9A 5KYXA 3I4FA 3IE0A 4CG2A 4UULA 1G3QA 4EW2A 3RIHA 5AHEA 3VUSA 3HJAA 3V7UA 1HRDA 1FWEC 2YXOA 2ZRCA 4K8RB 3CV2A 2AL2A 3H9JA 1EPXA 3SBOA 3GXBA 2CXHA 3OZRA 3JQDA 5HQ3A 2QCEA 4NF7A 2P2NA 5C3MA 3AHYA 1ST2A 2OGTA 4YRRA 1H4SA 4HKTA 2PDLA 2AJ8A 1K9EA 3K1DA 1YQQA 3CX3A 3F4CA 2GJ9A 1N55A 3IJ7A 1BEUA 3S4TA 1UKYA 1I8JA 2QX7A 3HO1A 2E1WA 4WZBB 4W8OA 2ZM6B 2VFAA 3QKUA 2HA2A 1OFQA 2O92A 2FWJA 3ITDA 2G80A 3UTCA 1B1AA 2P2CA 4RH0A 5J9FA 1GCOA 4FYYA 4ZT6A 3GBPA 3OOWA 4DN1A 2POCA 4AZSA 5E09A 2PRZA 3M0YA 2QN8A 3GDKA 1E2DA 3ZD6A 4JTDA 5C4IA 5JUWA 4FGSA 2EV9A 5LP6A 1OPXA 2O2HA 4OWGA 3RLFA 1P81A 5ITZA 4M1EA 4A9AA 5CC6A 3DLHA 3NFRA 3TLXA 4NJHA 4HWOA 4EPWA 1OBFO 1Q6EA 4KAXA 1GCYA 1VRXA 3IBSA 3OQNA 4YLGA 1S46A 1OXTA 1C3XA 3K1YA 5AKLA 5AYYA 3DEKA 5KJEA 2ONYA 3SY8A 1YNSA 4W1RA 4AMVA 4EY4A 1RWWA 5GJBA 2HA4A 1NMYA 1CF2O 3TA6A 2CLKB 4H0NA 3HQNA 2WWIA 1WV2A 1LBFA 5AZ0A 1OXMA 3T42A 3C0KA 5E0KB 1EFAA 1INLA 2ZTVA 2OESA 1EL3A 2XFFA 1V51A 2VNSA 3N0WA 1MLDA 3QJYA 4NIRA 4US5D 2JHGA 1SU7A 2AR0A 2YCBA 1Z7AA 2AG5A 4I9MA 5KWVA 1Y8QB 5IWAB 4J3NA 1ZK4A 3MO4A 3VKVA 3U7RA 2FW0A 3W29A 2PMBA 3A11A 2J6IA 3WL1A 3CVJA 3L65A 4MUIA 5IJ9B 3M4YA 2BOFX 4PGHA 1ES9A 3R1ZA 3ZLHA 3V75A 4R2MA 3S8MA 3CL7A 5CK5A 3TD9A 4OM7A 3LFUA 1YU9A 4GY0A 2BELA 2XF8A 3P1JA 3WYDA 2GA9A 1Q8AA 5E6ZA 4DM2A 1NP3A 3OHSX 1FKXA 2HQAA 1E3TA 4H41A 1NDYA 4OHXA 4QEKA 4J91A 4ND6A 2CLOB 1QNPA 4S12A 1MTOA 1GK8A 3DP7A 1ZUWA 3CZGA 3LX8A 4NHOA 1L4KA 3XIMA 4ENPA 3AUYA 4O17A 5K3FB 1XKXA 3U62A 1JG4A 4A4DA 4AWBA 4J0KA 4QROA 3U4CA 4IG2B 1KR5A 1RP9A 3U9IA 1XDSA 5FF7A 2FEWB 4Y2YA 2XBLA 3AF5A 1J7JA 4DMUB 3N8KA 2ZR0A 4O4VA 3ZQUA 3R9XA 3QHOA 2C18A 1EGQA 1Y3CE 1J70A 2XZPA 3ZW8A 2JVIA 1A53A 1W5PA 4WZAE 4WVXA 3I04M 4KJZA 1GPLA 2CXEA 5BUQA 1KQYA 3HXMA 1V3MA 1S5NA 2QX6A 4F4HA 2OGYA 3ZCPA 4O08A 3P9PA 5C9UA 1UC5B 1MW8X 5F2NA 4AJNA 3PQ3A 3ORSA 1LL7A 1RM3A 3EW9A 1RCOB 1QGUB 1XDBA 5EMJA 1SFLA 4NY2A 5CIYA 3K9GA 3AGQA 2G1UA 1WBDA 1HVXA 3ZWXA 4Y2SA 4Q4PA 3LP8A 1O5KA 2VDHA 1Y4SA 4PBFA 2AK3A 4V3BA 3IPYA 1HZZC 1V11B 2R96A 1WBJB 2JGYA 3LIIA 3EKZA 4ZQFA 1ZISA 3QWHA 4KFOA 2IFTA 4IX9A 1Q20A 2OAP1 2H9YA 2PBRA 3VR2A 4GKBA 1YH3A 1SCUB 2IYNA 1E62A 3NVAA 3AESA 3TOYA 1SHJA 5EXPA 5DF0A 2JD2A 2B2CA 2VC5A 2CEKA 1R0YA 3OTIA 1KQPA 4J29A 2FQWA 1ZN8A 1Y3FE 4DCMA 1NF3A 1N4DA 3KB6A 1PJTA 1AQIA 3CPSA 3M6XA 1GDDA 1PZMA 3I9KA 4DTCA 1BVNP 3ZXXA 3EEZA 3KCNA 4RVDA 4A6PA 1KL7A 3BSSA 1D9EA 1K27A 4DLFA 4CIAA 4E4UA 4UNKA 4OECA 4EHNA 3QELA 2D4AA 3A2NA 5CAEB 1XTPA 4C01A 3K9NA 3E1F1 4ZQEA 2C1XA 2NLYA 3JSAA 3IJLA 1PEYA 1OPRA 4OP1A 3BD8A 4NP7A 2R24A 2CUNA 5C6MA 2ZSFA 3V2HA 3UXIA 4UFJA 5HUPA 3WNVA 1ACLA 2J5KA 1KE2A 4KO2S 1U6KA 3SHQA 4HJWA 3KTXA 2GNPA 4GI1A 4EI8A 3OPYI 4EJ2A 3U6KA 4XGQA 5A2QA 2JGRA 3VJMA 4J3VA 4IUCS 1ISMA 2A3BA 4PVCA 3U39A 1ODSA 5B4VA 3ZFHA 3IANA 1MABB 1V26A 4DUZB 5H4HA 1SXJB 4R34A 3FOCA 1CY0A 3N5KA 5JNRA 2YXLA 3FLMA 1EIWA 2JEYA 3JQ9C 2R48A 4ROTA 3RO6A 3GR4A 3T8YA 2BJWA 1ZD9A 3SCQA 2QAPA 1ZJZA 2AXPA 3BHJA 3F7JA 1P0EA 3AISA 2Q8PA 4BRSA 1CP3A 2ZWYA 3M41A 4C0HA 1AU9A 1BKHA 4INJA 2RGNC 3SYKA 4KLAA 5SYNA 3CO5A 2X8RA 4CF5A 1SU6A 1YTLA 1U6IA 1HJWA 1JKJA 1H49A 4QLJA 4BVEA 4AW7A 2DHQA 1NBIA 2JH9A 5DN1A 2HKIA 4BEUA 4OL9A 2V9ZA 5DP2A 2O9OA 2CYAA 1F7UA 3S0CA 1LEHA 1C4KA 4M98A 2AZ4A 4OJQA 1RRFA 4HEA6 1MB2A 1E6NA 4MY8A 3CLSD 1XKYA 4IICA 1XLEA 2Q71A 3GT0A 3W7OA 4Q8WA 3L6OO 2Q1YA 3Q6IA 4G2DA 4CIWA 3M8KA 3VNLA 3L0NA 1K3UA 4BNFA 1XH2A 4XX0B 4YU1A 1R18A 3VMFA 4O4IB 3MZ2A 4MUAA 1P74A 3BGWA 3PS7A 3VNSA 4MJZA 3QPVA 4MQEB 1WAMA 4XFJA 3TGPA 1DXYA 5ENVA 3AYRA 1K2WA 4RE3A 2XWSA 4BI6A 4IVNA 4P81A 5AYZA 3WMGA 4EFMA 1ZPDA 3DPUA 4LWPA 3LHYA 1EFCA 1NAIA 1Q95A 5I3ZA 2NXIA 3GXNA 3P84A 2PSJA 2CMDA 2Z9CA 4ZYLA 4TT3D 4XXHA 3F4VA 2PWDA 3AHIA 1ZLYA 3W1AA 3NGLA 1A9RA 2W9XA 1YZFA 1CS0B 2W6RA 3DTTA 3AKYA 1H1DA 4YXGA 4GEGA 4XCVA 5IRCD 1FOBA 1UKCA 4C6BA 3NTRA 3UCFA 1XXHA 1B9BA 4IDAA 1V3HA 1P4HA 3KLNA 3D5EA 3COWA 4L2IB 5HK4A 4AICA 5CVJA 3HMQA 2ZU0C 4M49A 2GZRA 4KQ1A 3O05A 4L9XA 1E98A 3OZWA 2AD5A 3GUHA 4JTAA 4PSRA 2W63A 2WTNA 5K6AA 1NDUA 3ND7A 1E51A 1NP0A 3I4EA 5B12A 4GP9A 3CIXA 3IJ5A 2TYSA 5GAJA 3UBMA 4Y9AA 3O8DA 2A5LA 3WH8A 5B3AA 5DKFA 3BGAA 3QI7A 3HP1A 4G0VA 4Q9IA 3ABRB 3HGMA 4GMHA 1FDTA 1VE3A 4P35A 1Z7WA 3PV0A 1F5ZA 3KRUA 3RVPA 4P84A 1XNHA 5GPBA 3ECAA 3SCPA 3S2IA 3PVFA 2PDGA 3W4JA 1MFVA 1EEHA 1RRCA 3SEAA 1C7FA 3GMTA 5JD5A 5CXXA 3CL8A 4FOUA 4ILEA 4ECEA 4G4SO 3OMWA 5ANRB 2F6RA 1EPUA 4TYMA 2AOTB 4P61A 1Y9EA 2WD8A 1DIOA 3HGQA 3L0YA 2WHRA 1ENOA 4S3GA 2N47A 5K01A 4PE5B 3MWCA 3KYDB 4M22A 1PT8A 3KEHA 4POAA 2Y77A 4Z9BA 3Q87B 4ND8B 4MVWA 1BQ3A 4EVSA 1XIFA 1U4SA 5KOHB 3ABIA 2HHLA 3R6GA 2FH5B 1E4EA 3QOFA 2BASA 5E6SB 1ISWA 1IFXA 3WLRA 1TJ3A 4V15A 1PEKE 4MJLA 5G41A 4S2BA 4FKMA 2IELA 1N1DA 4COKA 1FHDA 3P27A 2PZ0A 1NULA 2IHTA 1XYMA 4ZEWA 3AK4A 5D30A 3RCMA 1NMEA 4GYFA 2HSWA 2WVVA 2OB2A 3FZQA 3IVRA 2RAPA 2QDXA 4DBWA 1M41A 4Q3OA 1GGNA 1SVWA 2HMVA 3FHCB 3UJ2A 3O03A 2PVPA 1BKSB 4OGZA 3K7EA 1EIZA 1QI4A 1FP7A 4LTSA 1UFRA 5CDSA 2WSKA 4ZICA 2QJTA 1HPLA 1HNYA 2A84A 4ER3A 4U8HA 1W96A 4C22A 4TO8A 4LW8A 3T06B 3QSYA 1CVLA 1TKCA 1S8NA 3HEBA 2WSYA 4NLLA 1NUTA 4PG5A 1TC2A 4N1AA 5I3CA 3DL7A 3TG8A 1UXIA 1OV6A 3TEFA 5E6RA 4MGKR 5IF3A 1HDCA 3WDMA 1E0WA 2BHTA 3VKAA 1NFGA 1XA3A 3SBDA 3H2ZA 1QV7A 5EG5A 3T9AA 4PG8A 2OV3A 4Q4CA 3IQWA 3HV8A 1PS9A 1XM3A 4LF6B 2FZCA 2Z1BA 4DSNA 1V93A 2CHGA 3PHJA 3D6VA 1Z3CA 3V4RA 1F6PA 4X0VA 4YV2A 3KEQA 4IDOA 1JJ7A 4Q4HA 4QUEA 4CKCB 1RUSA 2GCNA 3A6LA 1SG0A 4YRKA 1QG0A 1I9CA 2YDXA 1NZFA 4MPPA 2PA0A 3I01M 3DKRA 3DBPA 4GT1A 1Q65A 2A94A 4E8DA 2NU6B 1PIIA 3W82A 4KZPA 1LUCB 3RT9A 1FS5A 3VBEA 1O6FA 2Y6ZA 3GWZA 1JCLA 1OLSB 3Q6MA 3DESA 4O0MA 1T2CA 3MOSA 4P4SB 2RIPA 3ZM8A 4ETMA 1C8VA 3ILYA 1U1IA 3EOEA 4NCHA 4JQ4A 2WHMA 1Q6DA 1POXA 1R8SA 3X2EA 3SSMA 3C0QA 4AZ6A 4MR8B 2EG5A 1EAMA 4AMBA 1YPFA 3U7QB 3M5VA 3WMLA 4L5JA 3DYBA 5IEBA 1XIIA 3K0CA 3W3ZB 3WK0A 2AUNA 4GH1A 2QUTA 2DT8A 1K7EB 1EG7A 3OWOA 3FHQA 4FYVA 2PRHA 5LOVA 3B52X 4XRRA 3JVAA 4E38A 1CB2A 4V0NA 3L7MA 10MHA 1P9LA 2IPNA 4PULA 4O3MA 1MOPA 4WJ8A 1MO6A 3BS4A 3EARA 4PFKA 1B2LA 2D74A 4TKLA 5AM4A 2A0NA 4GXQA 1M1ZA 3FHTA 3SY5A 1SUAA 3ICCA 2H3DA 2NV0A 4ECAA 5I77A 2OU4A 1G3RA 4WY2A 5KQPA 3QKSB 3RTAA 1LF1A 1WPGA 2FPLA 1A4LA 3VMOA 3RAOA 2KI5A 4EYSA 3WBXA 2OOSA 3IV8A 4L85A 4EACA 2GJXA 2WJPA 2R1TB 2ZJ2A 5LGZA 2OHVA 3CSDA 2LXNA 4FDMA 1XTBA 4N4AA 3L0DA 1J8YF 4IGKA 3WAJA 4JA0A 4QTUB 1C93A 1VPQA 3W7MA 1N3LA 4OP2A 4CDRA 5C7LO 3JASA 1YC5A 2F67A 3W74A 2FWAA 4O1IA 2ZUEA 1ICQA 3IP8A 5AKHA 2VTFA 4CGZA 4U39A 2O4UX 2IZ5A 3TR6A 2RBKA 4BPBA 3ZIDA 3ZGZA 3BG5A 4TVSA 1O94C 3BUVA 5IKOA 3ZN2A 4L9RA 1UKAA 4PCTA 1LPSA 3O16A 3OE1A 2JJ1D 1TLLA 1JEYB 5GONF 3ORHA 3HP4A 2WU1A 5CA1F 2YR0A 4R7TA 4PPNA 4A22A 3NQDA 2O07A 3MMZA 1CY2A 3A6DA 5JZSA 4KZKA 4ACYA 1JZ2A 5E9JA 2FW6A 4INOA 3C7TA 1ZD8A 3P96A 4D80A 5JALA 4J0IA 4NPHA 3TZBA 3T3NA 1VJZA 2R5NA 2PFGA 4J0DA 1KJIA 1TVEA 4MRNA 1GG5A 3O1HB 4WACA 4NRDA 4OGFA 1DG3A 4UUMA 1WB6A 3WQWA 1XMXA 5KYYB 1RSCA 3MUNA 3H2IA 3UMFA 1KMMA 1UBSA 4C4YA 4QKQA 1YTEA 4IJRA 2KPOA 5ETJA 3R7AA 3BAZA 4NDZA 1FJ2A 2QYSA 4NCBA 5TAOA 2ZCUA 5ESXA 4YLYA 1YYAA 2QM3A 5JHGB 1Z8AA 3UFBA 1SVSA 2QRHA 2XNDD 4I9GA 3CJPA 1USIA 4YYCA 5BN1A 3MRTA 3WICA 4Q7MB 1KVUA 4NILA 5HRAA 2WFAA 2IYWA 2XYLA 5D03A 1M1NB 3F5KA 3BREA 4BBJA 4LB4A 2Q01A 4EKJA 3D2BA 4ATNA 2FQQA 2WHLA 2PS0A 4C6TB 4DV5B 1CTQA 4FOTA 5LU8A 2CE7A 3NUQA 1XVIA 3GNOA 3MWFA 3NEPX 4EA9A 3PFNA 3DFUA 1E9ZB 4PBEA 5EINA 2B7PA 4TXLA 2CLDX 2PT7A 1JXAA 1OGYA 1F2VA 3HIJA 5CPFA 4KQNA 4JGBA 1Y34E 1NW9B 3KT6A 1CLUA 3HJTA 2ZYIA 3MELA 3GJQA 2VDGA 4I1YA 5FEMA 2VLIA 1RYBA 2IYZA 2EX4A 4BO0A 1H2RS 1KJ9A 4YXWA 3OIHA 2J7FA 4HK5A 4N0DA 3WGVA 1N36B 2NP7A 1WUTA 3A06A 3P2JA 2NSJA 4H3DA 2NZWA 4QZVA 2AKMA 1ZS2A 3DA8A 3CURA 3R94A 1EWRA 2AWOA 4G23A 2O48X 1MZRA 1XOIA 3FDGA 3KVVA 1L7NA 4QS5A 3H5OA 2OLSA 3LDFA 3ILSA 2Z0MA 4LKOA 1MOSA 2Q7DA 3ZH9B 1BOOA 3TNJA 2XMCA 4I6JA 1ULHA 4YDSA 1A47A 3K4AA 3VINA 3H75A 4A3HA 2FR1A 4Q3NA 2IC5A 1I1OA 4C21A 3ZJ4A 4LQCA 3SN1A 1YW1A 1CUXA 2BIFA 3H2BA 4QOFA 3LZ5A 1YMVA 4R2HA 3W7PA 4RUKA 1UIOA 4MVJD 1G2OA 3PLAE 2RI6A 2XHEA 3EEIA 3ZGOA 3JQQA 2X0NA 3WB9A 3GT3A 3HSKA 3IJ6A 2A2ZA 1GFZA 3OE4A 3PP8A 1C4XA 2DC1A 2NNWB 4BN0A 4DVGA 3PNVA 2EGGA 1CBUA 1ORVA 1X7WB 1O6CA 1XRNA 4LEFA 1UEXC 1H7PA 2FX2A 4CF6A 4LHYA 1EX9A 4PRYA 5DT9A 4GWLA 2XRFA 4Z1OA 1D1PA 4XDYA 4H9XA 1TVCA 1SJDA 3QA3E 4B3BA 1OY1A 3U1TA 4LGMA 1G9TA 1VBGA 5I5GA 1NOFA 1JIJA 1Z18A 3DCYA 2SICE 3HQOA 1C2TA 2VZTA 4Q01A 3RYCA 4XFDA 2YA0A 1VFTA 5LC1A 3U19A 4P3YA 2FEOA 3RW9A 1VBMA 4F21A 1J2JA 2R11A 4XO7A 5BW6B 4LNAA 1E1MA 3QXSA 3MPOA 1EFZA 4J3ZA 3O74A 2GXSA 1HLFA 3PCRB 3PEYA 1Z2NX 5IKPA 4UEJA 1LBSA 4LAMA 2AGKA 2YDSA 4JEMA 4NAFA 4Q7QA 4PV7A 2JAUA 1T6YA 5CC3A 1SM9A 3ZD8A 5ISMA 3T5PA 2EKLA 1KEUA 1UBNA 2OGUA 3VPXA 4RMHA 3QQWA 4LTMA 4DNMA 3WMWA 3AKZA 4CU8A 1PQ4A 3A32A 1T5DX 3TPZA 1YHZA 2I6QA 5K6RA 3FKJA 1NIPA 3GEBA 1BTOA 3QY9A 2R8PA 1OKKA 3AF6A 1QVVA 4JSRA 1PHQA 5C8YF 3VKJA 3RR4A 3O6AA 4GSYA 2GJRA 1ESZA 2IWHA 2A6NA 1JHXA 3GH1A 2GVYA 1QRAA 4JXXA 4RA6B 3LCMA 1QCYA 3DONA 1PTGA 3ZY6A 1F9EA 1AN0A 3P2MA 3PEWA 4MNTA 3L43A 4CKBB 3G23A 4IJQA 4QEDA 4W5ZA 4OI4A 5FOQA 9XIMA 1MRQA 4AG5A 2ZBQA 2G8NA 3F9CA 3OEEA 3DHDA 3JYQA 4PX2A 4FDUA 2CN1A 5D7BA 1RI3A 3HDTA 4HQKA 4MA4A 1HL9A 3FM9A 1H0KA 4HNAB 5I6DA 2BDQA 3SEQA 3BGSA 1GHRA 3LNPA 1ONPA 4PTMA 4HUQA 1U2GC 3NJRA 3QHMA 3SIWA 4LYKA 3KVJA 1JIVA 2E77A 4DBLE 3PSAA 3KTCA 4KUEA 2B92A 4M0UA 3BEOA 3BTUA 1JZ5A 4AF6A 1ZNWA 5EWJB 1BIFA 4RL4A 2J3KA 3HU1A 5K9XA 4L5AA 3R58A 1RM5A 4B40A 1OXVA 4NYMR 1RPJA 5I7WA 1N6KA 3EMVA 1KGUA 2O0HA 1ONXA 4FIQA 4ERIA 3WK7A 1Q12A 4BFTA 2OM6A 4FNTA 3RABA 4LK2A 4XZ3A 5CYOA 2ADMA 3QFEA 3L0BA 5M2FX 2B5VA 1ZB5A 3SLRA 3OTGA 3S6DA 1T5OA 2J3JA 3HKCA 1VMIA 3QBEA 3I3SR 4YRBA 4I1UA 4RTKA 2WMNB 3K71B 2DUZA 1IG3A 5BCAA 3EH1A 2PEYA 4CV2A 2QLLA 1PW7A 1I4TD 1UG6A 3KPUA 3FYUB 4UQLA 2J87A 4FE3A 2XZLA 3AL3A 4GYPC 1FWNA 4L6AA 5KX5F 1YRBA 3NTOA 4AO7A 5FHRA 1XAHA 3AM4A 1OQAA 4DADA 1A1VA 1F8UA 1BSLA 1EP3A 1RRKA 1IWAA 2HLHA 4RNFA 3V3TA 2A5FA 4C7KA 4XYGA 2WMDA 4YC7A 1EKXA 5CZJA 4QYIA 5FA5A 4JXKA 3WF1A 3EXHB 4JNMA 3R0JA 4M0KA 2LCQA 3SNHA 2V81A 4NMWA 3R5JA 4W7IA 3HVKA 1MNZA 4KXWA 3W7EA 5JYBA 2FHPA 2ZBFA 3WUGA 4QYWA 3H3XA 1NVDA 2LTAA 1YQUA 1U02A 5XIMA 5DYWA 3IPXA 2RGRA 4D9BA 1IXSB 3GLFA 4UQOA 5LQNA 1AMYA 4UEOA 1N5RA 3FKRA 1M2OA 3MUZ1 3ECQA 2EZ9A 1APBA 1P4SA 4NMXB 3QJAA 1KI7A 3A23A 3GOQA 5ECDA 4OKDA 3R3ZA 4YNGA 4B6PA 3LI1A 3RVDA 3GEEA 5TMBA 5M3BA 4LJ4A 3N7AA 1KEEA 3LZCA 1BGWA 1W581 4JBIA 2NXWA 3NCTA 1BHSA 2A3LA 1CPUA 4MVJH 4L22A 5CG7A 1XGDA 3M5PA 3L6CA 1WF6A 4KCTA 4AUEA 2FYMA 1XISA 4NASA 3LHKA 2FH6A 1MRNA 3PSVA 4ALKA 2WZMA 3T6KA 5JATA 4KI0A 3P8IA 4V02A 1WZCA 3LC7O 2ZROA 4W9RA 3H4WA 4I50B 2H1IA 2FZDA 3EXFB 4Y2QA 1X1ZA 4K2AA 3CVUA 1UFOA 3E1GA 5KTPA 3TC6A 4XKYA 5KZMB 4DIAA 4O8ZA 1CDEA 2UBPC 2RFLA 3WY9A 1GPH1 4DKXA 1CZLA 2PX8A 1WXHA 3IAS6 1OC7A 3GW8A 4YDRA 5F3DA 2PXXA 4JVNA 4DPLA 3A5FA 2Z1SA 3RUIA 3HKBA 2GEUA 2C5HA 4GLLA 4GF5A 4C6LA 4OB6A 1WSWA 1V1RB 2IP4A 3RSZA 1PTJC 4C76A 1L7XA 2GM4A 1TIWA 2EKQA 5I0DA 2VBIA 3OLDA 4YJ3F 3RU9A 1NTRA 4PLFA 1XYZA 4G0OA 1ZUAX 3P9YA 4B5UA 1U2DC 3AF2A 4F79A 1F3OA 1QH8B 1RLOA 2MYNA 4KSYA 4WOKA 3ZKWA 3A9IA 3EF1A 4HDRA 3AFMA 1WSDA 4EB8A 2RJ3A 3PIRA 1WXWA 3QUQA 4OXKA 1T99A 2P9YA 2F1JA 1W54A 2VUYA 3WJXA 1L8PA 3D6UA 3EYWA 4Y2XA 2HF9A 2EPKX 3MB5A 3QFSA 1M2HA 1AQHA 3INPA 1OVGA 1Z83A 1XEFA 5JBIA 1QUFA 4DR4B 1JBQA 1XK6A 4LFAB 4WEVX 1X1DA 4IHJA 2CNDA 3WI7A 3N2BA 3U7BA 2ZTLA 2C0AA 4EK9A 5LNSA 1RBYA 1BXBA 1KZ7B 3DMNA 5C1IA 1SD5A 3H5RA 5CBIA 3Q1KA 4HB2A 1G20E 1DJYA 3IQZA 1CUJA 4AF0B 3WX0A 2BF7A 1V3JA 3CMFA 2WMGA 4UXHA 4O52A 4Z2YA 5JMUA 1QFZA 3EIOA 1GTRA 3OIVA 3JWHA 1DBVO 3IJ9A 1W9PA 2V67A 3R8XA 1KYWA 1UWVA 2OGZA 5HHTA 3TI9A 4CLHA 2F9FA 5TMDA 1WB9A 3KL2A 1RPKA 5HJYA 3PBMA 4CMIB 2PKXA 2ZZ2A 3LUTA 4OCZA 2WHKA 2UZ1A 4EPEC 3GG7A 4CLOA 1PWHA 2C3PA 1QAQA 2YDRA 3BWDD 4AHOA 2X0RA 1R7RA 3WF0A 3U3XA 2V5CA 1ZOIA 2C07A 2O2JA 1JDTA 3E03A 1DOHA 3SYMA 5JH7F 2C98A 5LSMA 1KDRA 1E43A 3SE7A 3LHUA 3ARRA 3G2MA 1BVWA 4Q48A 3A28A 1VQ1A 2XDWA 3BJRA 3FDKA 3CHYA 2AMJA 1R6TA 1UOQA 2Q1UA 2QV5A 1YJQA 1XMPA 3UD6A 4B81A 1AKYA 5DEIA 2JGIA 4NCNA 3WVNA 5HINA 3NNNA 2XDYA 4N3AA 4B6QA 2Y8KA 2VSNA 1Y1SA 4BNUA 1L1QA 2O1SA 4FYPA 1XLMA 3LY9A 2XGJA 4FSAA 3FJLA 3RFVA 5TPWA 2VXOA 4H83A 4C7VA 1KEKA 1FQJA 1RY8A 4MVCA 4RJIA 3D5QA 1CEXA 2D5IA 2O20A 3L8DA 1WAUA 1R15A 3D59A 2OXEA 1RVV1 5A71A 4QOHA 1QHHA 1N8WA 1D5WA 2Y7DA 2HF8A 3EISA 1GOTA 4C14A 1SCBA 3MP3A 2YHAA 3GIQA 3SQLA 1V6YA 3IRUA 4ZI3A 2FPIA 2I87A 3PDUA 3P9ZA 1JDBB 3LL7A 2PBOA 4MDOA 4QEEA 2YOHA 4RCVA 3OFSA 4L9ZA 3JD2A 4XIFA 2QXUA 4M9CA 2YKKA 4NE9A 4B3HA 3I8OA 1NFPA 3L23A 3W5VA 5LXTA 1N34B 1YNPA 1H1NA 1RHMA 3UAZA 4CM4B 4AHQA 1J5EB 2FB3A 1Y1QA 2HROA 4DJAA 3PUXA 4QNEA 1WG8A 5CGQB 2JI8A 1UFKA 1L5HB 4DBLC 2Q4TA 1BAPA 1AUPA 2Q62A 3NQMA 4R7WA 5F2OA 4LOIA 4MYTA 1QFYA 1KQNA 1P8AA 4BU0A 2VQTA 3AINA 4DO4A 1G67A 1JLSA 3NWRA 4YROA 1TMKA 1RK5A 3RYHB 2VPTA 2Z30A 4X85A 3SQOA 4E1BA 3RBVA 4IIGA 4H7JA 1FCVA 2QVLA 2Z3ZA 4QVGA 3JQFA 4C29A 4BFLA 3DE4X 4HY3A 2QLBA 2IYQA 4HP5A 4QG9A 2XR1A 1TU3A 3QV9A 3NH6A 4PLPA 1DPMA 1SZNA 4UQPA 1Y1PA 2GN2A 4B3FX 3F2IA 5LCXA 4X6UA 3H8VA 1WY7A 2GX6A 2H9IA 4L4XA 2FJKA 3AUJA 2I1WA 4Z1DA 4LY0A 1C90A 3VO1A 4UQDA 2XVXA 1XTRA 2OENG 2HQBA 3EFEA 1XU4A 2WLTA 4DPPA 1GTSA 1NWUA 2QDEA 1QTNA 1U9IC 5DO8A 1TQ6A 2G1JA 4A5SA 4GEKA 3I53A 3CWCA 1WXEA 4B9EA 5DWQA 3GLIE 2HMTA 4MADA 1BAGA 2CMFA 4HB4A 1JYVA 1UMLA 1SD1A 2YZRA 5THKA 3ZWPA 1MJHA 2H65A 3PZQA 3CNYA 4OI2A 4QM6A 4H7PA 5BOSB 1GTZA 2YNMC 4MWAB 2CZEA 1W5SA 3H1EA 5BV2P 5DBUA 1R3QA 4M36A 1JJKA 2CNWD 4F3NA 3I5MA 5DTEA 3GBEA 1ZMTA 4YJ5A 3THDA 2VDUE 4Q1VA 2A4KA 1CQIA 3AEQB 3PG9A 3MVIA 2FZBA 4C06A 2AXEA 2J8FA 1X1EA 2YW9A 3AOEA 4RXFA 2VEGA 9LDBA 2D13A 4DQLA 3C0JA 2HK7A 2DX7A 3T0TA 4AIEA 1VBFA 3ZY3A 1OCJA 3UUWA 1ISVA 5LZ8A 5F21A 1OCNA 5FAKA 5LUAA 2XCOA 2CLLB 3MJTA 3OTRA 3R11A 1N2JA 3GJ6A 5B2ZA 5BXRA 4LV8B 1IJFA 4R69A 3M0VA 1TPB1 4RDHA 1YCGA 5A05A 3GNLA 3SQXA 3AHEA 4L9YA 2QQFA 4KKXB 5AHLA 2QD5A 1P2FA 4AJEA 1NBMA 1KJQA 4WDWA 3GZNB 3K4HA 3LX6A 1R9XA 3D3EA 4D4GA 1C3EA 3N12A 3TW0A 3PPWA 2PL1A 2XXAA 3PRHA 4D9GA 5FO1A 4PC1A 3R41A 1LGYA 5K09A 1W1IA 3IK2A 3D54D 2HMWA 5JD4A 2BM0A 4AG3A 4D9MA 3FGCA 3ILXA 4DZRA 4TV5A 1UP2A 1Z06A 3PYLA 2X9LA 1RM0A 1NSFA 4Y6PA 1YCFA 4NDAA 3PQ4A 1LF0A 3L0CA 4MAAA 1QNRA 1KZ6A 2RHBA 4IRXA 4QUDA 1VLHA 4D9KA 5A5WA 2JFFA 3WIVA 2CV1A 2MTBA 4G8JA 3O7MA 1O77A 3W7BA 4Y1EA 4WESB 1VFUA 4Y9RA 2NZYA 3INRA 1EX1A 3B5JA 3ETHA 1V5FA 4AZCB 2G07A 2BCEA 3SVTA 4TYYA 3IVUA 2IIBA 2OCLA 3TNFA 4Q7LA 4GDMA 3BWCA 1X2BA 3PGVA 1VRWA 1BGVA 2C0HA 3BKXA 1N7JA 2X0FA 5IANA 4DLRA 1SW3A 4H3SA 5TQJA 1ZXBA 1IDN1 3KDSE 2BFNA 3A1CA 1BWQA 5DLDA 1ZLXA 3IGXA 1GZUA 2O0KA 2OZLA 1VG0B 3HUEA 1ANKA 4BMVA 4DWWA 4H8NA 4LYQA 3WGUA 4HMCA 1F9CA 3CMJA 5GQSA 4JLOA 3VR6A 3GFZA 4HT3A 3ZCUA 4TQTA 2NZLA 1Z5GA 3AHDA 3RM9A 4X8LA 3BK0A 3BSHA 3IUBA 4LJLA 3FFSA 5BT8A 3DXXA 3QOWA 4P7RA 2G0AA 2YYSA 4ENWA 3ML1A 5KZDA 2Z9BA 5MN6A 2GUUA 3N87A 3CC1A 2ZRHA 2XPKA 5KZEA 3O1LA 1DBSA 1Z75A 1XV8A 2J5RA 4LGCA 1XC7A 3HN6A 2HWGA 4DQWA 2YJTD 1SKMA 3IELA 3M4HA 1XJCA 1UCWA 4X20A 3UJFA 3WJYA 3O82A 4QNMA 1OD0A 1RXIA 1E5VA 3KPWA 2KWIA 1W2PA 2H16A 2PG3A 3CVYA 1GDTA 3K8MA 5LA1A 4MUHA 4X8MA 2VSYA 4J90A 1RK6A 3PLRA 2G9ZA 2J46A 2PM8A 4LHXA 5GZ3A 2CNLA 4DDVA 2Z0IA 3O84A 1IHPA 2ISCA 3KYJB 3DHEA 4FMPA 1ID1A 4IPIA 3NZ1A 1QC5A 3VTAA 4OFXA 3NAVA 2OCBA 4AD0A 4BMPB 4YYZA 1VPDA 1PZFA 4RBNA 4BBZA 5CPTA 3OZDA 5AM1A 3WQHA 4R33A 4LSGA 3KEMA 2RDTA 4LPSA 4LS3A 2Q09A 4GUGA 3GN1A 4N0MA 3HMKA 2QJIA 4F2PA 2ZI3A 3L06A 1MIHA 2Y9PB 3BVJA 4M7SA 4DJDA 2C78A 5XIAA 1W1VA 2PWUA 1OBAA 3DN5A 5C8XA 3FD8A 5LBUA 3LJKA 3ROGA 4LXIA 1WZNA 4PTNA 1PEDA 3KKEA 3EYPA 2YZMA 4DYDA 3QU2A 5BR7A 1PK7A 2E4AA 4QJ4A 3HYNA 5LQSA 4BIMA 2QZ4A 5E3JA 1PX8A 2SHKA 5KKAA 3PL5A 4BNWA 1IAQA 1O8CA 4D6CA 5AVRA 1WXFA 2C9MA 4DCVA 5BR1A 4K3UA 4HAYA 4IGAA 3W7NA 5C7IO 3STUA 2N9UA 4HGOA 5HCIA 2C2OA 3LDAA 2DG2A 1ZAYA 4TV9A 4PYKA 3BLOA 1SG9A 1FDUA 3Q8WA 4FHFA 1ECQA 3GVWA 3ABOB 3FIGA 3TW8A 1TUBB 4BATA 4KAFA 2P6UA 3IP6A 3O31A 2VG8A 4UU8A 2I34A 1H3NA 4KGZA 2IYUA 2NWQA 2RGWA 2AW5A 3LGEA 1V41E 4UMDA 4KWVA 1O1YA 3UV7A 1RABA 2WIBA 1BA3A 4FNUA 2ZWMA 3IEUA 3UIEA 4HYRA 4DJTA 4OHZA 5IFLA 4YJ2B 1N8TA 4ZIRA 3ETEA 1YQTA 2XUOA 3SC3A 1JA1A 4R9NA 3GH4A 4DLKA 4ZOLB 1IYZA 4DMCA 2WJ6A 3B1XA 2NQ8A 1DWFM 3L1JA 5TS2A 3UJDA 1T4BA 4EY6A 1U1UA 4OMDA 4HCDA 2CERA 3TTOA 4O6VA 2EBNA 3G2NA 1J56A 1KNWA 3O8BA 2YWFA 4I4CA 4OVKA 3AJ9A 3OWHA 3EPMA 1RYHA 3UHAA 2IEGA 2D54A 3NAQA 2QN6A 1FXWA 5C81A 2ZSAA 2Y68A 2ZIFA 4LWWA 3EDEA 1P0PA 3ITXA 1JUBA 4JITA 4WHMA 4MW4A 2DKOA 2PUVA 3TWBA 1FL9A 4MRAA 4V0ME 2WJEA 2NQTA 3H3JA 3DM9B 4LF9B 4P34A 1H6AA 4OHUA 4Y9UA 2FRDC 3LCGA 5AW6A 1X1CA 4DYVA 2DFVA 1ITCA 5I4CA 3O6CA 2PB1A 2V3CC 3RLHA 2QF7A 2CBXA 1UCFA 3SN4A 4BXOB 1M04A 3LLFA 2BONA 3VDQA 4CLRA 3CMGA 4INFA 4EW6A 2IS2A 3F8SA 4QXMA 2QMHA 5HILA 3MT7A 1N32B 1ILWA 1OXSC 4IP4A 5HBGA 1RZUA 2ZU6A 1PJQA 4K6GA 1TWZA 3QYSA 2QJNA 1V79A 1LBEA 1GUVA 2I76A 3B3JA 4JB3A 3DT8A 2O3RA 3VNIA 4G1KA 3QSRA 3T1TA 2VWPA 1QOPB 4H9ZA 2ZT7A 4QU8A 2JLVA 3ARXA 1MB9A 4NF2A 3T8LA 3EX7C 4AP9A 3F5MA 5BQFA 2XZ9A 2OXNA 1QHGA 2Q5JA 1XH1A 4I9AA 4BEBA 3LPFA 3QEMB 4FBMA 3N2TA 1A5CA 4ZQOA 4JTSA 1WXDA 1J9ZA 4OEHA 2MNRA 3AVQA 2CJXA 2P1DA 1TPFA 2UZ4A 4TTTS 3SZ8A 5J5AA 2DFTA 3FNQA 4M51A 1PDVA 4G5DA 4RZHA 1YKSA 5TMPA 3H2GA 1H2HA 1PU2A 3UWDA 2EP7A 2GGIA 3LCJA 4B0OA 3VO2A 1XF9A 1C1XA 3NHBA 3C48A 3VGDA 4MGIR 3C45A 4PQFA 2P6PA 2IHNA 1S3SA 2JIOA 3VIPA 1VLZA 1ADCA 3LBCA 4FLOA 2F9MA 2AQKA 3O95A 1RAGA 3U2OA 2WTUA 3KUXA 2UU9B 1JDZA 3Q7TA 3R74A 1CUCA 4BLUA 5K7JA 4YJGA 4M6WB 2YQ4A 3USZA 3NWEA 2ZBUA 3AWOA 4IHAA 3UMGA 2J7DA 3HGOA 4NAHA 3AIEA 2P9BA 4E2YA 4GPZA 4O4LF 2NV2B 3VIOA 5BRAA 4XIAA 2BDTA 4YUAA 3KBMA 2FLKA 4E5UA 2VENA 3LDUA 4IBOA 4WGXA 1XT6A 1OWNA 5AUNB 1I7QB 3FVQA 1MNAA 5FNVB 3WLHA 1OROA 4W82A 4N6GA 5FBHA 4UUIA 1FP2A 3T4PA 3EWSA 5KTTA 1ADYA 1DIKA 3ETLA 5K0LA 1PIWA 3N2GB 4CMCA 4Q1FA 3ORRA 1USWA 3NA8A 5BUSA 4N7QA 1OVDA 5BYAA 4NQ1A 2YIVX 4QX4A 4FB7A 3I5YA 3DOJA 4AUKA 3E5RA 2PSFA 4OG2A 2EJWA 4MW6A 3FYPA 2B2XA 5DMNA 4R2XA 3OCCA 1PJ9A 1MDBA 3I58A 4D8UA 1BLIA 1FQWA 1BFUA 1XALA 1QU2A 1MR3F 2C3MA 3OZEA 3W7JA 3QYPA 3H4XA 3BH6A 1GQKA 1L4EA 4HRAA 4N3BA 3IT2A 4Z0TA 3AERB 3KU1A 2CNNA 3VR4A 2QL9A 4GKKB 1GYMA 4ZVRA 3MJ4A 2JFGA 2OFWA 3OUZA 1M73E 4PMOA 2QRMA 5CMLA 4H8HA 2GDJA 2FR0A 1AQJA 2J0QA 4GQIA 1YOVB 4H4CA 1Y7HA 3EA0A 4XLZA 3WFLA 1OB0A 3VDAA 2PU1A 2WPNA 4KF1A 2PZJA 3PYXA 1WXXA 2XF2A 3K2QA 2WNHA 1H7RA 3B0UX 4IXHA 3ACCA 1K6JA 4QGCA 1IEQA 2VJPA 3T99A 3QOKA 2NVUB 3GC2A 3C3WA 2VGIA 2FFHA 3IQFA 3M5ZA 1CDZA 4JFAA 5AI9A 1TQHA 3SQWA 1NWHA 3OZOA 2WXDM 4DBUA 1WABA 1C14A 4D1YA 2R1NA 4XKMA 3JWIA 3PBWA 5MN4A 4AI6A 2HCJB 4KPUA 1VG9B 4PGMA 3LRPA 2RDXA 1U5AA 3DEFA 4F3YA 1XVVA 5REQB 3NBYC 1P7PA 2GKOA 4K28A 1L4BA 3Q2KA 1J0IA 4DNHA 1ZY9A 1S2DA 2GK7A 1VCHA 4DC0A 1Z12A 4MYAA 2HSZA 3FPHA 4LRSA 3ZY4A 1EUYA 1ZMXA 1XB2A 4KO4S 1QJCA 2R7MA 5LNK6 2PRSA 4G4JA 2LZ0A 3E7WA 2Z5GA 2AVNA 5HZMA 1E4OA 5GJWC 1UINA 1U28C 1CX9A 2X15A 2GBGA 2GK4A 2CLCX 3NAMA 2ESCA 3A8TA 3ZWSA 4NFYA 1M2JA 3Q3VA 4TLDA 1JIXA 3WNCA 3PENA 4OV4A 1YKWA 5ES3A 3CIFA 4KYIB 4GL4A 3B97A 1J6UA 2C82A 1UPBA 2Y1LA 3QU5A 5CT5A 2Q9CA 2I9KA 5BVGA 2N1MA 4QVKA 1Q0LA 4ZA0A 2YX0A 1V7AA 4KR7A 2Z09A 2ZSBA 2BVWA 4M1KA 5CNIA 1FY6A 1O94D 3Q3IA 2A0UA 4RY2A 2W4IA 3OGRA 4H7HA 1E4YA 1IATA 3MCTA 2AG0A 1G5RA 4CIDA 2AAMA 3KFVA 1GTMA 2OV4A 5B2FA 5JQWA 4DYKA 1HOXA 3D6NA 3WNKA 3HDJA 4KFPA 3HFTA 3SVLA 2WPGA 1VDZA 2OJPA 1EVKA 4MW7A 4J3TA 3AJRA 1D0VA 3MT9A 3LD9A 4ZVLA 3MF4A 2ID4A 3SHVA 4CN4A 4L0MA 3DEZA 4MWTA 2R8YA 4RVHA 3U0BA 4LZPA 1NM9A 2FE4A 2QS8A 4QULA 4F71A 2VC7A 1LFDB 2D0HA 2FKPA 2VP9A 2YWXA 4MULA 4PANA 1ZC4A 3FHAA 4D4HA 3OZBA 1Y7LA 1VM6A 1XJ5A 3BWBA 2BPOA 4A2SA 3CUIA 4GC4A 1T3ZA 1MRAA 3RS3A 3AIOA 4OA5A 3ONBA 3TTWA 2MSDB 1E2IA 1D2EA 3DB1A 4M1WA 1Z9BA 2I8CA 1O12A 2JBAB 5JDCC 1YRLA 1MXHA 5HMLA 1L0BA 2BV9A 4WOJA 4Q8UA 3OLCX 2YCJA 1ZHOA 2FCAA 1C3JA 1F0PA 3JALB 3H26A 4R1PA 1IJKA 4NUWA 4E5KA 2DZVA 3LOPA 4V0RA 5K51A 3W8NA 2JFWA 2FPPA 2C71A 3TBHA 1QZZA 4HLCA 1M8KA 4OHRA 3DTYA 4QHYA 2G41A 1E0AA 4Z3OA 2BFWA 3L1IA 3R5EA 3W0LB 1XVLA 2WRZA 3PGLA 5ALSA 3HJRA 4EHLA 1E4MM 4WXYB 2DORA 3AHZA 2AHRA 3LNCA 4JX6A 4ZEXA 1PK9A 2VN8A 3M7IA 4UNRA 1DKWA 4R6XA 4NQRA 1TPC1 2RHGA 3PNQA 1XGZA 1MPXA 4G97A 3VXGA 4GZ3A 1QDLB 3STVA 2IS4A 3L46A 1H2FA 2GJLA 1USGA 4RTQA 3PZIA 1DWHM 3R9KA 3NGMA 4UIOA 4X66B 1B16A 1KI9A 3EZLA 4QLAA 2GPSA 2VRWA 1LROA 4RULA 4ATDA 3VE9A 1TQXA 3N15A 3RROA 4CM9A 3KUMA 2VPPA 1JAEA 1MFZA 4MKVA 5D5PA 2OOFA 2ZJBA 2H9AA 3THYA 3VOIA 2IZOA 4KR2A 3QQ1A 1Z5WA 2PGOA 1NF7A 3L8GA 4HFJA 4LVGA 5ESWA 4PLTA 5FPQA 4J94A 4UBIA 4HA3A 1UFVA 3ND9A 4NYIR 3N2LA 3GY0A 2GUBA 1XAJA 1OFAA 1T5SA 1LBIA 1LJUA 1P4CA 1NJSA 3BXFA 1WDDA 1T8YA 4ZHSA 2ASVA 1XD1A 1CSEE 4OE7A 4GX0A 2QQ6A 2Y62A 2D2GA 2NV6A 4PMNA 2PH1A 1LQAA 2V2CA 5JAZA 4YO8A 2XMPA 4W5OA 1BDMA 2PA6A 4GI3A 1ZQ9A 4BLSA 2NUYA 1CEEA 3N2EA 5DQPA 3CQ0A 4HOYA 1W1PA 3EDCA 4MNJA 2GBIA 4ZCLA 1W1A1 3D3WA 2XYVA 4O1HA 4U8GA 2DZSA 3GEHA 4PLGA 1S01A 1VYRA 4KETA 2CKSA 1E2BA 2YA1A 3H11B 5A1AA 3W9UA 3H5AA 2IXVA 2PKYX 4D5EA 4LEQA 3NQCA 1T7LA 5IT4A 1PV2A 2KLBA 3VJKA 4MUXA 4BV8A 4M1BA 3C3AA 1P7VA 2UYCA 4CKWA 1XTQA 2VJOA 3DTVA 2V9CA 4QDOA 2OM2A 2VBFA 2HBRA 5DMLA 4CF7A 1CNEA 1YQ9A 5LA6F 4AJKA 2M98A 5B3JC 4YP7A 1ZIDA 1Q92A 1C7QA 5JJ5A 5CXPA 2VDMB 3ZE1B 3B9QA 4LOCA 3PZMA 2C2MA 5L3QA 4JKKA 4UB9A 4TU1A 1XLIA 1ZJ5A 4JWTA 4M0EA 3RUEA 4ZI2A 2D00A 5FBLB 4LN1A 1TUGA 3CEUA 1HP4A 1YONA 2WA2A 3EWUA 4YHHB 4UTOA 1M2FA 9XIAA 3SADA 3DEQA 3W7LA 3T0DA 4J76A 4Y7EA 1URPA 3VBCA 5DBGA 5BW8A 1TUXA 4EHAA 4B3KA 4FMDF 4FYIA 5D3ZA 3IV3A 3A12A 3M81A 3T5GA 4IQGA 3EZGA 4ASUD 2H5EA 2RSLA 1PJAA 3FA4A 3VCRA 3VGGA 3IIPA 3MCNA 1TCDA 4M0DA 4D6GA 3WKCA 2VHVA 4WDUA 3MCAA 1LOSA 1L7PA 4JQYA 5D3KA 1L4FA 1E7YA 4X63A 2HS6A 1GOXA 2R9VA 2IU4A 521PA 4NABA 5GPRA 4JN6A 3RPMA 3QZAA 1B43A 3PFIA 3TFQA 3G82C 2EC5A 3KQHA 1ZGGA 4KYUA 3TLQA 1NKSA 1O54A 3QHPA 4Q0MA 4PS0A 3STGA 3M6MD 4CD4A 4JGIA 2DH6A 4J7UA 4B91A 5AVWA 1SU8A 3LHDA 3N2KA 3TR0A 4MP6A 2ONKA 2BTQA 2PDKA 3JQAA 3MA8A 2VT6A 1EYEA 1PZ3A 3AT1A 4XVEA 3BL5A 4A3RA 4OU4A 5H3LA 1R7OA 4P7KA 5IJXA 1CQZA 1ALDA 1M53A 2E1RA 1XP8A 5K99A 4AG6A 2QP9X 1P4AA 3BGVA 3L49A 2VSQA 3P4YA 1I1NA 1PLLA 1V3QE 2F3RA 3IAXA 2ONZA 4X6LA 5LDHA 2WM0A 4KHZA 4HSGA 4MYHA 1H22A 2JFHA 4C2TA 4E2VA 3FNFA 1RQBA 1DV1A 2HRDA 3O4IA 4LEIA 1T8UA 1YZHA 1E2JA 2TS1A 3I62A 4OH1A 3BTVA 1DORA 3M89A 4LAOA 2HADA 2NLIA 3A05A 4RMNA 3PX7A 2OMEA 1TU0A 1DHKA 2GVJA 3A47A 3QR3A 1SJCA 4XWGA 2XTZA 4WLEA 1FTSA 4UUBA 2OXCA 4TKMA 4ZREA 4ZT2A 3KZSA 3NC0C 3N2OA 1AV6A 4OXIA 3OQ1A 4C91A 3PZBA 3ZHUA 1XLFA 3M5CA 3N7UA 4CI9A 3SURA 1OOEA 3TBKA 2O8EB 1FWDC 5E2IA 3PEFA 2IS1A 1ECPA 5FIUA 1GZDA 1K9DA 2ZIAA 4FJ2A 1JTVA 3B8WA 4JBGA 3RHZA 4G67A 1WZLA 1XIVA 1YR6A 2WCAA 5E38A 4MPJA 4Z8YA 2HZGA 1KARA 4EDFA 5H16A 2EF1A 5K20A 2CIPA 4BUCA 1FRFS 3CMCO 1A8HA 1QH0A 2W58A 4CM3A 1LM1A 5KTLA 1YI0A 4M19A 3BK7A 1XR2A 5DXAA 1DEKA 1BGXT 3SI9A 2EL7A 4QG8A 1MEJA 4BQQA 4HXEB 2REQA 1TZ2A 1Z6TA 2PTDA 4GWGA 1GVQA 4UTXA 4ZYVA 4BWFB 1RHQA 2ERXA 5KWSA 4P3OA 4HYWA 1IE3A 2WG0A 2QA5A 1JRLA 5LIUX 4ERXA 4GLFA 3ZHYA 1N1EA 3PDHA 3I6RA 4HHPA 4IG2A 5DNWA 2XLBA 4F96A 3CRNA 1R4MA 2C7FA 1BW9B 3WQBA 4B80A 2VHZA 1I4NA 2ORED 4CEIA 4PONA 1U30A 1QK0A 1D1SA 1HDZA 2H1LA 4KIGA 3AM3A 3VU2A 1R1DA 3UXEA 3RJXA 3V5NA 2Q5OA 1OD6A 4UU7A 3LYAA 2Y2UA 2Z2UA 1X8CA 3MTDA 1M54A 4ZQHA 1MB4A 4C90A 3OLWA 1XNJA 5CB4F 3GHSA 4MVAA 2CJPA 1Q6LA 5LD2C 1GUBA 1FLVA 3I2HA 1KBLA 4DZTA 3H84A 1QGUA 1N0WA 1MZPA 4XASA 4FN4A 2P11A 4LNCA 3K09A 1U1HA 4XVUA 1WWKA 4FCWA 4UVHA 1L5ZA 4OTZA 1V11A 3SRDA 1WBJA 1YDGA 4GUJA 1GOIA 4FDAA 3FOAA 2EJVA 1NX6A 1L9WA 3VPLA 2VYND 1RQNA 5BW4A 3MTIA 2YR1A 1AE1A 1MQPA 4E4PA 2ZZ4A 1PB0A 3BV7A 3UG4A 4JFWA 4QHRA 2R6CA 1TIBA 5FHQA 3CIOA 2XE8A 4AM8A 4DFDA 4GX8A 3LXRA 2PMDA 4AIOA 2O4CA 3AO0A 3HM2A 3VOFA 3KW3A 4FEZA 4C7GA 3HL4A 1Y3HA 2FR8C 3R2GA 4FR6A 4J1TC 1WZKA 3C6QA 3HVRA 1N57A 2JB9A 3UUFA 1LDMA 1YRRA 2O4QA 2QQEA 2NG1A 2G0WA 3QNWA 3LM3A 5ITVA 2WWXA 1COWD 3WKAA 4N6EA 4KP7A 1XD8A 3OLXA 1DG9A 4UBLA 4JBLA 3H7UA 5CAEA 2R1VB 2GLTA 2P3EA 3SXPA 1GQNA 1E77A 1D4FA 1SURA 4CUCA 4NNAA 4OQMA 3UCCA 3SCTA 3U4FA 5EIFA 4TWRA 2INFA 4XSVA 3EBOA 1YBVA 2RG7A 1QHYA 1SHZA 1UKSA 5CA0A 4GJIA 5ITWA 1OZMA 1Z0FA 1MKYA 4FX2A 1S2NA