4G56A

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
626
structure length
617
Chain Sequence
b'RVSSGRDVACVTEVADTLGAMANQGFDFLCMPIFHPRFKREFYKEPAKSRPGPQTRSDLLLSGRDWNTLIVGKLSDWIKTDSEVSRIRKTSEAAMQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHVGHHSTMFWMRVPLMAPNDLRDDLIENEPGEERTWIWWHNFRSLCDYNKKIALAIEIGADLPSGHVIDRWLGEPIKAAFLPTSIFLTNKKGFPVLTKVHQRLIFKLFKLEVQFVISGSHHHSEKDLCSYLQYLEYLSQNSPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQILMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQVTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDDGVSIPGEYTSYLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFHHPNKDDVIDNNRYCCLQYRVDLNTVLHGFAGYFNTVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPMREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hsl7 protein
molecule tags Transferase
source organism Xenopus laevis
publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
total genus 169
structure length 617
sequence length 626
chains with identical sequence C
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4g56A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4g56A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4g56A02
2FK7A 2XIMA 5AVNA 1VPTA 3IYLW 4CTKA 3QZAA 3LDUA 4PCAA 3TM5A 3TPZA 5DM1A 4PYJA 8MHTA 1XJ5A 1JG1A 2VDWA 2PWPA 1YZ3A 1XYLA 2FHPA 3PVCA 3T7TA 3THSA 5LR6A 3MTEA 1OR8A 5E9WA 3C6KA 5CVUA 5EMKA 1XLFA 3OBEA 1XLAA 3E05A 3KQMA 3D2LA 3VYLA 1SKMA 5DX8A 5CVJA 2PXAA 3TM4A 4E32A 5F2NA 5EHGA 2BH2A 4X41A 1XIHA 4HTFB 1R74A 3B5IA 4EVIA 5LQRA 3K0BA 5EOVA 5M5BA 3E7PA 1KYZA 1RJGA 1XCJA 1XINA 4OA5A 2AVNA 1INLA 3HCCA 4GJIA 2IPXA 3KWSA 4X60A 1G55A 1NW7A 1RJDA 2B78A 2EFJA 3UWPA 2XYQA 4YTQA 2P3QA 4YUYA 5ICGA 5LQNA 1XLIA 1G6Q1 3IUDA 1NT2A 2ZW9A 2YVLA 1BHJA 4FP9A 3ELWA 1SG9A 3LCVB 3CVOA 3HCFA 4YV1A 4HSGA 1XLBA 4QE5A 3OZTA 4A8IA 2NQ9A 1VP9A 3G2QA 4R6WA 5DXAA 4QPNA 2NYUA 4QE1A 2ONYA 2NQHA 2AZTA 5HIJA 2JH9A 5CCBA 3AJDA 3OU7A 2EJTA 4E2ZA 3A4TA 1L1EA 2YQZA 4E31A 4RTNA 3LMZA 2I9KA 3NJRA 2AOUB 4R8SA 3LKDA 2B25A 1JR4A 2ZVJA 3IHTA 3MCTA 2GYIA 4FR0A 3P6LA 2Z6AA 1EJ0A 4QDWA 2QM3A 1TZ9A 3KR1A 4FSXA 5DT2A 3M0LA 4C4AA 4IV0A 4HH4A 5TNVA 3KBWA 1EJ6A 2Z6UA 4PYMA 4WXHA 4M37A 2QRVA 2K4MA 1R6AA 2GLKA 1NW6A 3GRYA 3HNRA 3SM3A 1VP3A 3M6WA 3P2IA 5FQNA 2FPOA 5CVDA 3R9XB 4ZBCA 1KHHA 3R0QA 5AVHA 2OPBA 4LG1A 5GIPE 4A8LA 1G8AA 1N2XA 3CBGA 3GRVA 3PS9A 3ELDA 4CKCA 5LQUA 2CKDA 3HCAA 2ZIEA 3CCFA 3XINA 4K1GA 3QXBA 4M7RA 3X0DA 1X1DA 2O06A 3UZUA 5CVEA 3UJ7A 3HP7A 4M38A 3GRZA 3O7WA 4Y30A 1QYRA 2OY0A 3EPPA 3G2OA 4NECA 5E2AA 4XUEA 1XYCA 2AOTB 2JHAA 3UJCA 5DLYA 3DXZA 3UFBA 2R3SA 3GXOA 2OB1A 3KQOA 2HV9A 4OQDA 2JH8A 5DSTA 2ZFUA 3KHKA 1P91A 1P1CA 3NMUF 3GU3A 4RVHA 5BW5A 3SMQA 2HK0A 1H1DA 1SQFA 2VDUE 3C3PA 2Y1XA 2EJUA 3HA7A 3L8DA 1XLJA 5XIMA 3VNLA 3S68A 3P2EA 3TLJA 3M6UA 3TMAA 3TFWA 3FPEA 5KQRA 3PTAA 1M0EA 4M36A 4V0QA 4GOOD 3EVDA 1A0EA 1T43A 2BR4A 2JJQA 2BZGA 3I64A 1L9KA 3P9KA 4CTJA 2OBFA 4C07A 3BWBA 2QY6A 5EKXA 5LQJA 2G1PA 3CC8A 4C05A 1JG3A 4KW2A 2R6ZA 4IV8A 2O57A 3U3HA 1ZHFA 4EK9A 5G02A 4HHMA 5LSAA 3N4AA 2PT9A 4FGZA 4FT2A 3Q7EA 2O05A 5CM2Z 5HFJA 3HA5A 3AWIA 3QOXA 2ZIFA 3CJRA 3TKYA 3P2KA 4CXMA 2GB4A 3DP7A 4W4QA 4P7KA 9XIAA 2PJDA 1KP9A 2OXTA 3UJBA 4DF3A 4FT4A 3WSTA 2PBFA 4PGLA 2GA9A 5BXYA 3BDKA 1P39A 2P7HA 2QUMA 3FYCA 3GNXA 3HM2A 4OQEA 3SGLA 4EQZA 5BW4A 1DIDA 5FCDA 1I6NA 1I60A 3ITOA 1QANA 2VP3A 2YXDA 1S5MA 1VBFA 4RTOA 2UYCA 4C04A 3DUWA 2YR0A 1KPHA 2B9EA 4KIGA 2FK8A 1Y8CA 3BWCA 4P7JA 1B42A 1NE2A 4KDCA 3ITVA 5LQAA 1XLHA 2AOUA 1DIEA 3PFGA 1XIIA 3AYVA 3I58A 5DRTA 1XYMA 1NKVA 1JSXA 2NNWB 3LBFA 2PSSA 1EQAA 3FRIA 2P3OA 3T7SA 1FP2A 4B17A 3G88A 4KWCA 1QAOA 4HGYA 3BZJA 3BWYA 4YMGA 1RJEA 4GF5A 3ELYA 1BKYA 4DVOA 3P71T 3EVCA 3U0HA 4DKJA 1V39A 1NV8A 1ZKDA 2AR0A 3NDIA 4XKMA 3XIMA 3CQKA 2GS9A 3DLCA 4LECA 1KR5A 5EVJA 5HIIA 1VLMA 2IDKA 4UOEA 3HVHA 3K6RA 1BC5A 1R8YA 2PX8A 4AZTA 4RTKA 1R8XA 2P7IA 2UYQA 4DCGA 3RW9A 3FTEA 1YZHA 2OKCA 2P40A 5FULA 5ICEA 3E8SA 5EQJB 2WA1A 3UJDA 1R18A 4POOA 3M0MA 3EGIA 3C6MA 3KR9A 3FPJA 3GRRA 4RVGA 3B7PA 4KIFA 4YTSA 5I7GA 4Z2YA 2P41A 4QVKA 3TOSA 4YV2A 3QC0A 5EMMA 2NQJA 3OU6A 3PFHA 3VSEA 2GPYA 3KBMA 3EGEA 4DMGA 3UJ8A 1DCTA 4P7FA 3A25A 5K0LA 5EIFA 1WG8A 1ZG3A 3CGGA 3GJYA 3HA3A 3LPMA 3TVAA 4PYOA 4ISCA 4XIAA 1O9HA 2LD4A 4ER7A 3EEOA 2QUNA 1XYAA 4GBED 4YTUA 4HNOA 2IFTA 3DX5A 5E8JA 5LQCA 1DXIA 3C0LA 5H6HA 1JQEA 3FUVA 5H02A 1R00A 3DMGA 3BZBA 4E70A 4ER5A 3ERCA 2X7VA 3PT9A 4QQNA 2PT6A 3V97A 1ZGAA 4BLVA 2UYHA 4HG2A 5H1WA 3KQPA 1G38A 2XINA 4DM3A 3R3HA 3KBVA 3SX0A 3JWGA 3XISA 3HEMA 3DMFA 1RI1A 3MQ2A 1RI2A 3EGVA 3NDJA 4ZB2A 3SR4A 4CKEA 3ITYA 1UFKA 3M33A 5K0EA 4YUZA 4R6XA 5EMLA 1NW8A 2OO3A 3U81A 3CJTA 4U7PB 4ZTBA 4PONA 2X7WA 2ERCA 2F8LA 1DE6A 3MCZA 1NBIA 2PXCA 4FSDA 2V7EA 3UA3A 3BGDA 1XDUA 2ZBRA 2ZZMA 4XIMA 1A0CA 2PX2A 4BP3A 4DA4A 3SVZA 1MJFA 1XIBA 2FCAA 4PYKA 5EC8A 4ER6A 5K0BA 3MHTA 2C7OA 3VNKA 4PCLA 1BXBA 2Q41A 4YUXA 1G60A 4GQBA 4V0RA 1VE3A 3MGGA 4OA8A 4CKBA 2ZWVA 1YFLA 4X1OA 1JQ3A 2G4JA 1XISA 4QVGA 3KU1A 3O4FA 3G2PA 1JQDA 5HEKA 3P9CA 3M4XA 3ITTA 3SSMA 4E2YA 4RTRA 2C7QA 3UA4A 4P7GA 1L3IA 2WA2A 1PRYA 3FUTA 5EPEA 5CIYA 3NVKI 5XIAA 1M6EX 5J8LA 4AZWA 2VZ9A 3LHDA 3JU2A 5D1HA 2P35A 3I5UA 2NXJA 2YX1A 5K09A 1BOOA 2IP2A 5CUQA 4XSMA 3HTXA 3REOA 1XLLA 1XIJA 3KKZA 4XSLA 3EVEA 2XBMA 3BWMA 2ZZNA 5DM0A 3ER9A 1D2CA 4GC9A 3V8VA 2H00A 5K0GA 5EIWA 1SUIA 1ORIA 4DUOA 4C03A 3UU0A 3DOUA 1O1HA 1KPIA 1TPYA 3KQYA 3LX6A 1P1BA 3CJQA 3SSNA 4C06A 4PIMA 4PINA 1KXZA 3ANXA 4ER3A 2B2CA 5ICFA 3KBSA 1NW3A 6XIAA 2KW5A 3EMDA 3KPWA 2AOTA 4O29A 2I57A 1U2ZA 4EKIA 3CQHA 2BR5A 3LCUA 2ZTHA 3NWBA 1G8SA 2OB2A 2ZDSA 2Q02A 3KQTA 3UBTA 3G8BA 3M0YA 3WQOA 1D2HA 3EVBA 3QV2A 2Z6QA 3NW9A 2XISA 3KQVA 1IM8A 3KR2A 5D1NA 5DM2A 2GUBA 3DMHA 2OU4A 4KW7A 2AS0A 4AZSA 1ZQ9A 1S5NA 1UWVA 3C0SA 3OFJA 5E9JA 3ER8A 4EACA 3JWHA 4RX1A 4X61A 3P9IA 4ER0A 3P8ZA 4US6A 2J6VA 2G8NA 1WXWA 5FWDA 2VDVE 3LDGA 4KDRA 4QEHA 4R05A 4WVLA 1I4WA 3VC1A 1L3CA 1AQJA 3A26A 3UJ9A 3GIWA 2ZCJA 3KR0A 3LKZA 4QQKA 5JR3A 4HGXA 5E1MA 2IBSA 5K0NA 4OBXA 1XCLA 3OU2A 3BT7A 2YTZA 2ZSUA 3HCBA 1VQ1A 3OFKA 1TW3A 1K77A 4JXJA 1KIAA 3RODA 2HR1A 5K8VA 3EEYA 2Y1WA 1FP1D 2PLWA 3EVGA 1IXKA 2V74B 2G0WA 3FZGA 4MWZA 3TRKA 3FTFA 3AY0A 5FTWA 3JWIA 3MAGA 5BP7A 1Q0SA 2PWYA 1BXCA 3E23A 2IIPA 2QYOA 3LGAA 4PWYA 5DM4A 4EMSA 3A7EA 5EG5A 2QRVB 3OCJA 5K0JA 1FJXA 4RSRA 2ORED 3L23A 2HMYB 1SQGA 2AOVA 1D2GA 2GLUA 5F2OA 2O0LA 1SUSA 5ICCA 1WY7A 3GGDA 5EEGA 4YTRA 3ME5A 5FQOA 4HGZA 2C7PA 3A27A 4PIPA 2IH2A 5MHTA 3CQIA 3FTDA 3NGFA 2CWWA 3C0QA 3FVMA 1F3LA 3VNMA 5E2BA 1VIDA 3P9NA 2ONZA 1EG2A 5F2KA 4KVZA 2QW5A 4X63A 2B3TA 3DULA 5EKUA 2ZVRA 1FPQA 3G2MA 1XVAA 3Q87B 4K3ZA 5CVVA 1WXXA 2PXXA 5KVAA 1I9GA 2HTEA 5K0FA 3BWWA 5FUBA 4YTTA 2ZBPA 4AUKA 2HNKA 10MHA 4C08A 5EHIA 2HWKA 4GC5A 1VL5A 3I9FA 4RTLA 5HIKA 1O9GA 3BKXA 1ZGJA 2EX4A 2QE6A 3LL7A 3T0IA 4ATNA 4AZVA 5K0CA 4LWOA 3PB3A 4RTMA 5DX0A 3KPYA 3DXYA 4BP1A 3OE4A 3FUUA 2HCVA 1DE5A 3QYSA 2JG3A 4DZRA 4GEKA 1WZNA 5DTRA 2G72A 4LNCA 5C0OE 5CD1A 3ORHA 2I56A 4DQ0A 2XYRA 4EKGA 2ADMA 4HTFA 1L3BA 1OADA 3AYTA 3PX2A 5HILA 1XLMA 5B1SA 4E3VA 1QT1A 1KPGA 4QDKA 3T7RA 1NBHA 5DWQA 1AQIA 3PX3A 3F4KA 1XLKA 1I1NA 1O54A 2O07A 1KYWA 3JWJA 4HHLA 1XXLA 3M6XA 3G5TA 1ORHA 4GJJA 1Q0TA 2IGTA 3GCZA 5JUWA 3B3FA 1XLCA 1NV9A 4RTJA 3M0XA 3FPFA 3IV6A 5T64A 1YF3A 4BY9E 2CMGA 4KRGA 5GM1A 3GO4A 3NVMB 2P1DA 5U4XA 3CQJA 4IKPA 2ZULA 2N47A 4GOLD 3VYWA 5IKMA 4QEEA 1QAMA 5FHQA 3HCDA 3ITXA 5C9ZA 2BM9A 4F86A 2XVAA 2NP6A 7XIMA 2GH1A 2I6GA 3AALA 3GWZA 3A7DA 4OBWA 5KQSA 1XDZA 3FPGA 3B3JA 4GLEA 5K01A 4ZB0A 1RJFA 2WK1A 3BGIA 3KCJA 5B80A 1FBNA 3DTNA 3MB5A 1EIZA 4PYQA 4G56A 4EAYA 1Z3CA 2ZIGA 4RVFA 2NP7A 3KPJA 3SSOA 4GOND 4PYLA 3B89A 1TW2A 1JTFA 3LCCA 2DPMA 1JG2A 4Q7IA 4RV9A 5DTMA 4DCMA 3QOWA 1YUBA 2AVDA 3BXOA 4A8NA 5E1OA 5FA8A 5DRYA 5FHRA 4MQ4A 4A6DA 5E1BA 2IH5A 1MNZA 4PNEA 4RTPA 3P97A 4QDJA 4F84A 1XLDA 1QUMA 1AF7A 3SXJA 3THRA 4FZVA 4GUAA 4YUVA 1RI3A 3M6VA 4E30A 3IUIA 1QAQA 2H11A 5CCXA 2I7CA 2G71A 2VS1A 2QULA 4QTTB 4GOMD 5EEHA 3ID6C 1YX1A 3M0VA 2NXEA 2IBTA 1SVUA 3IUHA 3KPVA 4AX8A 3CNYA 4PYIA 1QTWA 5GM2A 4E2WA 3HVIA 3FPHA 4BLWA 4U7TB 3DXXA 1YB2A 1RI4A 2PX5A 3G5LA 3KCLA 4MIKA 5EZQA 5KYGA 4MTLA 3OE5A 3UJAA 2GVEA 4E33A 5B7YA 2AN3A 4K6MA 3KBNA 2PGXA 4PGHA 2IH4A 4YMHA 1D8WA 5GOZA 2UYOA 1UIRA 3LDFA 2OYRA 4YV0A 5K03A 3BUSA 1N7JA 3CWHA 5GIOE 4PFHA 1F38A 1X1CA 2E5WA 3FUWA 4J4KA 3OPNA 3LECA 2OZVA 3BGVA 4P58A 4IWNA 3KQQA 3FRHA 1AV6A 4FS8A 3ITLA 5GINE 3UJ6A 3BKWA 1RI5A 1XIGA 3HVKA 7MHTA 1XICA 1JSZA 2PVCA 3EMBA 2GAFA 4F85A 5E9QA 3KQWA 1GW9A 6XIMA 3IEIA 1XLEA 3BZGA 1A0DA 3DR5A 2FYTA 3KTCA 3DLIA 3R6TA 5EMJA 2NXNA 5EGSA 5B7ZA 3C3YA 5HOQA 5LQKA 3AXSA 1XTPA 1XIMA 5XINA 2CL5A 3NWEA 3M0HA 1NW5A 2PV0A 4Y2HA 3P14A 3TC3A 1XIDA 2XYVA 4A8RA 3B3GA 3BANA 9XIMA 1XDSA 2XVMA 3GNLA 4XCXA 2H1RA 2PKWA 4XUCA 2YUIA 3AXTA 5DXJA 1PJZA 3G89A 3KBJA 4RYLA 4ZB5A 5EZSA 5K05A 4HC4A 2YXLA 5C1IA 3NTVA 3RIEA 3MTIA 3KQSA 1CLKA 1XP3A 3DBNA 2ESRA 2BR3A 5E8RA 3VNIA 1DUSA 2AN5A 5IH3A 1QZZA 1X19A 2JHCA 3FYDA 2PX4A 2YXEA 3G7UA 5DSXA 4H0NA 4RTSA 1MHTA 1XYBA 3VNJA 3UXIA 5T6BA 3EVZA 4A6EA 3GDHA 3GRUA 3O31A 3OZRA 4L7VA 3TQSA 2AN4A 4YUWA 5DTQA 1EAMA 1X1BA 3LBYA 4QDPA 2P3LA 3R24A 2P8JA 5KS2A 5E1DA 3CKKA 3FUXA 2AOXA 5HIMA 2DULA 2A14A 3I53A 4HRAA 3G8AA 5FADA 4RWZA 5ERGB 5FWAA 1XIFA 3FTCA 4OX9Y 4RVDA 1JG4A 2CMHA 3PLAE 2AOWA 2ZZKA 1XIEA 5GP1A 3TKAA 1HNNA 4QE4A 2HK1A 3EVAA 4OVXA 3MERA 4MHTA 3HVJA 2C7RA 1MUWA 3KCOA 1JTEA 4R8RA 2NXCA 4RTQA 3VC2A 2I62A 1M6YA 2BM8A 2ZLBA 3AAMA 2EG5A 2ZBQA 4LWPA 5FA5A 8XIMA 2IDJA 3KPUA 1DL5A 3UVAA 3C0KA 4PGGA 5P8WA 1WS6A 8XIAA 3LSTA 3TR6A 1X1AA 4PYNA 4CWAA 3HCEA 9MHTA 2JHPA 2PY6A 3OZSA 2UZ4A 4XISA 1IY9A 5DX1A 3H2BA 4BLUA 1HMYA 3EVFA 3M70A 3DH0A 5GWXA 3ELUA 2G70A 5T67A 4QTUB 1YFJA 4XUDA 1N7IA 2ZWAA 5DPMA 4E2XA 5HZMA 1XLGA 4QPPA 2FRXA
chains in the Genus database with same CATH superfamily
4F8EA 3KM8A 3BORA 4NOKA 1UR1A 3M7IA 2GA8A 1W3TA 3SNHA 4Q7BA 4NF7A 3EQ9A 3DOCA 4HU8A 2OXTA 2XADA 1PTJA 1A9YA 1U9IA 5KINB 2AG5A 3EQ6A 4UR8A 1L4EA 1EEXA 3L3BA 1Q0HA 2CLKB 1YQUA 1DAOA 2C15A 2PMBA 4IPTA 2QD1A 4YCBA 2JFUA 1BGAA 2JDID 4Z4IA 5KNBH 3BVJA 3SM3A 3HBFA 2UZIR 4GYPA 1YCFA 1G8AA 2G9NA 3R7LA 4N5IX 1X7IA 1N33B 4US0R 5D5PA 4EY8A 3H70A 3ESQA 4EG1A 4FQ8A 2SKDA 1IN7A 4FN4A 2WBGA 2J6BA 3OOYA 5JCPA 4CT5A 2OVLA 1P91A 3IEMA 1JYFA 1JLMA 2EJ1A 2WJDA 3P2EA 1KEVA 4F9EA 3ELBA 2LNDA 2ZYVX 1XRRA 3B03A 2JNWA 4WDWA 1R16A 1OREA 3C3MA 1K7FB 4GG1A 2ZIFA 2DCUA 3B9OA 1TZBA 2PJDA 3OICA 2VT0A 2W4IA 4L4PA 3A6DA 4BXOA 1I80A 3R0ZA 4K05A 1IEIA 3IX7A 4PZVA 1EB3A 1CPYA 4HLUC 4BNHA 5BNFA 1VRVA 5CSYA 2B4YA 2ZRMA 1OGGA 3NBKA 1KO7A 2J9XA 1PQYA 4MIMA 2SICE 3DBLB 3KX6A 4RM3A 3WRXA 2VNCA 3RO6A 2G8ZA 5LIXX 2QGNA 3W1WA 3OIVA 3T9CA 3M0ZA 2FSVC 1EWKA 2VSFA 3ROKA 3W9UA 2PKQP 3UXEA 4E0BA 1YOVB 5MFPA 3M4NA 2AUTA 3P81A 3C6QA 3K73O 3OM8A 2V38A 4XB1A 4FKMA 4ZOAA 3I1JA 5AVXA 4JX5A 5JAPA 2RD2A 4JQ1A 3NM6B 5CJ5A 2R2GA 3G9ZA 5ITZB 5T4EA 3ZSTA 4OSEA 4F2WA 4U7PB 3ONNA 2I0FA 1XDUA 3EDYA 3TNLA 3AFIA 5HF8A 4I5EA 4LCJA 3GUGA 7REQB 3ZK9A 3DDZX 4WI1A 3WQ4A 2HJRA 3GEBA 1OTHA 2OAGA 2JGIA 5ADVA 5FUMA 2R84A 1XQLA 2XV1A 5BSEA 1HC7A 3B8DA 2W6QA 4JASB 2XDFA 3QYQA 1G7RA 2I54A 2HSDA 2WMOB 3IAM6 2WMYA 1OVGA 2IZZA 2WC4A 3GXFA 4JC5A 3EJWA 5KMGA 3CL6A 1TCMA 4MS4B 2CB0A 3MS2A 3TYAA 3QX7A 4JJEA 3OLZA 4CDRA 1QI0A 4FYWA 4UHHA 2RK6A 1KVRA 4Q01A 3KAPA 2UUCB 1E1NA 2QRVB 1VKFA 1WQ4A 4B84A 1N6IA 5F2OA 2A3LA 3ADDA 5CJJA 4YTRA 3ENNA 3IOBA 4JLAA 2QTVB 3WD4A 4HDSB 3EX4A 2CSUA 2Q4EA 4AMGA 3HNOA 2MDTA 1M0TA 5EHXA 3KU4A 4ES4A 2EKLA 3ZY5A 2ZSBA 4Z0HO 3BEOA 1FX6A 1VIWA 4DRYA 2OC4A 3TEFA 1ONOA 3B1XA 3EZ6A 3BIWA 2ALDA 1IK4A 2HRCA 4OQZA 4O8AA 1Z2EA 4KR2A 5JEDA 3PYLA 2QD5A 3TFCA 2GEFA 1MW9X 3PWTA 4PBGA 1RE1A 1PNOA 4OPMA 1RTTA 1DBIA 3HDGA 1HGXA 4GFIA 2BFGA 4BL5A 1BHGA 1WVMA 3EZ9A 7XIMA 3CEPA 3GAYA 4P92A 2YW3A 4JTKA 2A7NA 1WKVA 3GH3A 3JRWA 2Y70A 1KF0A 4IVRA 4A6DA 1Z5UA 5LP6F 3NCTA 1EJXC 3A70A 4UDXX 2UXCB 3RS5A 2W0SA 2QZ4A 3GH1A 4D4GA 1H11A 5CZSA 1W4CA 2I7TA 3TDKA 1G66A 1MRQA 2QAPA 3FHQA 1O95D 4AZ0B 2FQWA 5K2OA 1K08A 2QTRA 3C3JA 3M83A 1XLEA 3B3DA 9LDBA 3FMFA 3LCMA 5C8YF 5ECWA 3AETA 3Q9NA 4DG5A 3PUXA 5KQPA 3GDGA 3UY4A 1MUUA 4JSTA 3WMWA 2G9VA 4RTSA 1XYBA 3VHXA 3ZJ5A 4UBLA 2VYQA 4MCAA 3OVRA 2WNSA 2IKJA 1R85A 1WUYA 4LXHA 1VMDA 5DP2A 3SZLA 1K8RA 2NLYA 3UMBA 2CF6A 5LUBA 1J5XA 1MAUA 5DLQC 2IDJA 1WS6A 3AGQA 2D0GA 3A6EA 2RH9A 1QLJA 1CR2A 1JECA 2OSBA 1QO5A 2NT0A 2EF0A 4BP9A 3L1KA 5L3RA 1TZCA 4HB4A 1E2GA 1QG2A 5C4IA 4ACYA 3C1AA 2OTCA 4X7BA 4ES6A 4D0NA 5EOVA 1RJGA 5JHGB 4W85A 2BFNA 2O9PA 1FFRA 3Q67A 4GI1A 1J0JA 3TLYA 5EKSA 2RC6A 3QY6A 4RZIA 4X6UA 3WQBA 4OP2A 3IK4A 1AN0A 1TX2A 4KZKA 3F5DA 3SXPA 1IPHA 4MXDA 3DI0A 4C6MA 3HNRA 4K6HA 5BV1A 4O4HA 3HHPA 1GTZA 2JKVA 2ILVA 5IJ9A 2AOTB 4WXYB 3NDYA 1KDZA 3GGSA 2P0YA 4Z4FA 1QNPA 4FKZA 3DE5X 2WLZA 1SSDA 2VXCA 3EXG2 1SQFA 4NP7A 3RLGA 4N5NA 2ZZ1A 2Q3RA 5BXRA 4HNGA 2CEAA 3RIGA 4A03A 1E7MA 3LERA 4JENA 1DHPA 2YZKA 4TWBA 3NHAA 5FOQA 1P19A 1H3GA 1SFTA 2EWMA 3GYCA 4XH9B 4HDMB 4U3JB 2IUFA 2NV1A 3ZE8A 3T15A 4DB4A 1SG6A 4RDCA 2G5WA 1FP2A 1PKMA 5B7GA 3CMFA 3HXKA 4UPVA 3P71T 1N2CA 5T41A 1GKUB 1RCUA 3B2QA 3RF7A 3SIRA 4Z2LA 2WSPA 2FX3A 4DNXA 1XOIA 2V63A 4IJ5A 4ZGWA 2HM7A 2AV6A 3W2JA 5J5VA 4YV2A 1QF7A 4S0ZA 1P3DA 3EZNA 4BKPA 3QQ1A 5K2ZA 2XXBA 2Q6TA 4K1XA 1KEKA 1TV8A 2C0CA 4C6IA 1T10A 1RY8A 2R4TA 4DCCA 3FNFA 3KRUA 3BSFA 5CZKA 1S8NA 3PIDA 1ZN2A 3N0RA 1X1NA 3B70A 5YASA 3N2KA 1XEXA 3BE4A 2W2VA 2JK0A 1RCTE 1I0BA 4E2VA 1ZJ4A 1ISSA 3VRHA 2JFEX 2BKVA 3N4FA 3M1AA 3EBVA 1OZGA 4IS3A 3I5MA 2Y6VA 3C3CA 2Y61A 4RTRA 4IGEA 4DJEC 4F5ZA 4MGYR 4M8LA 4IICA 1V3VA 3E5BA 5TGDA 3NYWA 3E3NA 1M1UA 1J99A 1BMDA 1ZITA 1EP2B 3FX2A 1P5ZB 4CCEA 1JB1A 1JTVA 2C2BA 1ISRA 4RIEA 4PIMA 3TAOA 2LXNA 2RBEA 2GN4A 1FUUA 2TS1A 1G8SA 3GD7A 4KQIA 3V7FA 3N8DA 1ZINA 3W7GA 2B37A 4HYWA 3AR4A 4AIBA 4XWOA 4B83A 1C9WA 4PO9A 4GY7A 3UNTA 3BSHA 2C7BA 2I66A 1QB7A 4C21A 3EVGA 1FUYA 5B64A 4OXNA 4CR7A 1AV7A 1XLUA 2VZLA 1V02E 2ZRFA 4HRXA 4MV3A 5BYAA 1J21A 1SD1A 1LC0A 3RVJA 4MUEA 2FSUA 2RHMA 1A7KA 4Z1MA 1GDHA 5K0CA 1AZ2A 2VXBA 1AKWA 1VE9A 1E6UA 5DT9A 2JG3A 5CD1A 3ZWSA 2I56A 1WQ1R 1JA1A 3GHRA 1LTQA 1K2WA 3AYTA 2PKRA 2VSNA 1B8VA 5BPFA 3OETA 4RHCA 2OZ0A 2TMDA 1QYWA 1I9CB 2I6UA 2UVDA 3FPFA 1YF3A 2EZTA 5CC7A 3KOMA 5KSWB 2Q7DA 3O0FA 5G4LA 4M60A 1ZEJA 4B4VA 4DJJA 3DQQA 3UYCA 5JNTA 1QFZA 2DR3A 4QFMA 1K7YA 3W9ZA 5ECDA 4KYUA 3ZPXA 1IEWA 1T5HX 4QSMA 1TVEA 4R85A 1MB9A 5BU9A 3X1DA 2REQB 5ENDA 2IBTA 4WXMA 3M7SA 4X9XA 4DYVA 4GO9A 2JIEA 3WELA 4ZGGA 3WFIA 2BEUA 4R9XA 1RM0A 4UXHA 4NJEB 1WZIA 4J0FA 3DAFA 3WZ2A 1PX4A 4MWAA 4PGMA 3H75A 1RMYA 2CE7A 3UZJA 3BCFA 2WRZA 2AIRA 3CB2A 4REQA 3HI6A 3V2HA 4LOLA 4TXEA 1N8KA 1PFKA 5CEFA 1JGTA 4R51A 2ESRA 4DZIA 3GXNA 3AKDA 3O6DA 3APTA 2R7LA 1MOPA 3T7KA 2QTCA 2PYZA 1SKUA 1Y4AE 4B6OA 4OVXA 3ICWA 1VC4A 2R751 3KCOA 5FIPA 5A06A 2XGIA 1UOZA 3KOZA 5A0TA 3P61A 2PY6A 4TKVB 5I3KA 4O4HF 2J45A 2Q4BA 5GWXA 4UTVA 1QVVA 3P8JA 3WV4A 5B12A 1U0JA 4FEAA 4JU9A 3H2NA 2W6PA 1SUPA 4G0XA 3WIVA 1ZISA 4MRAA 5TJ9A 1W5EA 1LBHA 1QQ6A 1QNSA 4QUBA 1KXQA 2CHRA 1V37A 3MJVA 3AI1A 1ZIXA 1PUDA 3TBFA 1PWLA 3BWVA 4REQB 4FP9A 3G02A 3H2JA 5DXAA 4QE1A 2WZQA 5DHQA 4NK5A 3T0DA 3ANYB 4FNOA 2C07A 3ZJ8A 4GLLA 4M9RA 2YHIA 3MJMA 4AZGA 2CKRA 1XL1A 2G97A 3ARSA 1A1VA 2PDQA 1H2WA 4M5PA 1TMKA 3ARZA 2C04A 4LX4A 1C3EA 1E6RA 2NV0A 4KXLA 3UZWA 1ZD9A 3SGZA 1ZP6A 1GUBA 3DHUA 3MANA 3GCGA 3A13A 3GLTA 2PCLA 4L6CA 2CXXA 3G8YA 2Q1SA 3TONA 3IT3A 4IV8A 4QUDA 1BH2A 2O05A 2PD9A 4WY0F 4V1CA 4I7VA 3NWPA 1IZCA 2VJNA 4MVJA 2YXDA 3APGA 4BOYA 4E5PA 1FKWA 1E5NA 1HFWA 2GXSA 4L74A 5K3FA 4RLHA 1Z32X 1EEXB 3I83A 1K9EA 1RZVA 4R1LA 4YMGA 1TZ2A 3FHLA 4HZUB 4DO5A 3CH7A 1R12A 3DNFA 2NXIA 4O4JF 1HO3A 3TYDA 2SFPA 1KFLA 3IJ6A 3ZUGA 5KTKA 1RAFA 3R8HA 1PT9A 1YHYA 1GZJA 1KORA 3R3YA 5KTOA 3DENA 1TMHA 3HA3A 3DS8A 2LD4A 3AXXA 4EO4A 3DX5A 4E1VA 3BYZA 3DMGA 2NSOA 3QU4A 1SNYA 4OP3A 4YVPA 4NJKA 4TVOA 1DAKA 1V4YA 2A6NA 3H6OA 2BASA 1KNWA 4RC9A 2FZCA 3AR5A 1U7HA 4UFKA 3WY9A 3FPSA 1V5WA 3SF8A 4UASA 4L57A 4YUXA 2KZHA 4NX5A 3FPKA 4KH0A 4ENTA 4RA6B 4YJDA 4FGLA 5BMWA 2Y99A 4UPEA 2NW0A 4YCDA 3CUTA 5F2IA 2EAWA 4PC3A 3IBTA 4LJ8A 1TEVA 4PG6A 1WB4A 5JMUA 5IYZF 1F9AA 4B3IA 1P1BA 2GHIA 4DIMA 1Z4KA 1TX0A 3TH6A 2OV3A 4FK8A 2C6QA 1GORA 4AS3A 4PC2A 1F4VA 1VI2A 3BG9A 1MORA 3AF5A 1BFKA 5FEWA 1BSVA 5IBCA 3KOYA 4R05A 4AROA 3TTSA 1PQWA 3PTQA 2FE4A 4KXUA 4W4TA 1M2NA 1N0WA 3R5FA 2FGJA 2OMAA 4LYEA 2PLWA 1MEHA 5D2VA 1DQUA 4Y6QA 3OYZA 3VDCA 4XRRA 4OFCA 3E1KA 1HUQA 4CTNA 1C8BA 3SQWA 2HV8A 2PWDA 4M49A 4J3JA 1IBMB 4HGRA 3A27A 3TQKA 2XEDA 2Z1WA 1UZLA 4Z9FA 4QHYA 4EK7A 3LTEA 2X1TA 3LAWA 4EX6A 3N28A 4ZO8A 2R6FA 1CB7B 4NXNB 2WEKA 2VUIB 1RLCL 3PSAA 3IGUA 1SB8A 2HXSA 1H2JA 4B45A 2B4GA 3WQRA 1XLKA 4J1OA 4BFCA 4HYRA 5ESDA 2FF7A 5CZ0A 1T1RA 2B8TA 3HFYA 3A2MA 2J25A 3QE2A 2BM9A 5M5DA 2FQYA 4O0QA 2BHLA 3FPGA 1A5OC 4YRSA 3RFUA 4FLOA 2DEUA 1YI8A 2Y1DA 4V27A 1DWOA 5KJCA 2WHLA 1YV9A 4PX5A 3PGA1 1BZYA 4B5UA 2P5SA 2EIXA 4I1RA 5LM3A 1CF9A 3M0VA 3D8HA 3DLTA 1GG5A 4QAIA 3DXXA 1YB2A 4U7TB 3LYLA 4GWGA 2VQ3A 2B8JA 4U7DA 2FMIA 1J07A 3TW0A 5GIOE 2WWTA 3GGGA 1FA9A 1AU9A 1XRLA 5REQA 4YT5A 5ITSA 3KD2A 2EG8A 4TV9F 4BTVA 3IEIA 3VYSB 2X4IA 2Y67A 2XE4A 4CKBB 3HXQA 4E5VA 5AECA 1BHQ1 3ICPA 4A4AA 4F2DA 4QJIA 1X8KA 1IJEA 4W6QA 3UJ3X 2MYUA 3H1EA 1T4DA 4EF4A 1V0NA 2CNLA 2W2KB 1Z39A 4WCFC 2J7GA 4J2PA 4MS1B 3DECA 3TCKA 3ZCTA 3FWPA 3WIOA 1N92A 1U83A 1TVNA 2J07A 1Z89A 4MW9A 1J9EA 1DELA 3KZKA 4DHEA 4Y90A 3SJUA 3WB2A 2DT1A 3VC2A 3AAMA 1JKIA 1USVA 3PC8A 5DISB 8XIMA 1NF3A 3UVAA 1EGAA 4AVFA 5AOAA 3HURA 1ZXBA 3ZWKA 5LGXA 1H1ZA 3FG9A 4MYXA 2PUHA 1BKSB 4Q4SA 3S1WA 4UR7A 1C8VA 3DVRX 5B2FA 1GJUA 3VMOA 4FFDA 1NVVR 4WKCA 1A8PA 2B61A 2WCGA 2Q5JA 1RVKA 3G0UA 1YJBA 3IVMA 3K4HA 3PUIA 4WKHA 4MUBA 3EA1A 1DG9A 5LVAA 2VXYA 1C8XA 1R47A 1R8JA 5BQ3A 4GJIA 1MO4A 2NWRA 1GL9B 7AT1A 4X84A 5TT1A 1XBZA 2AH5A 1V41E 1JE1A 3URMA 2BI8A 2NQ9A 4L2IB 4HNAA 5L45A 4QPNA 3MAAC 4XZWA 4RHUA 5EQTA 2VOMA 2PKXA 1D8CA 1WR8A 1VIZA 1LLCA 2P1ZA 4Y67A 1CSEE 1ZC3A 1C4XA 1SXIA 4LK2A 4DYHA 1MF7A 1HJSA 4LMBA 4UFOA 4Y2QA 4EECA 1PT8A 3F7TA 3E0IA 3HCAA 4PGFA 3E6EA 4PB3A 1V7CA 3ND9A 4YRFA 3S2ZA 1N1GA 1I1HA 5AVUA 4KETA 2PMFA 2QTHA 1LTDA 1P1IA 7ENLA 4D3SA 2VYND 2YHBA 2WJZA 3B0UX 5C54A 1Z3NA 1W1IE 3USBA 3FCAA 3PXEA 4BQEA 1T43A 2PIDA 3FB4A 2OBFA 2CVPA 5CB4A 1JQXA 5FNVF 1HM5A 1Y8ZA 3I3SR 3TAHA 1TT7A 4DIEA 5CFOA 2P5YA 1H3NA 3UAYA 1JDTA 1QXSA 1AGRA 4LK3A 1UR3M 1ZA1A 1J4EA 3Q9SA 3ECAA 3V4ZA 5KU1A 1HKJA 1XQ6A 1U0OC 3HO6A 1QCZA 1KPHA 4MYCA 1E4NA 4CEIB 3R75A 2F4VB 2A88A 3IVXA 4JJZA 2V4ZA 3KD3A 3Q5DA 1JT9A 2M2IA 4EPVA 5KCZA 1KYQA 3IAPA 5DBUA 2QSJA 3V1UA 4LW7A 1VPDA 3M3DA 2DFPA 2R8EA 5A6SA 4QG9A 4BKNA 3V2UA 4IFTA 2IV7A 1AE1A 1AO3A 3V1NA 5ERYA 1CJCA 1Z2PX 3EC7A 4ML3A 3GFQA 3B8SA 2DPGA 4G8DA 2NPIA 2FRDC 3ACDA 3OJWA 3VNQA 4QJ5B 5U9CA 4HYTA 1VHLA 3AHEA 3WUEA 1FYEA 3DKVA 3P9XA 4YJKA 4RACA 2H5JA 3W22A 4O1FA 1E4IA 3LA8A 1JQEA 3HUEA 5H1WA 5DNCA 1KO5A 4D9FA 1M7JA 5HR7A 1GTSA 1EWQA 2W67A 4KFNA 1UJBA 4YUZA 3OA3A 2G9UA 1JDVA 1PEYA 4PRRA 3RTCA 1BXBA 4N5LA 2ZWVA 4ADTA 3NVKI 3LY9A 1PRYA 3WJ7A 4HVCA 3HWWA 3MJTA 2C9OA 3VPCA 3QEZA 3PM6A 2BF7A 3PZOA 4UZSA 1NF8A 2H2GA 3PZRA 1OQAA 3DOUA 4PCPA 2BFCA 3W38A 2VP0A 4GLFA 2XOEA 2BI7A 1THFD 1MQ9A 3U5TA 5I7RA 4CEIA 4MQFA 2OILA 3NGMA 1X7GA 4HLDA 5B3JA 1B41A 3TZ6A 3HKDB 4ER0A 2HJ9A 1PWMA 5A4AA 5KSOA 5AKIA 3LX9A 2P4HX 1IHPA 5K0NA 1LV7A 2GBLC 2WJGA 5BR4A 2Z83A 3KLKA 1IM5A 3VDNB 4BECA 5KOJA 2A92A 4O15A 2JKAA 1Z0ZA 2CC2A 4F0KA 1W47A 2I2CA 4CNBA 1QPBA 3CEPB 5F2KA 1MDRA 1YPXA 3WNCA 4PMVA 1HLDA 5ARCA 1TKAA 4OBSA 3QSYA 4AZVA 4DMRA 4QGSA 4P7LA 5F1PA 1EWRA 5KWEA 4QEZA 4IKOA 1XHEA 5B1SA 1SJDA 4UTMA 1SZFA 1SELA 5F7OA 4A2WA 1WDWB 1XA3A 4EF9A 3RRJA 1K4YA 2WNHA 3A6HA 3G0IA 3GO4A 5KWIA 2ZULA 4HDKB 3WIDA 3VOHA 1IPFA 3GA7A 2XVAA 2J79A 2D4HA 1AQMA 3L2IA 1H0KA 1LTKA 4DQLA 3BGIA 1DKOA 4IIUA 2C5FA 3PJDA 2BN4A 5JARA 1GZ3A 4ZVPA 4EM6A 2B7BA 2D5AA 1UJPA 1KU6A 4F4IA 4TLCA 3AW8A 3A9CA 1W8IA 4NMMA 5HUOA 2ZI9A 4MS4A 4KBGA 2ZTJA 1GVIA 4N1AA 2O2JA 4TVBA 4P3NA 2E5WA 2R60A 1KM2A 5HMMA 2VPQA 3EBOA 3QWAA 2G06A 5F21A 4KWWA 3W5SA 1HFKA 3SKXA 2I1WA 3DLIA 2QVBA 3CNNA 4U0KA 2GBLA 4KKVA 3ZK8A 4HNHA 4N03A 4Z1AA 2FIQA 4NBTA 4JS3A 2NGRA 2IU0A 2PX4A 1X0VA 1SIUA 3O7MA 3QXSA 3R10A 1K3UA 1CJSA 2QZPA 2YFQA 3TRIA 3Q6MA 1DOAA 5KS2A 2KBFA 4Q3AA 4LJKA 1DAMA 2MOKA 1XGZA 3OAAD 3GG8A 4IS2A 3D64A 1T8RA 1CE8B 2YICA 3MO4A 4AN1A 3QVLA 3UG8A 3AFMA 2FEXA 4MB5A 1NVFA 4GBGA 3UWKA 1IUKA 3FF4A 1ZN7A 1EKOA 2ZBQA 3WK5A 2JGNA 1AS2A 1YBQB 3NM3A 1WMFA 1T0OA 3EX1A 5AXAA 5LDHA 1YFJA 1UBRS 4E14A 2WB4A 4BFVA 3PXGA 3TM5A 4D92A 3KZVA 4F0SA 1B00A 1Y4ZA 1U9YA 2Y66A 2CBGA 3A4NA 1RYFA 4BJ6A 4E8CA 2EJAA 2IGBA 5BN1A 2F9FA 1QYVA 2VHVA 4V0KA 5C4GB 4XYBA 3OQOA 1FSGA 1NU8A 1MEEA 3KHDA 1XUOA 1Q2XA 5JI2E 1UASA 2XD9A 4C7GA 1ULZA 1KS9A 1PDVA 1JMYA 1NSFA 1FTQA 3PFMA 3VPFA 3FI0A 1TE6A 1KVSA 1QV9A 4GQGA 1UWQA 1BE1A 4IZHA 1VSTA 1HKIA 2WM3A 3IEPA 4MDYA 1VYHA 2VP6A 5NULA 4B4DA 1Y37A 2PQ6A 1IT7A 1LC3A 4HUQA 3EDJA 2CW5A 1E51A 5K3DA 4O28A 1LY1A 4GI3A 1QR2A 4JGIA 1XMQB 4L64A 2ZR8A 1JQJC 5DK6A 1VPVA 3KVNA 3CC8A 1E3WA 3IO5A 4HNTA 2W2QA 2MHCA 4GXNA 4MP8A 3C43A 3GCXA 3BRSA 2C88A 4DF3A 4B5WA 2X5OA 1VHCA 3A4VA 1U7UA 3OVMA 4R9SA 2VP3A 3HGMA 2Q5OA 1IONA 1K4KA 2VNSA 2D1SA 2QEZA 3R40A 2IT1A 3NL2A 2GBIA 3FRIA 5IYZB 2OB3A 2JIQA 3G8EA 3ZW7A 1QOPB 1WOBA 1AY0A 1GVEA 4GICA 4DVJA 4AZTA 1GCOA 1POJA 1UF9A 3WTBA 1TM2A 1TLFA 1TRHA 4BQQA 3IVUA 4WA8A 4NL4H 3GLHA 3HVUA 1OA0A 3GRRA 1NP2A 2GD0A 2DSNA 1SIBE 4XSVA 4REMA 2WJ3A 3EMCA 3E0VA 3O05A 2VT7A 4HN9A 3LPMA 2VZUA 1DAEA 1BG6A 4U28A 1AZLA 4CV3A 4E70A 5KSZA 3ZVHB 3AVTA 1XWWA 3SBXA 3VKGA 3GDKA 5KNCD 1RI2A 1FQ0A 3C3UA 3UK2A 1SU4A 4D0LB 1IUPA 3WQGA 1CIVA 4MGGA 3SVZA 3HV2A 2J9GA 3VOIA 1M3UA 4UNPA 1BFUA 1EDQA 1SKYE 2X2PA 3T07A 4AO7A 4OLJA 1ZM7A 3ARYA 3M9LA 4A27A 1MIOB 4IXNA 2OFXA 1H69A 3BXEA 3BGGA 2B5OA 1WKYA 3OQMA 3TQPA 1JH9A 3S42A 1V1RB 1G4SA 3QFFA 3RUPA 1KXZA 5F5NA 2HJWA 1NRXA 4QYWA 2PTXA 1ILWA 4HOYA 2XQVA 4LF5B 4ZOQI 2GRJA 2XISA 5L7YA 3CV7A 4LGYA 2PFGA 5IEJA 2G0NA 4D46A 4ETWA 3DBHB 1P5FA 2XLBA 3G5AA 4J07A 4MLZA 3QMPA 1FQKA 3PDJA 5COAA 4IXTA 5JJLA 2PLFA 3OEHA 1O87A 1CK4A 1C8QA 4EVRA 3ALGA 4HL6A 1P1MA 3TS1A 1HK7A 2XAUA 4O2BF 1WY7A 2WSBA 3ME5A 5CFPA 3MVEA 5I77A 1E4YA 2P0AA 2PZJA 1FCJA 3GQVA 2O0KA 2QTGA 2WKGA 2PDLA 1SA0B 3GUHA 3HYRA 4XM2A 3NC0C 3U44B 3QENA 4O4JA 2D22A 1KRWA 3MMTA 2EEZA 2XFWA 3HFJA 2YL2A 3EXFB 3M3HA 4HBZA 5SZKB 1ZUHA 3NRCA 3IIVA 4Z4HA 3SS7X 3VYWA 3BFXA 5KSPA 2J3KA 4D6YA 4XVUA 4F3KA 1ZSNA 5EFFA 4EAYA 5FR2A 5FEXA 2QZRA 1N2EA 3W7MA 4H3VA 5HQJA 1UWAA 2FLIA 3RROA 4ZVMA 3LV5A 4QASA 3CXUA 1RZMA 2FWBA 2FSSA 2JEQA 4GYWA 3NOQA 1A5ZA 2GZDA 2ZVIA 5GM2A 1Z6PA 1KGSA 5BNTA 3WMRA 3UO8B 2IH4A 4A3UA 1ZSYA 1UP6A 3UK7A 3MILA 1ZP3A 1PYFA 3KZXA 3BTSA 5KYKA 3EMBA 3D8BA 3GCDA 3FZQA 5CB4B 2ODQA 1UDAA 3E3HA 1O57A 3DL2A 2DXIA 3DBLA 2X9NA 1H2BA 1JR2A 1QFYA 1K03A 1ME7A 3QTPA 4IH1A 1E1QA 1THMA 5F4BA 2JEPA 4M88A 3VPBA 2XGSA 1X1BA 5AOCA 2NMVA 1H65A 4PG8A 1QVZA 3GDMA 1DNPA 3I32A 3ZD6A 1P5HA 3N4EA 3H0EA 3QVGB 3TNOA 2VUTA 4MPTA 3WP1B 5IZCC 3ONEA 1I9CA 3QHMA 1AMOA 5HF5A 1IBCA 1A50A 3WK7A 5FACA 4ZVOA 4DR1B 2UZ4A 1Q0UA 2GN1A 4G26A 2RGLA 1M54A 2XIMA 2X5JO 2W2KA 2P6RA 1E94E 3K96A 3PWIA 2C3UA 2JRCA 4HI0E 4MY9A 3CZQA 1SN7A 1GTRA 2BVNA 5AKXA 5EN4A 1PFQA 4AB4A 2BYTA 3RVDA 2ZXUA 3PE4A 3CZ8A 1GAXA 4R1UA 1NGSA 4AXKA 1VKNA 2JD1A 2RH8A 3HQ1A 2EJTA 5C71A 3SOZA 1TF7A 1RMQA 1WAUA 5JS8A 3DFOA 4L4RA 5A95A 3D6HA 1BXZA 3FCEA 3TZHA 3FVDA 4QBIA 1UQRA 3DEHA 1RWNA 4DQKA 1QNQA 3QV7A 1DC3A 2R00C 4CQLA 4X85A 2PNJA 2ANBA 4JLPA 3W28A 3GEMA 2GDUA 4O1MA 4WIWA 2QPAA 4EGCB 4OHOA 2UXBB 3NU1A 5B55A 4CCSA 3IAFA 5AC7A 4W89A 3GJZA 1M66A 2V1UA 5HMEA 3AIRA 4D9HA 3I01A 1A4LA 3WX0A 3T78A 1H2ZA 1Z7WA 1RK6A 4OKIA 4RZHA 3BTUA 5K8TA 1NBOA 3OLCX 3G8RA 4UU1A 2G28A 3H5IA 3U7HB 3OZ7A 4IUGA 3HNPA 3WSUA 1CFZA 3PUGA 3THOA 3WGKA 2EC5A 1EBHA 2A58A 2ATCA 2X19A 1JPVA 4Y9MA 3EMZA 1R2RA 4FYJA 1R6DA 1MDLA 1Y1KE 4X95A 1XUZA 3FUCA 4NZ5A 3JYLA 4Z4QA 3OTHA 3B3QA 3M4YA 5GJBA 3UJ8A 2R97A 2HDJA 2FZKA 3WYDA 3KTXA 2VJPA 2ZQYA 2YNMC 4QARA 4BNFA 1S1MA 4ZVNA 4YRZA 2OBBA 1XXHE 4XUGA 1NVWQ 4YJ3F 3F47A 3PG5A 1RKVA 1W73A 1UBEA 4KVAA 1VFOA 2MANA 2HIHA 2VQSA 4XBJA 1HT2E 3IUEA 5EC8A 3QY7A 2C7OA 4Q4CA 2ZEJA 1TJPB 2A78A 1SCNE 5LXEA 4J40A 2W6OA 3BOXA 4EJMA 4GH3A 1L3IA 3EARA 3V9AA 2PJZA 3W9SA 4S1NA 5A2GA 3K8QA 3EWZA 1RA0A 2AWOA 3SJBA 4ISBA 3AUSA 4P34A 4BWLC 2CLMA 2QPXA 4RE2A 3J81k 3WYFA 1H7OA 4L65A 1K02A 5BSHA 2OD7A 4EX7A 2LRHA 1UD5A 3JYHA 1NR5A 4L61A 1BQGA 3OQPA 1A5LC 1S3SA 1NNSA 1WZEA 4JDUA 4UZEA 5CYGA 1GRNA 1F2DA 3KYCA 4JIRA 2X3YA 3ZK7A 3PDCA 2V6GA 3T1QA 1XLWA 3MJEA 4C3ZA 4HLUA 4Z51A 4AUMA 3CRMA 3OU2A 4RZXA 2R4QA 3R3ZA 4N0PA 4WNYA 1C7QA 1PL8A 3BDVA 5EG5A 2DERA 5TJHA 3L7NA 1ZL2A 3O82A 4BN5A 4FO4A 4J0KA 4NV3A 4WBSA 2VEDA 2D7JA 3KL2A 1EXDA 4QQUA 1OGBA 1JR1A 4GACA 4DY4A 3U80A 3UGJA 1KFEB 2UBPC 3MT1A 1ZGJA 8ATCA 5AK3A 1MC8A 2Z2XA 3WJZA 3EQ7A 5DXYA 4B5VA 4P5DA 2P50A 4JTIA 4WSHA 2W2LD 4E4PA 5IDVA 4N7MA 3ZVKA 1R7OA 1T3SA 4HMCA 1E8MA 4JCLA 2FQIA 1PSWA 5IS2A 4AC9A 4D79A 1Y82A 1KY2A 4PMOA 3OGVA 3Q3JB 3NQFA 3CSSA 5KJ6A 2ZDGA 3EIEA 4N8DA 1Y6RA 4EDFA 3EYWA 1Q57A 1FU8A 3U3KA 3GFZA 3WE7A 4YRJA 4NVTA 3COWA 5DI3B 1F1JA 5KYYB 4FHDA 3IUIA 2ZRVA 1S2LA 2IHYA 5CW1A 3FCOA 5EIHA 4BV9A 4A4DA 4H7HA 1Z25A 2O2EA 1FQWA 2QQ6A 1AGPA 1E1RA 1XHFA 4AS1A 2OGJA 3NC1C 4Q34A 4HKPA 2H0QA 3U7JA 2ZQ0A 3L0KA 3RJ9A 3RFCA 4P3YA 4RZQA 4AU1A 3I8OA 1GWNA 4O10A 3ADPA 3GMIA 1VHDA 1VH7A 1BVNP 3STVA 2PRZA 1Q3TA 2FRVA 3LWZA 4L6AA 3GDHA 3DF7A 5EUQB 2W27A 1JF6A 1ICIA 1UMYA 4G25A 3OX1A 1O68A 3FTCA 1KAEA 4QE4A 1BAGA 2IF2A 4EPDC 1CYEA 4O3MA 1RP9A 3VHLB 4DYJA 1BCSB 2OXRA 4KO3S 1TZ7A 2XZDA 1U8CB 3ENVA 2WQ6A 1TA9A 5HJEA 4KODA 4WY0A 2J0UA 1XKQA 3PKZA 4L75A 3JD2A 4NMWA 3EZXA 1XELA 2FRXA 4HZ8A 4TS1A 4BQOA 2P6NA 5BZAA 1NSTA 4OHRA 1GPWB 1P73A 1RAAA 1EOMA 1SZGA 4WK9A 3TXAA 2JGEA 4QJ4B 1WM1A 3RC2A 2QRNA 5G0VA 5D2TA 2PSDA 1XCGB 3B9PA 1MAVA 1ODSA 3S9ZA 3FOZA 1PTDA 3K6KA 1QO0A 4H7ZA 5FB3A 2YFKA 1U6KA 3L01A 1I7SB 3T0TA 4LAUA 4GDFA 1RIIA 2SCUA 3HG3A 2VQTA 1K88A 2WM8A 4J2HA 1FK8A 1E79A 3BV7A 3GVRA 5JWRA 3PXUA 4AJKA 2MT9A 2QIWA 3OQJA 1FTGA 5A7FA 3C6XA 4HP5A 4CV2A 1S2WA 2V3VA 2RGMA 1PF7E 4OB6A 3KC2A 4L7ZA 2AJBA 3B9QA 4ABYA 1VCGA 1T26A 3VO2A 4EEXA 4BNUA 3AUOA 4OQDA 1SBIA 3NMUF 3QXGA 5ALKA 3HA7A 4W88A 3TFWA 2QCNA 2PWUA 4P2BA 2J67A 4OUIA 2I6TA 3P67A 4LMAA 3NR2A 3QF4A 3NQEA 1YJAA 2P7HA 3B1VA 1CETA 3CCCA 1XQYA 5ARDA 2J9XB 3AXHA 3ITOA 2YBDA 1OBCA 3TLZA 1DP4A 3RM3A 4IZ6A 1I2OA 2C3PA 2MMCA 3VGFA 1J0XO 3EEQA 3C8HA 4UR9A 2HUNA 1KRHA 2BMBA 1LQUA 5AKLA 2W90A 4OV9A 2PH5A 4QHRA 3U0HA 3W1LA 1AG9A 3PQ3A 4LECA 3G1VA 3F2DA 5FI0B 2MSEB 3V4OA 5LU8A 1OK6A 4RZSA 2HEGA 5F7XA 1EJ2A 1CRZA 4ZJPA 4RKRA 2WU0A 2EP7A 1GLGA 1TO2E 3THWB 1KXJA 3WN6A 4WEOA 5LP6C 5I7WA 4FWBA 1N9GB 4YJHB 1NF2A 2O20A 2WHYA 4JLWA 4IJ6A 4QEDA 2I78A 5FUVA 2VUUA 2J9ZA 2X7WA 3AMLA 3A9WA 4WBXC 4XLZA 4XAFA 5K3AA 3UMJA 1VE3A 2DT8A 4B46A 4F4UA 1W5FA 4N65A 4ZMSA 3TINA 5BV2P 4FGJA 2DJIA 4IMCA 2RHWA 1EFDN 5GONB 1FTWA 4U7GA 1OM0A 1I2BA 5JS7A 4NFSA 3WQPA 4O1CA 1MN6A 3INYA 2OFWA 4JX6A 3U39A 5HRAA 3K5IA 3VX0A 5FJTA 3IQFA 1AH3A 1JI1A 5IJAA 3QQ0A 4EAQA 3AUJA 4BE4A 4EGQA 1S96A 2OSXA 3G1YA 1I4WA 2D0HA 2ZYSA 3NC4A 1N3YA 1Q5PA 2Y1LA 1A5CA 2HUPA 4QQ3A 2NO4A 1U1EA 4DDVA 2ZE5A 4MR8A 3GEHA 4TUYF 5ALVA 4BZXA 3L0PA 5EFZA 5MGBA 1JZSA 3MDWA 1ISJA 4Z7NB 3C7TA 1TU4A 3I6QA 4YMIA 4FWTA 2P0OA 4Z2HA 4HWOA 4UEJA 4FFLA 4YV7A 1HL7A 4Z1MD 1NFRA 1X80A 4A0RA 2RGAA 1Q6QA 1XLTA 5DTRA 3KQHA 2ZOSA 2ACSA 1GNLA 2ZZ5A 2BBSA 3UZYA 3HM9A 3G1SA 1ORWA 2Z4TA 3BFJA 4AY3A 3O84A 4G1FA 1NDQA 1JAEA 1XXHB 5JASA 2P0EA 4D9GA 3W4IA 4N2YA 1G6KA 2OLEA 2XH8A 2WR8A 1TQXA 2R6JA 3B3JA 3RD5A 2PGLA 3RSSA 3I72A 4FOLA 3JVVA 3BXZA 5HJ2A 2CNKA 5C53B 2OHGA 3G17A 3ZZUA 3NUKA 2ZRCA 4TU1A 4NCIA 2QULA 3CWOX 1A8IA 1ZY2A 2P30A 5CC3A 3V55A 4MROA 1RWOA 1SXJE 3UQZA 4IEFB 2VURA 1XAIA 4YAGA 2HLPA 1RQHA 1SG0A 4F8YA 4Z1OA 1XICA 5JROA 2VDRB 4DEFA 1XRSA 5EA9A 4O2BA 1JW9B 4S1FA 4AX6A 3RCMA 2G09A 3P14A 5DMNA 2BHYA 1OPXA 2XVMA 1DKWA 3B40A 1UKBA 3VR5H 1EK5A 3WGIA 2GO1A 1X70A 1BS2A 4MKXA 4BFXA 3OZUA 5A5WA 1UM8A 3SLRA 3HO8A 5HF9A 3EIXA 3MOSA 4HXGA 1JDEA 4TOQA 4B5NA 1C9MA 3A1UA 5KNBD 5I7SA 4G9EA 2Q27A 4RQAA 3PCTA 4LY3A 2ZQZA 3CEHA 2QQ5A 5L3QA 2Z4RA 2Q5QA 4OQLA 3SAJA 1UADA 2GBPA 1LLDA 2JI4A 4BJHB 1DL5A 4C7DA 1NP7A 3E48A 2XGBA 4JGDA 3WAKA 2Z8YA 1XLGA 3AH8A 2QEQA 4FMDF 4BC0A 1O96B 4O0LA 2NO1A 1JD7A 5JJKA 4LYYA 4C20A 2OHHA 4CM1A 2JE8A 1M33A 2WTEA 3Q7TA 2P3QA 5CRIA 3N3AC 3ZGZA 4BY3A 1BHJA 5CKSA 2PBZA 5E4FA 1ISGA 1U2RA 4YDRA 1CUDA 2YQZA 3OO2A 3CE6A 2OV8A 1NN0A 1OY0A 3JPYA 4KEUA 4Q18A 4LV4A 3FNQA 3CVUA 1FWTA 4KMRA 3BOLA 2QA5A 4ANFA 4MCHA 2WSQA 1IIBA 3C3BA 3GVXA 3NV7A 1EWDA 1WDWA 4RE6A 4WFJA 5TQ2B 4MYTA 3CBGA 4O08A 4IP4A 3GRVA 4C22A 3BXWA 3RSZA 1EGMB 2WYIA 4E8GA 4LZNA 5DHSA 4A5SA 4F72A 4FFOA 5ILQA 4G9BA 4DN1A 4TLMB 3ARUA 3B0XA 1KRMA 3MUOA 1ARZA 1M8GA 1ND5A 1SUXA 4F0MA 4F3RA 1G42A 3WBFA 1SU8A 3W1TA 1N2OA 3N2MA 1DG1G 3FCXA 1XEWX 5H9VA 3K8YA 5JJCA 1QG6A 1J2WA 1UXHA 1H0SA 1VBFA 5AI8A 1IEQA 1HQYE 1D03A 3LLFA 4KDCA 2Y8EA 2QT0A 3BH0A 2YSWA 3RFXA 5G1OA 5T9CE 2WANA 4J3UA 4HDMA 1OFBA 3NQ8A 1G5RA 4KE6A 2P9YA 1IHDA 3N9SA 1XMJA 3S5JA 2P88A 5ISMA 1VBUA 1P9LA 1I4EB 2LLEA 4N7JA 4B4KA 3PYMA 4DV1B 4EG8A 4GP9A 1A9OA 3SLGA 1YBHA 1VE5A 4B3XA 2Y0FA 3M9WA 3R94A 3RGWS 3ZHTA 2ABWA 5EWMB 2MSWA 4L8FA 2PX3A 1U2YA 4QQNA 3UQYS 1LOQA 3HMCA 2CITA 4OXQA 3WLMA 1Y3AA 1U2SA 2BKUA 4OM8A 4BVHA 3U81A 1CEEA 2HROA 3GE7A 1U2PA 2P68A 3TYXA 4TL8A 1MJFA 1KDOA 3AOFA 1KWKA 2ACRA 3T5DA 2FPTA 3ZYCA 1V5EA 4U39A 1B31A 3FUTA 2E9BA 1UAYA 3PJEA 1FXPA 2A35A 2P2YA 5JG7A 1W52X 2VJAA 5DN6A 4OJQA 4PV7A 2EQ5A 2VUNA 5FTJA 3UMFA 4BGEA 2QIOA 3IIPA 3MA0A 1YQ9A 1X1QA 1WETA 2FDRA 2VPTA 3NTQA 2BZ1A 1IM8A 1SOUA 3NOVA 3QJYA 4B5LA 3WJXA 1DAHA 4BBJA 2XMPA 3WADA 4UUOA 3TUIC 4LQCA 4HTAA 2POQX 3QF0A 1KIAA 3ABIA 2RHBA 2AMYA 2YJGA 3GZAA 5BN5A 3E23A 4FCCA 3OZCA 3WKZA 3R41A 4LSWA 1CLEA 2VTKA 3H55A 1Z5OA 2CWWA 4ZYYA 1PGJA 4QNNA 3GHTA 3IEVA 4J2MA 4U5IA 2JB9A 3NEAA 2IUSA 3IJQA 1P1JA 1YDOA 4ZYXA 3HB0A 1UFVA 2PBRA 2WSYB 3AJEA 2Q71A 4W9NA 4C01A 1AQIA 3NEYA 4HHLA 3TYBA 4C4XA 2H2HA 1JLKA 4KRGA 1R7AA 1USUA 4YK7A 1R1DA 4ZXFA 2BOGX 5CXQA 4HY3A 5IT5A 4URZR 2PH7A 4NAEB 2QUJA 3L8MA 3WL4A 2B83A 4K68A 1ISWA 2ZC8A 2CUNA 1QIGA 5DCLA 5FFMA 5JYCA 2RJOA 2HADA 1XLDA 4EPXA 3A1WA 5EYPA 1CX9A 3NTUA 3AXKA 3I1FA 4XIIA 1CS0B 3KTFA 5E95A 2J5QA 1PI3A 1NA5A 3MS4A 1LYXA 4HAXA 1TIBA 3MCWA 4Y9NA 3VZZA 5CB6A 2YCKX 5IVIA 1I0ZA 1I5OA 5BV8A 1YQEA 1JDCA 4WLNA 1YA4A 1AB5A 3C3YA 1XIMA 4GBMA 1H8HD 1CUZA 1ENPA 2J62A 1W35A 4DA7A 4NBLA 4AXNA 5C80A 1GTEA 1C30A 3L1IA 4KITB 1QOXA 2FNAA 3SIWA 2GZXA 3QFWA 2AN4A 3O8NA 4IL0A 1OFQA 3AQUA 5F7JA 2PDWA 2GZ2A 1E66A 2XTMA 1R6WA 4P1ZA 3EA3A 1ABBA 2BEJA 5AVOA 4XTCS 2V3GA 2YFHA 5DCEA 3EXFA 3AERB 1UBOS 2EWVA 3C56A 1QO7A 3BJIC 3N6XA 3CPJB 2X86A 1NX6A 5GNXA 4BE7B 2AAAA 2O2XA 2DLCX 4XYGA 1F3TA 3D7SA 3GG2A 3GVHA 4HQFA 5CQ1A 4Y9TA 4E4RA 3DHDA 1USKA 3Q3GE 4I6KA 4ZJUA 4RPLA 1A5UA 3DBVO 3L66A 3W37A 4OK3A 2XXAA 2R0QC 3UWPA 2OC9A 3B2NA 3RWOA 2CVQA 1SG9A 3WNPA 2QCCA 2WFAA 1PNVA 2AI1A 3WYAA 1TM1E 3ETEA 2PRSA 2F2TA 4E31A 3ZWMA 2QI9C 3S1VA 4BF9A 1TKKA 3LKDA 1H9CA 3AILA 3P80A 4KFSA 1WE5A 1XKYA 5FJJA 1KS2A 3QFCA 1I33A 2B35A 1VP3A 3UOWA 4RCYA 4BI7A 4LXFA 3PS9A 3L5OA 3FOCA 2IUZA 2QNIA 4G36A 1PG2A 5BYKA 3LTSA 4NECA 4JEQA 1WYIA 5K4AA 4FGKA 2I4MA 1NXPA 4I1UA 5T3UA 3W6UA 1FH8A 4WY0B 1YR2A 2Z6IA 5EWLA 2HXUA 3B8HA 4I7EA 3SB0A 4ZVLA 1XDLA 2X15A 4DLRA 3UOAB 1ZHFA 5AKGA 2OOFA 3OKPA 1OFOA 3LD5A 5ILOA 2XUPA 3H9QA 4W4QA 2BY4A 3SK0A 1M1NA 2IXDA 2FPIA 2APJA 4JAWA 4BVAA 3O3CA 4OGKA 3PNPA 3NJ3A 4AWXA 2AQ8A 1ZESA 1WUHS 2XX3A 1BEUA 3MI6A 5ALFA 4P6VF 4DWDA 2QB5A 3M0JA 5HIIA 1TM4E 2ZK7A 3PC2A 1MD9A 3WF4A 1E20A 3VGBA 4WY5A 5JT1A 4IXWA 3CNLA 1OHHA 2UZ3A 3B7PA 3ETDA 1YL5A 4KB5A 1ALDA 2CLOA 1JL3A 4NASA 4DQDA 4TQTA 5K0LA 3GIPA 4MLJA 3FBWA 3DZIA 4OF4A 4XLTA 1T1IA 2O2ZA 3UANA 2PTDA 4NNOA 4NMLA 2ABAA 1CCWB 2L69A 5EMLA 1F07A 1TB3A 3AF0A 1Z8FA 4DUYB 4MRRA 1ZH0A 1PLLA 3FOFC 3H97A 2W98A 4M76B 1YI1A 5JZBA 1LZLA 1NJ6A 4C6JA 3OP4A 3VDHA 3TTWA 3EMKA 3MMXA 5FBVB 2BGKA 1CZUA 1EB9A 3NPWA 2B1QA 4U3AA 3L67A 2B21A 1XUUA 4RPHA 5B57C 1BLIA 3DWGA 1V1MB 2DZVA 1Y7LA 1Z37A 1GN8A 3VDMA 2E37A 1ESWA 1VFFA 3P9IA 4FHCA 2G8NA 5JQ9A 1G3MA 1ZUWA 1TPDA 3PL5A 1N2IA 4ZMGA 1XCLA 1A4IA 2R6DA 2ZSUA 3WLNA 1U0RA 2PP0A 2IE8A 4EY7A 3DCYA 1XH0A 1N55A 3V7UA 1DMSA 2IIPA 3TN6A 2GLUA 1CD5A 3ZBTA 3G8CA 4H9UA 5F5LA 3ZV5A 1ZL0A 4KPGA 2ASVA 1R86A 1CZHA 5D2YA 3BVPA 2JGKA 1O5TA 2E4UA 3INRA 3P94A 2OR2A 1UJ6A 2B3DA 1ETHA 5FAJA 4LVAA 5EXEA 4KO2S 1POKA 1JHUA 1PCXA 1H09A 2YCLB 2JLBA 2DTEA 3QHNA 1N0IA 2NZXA 4NABA 3B3FA 1ITCA 3L7IA 1GADO 1VENA 4PANA 1O7AA 3RLFA 1TA3A 4LGCA 4NJMA 1VGAA 5E2IA 2P10A 2R1PA 3S8EA 3E61A 2VCCA 3LBOA 4Q7IA 5I9IA 1WV2A 4MVJD 2W61A 3W70A 3CEUA 2AN1A 4W1SA 3MI3A 5TD4A 5FKJA 4W8LA 3WK3A 1GGMA 1WXEA 1B3VA 5AT1A 2ZETA 2HOQA 1ADBA 5CCXA 5FWYB 4LYRA 4X1IA 3KPVA 2OVBA 2VOTA 1IB6A 4KKXB 5EZQA 1YBAA 1BQCA 5G1MA 4UTKA 4DJFD 5KDLA 4U33A 3T1HB 1C14A 1LQ2A 2GCPA 3PAJA 1YE5A 4L4SA 3DR5A 2AOSA 3B5EA 4NCJA 2HAEA 1WMBA 2WPDD 1Q1ZA 2D0PB 5DXJA 3G89A 1QFEA 2NUAA 4D8VA 5K9DA 1IYXA 1PZFA 3KVJA 3W00A 3EEZA 2OOSA 1RAGA 2Y27A 2JJ8A 1VJIA 4JYDA 2QNBA 4FDUA 5K3EA 1XIFA 1E77A 3CW9A 4ROPA 3MCMA 1SIWA 1KJWA 1V6YA 4QYMA 3RX4A 4R9NA 1WCYA 3DTVA 1QU3A 1XH1A 4YYEA 1WO2A 3N2KB 1N4DA 5DDIP 4CL0A 2F6UA 4Q8MA 4X8MA 1J0ZA 1XU9A 4QTUB 4H6PA 2WOJA 3D7RA 3EIOA 3LW8A 1U7OA 2ESCA 4EGJA 4J0GA 1ZUD1 2PLAA 3VU8A 2G63A 3JAMA 3WGHA 1KI9A 3CK5A 2CLEA 2A6PA 2D0FA 2JANA 3B5IA 2H52A 1FZTA 3PICA 5C8ZA 5FO0A 4RTMA 3DYVA 3NT2A 1MABA 4GXQA 1TCCA 4TZ0A 2ZJ0A 2XVYA 1FXUA 4KKXA 3DE4X 3HCFA 4KQ2A 1ZUAX 3N13A 1TL7C 3QMVA 1TJ2A 1UFRA 3WBAA 4M8NE 3PFIA 3KOWA 1XIVA 3FD8A 4MVJF 4L2IA 1EF3A 1PWXA 3VUEA 2HTMA 1AXRA 1NSJA 3C3XA 3PB2A 2B6NA 5L6LB 1T4GA 4B6PA 3R13A 4K3VA 1TVMA 3OLGA 4JKIA 3GLIA 4UEKA 2NPOA 2C1GA 3H7AA 2C61A 2X0KA 4YWHA 4DILA 3B1ZA 4PLYA 3HP1A 1R3RA 4LE2A 1YRHA 4L73A 3RS0A 1GPH1 1LPMA 3TR0A 2OEKA 3B8UA 3KZPA 3E22B 1EFHA 1W54A 4K37A 4HAWA 2QYTA 3O2QB 1JZ2A 2V3DA 2HREA 4YIKA 4FW9A 4FCTA 5JISA 3RU2A 1X14A 4CXMA 1P5BA 3EOBI 4DLWA 3U7IA 3BDKA 1T4CA 2V54A 3IMGA 4QJ4A 1U04A 4GXWA 4RNIA 4RESA 3BWCA 3HCOA 1MR3F 4JA2A 1H4VB 5HPYB 3ESZA 2H3HA 1ZJWA 3WL3A 1EA0A 2WNQA 3OOWA 4DZAA 2AMGA 1G1AA 4DV2B 3DFIA 1GZHB 1G5QA 1VCVA 1DCKA 1GPKA 4I4LA 3KLOA 5CLGA 2FVXA 1R18A 1BEEA 2ZBGA 3NZQA 3BLIA 1DHRA 1D3CA 2BHNA 2FPKA 2B1IA 2OL4A 2BTEA 5HSGA 1OB5A 1ZG3A 3CGGA 4I1OA 4XIAA 3IR6A 4HSHA 3MUZ1 4O4VA 1H93A 3FKQA 2CHGA 3CVJA 3C52A 1L4NA 4QDXA 3EDKA 1TZMA 1Q1NA 3WO0A 2XTKA 3W1NA 1W8GA 3VO0A 3CJTA 4LVOA 4BEWA 4PHHA 2QNEA 1QGAA 3GLGA 4QYIB 1D8AA 3S2UA 1X6NA 2J08A 3HXTA 1SHKA 3HLYA 4WOBA 3NL3A 4ILEA 5IAGA 1B5TA 5IBRA 4FDLA 2QVCA 4O0ZA 3S6JA 1XI3A 4PC7A 1NI5A 5KVQA 2II6A 4MJMA 4PCUA 3VM7A 1LRLA 3EF1A 2VWGA 1GZ4A 3LTNC 1P62B 2GGSA 3K2QA 5AYIA 1HDZA 3K6JA 2YPIA 4GGBA 4AEEA 3FKRA 2HTFA 4I81A 4Q8VA 2V7BA 1H2FA 1FRQA 4Q1BA 1KI1A 4JP5A 4ZSTA 4TWIA 3V34A 1HT1E 1XYGA 3GD5A 3OFKA 1II8B 5EA2A 1NBWB 4BQ2A 3FZGA 1ONRA 3VZSA 5CPSA 3A7EA 1JGIA 2QRJA 3D4NA 5DASA 2ZJ3A 4JT4A 3GLGE 3OGRA 1P7WA 4XWAA 2EGGA 4EW6A 1CDEA 3KRBA 3WKBA 2YYSA 3K31A 3CHVA 2A3AA 3WX7A 3PSHA 3B97A 1MEJA 4ATDA 3HJNA 5CBPA 4F3CA 2Q6KA 4RLQA 3OLWA 1SGJA 2XYRA 4KMSA 1PFVA 3HJUA 3C4QA 3GLCA 4Z99A 1JKXA 1E72M 4C6RA 2NX2A 3DAPA 1F0PA 1J2EA 2X2GA 1XN4A 1QI5A 2E3ZA 4BU1A 3KO8A 1PO9A 5KJFA 5J3JA 1EIZA 1JTFA 4ARVA 3O90A 2BS9A 1D2MA 4CHGA 1Z0AA 2H9AA 2WCSA 2B98A 4E30A 2QJOA 4QQRA 3L1VA 2HT1A 1R9XA 5THKA 3FYOA 1F38A 2CCJA 1KAMA 4KOAA 1R6BX 1Z6AA 2VEMA 1PT7A 5HOQA 3QITA 2ONKA 5DLEA 5LFAA 3UWQA 4B44A 3VIJA 5JY6A 3UXIA 1RKUA 3U9SA 3URKA 1XL9A 4O25A 1H0RA 4F1WA 4K6CA 1T8UA 4BWFB 3EX6A 5I4BA 3U7RA 4P7RA 2XWDA 3ILHA 3PSVA 4X24A 2GTIA 2H1OA 4RTQA 3HU7A 3AF4A 4HFJA 2ISSD 5JNRA 3GR7A 4BLUA 1GQJA 1PNQA 1HTTA 3TSMA 3W7LA 2CZVA 1XD1A 2CXTA 1L4FA 2Z1VA 4M46A 3D0CA 3N39C 3STEA 4K8RB 4W87A 2NX3A 2OORA 3K13A 3GJ8A 3PXCX 3FOAA 3ZQ9A 3L7YA 5K45A 3CN9A 4YIHA 4A3HA 3BULA 5FNVA 2Y1FA 3CVOA 3UETA 3B82A 3HJBA 3MKVA 3KAOA 4MGIR 2O2HA 2JFPA 1X86B 1H1LB 5JADA 5AI6A 1F61A 3VD5A 4MOWA 3IHTA 2P6UA 2WAGA 1A9XA 1C7IA 1NVDA 1EJ6A 4WESA 3W8RA 1GFSA 1FWDC 2ODEA 4TXMA 1Y98A 3FX4A 2VENA 1RABA 3EEFA 1X1DA 1UJCA 3PJWA 1ZIOA 1AKNA 2GRUA 1V5FA 5AIBA 3G2OA 4B91A 3HG5A 4LV8B 1U0TA 4UNSA 2JVKA 2R8WA 4D6DA 1E4VA 5DJ5A 1KH3A 3ESAA 4ASUD 4D1IA 4ZVTA 3VPAA 5LQJA 4O54A 3EOLA 3N4AA 4G5OA 1QORA 2XZPA 4D6GA 4IF4A 3GNXA 2VKZG 1YDMA 2QPUA 2A9JA 4E09A 2Q4TA 1XZPA 2QXWA 5LJLA 2PSSA 4GX2A 3W5AA 2GQAA 1TK9A 5ESXA 4IMIB 3OQVA 4F93B 3B04A 4F3NA 1W44A 2PF8A 3BAXA 4NZNA 2PX6A 2CN1A 2OFPA 3U4QA 2ZSAA 1UKPA 2VP4A 4FC7A 3F2IA 3DZ1A 3TVAA 5EL1A 2QUNA 4GGPA 3QVJA 4X3ZA 4EO9A 3BZBA 5G2IA 4LYDA 2JAUA 3MMWA 1HV8A 1TKCA 3G85A 3NDJA 5LKRA 3SUWA 1TYEB 3DFZA 4MUAA 2JKYA 4YRLA 2AZMA 2OKTA 3EPJA 3N73A 3HWSA 4JZKA 2AD5A 2PD4A 1LLQA 4KI7A 2XWSA 5KYUB 3CR3C 1MPXA 4WX2A 1BPLB 3P0RA 1GCGA 4P0TA 2DWUA 2SKEA 5TMBA 2VGGA 3RFAA 5D02A 4BX8A 3V16A 5D1HA 3KYIB 3IIJA 1OKKD 2OWCA 2GFHA 4GVIA 4CEJA 1EP1A 1ECGA 1UWRA 3RR2A 4D0SA 4BNXA 4IOMA 4LUYA 2VWHA 1GGKA 4DKXA 1IT0A 4F0RA 1ZNNA 1L1FA 2EX1A 2QXTA 2ZKIA 3VDGA 1JX6A 1NQTA 4KGXA 1X7WA 3KQKA 1LP6A 5I03A 4A16A 1DX4A 3MBKA 2PGRA 3K1DA 2HF2A 1OLUB 3MS8A 4P4UA 2WWYA 4WTOA 3EWAA 2G7MC 5IZCA 1V7AA 3TW7A 1FSZA 2QM7A 3GEPA 4NBRA 1R0WA 2WFLA 3VDRA 5I3FA 2A8YA 1ADFA 3IIOA 3QELB 1OFTA 3NDPA 1UODA 4E4YA 5LOVF 4ZOBA 4FIQA 2JLVA 5J1TB 1V3QE 1FWIC 1XD9A 4BO6A 1Y0BA 3BWWA 2ZBPA 1AN9A 4R3WA 4JIEA 2V96A 1VJGA 4F2PA 1EJBA 5FCZA 2O48X 4FUQA 1E2KA 1EP1B 2QTTA 2IEDA 4FTWA 1TUBA 4GYPC 1XPGA 3T09A 4CU5A 2HBYA 5L3SB 4TUYB 3WV5A 3WAGA 5TVKA 2FHFA 2XMRA 4HSNA 1QLHA 3JQRA 3EX7C 2P9HA 5JVDA 1QUFA 3W2KA 2QJMA 2XWJI 4KMOA 1ZJZA 3WFAA 4RV9A 1WSAA 3SBFA 4O5AA 4PQEA 4LC9A 2VA9A 4FQ5A 1QTWA 1SCKA 1WCGA 2P4UA 4D8ZA 2MNRA 1L6IA 3NHJA 2WJAA 2HCBA 3OTRA 1T5BA 3UJ6A 4G84A 5JANA 4IQEA 2BEUB 4S12A 4N0QA 4NCNA 4RWEA 5E0KB 4JFSA 3KYDA 2ZI4A 1G7VA 1J1UA 1IZYA 2Q3CA 3GNLA 3W3OA 2BF4A 1YQWA 2NXHA 4G85A 1XKJA 2Z00A 4MB4A 3BIOA 2A3EA 4JLBA 4U6NA 3R24A 4IDNA 3NDZA 3A6LA 2A14A 4OBTA 4RCZA 3PLAE 1JNDA 4MI3A 2GSJA 3DB2A 4F40A 4RCVA 2HXGA 4MTCA 4AUNA 4LVFA 4ML9A 1K75A 3AICA 1UZ4A 4FE3A 1VCOA 2X4LA 2Q6IA 3EIQA 1L5ZA 5KC9A 1V02A 4M9QA 3HZ3A 5CXUA 3VPLA 3N59A 4GX0A 2FPPB 4EB3A 4Y6OA 2J8ZA 1DJNA 4F6LA 1LRTA 3ABOA 3ZIAA 1JDFA 3FCUB 5LR6A 4I6VA 1Q20A 1XLAA 4WJXA 4ND8A 1C7RA 2J32A 4N3GA 3DDOA 3W8FA 2QUUA 4RZ5A 1IZJA 3T4UA 1MRZA 4WOPA 2GSEA 5H0IA 4O02B 2AZTA 1LBIA 4UMBA 3BMOB 3EKZA 3SCUA 4JD4A 2CNWD 5G0UA 4RY8A 3QGKC 2K4MA 1SCUB 3WDQA 4OK6A 3WQSB 1JS1X 3OQIA 1EFLA 3KSMA 4LE1A 1V5GA 3W4RA 3D02A 3W5BA 3CLWA 3TX6A 3W6YA 4F97A 2CVFA 3ROQA 5F4WA 5KAPA 1QRSA 1W85B 2ZI3A 5CDGA 4PEEA 1X8XA 5BW5A 2XOXA 3JZAA 1Z4OA 4K6FA 3OA2A 2FUKA 5CLIA 3HYCA 1CUHA 3IV3A 1RW4A 1Z6GA 1UD8A 5I0DA 4C4RA 3UT0A 3P2KA 2B0JA 4J7CA 2OO5A 4IAOA 4KQ9A 5A5DA 5TGZA 3AVVA 1W9VA 4C6PA 1CVLA 3BAZA 2I87A 1XIIA 4MA4A 1JSXA 5EBAA 1YQDA 2ODNA 4R7WA 3Q7QA 4X92A 3TEJA 1KI6A 2RJ3A 3W72A 1F7VA 1Z36A 3SRHA 5DGIA 1GVSA 1NU5A 4L72A 3ZVRA 2DSKA 1SD5A 4TZKA 4AYTA 1AQYA 4FDTA 1GU0A 4GIAA 1MABB 2NU8B 3PXBA 2Q6LA 3HHEA 1QGOA 2A4AA 2Y7FA 4CN8A 1FL9A 4BQFA 4XUYA 5JCXA 1CUJA 3FFXA 4HEA6 3FSUA 4E12A 2X1SA 5EJIA 4I4NA 5KX5F 3A6PC 1EUDB 5HANA 1FDWA 2J3EA 2AKAB 1R2SA 5FP0A 4NPHA 1PJLA 3WK9A 3MP3A 2J9FA 4MVYA 4O4HB 3RANA 5AP9A 3G2IA 3GOHA 4QA9A 3I8SA 2WVUA 3QMMA 1TEHA 3KZSA 3LS2A 2EZ9A 4CU6A 1M7BA 1KFWA 1P2FA 1YU9A 4XXHA 1KCZA 3QYPA 5EERA 4C7JA 4V0LA 3H8VA 2WZDA 3FVRA 3LHDA 4PAQA 4H6VA 1EPVA 2IYSA 1IIGA 3KKZA 2J7FA 3TWAA 1R5NA 1YTUA 2IKQA 1IOVA 2UUPA 4NZZA 2PGFA 1H6BA 4B40A 1BG9A 3E9YA 4TV6A 5HOSA 2KWIA 3TEMA 3LCUA 1LX7A 3G82C 1QHSA 2XUZA 2GUBA 2NV9A 4IFOA 4I1PA 4TS4A 1FWAC 3SZ8A 2JCVA 1X8CA 1E3LA 1QAPA 1RRGA 4Q9KA 1T0JB 1E5JA 3QA9A 2FW6A 2H06A 4LNUA 3EKLA 4J29A 3JQGA 2WJ4A 4QR6A 4MIOA 1RRKA 2C7FA 3W3AH 3ZD7A 3LHSA 4MAFA 4NJJA 5TNXA 3DIPA 1J9ZA 4I66A 3N74A 4NJMB 1JHDA 3BE6A 1WSDA 4E46A 4JIMA 1VKZA 2HIAA 4WXPA 3ZNOA 4JVOA 3I62A 2JFZA 3RTGA 3CONA 4EI7A 2QCDB 4FLMA 3U7BA 1CQIA 4H6XA 1GG1A 4HOWA 5EQDA 3QEAZ 1E6ZA 3PX2A 3HPXA 3VAVA 3CPHA 2NNLD 4Q9DA 2F8SA 3DG7A 1J49A 4HMQA 3LLDA 4I9AA 1AURA 4RKQA 3AW9A 1CY0A 4HEQA 3RR1A 3ITXA 1TF2A 3PB0A 4U02A 2WKLA 2HFJA 4AJPA 2R25B 4DEXA 5ALOA 3NZPA 3MS7A 4LRSB 1GN9A 4M2LA 4C9BA 3TIVA 5BXQC 4DCPA 2YIMA 2X42A 2O54A 3H7UA 3IAS6 4UU0A 1B6TA 5LOVB 2X2YA 3S2FA 3LDFA 5D05A 3KEQA 1XAHA 5A6LA 2HA3A 4HPNA 1G0CA 1TCBA 5L3SA 3GPIA 3VIPA 4I5FA 4AJ2A 4F8XA 2BDQA 5ES4B 2OQLA 1GPJA 4LXIA 3P52A 3CUXA 3USES 1F8IA 1FNNA 5B3JC 2J24A 4BNMA 3VNJA 1FRFS 4FCVA 1BCSA 4WNAB 4KMQA 4LY4A 1E6WA 4LX0A 4TGLA 3MT9A 1GA6A 2FN7A 3HV0A 1P2GA 4W5OA 3GXTA 3PENA 3S6OA 1YA6A 1R0SA 2BOEX 2E18A 5GGYA 3NO1A 4R8RA 4Q4HB 3EGXA 4FOOA 1E60A 3BQ5A 3WDRA 1B1AA 2VDNB 4RXMA 3PQ8A 4OHKA 3LUKA 4LB4A 5HZMA 2VQ6A 4KCWA 2C4UA 5JFTA 4ZCQA 8MHTA 2FXVA 4U4MA 4B3RB 3KQLA 5E6RB 4QUAA 4LPCA 3FIUA 1QYIA 4YRKA 1V6XA 3EYAA 2FPRA 2CNBA 4TUFA 2QTVA 5I3CA 3AF1A 2YVLA 2FVKA 1X0XA 2ONYA 1A88A 3WWDA 4QKQA 1M2GA 1ZSVA 5JNVA 2ZCUA 2ZUVA 1A2KC 3UGKA 8A3HA 4XVDA 3M6WA 3POCA 1VFUA 4TZ6A 3CCFA 3R3SA 3IEBA 3L4SO 4UBKA 3UZUA 5GVSA 2I9PA 5A5VA 4Y30A 4DMLA 3SUVA 3JD4A 4F1JA 1PZHA 1NXXA 3M4ZA 4OLBA 3GDLA 1UBSA 3KVLA 4U63A 2NUWA 3NPXA 3WP0A 4UFJA 3KT6A 4B43A 1OW3B 4CQMD 1UIPA 1PWZA 1M0EA 2IE0A 1JLSA 3ZZNA 4I55B 5G1NA 2XF2A 3K1JA 4CN1A 4X5OA 3AVPA 2DFKB 4MNJA 3LHVA 2OAQ1 1JDNA 1GKYA 1NG9A 2A2ZA 1YB1A