4G56A

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
626
structure length
617
Chain Sequence
RVSSGRDVACVTEVADTLGAMANQGFDFLCMPIFHPRFKREFYKEPAKSRPGPQTRSDLLLSGRDWNTLIVGKLSDWIKTDSEVSRIRKTSEAAMQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHVGHHSTMFWMRVPLMAPNDLRDDLIENEPGEERTWIWWHNFRSLCDYNKKIALAIEIGADLPSGHVIDRWLGEPIKAAFLPTSIFLTNKKGFPVLTKVHQRLIFKLFKLEVQFVISGSHHHSEKDLCSYLQYLEYLSQNSPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQILMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQVTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDDGVSIPGEYTSYLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFHHPNKDDVIDNNRYCCLQYRVDLNTVLHGFAGYFNTVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPMREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transferase
molecule keywords Hsl7 protein
total genus 169
structure length 617
sequence length 626
chains with identical sequence C
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4g56A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4g56A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4g56A02
1VL5A 1K77A 2BR4A 1KPIA 5FHRA 1MJFA 4RVGA 5K0GA 1DCTA 4LWPA 2ZW9A 3ITLA 2P7HA 1QAOA 3FPEA 5C1IA 1XP3A 7XIMA 4BP1A 4QQKA 3NVKI 4OVXA 3P8ZA 10MHA 5B7ZA 3KQWA 1XLFA 1PJZA 2IH4A 4PGGA 4XSMA 2YVLA 1UFKA 4KW2A 3EGVA 3BXOA 3GWZA 2QW5A 3GNXA 2I6GA 3PS9A 5DRTA 3G8BA 5J8LA 3SGLA 2QRVB 2UYOA 1I1NA 2C7QA 2GH1A 3LCVB 4X61A 3RODA 3P2KA 5CM2Z 1XJ5A 2NP7A 4GJIA 1G6Q1 3VYLA 4YTSA 2JHPA 1YUBA 1XLDA 4QEHA 3DLIA 5EHIA 5E9JA 3I9FA 4P7JA 3M4XA 5FA8A 2EJTA 3T7SA 4YUZA 1AQIA 5CVUA 5GINE 4ISCA 4Q7IA 3IUDA 4B17A 2AOXA 1DXIA 4HNOA 2I56A 3UWPA 2Z6AA 3I53A 2PJDA 3OFJA 5EZQA 3CBGA 3V97A 4P58A 1P91A 3C0SA 4EKGA 2Q41A 1NV8A 1QTWA 3KR1A 4EVIA 3CNYA 2BM8A 3KPYA 2VP3A 3DOUA 5T6BA 2PXAA 1HMYA 3C0KA 4C04A 2QUMA 3UXIA 1XVAA 3C3PA 3K6RA 3EVZA 3ERCA 1QT1A 4HH4A 2JHCA 3I58A 2ZBQA 4R6WA 5EMMA 3CJRA 4YMGA 5B80A 2K4MA 5DX0A 2KW5A 4RVFA 3FPFA 4H0NA 5B7YA 3NGFA 4BY9E 2AN3A 4V0QA 4CKBA 3IYLW 2H11A 1SQFA 2ORED 5HFJA 4QPNA 3THSA 4AZVA 3HVJA 3KQQA 3GJYA 3P9NA 2IBTA 1XIMA 4EACA 3X0DA 5EHGA 3HCFA 1M0EA 3BUSA 3DH0A 4X60A 2NQ9A 1RJFA 3LL7A 1G60A 1Y8CA 2WK1A 2AOTB 3B5IA 4DMGA 4E2WA 4PYJA 1XIGA 1KPGA 1XDSA 2R6ZA 1NT2A 2YXEA 3PX3A 3DMHA 4FT2A 5LQJA 3AYTA 1NW7A 3FPJA 3KBMA 3C3YA 3DXXA 3G5LA 3NWBA 4F85A 5HILA 1XLIA 2N47A 1S5MA 5EIWA 4U7TB 2UZ4A 4A8RA 4ER3A 4MWZA 3MQ2A 3TM5A 1NW5A 5F2NA 4YTRA 4BLWA 2G4JA 5DRYA 1EAMA 3AY0A 3NVMB 2AOTA 4XISA 2LD4A 2EJUA 3DTNA 2ERCA 3KBVA 1XLLA 1DE5A 1O9GA 5H1WA 1WZNA 2B9EA 1ORIA 3UA3A 5C9ZA 3KQPA 3KU1A 5LQUA 3AXTA 4V0RA 2IDJA 1AF7A 5D1HA 2JG3A 4QVKA 3KR0A 1L3IA 4PYQA 4RTJA 3AJDA 9XIAA 1R00A 1NBHA 2AOWA 1PRYA 1X1BA 3DMFA 1B42A 3UU0A 5DX8A 1XIHA 2BR5A 3KKZA 2Y1XA 4KIFA 2A14A 3UJ7A 2NXNA 3FZGA 4OA8A 4RSRA 4DQ0A 4YV0A 2PKWA 3P9CA 2X7WA 4A8NA 4YUYA 3AYVA 4EMSA 4RTPA 3M0LA 2CMHA 3HEMA 2OB1A 4QTTB 3G8AA 4US6A 6XIMA 1NW6A 2IPXA 1INLA 3MAGA 2GB4A 2GYIA 5GM1A 5IH3A 5FWDA 1EQAA 2IDKA 3GO4A 5E8JA 2B3TA 2E5WA 4XUDA 1SKMA 2GS9A 4WXHA 3P14A 1KIAA 5FQNA 2FYTA 2AZTA 3GU3A 2Y1WA 4Y2HA 2ZVJA 4MTLA 3KWSA 3ELDA 5CVVA 4YMHA 4EKIA 1SG9A 1WXXA 4DVOA 2ZBPA 1I9GA 3T7TA 3C0QA 2NNWB 5GM2A 2VDVE 4YUVA 3FUVA 3T7RA 1H1DA 3PLAE 5E1OA 1NBIA 3OZSA 1QZZA 3LCUA 3CQHA 2QY6A 5EQJB 3TRKA 5IKMA 2YUIA 5LR6A 1XICA 2JJQA 3ID6C 1GW9A 5FCDA 4A8LA 4QE1A 1XLAA 3KBNA 1CLKA 3LBFA 3PT9A 2Z6UA 5XINA 3K0BA 1TW2A 3KQOA 3DMGA 1NW3A 2BH2A 1MUWA 3GXOA 3HM2A 1YF3A 3KCJA 4KRGA 4RTQA 4MHTA 5DTQA 3FPHA 3SSOA 3HCCA 1O54A 5U4XA 3KHKA 1JG1A 3A4TA 1FP2A 1FP1D 5B1SA 2HR1A 3QZAA 3E23A 3OBEA 1ZHFA 2ZIGA 4E3VA 5EPEA 4GC9A 4GC5A 4M36A 3BANA 3QC0A 1I4WA 2OO3A 3GRUA 4QEEA 5DSXA 4AZWA 5EKUA 3QOWA 4GQBA 3QOXA 3KBJA 1UIRA 4P7GA 5E1MA 4XIMA 2O57A 4OQEA 4GLEA 1VP3A 1XIDA 5EIFA 4QTUB 1JSXA 2ZLBA 5EEHA 5GWXA 4ER6A 3DP7A 3HVKA 4E33A 4QVGA 3SX0A 5HEKA 3R9XB 3TFWA 2P3QA 3FTDA 1WY7A 3HNRA 3CWHA 4RVHA 2DULA 2JH8A 3SXJA 5KVAA 4CTKA 3Q7EA 1OADA 1L3CA 5ICGA 4PYNA 3CCFA 3E7PA 2HMYB 2ZZKA 3HA7A 4PCAA 5G02A 5FA5A 3KR2A 3SMQA 5EC8A 1RI5A 1BXCA 4M7RA 4YTUA 2GLUA 3PVCA 4DKJA 3G88A 1QAQA 5EGSA 4FSXA 3OZTA 4QPPA 2OYRA 2P1DA 1D2HA 5KQRA 2G71A 3FUUA 2ZIFA 8XIAA 3LPMA 3LCCA 1BXBA 4HG2A 4YTQA 2QE6A 4YV1A 3TQSA 1MHTA 5DM2A 3IV6A 2GLKA 1KYWA 2O0LA 3FTFA 2IGTA 2B2CA 3FRIA 1VLMA 3UBTA 1JG3A 4P7KA 3MHTA 4ER5A 5F2KA 2Q02A 4RTSA 4E32A 4HRAA 3TKYA 3R3HA 2G8NA 3TLJA 4YV2A 5LQRA 4PFHA 3C6KA 3CQIA 2ONYA 3NJRA 1XINA 5HIJA 2HK0A 3N4AA 4LECA 4R8RA 4RTRA 2PT9A 2OXTA 3UJ6A 1D8WA 4AX8A 4HGYA 3OPNA 4K1GA 2AOVA 5CUQA 3LDFA 4RTOA 3VNIA 3OU6A 3TM4A 3NMUF 1KP9A 1WG8A 2X7VA 2XYRA 3ANXA 5GOZA 1G8AA 1MNZA 1JQEA 2ZWAA 4PYLA 3M0XA 3SSNA 5LQCA 1IY9A 2FCAA 1XXLA 3HCAA 2DPMA 2HV9A 3LHDA 5K0NA 3UJAA 1XDZA 1SVUA 2GUBA 1VE3A 3ITTA 1VQ1A 3QV2A 4R8SA 3KBWA 3EGIA 5GP1A 2WA1A 2YX1A 2IH5A 5DWQA 4PGLA 1A0CA 1JG2A 1Q0TA 3L8DA 1L3BA 9MHTA 5EKXA 3JWHA 3UA4A 4E2YA 1QUMA 5CVEA 1YFLA 3JWGA 3O31A 1S5NA 2PXXA 3KQYA 1FPQA 1KYZA 4QE5A 3M0MA 4KDCA 4YTTA 3KPUA 5FQOA 4GOMD 4E70A 3VNLA 5EEGA 3ITOA 3ER8A 2P41A 4QE4A 4GF5A 5FTWA 5K01A 2QULA 1RJGA 5K05A 2PGXA 3NTVA 3BGDA 1VBFA 4R6XA 1YZHA 2C7PA 2G70A 2NQJA 1ZQ9A 3GDHA 3THRA 5CCBA 3U0HA 1RI4A 2PX5A 4FP9A 3GIWA 2CKDA 4PYKA 3M6UA 3IUIA 3UJ9A 1AQJA 3AAMA 1TPYA 2O05A 3BKWA 3DLCA 5DM0A 3FTEA 2ZBRA 4QDWA 3OFKA 3L23A 4O29A 2PX8A 4A8IA 3BWWA 4IKPA 2V74B 3KCOA 3VNKA 3G89A 3OU7A 2HNKA 5LQNA 3OZRA 5HZMA 1NKVA 3JWJA 2ESRA 5CD1A 1F38A 1G8SA 1WS6A 2UYQA 3BKXA 3DUWA 3TMAA 4E31A 4A6DA 2PVCA 1D2GA 1R74A 3NW9A 3U81A 4POOA 5EMJA 1BHJA 5K0CA 1YFJA 1IXKA 2GA9A 2ZULA 5FWAA 2VDWA 2XYVA 3PFHA 5HIIA 2OKCA 6XIAA 3HVHA 1I60A 3G2PA 3JWIA 3TOSA 4F86A 3CQJA 4HC4A 1FJXA 4RX1A 3MTIA 5K0FA 2C7RA 3REOA 4Y30A 1F3LA 2AN4A 3P2EA 4LG1A 3V8VA 3BGIA 1RJEA 3ITYA 3ITVA 2XINA 1N2XA 2XVAA 3UFBA 2J6VA 1A0EA 1QANA 2EX4A 3G7UA 4HTFA 3F4KA 3GRYA 5E1BA 2JH9A 3ELUA 3VNJA 2FRXA 3M0VA 4CTJA 5CCXA 3KTCA 2HTEA 2PY6A 3DX5A 2YXDA 4QDJA 4QDKA 4C08A 2PSSA 5T64A 3UJCA 8MHTA 2GVEA 4OX9Y 2GPYA 2NXEA 4RTNA 2G72A 2QYOA 2ZZMA 4A6EA 3ORHA 5H02A 1JQ3A 3EVCA 5F2OA 4PGHA 3UJDA 4E30A 1EG2A 4KIGA 2H00A 2JHAA 3SSMA 3SM3A 1SQGA 4GOLD 4DM3A 3ELYA 4M38A 2YTZA 2CWWA 5E9QA 4BLVA 3EMDA 5GIOE 2XYQA 3B89A 1XLJA 2OBFA 3G2QA 3IHTA 5DM4A 4RTKA 1BOOA 3MCTA 5HIMA 1X1DA 1UWVA 4HGZA 5E8RA 4PYOA 2FK8A 3SVZA 1KHHA 1ZKDA 4P7FA 4ATNA 4DCMA 5HIKA 4J4KA 4QQNA 4K3ZA 2PBFA 3R0QA 3QXBA 2WA2A 4RYLA 4PCLA 1N7JA 4CKEA 3LGAA 3VSEA 5KYGA 5XIAA 5DXAA 5EMKA 5AVHA 1RI2A 1FBNA 1XYLA 3BWMA 3CVOA 3P71T 5D1NA 3UJBA 5JUWA 3M0YA 1R6AA 4C05A 2P8JA 2PWPA 3IUHA 2ZWVA 3FTCA 3M6XA 4X1OA 3BWYA 5E1DA 2FK7A 2ONZA 5BP7A 5FADA 4DZRA 3B7PA 3FPGA 5M5BA 3CJQA 2NP6A 4RTLA 2AVNA 3O7WA 1ORHA 1XIBA 3BWBA 3LBYA 2AVDA 8XIMA 4W4QA 1JG4A 5DT2A 5FUBA 3WQOA 1XLKA 2AOUA 4ZB2A 1NW8A 5EOVA 3UZUA 4E2XA 1DUSA 1XCJA 1XIJA 1EIZA 3OE4A 4GBED 5DX1A 1I6NA 2I7CA 2ZCJA 2P7IA 3ER9A 2I62A 1DE6A 3BZJA 2FPOA 5EZSA 4OBXA 2BR3A 3KPWA 1ZGAA 2BM9A 1BKYA 4K6MA 4ZB5A 5DPMA 3UVAA 3KQSA 3OU2A 5E2BA 3UJ8A 3BDKA 4BLUA 3SR4A 3FUTA 4FZVA 4RTMA 3T0IA 4KWCA 1XLHA 1SUIA 3KQMA 3MTEA 5BW4A 5K0EA 1DL5A 3P2IA 3LDUA 4YUXA 3E8SA 1JTEA 3B3JA 1G55A 1RJDA 3KPVA 1XLCA 3P97A 3XIMA 3XINA 4GJJA 3Q87B 4MQ4A 3IEIA 5FHQA 2ADMA 4KVZA 3KBSA 5DTRA 3BT7A 1N7IA 2VDUE 1TZ9A 2PXCA 3M6VA 1XISA 1P1CA 3GCZA 4L7VA 1X1CA 1X1AA 1OR8A 2CL5A 1T43A 5BXYA 4XUCA 2C7OA 5DXJA 3FYCA 4CKCA 4GEKA 4X63A 1XYBA 3E05A 3EPPA 3PFGA 2PLWA 2AS0A 2AR0A 3A7DA 3LSTA 1XIFA 4AZSA 3OCJA 3MERA 3G2MA 3OE5A 7MHTA 1XIEA 2FHPA 4ZB0A 2VZ9A 2OPBA 1M6EX 2P40A 5K8VA 3RW9A 2G1PA 3M70A 2OB2A 3HTXA 3B3GA 1P39A 2H1RA 3KQVA 4OBWA 4C4AA 4WVLA 3TR6A 1TW3A 1RI1A 2PT6A 3P9IA 3S68A 1D2CA 1VIDA 2OZVA 4OA5A 3AWIA 2P35A 1JTFA 4F84A 2O06A 4PNEA 3HVIA 4ZBCA 3D2LA 2EFJA 3HCBA 4GOND 4Z2YA 1A0DA 5CVJA 4C06A 5JR3A 2ZFUA 3NDJA 4DUOA 3HP7A 3EVAA 3AALA 3GRRA 1G38A 2Z6QA 1Z3CA 1XYAA 5E2AA 3NDIA 3MB5A 1O1HA 2IIPA 4HHMA 5ERGB 4IWNA 3DULA 3EEYA 4IV8A 3R6TA 5GIPE 1VPTA 2PX2A 3A26A 4PWYA 3MGGA 3TC3A 3TVAA 4OQDA 5XIMA 4U7PB 2IP2A 3AXSA 3VYWA 4PYIA 4UOEA 3I64A 4FR0A 5BW5A 3O4FA 1XYMA 2PX4A 3JU2A 3A27A 3RIEA 4C07A 2NXCA 4ER0A 4ER7A 2IBSA 5DLYA 5HOQA 3GNLA 3HA3A 4RWZA 2B25A 2IH2A 3VC2A 2VS1A 5CVDA 1WXWA 2CMGA 1VP9A 3HCDA 4PONA 3ELWA 4ZTBA 2O07A 2G0WA 4C03A 5MHTA 4LWOA 3VNMA 2P3LA 3EGEA 5K0BA 5DSTA 2BZGA 3U3HA 3I5UA 2HCVA 4AZTA 4RVDA 4JXJA 1X19A 3TPZA 3BWCA 3GGDA 1JSZA 3HCEA 5AVNA 1KXZA 4PYMA 3DBNA 2QUNA 4M37A 3BGVA 2ZVRA 4DF3A 5LQKA 4X41A 2I9KA 4FSDA 4RV9A 3A7EA 1XLBA 4YUWA 5K0JA 3KPJA 4QDPA 2B78A 3KCLA 2HWKA 3LDGA 3PB3A 3HA5A 4PIPA 4XCXA 5C0OE 2P3OA 3H2BA 2R3SA 4HGXA 4AUKA 4EK9A 1QYRA 1IM8A 1NE2A 3G2OA 5TNVA 3GRVA 4HTFB 1V39A 3BZBA 3EVGA 3LKDA 1BC5A 5LSAA 2NXJA 4KW7A 4DCGA 1AV6A 2QM3A 1XDUA 2ZIEA 5EVJA 3EMBA 4FS8A 1R8YA 5DM1A 3CKKA 2YXLA 3CJTA 3FRHA 3FUXA 4HHLA 3G5TA 3LKZA 1DIEA 3R24A 4PINA 2ZTHA 3ITXA 2ZDSA 5ICEA 3EVDA 3WSTA 3QYSA 1KPHA 1RI3A 1XCLA 4CWAA 1R18A 3CGGA 1ZG3A 3M6WA 5P8WA 3TKAA 5K0LA 1U2ZA 2AOUB 5LQAA 5T67A 5H6HA 5ICCA 3KR9A 2ZSUA 4GOOD 3DR5A 2V7EA 3CQKA 5ICFA 4CXMA 1JR4A 1L1EA 5K03A 3LMZA 4LNCA 3XISA 2F8LA 2XVMA 2HK1A 2YR0A 1O9HA 1YZ3A 3EVBA 5E9WA 5EG5A 3NWEA 3VC1A 3EEOA 2UYCA 4GUAA 3M0HA 1ZGJA 1JQDA 1XLGA 4BP3A 1R8XA 2I57A 1SUSA 3FYDA 4MIKA 3LX6A 3ME5A 4KDRA 2GAFA 1QAMA 4R05A 2PWYA 3A25A 5KQSA 1Q0SA 1NV9A 1XTPA 3BZGA 5EMLA 3MCZA 4XSLA 5DTMA 4DA4A 2XBMA 2ZZNA 1XIIA 2XIMA 1XLEA 3LECA 4FGZA 4EQZA 5K09A 5CIYA 3P6LA 1DIDA 1L9KA 2OY0A 2YQZA 2OU4A 3C0LA 4XIAA 3KQTA 3PX2A 4PIMA 4XUEA 4E2ZA 1XYCA 3CC8A 3GRZA 3M33A 9XIMA 3B3FA 1EJ6A 5KS2A 2PV0A 5I7GA 3DXYA 3FUWA 3P9KA 3DXZA 3C6MA 3EVEA 3PTAA 2UYHA 4HSGA 1YB2A 2IFTA 2XISA 1P1BA 5FULA 3EVFA 1EJ0A 1XLMA 1HNNA 4XKMA 1KR5A 2AN5A 2EG5A 2NYUA 4FT4A 4NECA 2QRVA 4IV0A 1M6YA 1YX1A 4EAYA 3FVMA 2NQHA 4G56A
chains in the Genus database with same CATH superfamily
1K77A 3KOZA 1J22A 3EZ2A 10MHA 2R1KA 4XSMA 1WTCA 2Y1OA 1ZBVA 4ENVA 1SC3A 3N3AC 4H9VA 4FFNA 3GRCA 3N29A 3IOMA 2DSWA 2TMDA 3FOBA 1KRCC 1H3GA 3D8NA 1G17A 3PL5A 4IH9A 3L0SA 3VNZA 3D6VA 2IEBA 3CPHA 1JCLA 1RIFA 3T54A 3GJYA 5HM8A 3S5YA 4RFVA 5EUQB 1QH8B 1KPGA 1Q14A 3GGJA 5F1YA 1RKVA 2D5CA 5U7SA 3KWFA 4LDZA 3LK6A 1KEEB 1A8SA 1JDTA 1DJQA 4DLSA 4DS3A 4AG3A 3F6CA 3MSRA 3BMNA 3N2GA 2Z4TA 3ZHVA 4YCLA 4QVKA 3PN8A 4IXTA 1PGJA 3JD2A 3GJZA 2QJNA 3CNEA 2VQ6A 3LBIA 4GZ7A 1YFJA 4MX8A 4Z2GA 1A5BB 2H3DA 1U0GA 2OEMA 1QHYA 1WY5A 4JT8A 5GVJA 1UJPA 1Z6ZA 3UHAA 4D42A 4M7OA 3Q6MA 1EVZA 4Y1EA 1RS0A 4CT5A 2O5RA 1W3IA 4UBMA 2BTOA 3P0JA 3R25A 4QFCA 4OXYA 3QLUC 4HGOA 4EHHA 2C20A 3DFQA 1ME8A 1ZD8A 1GGOA 5FH9A 1E79D 2POZA 1LPSA 2CJXA 5EC8A 2NMVA 3I4KA 1T99A 5CBJA 4BNNA 5IEJA 3M46A 2AMVA 4CTNA 4C30A 4WJXA 3LUPA 1C9WA 2GVJA 2TAAA 4GP9A 2YW9A 4V2IA 4RM3A 1ESCA 1GRQA 3OPYB 1G16A 1BCSA 1AT1A 4LF8B 2VR4A 4L08A 3QR1A 4MUHA 4N76A 1Q74A 1JHPA 4Q6WA 3DFFA 2ZB4A 2C71A 2G1KA 4PPNA 2YOFA 2XGJA 4DNFA 3E5NA 3V4SA 3OZMA 2O8DA 1NNSA 3H2NA 5JD5A 4W9TA 1Q91A 4CDRA 2D5IA 4MNTA 1J0HA 3MMDA 2QEQA 5CW1A 2AGVA 4HEHA 1BEUB 1BHJA 4XIGS 1G6OA 3B1KA 4CBVA 1LSOA 2ZTUA 2Q5HA 5L40A 1FNNA 1TZJA 2C18A 4BI5A 1K8YB 5JFGA 1JJAA 5A2BA 3DX5A 4CFSA 1FRZA 1NAHA 4OQQA 2Q0XA 3SJUA 5H3LA 3NC4A 2ZT5A 5K0GA 2TS1A 3ACCA 3QV8A 4RCXA 4LNAA 3ZDCA 2GK1B 4KGLA 4OBEA 3FJ4A 2GLXA 3VPGA 4FTWA 1TCDA 3KBBA 5HF8A 3PSVA 5HKBA 4IWXA 5A9RA 1ZYUA 3CEPB 3HFRA 4KIEA 1JB9A 1II0A 4KFOA 4PZDA 2BM9A 2F1RA 3MWCA 2VWSA 1KMHA 1XLHA 4X7BA 2BY4A 1X1EA 2C3UA 1HEYA 3NHRA 2AL2A 4WOZA 1H7NA 2YIMA 4HGNA 4Q1VA 2J24A 1GPMA 2QMOA 4XCVA 5EZ5A 4QFMA 2RBEA 2V30A 3CPSA 5DMLA 2PU7A 3A1DA 3RM4A 2EBNA 3OFND 1IHOA 1NU5A 1WV2A 4NU8X 4BWFB 3RJXA 1G4AE 2DTEA 4ZO7A 3A4JA 3MRTA 2J59A 3P96A 2DSNA 5KTTA 1P1KA 1ID8A 5DT5A 3S2IA 4W7IA 3I61A 4D1YA 4XXHA 3ZR4B 4CM9A 5LZ5A 1ZRSA 1PS8A 1DV1A 2EKPA 3Q37A 3DTTA 1W44A 1RZUA 1PIGA 1HWYA 3AH8A 1TUEA 2JGLA 4DV1B 3TJLA 3CX4A 5HULA 2DZUA 4DO7A 1NVMB 2R25B 3NEPX 1EUDB 3AJEA 1NNEA 3HNOA 4Q32A 4BMCA 3B1JA 4WCFC 4CM5A 4MB0A 3E38A 3SQNA 3DG3A 4PPFA 2I17A 1EFDN 1PDYA 1RCOB 2QM3A 3TRDA 1OEPA 4JX5A 3LGEA 3MO7A 1U2ZA 5CIWA 3ZBUA 5CPFA 2QGFA 3TQOA 1X0VA 4X97A 1OB0A 3Q4GA 2AKZA 3BMOB 4MVXA 1H4PA 2BUAA 5JI2E 1A9ZA 3NBZC 1E58A 4X8HA 1W1ZA 1M76A 3WSWA 1QF6A 1MQ9A 4DLMA 1G41A 2MYPA 5IS2A 2W2QA 3K1AA 2YWCA 5FIPA 1XQYA 4QXQA 2RH9B 4EHBA 1K7FB 2C31A 4PUMA 3NHBA 7XIMA 3ICJA 2OCBA 3OQEA 3HDHA 3P32A 3WH8A 4P53A 2GH1A 4CMAA 1Y98A 1DCKA 3AMVA 3P2KA 4IX0A 1ISHA 5GMOA 2NPIA 3N53A 1NQUA 2A3NA 5H8PA 3CONA 4AQDA 3MGKA 2TSYA 4UDXX 1F9CA 1US3A 5J2UA 1ML4A 2QRUA 3MP4A 3CJRA 5MKGA 2VG8A 3WUBA 3LLFA 1YSCA 3IJ7A 4CL8A 2IYYA 3CHEA 3AZPA 4Q4HA 1UK8A 3K9GA 2CLMA 4BDTA 4NJEB 4YCJA 3KVLA 2OORA 3B36A 2VCBA 4E5SA 3NALA 3KBVA 3TIMA 4PYQA 3JQAB 1NBMD 2PKWA 4P7QA 4KNWA 3WGGA 2JZCA 2GS9A 3NQ8A 4XE5A 3H6KA 1N82A 4NU6A 1EM8A 1N8NA 2G1JA 1QZZA 1GU1A 5IFTA 1UWTA 1KLZA 3IEXA 1MUWA 5U4NA 1J0AA 3K9CA 2BLLA 1U9YA 2X0YA 3R6GA 2F3RA 1YZQA 3JX9A 5L7TA 2E6KA 2OO3A 4LS0A 4QEEA 4BXOB 1I6WA 2OBNA 3A9TA 1Z28A 3WJXA 2AN1A 3DEHA 3HVKA 1RVKA 3OUTA 1NQTA 2HPIA 3GEEA 3DHYA 5KYVA 3L0YA 1F07A 1L9XA 1CQXA 1WPRA 3HV2A 2HD4A 4M1MA 5AJXA 1H5NA 1N2GA 2ZIXB 5IHRA 3OOWA 3TQSA 5I7AA 1S02A 3NATA 4OU5A 2YZKA 1M41A 1PGOA 3URNA 3NJRA 1BFNA 3PANA 4I4TF 3TI7A 3FSRA 2DFPA 2PUZA 5CAKA 1A7UA 2E40A 4B5VA 2X7VA 1E6PA 2PAJA 3ETHA 2PZ8A 3U0BA 4R8SA 2Q4BA 1JPUA 3NORA 1NELA 4LKOA 3L6CA 3GPLA 3W1PA 2FPTA 4HUJA 3AW8A 3VDAA 2B8NA 2PUWA 1MUCA 4J3TA 3U4CA 4DG5A 1OJLA 2VGFA 2BG5A 3ARXA 1DMRA 1VCHA 3H1BA 5L6UA 3H42B 4B33A 4M19A 1CS4C 2ZTJA 4IMGA 3I01M 2RHTA 4X62B 3C3CA 1N7GA 3GDKA 4H3VA 3KYBA 3T8QA 1M2HA 3IT2A 4GUJA 4B5SA 4C1LA 1Z44A 3FVTA 4D9JA 2A30A 3NLLA 1VP5A 1CECA 4D4IA 1E4YA 3P20A 1PZ2A 4DR4B 1EG2A 3SE0A 2UVPB 5M3WA 2G25A 1OXUA 1DDOA 2DBYA 2ZCVA 1QNSA 5J2UF 4GY0A 4PCLA 2ZYWX 3ZWBA 1XTUA 1IM5A 3EX1A 1ELSA 2QP4A 1NG1A 1KRXA 4BQIA 1A4IA 4IDBA 1MPXA 3OQIA 4QLLA 4QBXA 4OJQA 5JADA 3NT2A 1YNYA 1HSZA 4IX2A 4DYKA 1E6LA 3IEIA 1E5TA 5AM1A 3S42A 4D56A 1DVRA 4JQ3A 1KJZA 3VD9A 1YS9A 5B58T 5BRAA 1SBIA 3CLVA 3WNCA 3PGJA 4A0QA 2EG6A 3ILYA 4G85A 2VHZA 4RLHA 1Q22A 1RI1A 4JI0B 3OBAA 2VSQA 1JZ6A 3FEMA 1BRLB 1G38A 4I9AA 4UAJA 5F52A 5A6SA 1Y8RA 1L7RA 3CZPA 3GLIB 5B1EA 1QHXA 1VKRA 3H87A 1RRGA 2OBLA 4YRQA 3RIEA 1COWD 2FTKE 1NOFA 3JASA 3N1UA 2W58A 2C7FA 3DT8A 5G1MA 4PQRA 1ZU8A 5BSFA 4AN0A 2QTNA 1UBTS 5IN4A 3LDGA 2QVGA 5G4EA 1W3KA 3O03A 2VJQA 1LRNA 4L80A 5D86A 3MPUA 4JN7A 3LRXA 4Q7LA 1IR1A 1PS0A 4TQAA 3WDIA 4K9LA 1WHSA 1DTWB 5ICFA 4CXMA 1EJVC 3SLKA 2DIEA 3PUYA 2ZXAA 2ODTX 2PDWA 4HK7A 3KT0A 4TRMA 1XTPA 4KEMA 4MHBA 1XIIA 5M2QA 3GAZA 1JWLA 1TAGA 3ETLA 2OXRA 3NNSA 1IJEA 4BF9A 1OFHA 3OBIA 5I3CA 2A0KA 3WY1A 3V2HA 4S1FA 1FDVA 4UMBA 1YAJA 1ZH2A 2XX3A 1CGYA 4BNZA 3PS9A 4PZCA 2TRSB 3HBNA 1R4MB 3NANA 2I34A 3EEIA 1EUQA 4Q4JB 4EHAA 3UMFA 2YA1A 5LP6B 5A6SB 3QPVA 2NSLA 1UOZA 4Q8NA 4EWJA 5ESXA 4R2WA 4LN1A 4S23A 4NAEB 3LOPA 1ISYA 2PL1A 2VX7A 1JXMA 3PSWA 1WSBA 3P9QA 1GTEA 2R6ZA 2TPSA 2Q6ZA 2FZCA 3KD2A 5TGDA 4RVOA 2JALA 1XQVA 5CYGA 3L7IA 4NENB 2QK4A 2EJUA 5C9ZA 8CGTA 4E4PA 5LD2C 5EFDA 4KIUA 3IGXA 4OATA 5D6NA 4ZVKA 1KM6A 5BSMA 3RHFA 3L9WA 3RYCB 4L2IA 5EFOA 3IJPA 3WFAA 4LRTA 1WAMA 1WXXA 2P11A 1V41E 4RLQA 1JFXA 1IUOA 3TYDA 6REQA 2QY6A 2CLOA 4IJWA 2WC3A 3BJIC 4MHTA 4TTVA 4X7RA 2DETA 5C34B 3OBEA 4LA4A 3PUWA 4HNCA 2F1IA 4AHQA 3AKZA 5I5RA 1LD3A 4RPQA 2P5YA 4Q9JA 5AH0A 2BBFA 3F3MA 4LUSA 2QDEA 2F3UA 3LIIA 3VO0A 3B8UA 1KJJA 4BE9A 1OT3A 1RCXB 3G88A 1QK0A 5KWJA 3RKUA 4BC0A 1FRNA 3O4JA 4JL1A 1JJIA 3GDWA 3QWBA 1UMKA 5JJKA 4YI5A 3M0EA 5LQRA 3GZJA 1I2BA 1I80A 2J75A 4D9BA 3A9BA 3P5ZA 4B3FX 2R1TB 3ZJYA 2F7SA 4K6GA 2D3TA 2C54A 5BWFA 5F2EA 1XD1A 1RRPA 2VXCA 3AF2A 4WOQA 1MQPA 1Q0TA 4NU0A 3ZK7A 1AKEA 4X8LA 5CVEA 3HABA 5DCLA 4BAGA 3Q15C 4MQ6A 3QSTA 4P4GA 1VIMA 4AJKA 1KK0A 1QASA 5EWMA 3DBLA 3OIHA 5DP2A 2R00C 3RUAA 3EWCA 4GZMA 1P48A 3HJFA 3EOSA 2JGDA 3DSRA 4WXPA 5JECA 4WN3A 1I60A 1Q0PA 3RILA 1G8MA 3PLNA 2Y1HA 2WNSA 3STGA 4FEYA 4BX8A 7A3HA 1L5WA 1Z08A 1UP0A 3COYA 4YCPA 4TKUA 3UJFA 2G72A 3FAXA 2RJHA 2C8JA 4QX4A 3W78A 4RE2A 1NG9A 2ZT8A 5HIKA 3B4UA 3QQPA 2C6QA 1W48A 3MQTA 4G5DA 3P27A 1AK9A 1S9HA 4UU8A 4RTLA 1ZTVA 2PSEA 2HMWA 1U3GA 2OVBA 4PCUA 5I45A 4K8OA 4U5KA 3URQA 4FNRA 4JIRA 4QRDA 3ZCQA 1IZ9A 1VE7A 2BFPA 4JKKA 3TRHA 1UR8A 3NIDB 4WK2B 2PDPA 4G4JA 1WYIA 9LDBA 1GYQA 2AMYA 4ASUA 3S2FA 1Y3FE 4HZMA 4HDNB 3MYOA 2QAGA 2FJPA 2PT6A 2ZYDA 3N2GB 2PIDA 3NP7A 4ZMBA 4JLMA 4JKYA 5DNVA 4NJGA 2J6CA 2ERXA 2P9CA 4U5QA 1WV0A 1M67A 1FDZA 2YCLB 2WVSA 3D3NA 1JKFA 4MUMA 3MXTA 1J0ZA 3AMCA 5C54A 3HB5X 2VP9A 1GK8A 1O5KA 1UZHA 4NXSA 5CPLA 3QU5A 5H3HA 5F2IA 4DYHA 4NCHA 1UOKA 3PQ3A 3HN6A 2L17A 5HDQA 1TEZA 2XHEA 1VG8A 4ZHQA 3CQ9A 3LLSA 4IKOA 4EFKA 1FQOA 2X0DA 4EYOA 1GUZA 3U5UA 4XSHA 2OTDA 4X6XA 3SY8A 2Y2UA 1PFUA 2ZYIA 1Q2XA 1MB9A 4FNPA 3LOTA 1GSOA 3AUSA 4JIGA 3T5DA 1TK3A 4GLOA 1F4AA 3ZH9B 3WLSA 3WL1A 2J08A 4R41A 2ISSD 2D0OB 3TLMA 5H0IA 1ND6A 1PK8A 2WAXA 1F0PA 4Q3AA 1TPH1 1P5FA 4IX9A 1Z2CA 1KXHA 3LCFA 3K70D 2BGNE 3R7LA 3LY5A 4UC0A 2Z1VA 4MRNA 2JFFA 1Z33A 1G9HA 2XUDA 4KGJA 1Z82A 2KI5A 1Z0ZA 4G07A 4EOUA 2WU3A 3PWTA 1XHEA 4KJZA 3QF0A 3H2HA 3VC3A 2K6GA 1P1FA 3W3ZB 1B30A 2FFBA 2ZE8A 3IVMA 1C41A 3PPVA 4ZK2A 2X0IA 3C5HA 5DLEA 4CKZA 4YMGA 2UU9B 4CM9D 1ZRQA 2PQ0A 4CMGA 2OZTA 1ZNXA 2ZRBA 2X41A 4RXFA 5LZ8A 1ID1A 2Z5GA 3WGMA 2RC5A 1ECJA 1F2DA 1TCBA 3OOQA 3GJTA 4HNUA 4OOZA 3WQVA 2UZ4A 4KMOA 2PNJA 1W29A 3CRNA 2PZNA 1U2SA 1T1GA 1AF7A 4YS6A 3WTCA 4I9JA 3AJDA 1X1BA 3KEFA 1F9EA 4RSRA 6PFKA 3TSBA 1RLDA 5K45A 4YROA 4JX9A 1OD0A 1SUFA 3QVGB 3IDQA 2QEZA 1TRIA 2B7NA 2DZPA 1K5HA 3LHSA 1TLFA 3DFNA 1T4BA 3N18A 3TTOA 3SICE 3STVA 4YAFA 3I5MA 2ZR7A 4GLJA 4NJMA 1GLGA 3UMGA 2FDSA 2BGQA 5JCJA 3QOKA 4S2UA 1L3CA 1F51E 4EUSA 2Q9AA 3KUCA 4YREA 1SJAA 4Y9NA 3NYZA 4LRYA 4F0HA 4L5BA 2DH6A 3V34A 3SJCA 4Z8YA 4WDTA 3IV6A 1QI4A 4D2JA 2GHQA 4IHJB 1NDQA 5DY3A 2JGQA 4GKBA 2YV1A 1XINA 1SCIA 1D8WA 2ZTKA 4J1TA 4QR6A 5CCEA 3W7DA 4GYFA 4Z9FA 2ZWAA 5D3ZA 2YDRA 2GK3A 3WI7A 3DD5A 4LNUA 2PYIA 2D2GA 2WJZB 4UASA 2J7CA 4CN6A 3LVRE 2J30A 2F7FA 3ZX5A 1J9YA 1BA3A 1QE5A 1JPNA 1OLUB 2UV8G 3STCA 1NM5A 5CCBA 3FCUB 1OFOA 1XRMA 4FIZA 3WH7A 1F05A 4UQPA 5C8VA 3W3AD 4V3CA 4UXDA 2D2XA 2OHOA 3BGOS 3FF1A 1EI9A 4EPWA 3NDPA 2VDWA 1RRVA 2W6CX 4CKEB 2G3FA 3P60A 4JR0A 4P4SA 2ZXFA 2FW0A 3F4KA 4EQ6B 3C74A 2YJ6A 3QHAA 4KBFA 4PQGA 3ZE7A 1RJRA 4M6WA 4TLLB 2AH5A 1DAKA 2NVDA 4OUDB 1FBNA 3UNXA 5BURA 4Q4OA 4RSHA 3PQFA 4MLPA 3N2EA 4EANA 4XX6A 2X7JA 1YS6A 1XWWA 4GBED 3BZJA 4IDAA 2LTAA 1EG7A 2J9FA 1A3WA 3MJMA 4BVHA 4EYEA 8A3HA 2WNQA 1OWLA 3E2IA 3W9UA 2O20A 3RBVA 4WQ6A 4J3VA 4F6RA 1KI7A 4QDZA 1CJBA 3TU9A 1VKNA 4RIHA 1Z69A 4HXFB 1KYYA 4MB6A 5HJLA 2R8OA 5BQOA 3IAM6 3ZWXA 3L0BA 1LBEA 2QLBA 1VXOA 4Z2KA 3RW9A 4LZLA 5IAJA 3GLHA 3DENA 4ZCMA 1WW3A 3S68A 2C2WA 1YDGA 3AWIA 5E09A 3NDOA 2R24A 3K7EA 2HTFA 1RNLA 3GRRA 1DJXA 1US0A 1TM7E 1PZMA 1O95C 5EJ9A 4I4TA 4LZNA 2GNAA 2VNJA 1CCWA 3WX0A 2F43B 1EX5A 3CEMA 3D47A 3MN1A 2IH2A 3VNVA 4ERGA 1ADOA 4NC9A 2J09A 3QUTA 4C6IA 3IJ8A 1JLHA 4IRUB 1C93A 1V4BA 3MPOA 4ZVPA 4WK6A 1ZC3A 2IXFA 3LOUA 3FHTA 4BCBA 4YWSA 4XZNX 2CIPA 5TT1A 3CEUA 1NPTO 3EYPA 1W5QA 1OIMA 3BXHA 2ICSA 1NWHA 5LQAA 1EOMA 4HQKA 3KSZO 2G3JA 2IA5A 1DEAA 5ARCA 2A5HA 4OGLA 3ZGLA 5LIRA 3WGTA 4CL3A 1MW8X 1EHIA 5K6AC 3Q2OA 1FIUA 5DTMA 2GZHA 4CNPA 3KZ1E 3JAWB 4W8OA 3HWRA 1Q6CA 1HM5A 9ABPA 4DNQA 5IJ9B 1ZJAA 4RW0A 3THDA 1EJ0A 4MFDA 3PZ9A 3AIRA 2V54A 3KWJA 4O1MA 2FMFA 4G1VA 3NZRA 4FS3A 2C5GA 1TCCA 1UC9A 4F4DA 1HTTA 3E9DA 3GAMA 4W63A 4GZ6A 3L49A 2DM6A 5H4HA 4I9TA 2OSXA 5G4LA 5I51A 1XZHA 4MYHA 3GFPA 1UJ4A 2J9YA 2FLVA 1DKUA 3QTBA 5I9SA 3F5KA 2CHNA 1GZ4A 3O7MA 1DRWA 3IILA 3L1VA 1A0OA 4ETWA 3F6PA 5DX0A 2WXDM 1TUIA 3AHIA 4P38A 4CPDA 5L9FA 3OZAA 2RGNA 4XDZA 4B3IA 5F1OA 1T4CA 2RJ3A 1VZ3A 2R84A 1J2EA 3PC8A 3EIUA 4PR4A 4W6ZA 4NAHA 4MARA 2R1MA 5K3CA 3ZT7A 3DV2A 1S46A 4YRSA 3QVOA 1NT2A 4DRXB 3R0VA 4YLGA 1IPFA 1Y4DE 3W7NA 4E5VA 1SA0B 5G1PA 4YTRA 3VJKA 3EUWA 3RGTA 3KTFA 4DCCA 1EC8A 3KQPA 3UA3A 1ULHA 3RKRA 3IVUA 1ZALA 4HI0E 1XXHE 2I66A 3TO5A 2RHWA 5BSRA 2H7CA 1EBGA 4UUMA 2ACKA 2G8LA 3NNDA 4PYSA 2ZI9A 1ISRA 3GO4A 2IDZA 1SKMA 4MQBA 2CKSA 1N6NA 1G18A 1KM1A 3OPSA 2AJTA 5KWSA 1KVSA 4LJLA 3KVVA 5LWHA 2BGMA 1RYYA 2EGGA 1SXJC 4Q3OA 3PCXA 5ARDA 2HF2A 1JE0A 4DG9A 1W2WB 4LV5B 3DG7A 3EGWA 2EBUA 4L0MA 2QGYA 4EUFA 4CLHA 4UZEA 3FFTA 1E3IA 3UH1A 4K1WA 2YKKA 4XAFA 4UXJA 2FGKA 4DQXA 4H4CA 1JHOA 5B2ZA 1JDAA 4BNJA 3OBKA 1JI3A 2P4EA 1J20A 4RAOA 4ZEWA 3F8WA 4G7FA 3TH5A 4TRRA 5I02A 4UMCA 2HPAA 4ESHA 4ZQGA 1VFMA 5FTLA 4TTJA 1VGAA 2Q9UA 4RZ3A 1LK0A 1MBZA 1E9BA 2JJ2D 5L51A 1E1KA 4HMDA 1U4OA 1XXLA 3R0KA 2EGHA 1GFWA 5T4HA 2C96A 3KXDA 4PFJA 2WVAA 1AMOA 3A31A 3LTEA 2HVMA 4X91A 3K8QA 2Y8VA 2ECQA 5A3VA 4ZT4A 3C8HA 4DCSA 5C52B 4AQLA 2B8EA 1NWTA 1NUAA 3GMIA 3GD7A 3BFJA 1E3TA 4JTJA 4RHUA 3EX2A 1OM0A 4F86A 5A5WA 5AK3A 4ENQA 2XINA 2IXBA 3HU3A 1NY6A 4EG3A 3OA2A 3G5MA 3GNDA 1KSGA 2QBYB 2G9RA 1HLGA 2F9LA 5F2OA 3UJDA 5LA6A 3SM3A 1Z5OA 1QOZA 2DCUA 5G40A 2J0SA 5AESA 4W5JA 4K40A 1KHHA 5K20A 2AE2A 5M7EA 3QFHA 2XH0A 4H59A 3LLVA 2O6LA 1YL6A 4RBNA 1H2AS 3L43A 5IM4F 2XMPA 2IWRA 1EIZA 3GK0A 1LWOA 5FX2A 4KXLA 3UKOA 4KMQA 2Q3OA 1I2MA 4WZAB 3UT5B 4MV8A 4R81A 3BT7A 2WKQA 4QHSA 3WIBA 5DYTA 1Y5XA 3OX1A 3KZXA 1XNGA 3M82A 1I6LA 1JKJB 2E09A 4JKIA 2AZMA 3TEMA 5ALSA 1PAMA 1RYZA 1P2DA 4Q9AA 5B2EA 2AXQA 4H7KA 5JTUA 3G0GA 2IYPA 2O9TA 2OCGA 1J8MF 1U22A 4ALIA 4UMVA 3POHA 2PRLA 4JVOA 2WKWA 5LQSA 4MS4A 4CM1A 2NQLA 5EWMB 2CNBA 4G01B 4ZCRA 1X8CA 3GFXA 2WUWE 3WIDA 3O6CA 4NFLA 4CQLA 3H6OA 4KGZA 2HB6A 3W0KA 4ZI5A 4B79A 3WOVA 5DXYA 2ZXEA 3H2GA 3DI1A 5AVNA 3IAFA 2PTGA 3ZLJA 1FTGA 3PUOA 5DEZA 4I3FA 4D98A 4L4OA 4RA6A 1SCKA 3QITA 1A5ZA 3NXFA 3EC2A 4J4TA 3SRDA 1NFRA 3AEUB 5B4UA 4KVGA 1JDCA 1S2VA 3H7AA 4B40A 4TKUB 1T29A 2OENG 2G97A 1D4ZA 3MELA 1FK8A 1IB6A 2Q8ZA 1J0EA 2JJMA 3KT3A 3N2LA 5KJFA 1BFDA 2IPMA 3UWDA 3UG7A 1S1PA 4Q3MA 5EMLA 3IHLA 2UXBB 4UFJA 1C7RA 2R6OA 3RN6A 4DBZA 1PZFA 3CUJA 1K8XB 3LAWA 2H8ZA 5DHAA 1K4HA 4NPHA 4MEJA 1QAPA 3CU2A 3QKWA 3FN9A 3EXSA 1Z2PX 4AZ0B 1R6XA 2NLYA 2DHQA 2HA4A 4DQDA 2BXYA 4WNCA 1XQ6A 2JFGA 2I16A 4JYPA 4C91A 2ZVQX 4A91A 4H4DA 5ALZA 1QXLA 4IF2A 4MFEA 3P0EA 1GYMA 3REQB 4HPJA 2Q2OA 1DCMA 2R1ZA 1QH0A 1L4BA 4DN6A 4RS4A 3TJZA 1TEVA 3EIFA 2PBOA 4Q8MA 1RMTA 3DWFA 2WCAA 3KRZA 3C2QA 5LNVA 1YWGO 2F8MA 2C1IA 3OMLA 5ULLA 5B80A 2GFQA 5B7YA 1FLAA 4PLHA 2C57A 5I7RA 3QW3A 4Q7JB 4BU0A 2H08A 3BMCA 1IBCA 3PULA 4DO6A 4EB8A 1XDSA 1QIGA 3FWYA 4ZYLA 3VOIA 2FHBA 4XVUA 3SI9A 1OQFA 1Q1QA 2QWXA 3PB0A 3WBJA 1UPUA 3CSUA 5DRYA 4HO1X 3E9YA 2HEGA 4O16A 4ZK6A 1BWVA 3KR0A 2A4KA 2XYLA 3QLJA 1AG9A 3KL3A 3UJ7A 3WGUA 4UOZA 3IERA 2TMYA 3F49S 4A2RA 1UR4A 2OOKA 2VI5A 1EEPA 5ITZA 3P26A 1YGPA 2Q3CA 2DH3A 3UPWA 4KV7A 4OXIA 2JIDA 5LIUX 3U7GA 5BRBA 2D2VA 2AFIE 4HZIA 2V67A 2GUWA 4WVFA 2PQ2A 5AM5A 4L9XA 1TV2A 3L3BA 5AKHA 1O94A 3IEMA 1TWDA 1G7TA 1E96A 5B7NA 1N33B 4FDTA 5K4HA 5ECWA 3KLPX 4CG0A 5JV5A 2SBTA 3EH1A 2UY4A 4EY7A 1JS1X 4YMTA 5CFLA 4IOMA 3KVMA 1V7QA 2FQIA 3RF7A 4PE5B 3AUJB 1GWJA 4YJKA 2WKPA 3G77A 3KLLA 1II8A 1EGZA 2YNMD 4BQ4A 3PUGA 4EDHA 8RUCA 5FBVB 3BIFA 2ZYTX 1DOHA 1ZISA 2ORVA 3VO8A 1YBHA 1Y7LA 4FZRA 3SSNA 1JYVA 4K7JA 1TB4A 5EWLA 1E59A 3T42A 1T3SA 3NWJA 4I7UA 1R5JA 3UD6A 2C1XA 2PGFA 3WLHA 4KWTA 4RESA 1FSFA 3E9RA 4JUAA 1V7AA 4LRSA 2NQJA 3IIZA 3FYUB 1GILA 1FZQA 3PDJA 1YZLA 4I19A 4LDPA 3PFBA 2B99A 3FKKA 1BPLB 4TQGA 4GQRA 2XHYA 2V9DA 4AMUA 2A35A 4F8YA 2P4SA 4PYRA 4K26A 3AX6A 2FEWB 4X92A 2AN4A 2VDNB 3HWSA 3ZU2A 1Y42X 4I14A 2QUTA 2PH5A 1X39A 4F0SA 3BSWA 4PC6A 1WXFA 2O2EA 3GEPA 2GOYA 2E5DA 1WL8A 1U9ZA 1LL6A 4P3YA 4JNMA 1A9XA 3MOSA 1PJBA 5CJNA 1GA1A 1DC5A 4OIFA 4K3ZA 4R9RA 3PZBA 1L4MA 2PEVA 1RI2A 2GPAA 1G7VA 3GXTA 3VIOA 2P8JA 3IDSA 4LF9B 2HDWA 1T34A 1C2YA 2A88A 1ZJ4A 1FTSA 4PUEA 3Q7IA 3PUZA 3CG0A 2I71A 3HB4X 4PLYA 3ANNA 3PDCA 3O95A 4GJJA 2WBLC 1EFHA 4D5EA 3IA7A 4HGPA 1T43A 1NDHA 3HI6A 1PV4A 5FAKA 1I0ZA 1LVUA 1CRLA 1RH9A 3T1OA 1PQUA 4B15A 4MYCA 4PPYA 2PUDA 4XKYA 3DF9A 3VKCA 2C4TA 4QJBA 3GMSA 1ECBA 4LALA 2ZSDA 3OJCA 3THXB 5B5SA 4N7MA 1PLKA 3VDRA 2WBKA 1O1HA 3BE4A 4MPTA 3UW6A 1YB1A 2XVZA 1E1YA 5I2UA 2WLSA 5SY9A 1XKYA 2Q50A 1NXXA 3MTQA 4R7GA 3CVWA 4JP8A 1NRWA 5F9MA 2YCKX 4RK8A 1NHGA 1CWYA 3RT9A 2CWNA 3HACA 3P2OA 1LXCA 3EOAI 2J31A 4DNMA 2P3OA 2PLFA 1VEPA 2YWGA 3O8OA 1Q6EA 2HAEA 2J9XA 2ZBVA 1NR1A 4M8SA 1ZVMA 1D9EA 3VOFA 3CF0A 5TQ0A 5CH5A 3ONFA 4L65A 5IJWA 5LNRA 1Q7TA 4X2PA 2PLMA 2SCUB 4R7TA 1J00A 4L4UA 2XODA 3MCAA 4TWJA 5CSSA 5G1NA 4IHJA 2AEJA 3WBAA 3MJHA 4NRRA 4L5ZA 4GKJB 4F66A 4HSGA 1ZBWA 1UP6A 5D7BA 2E2WA 3DGFC 3UOAB 4AMVA 4WNAB 2A0WA 3UBPC 3A23A 4AWEA 2A9FA 3MBKA 1KR0A 4PGGA 1TK2A 2ETXA 2GWGA 1IHYA 4MO9A 2VPPA 4EX7A 3B0PA 3C1TA 3DLIA 3UW3A 2X9QA 3L8CA 3ZZMA 4HNOA 1FOBA 4OXXA 5DW3A 2NVBA 5D87A 2FUNB 5CM8B 5M34A 5EQTA 1LBQA 5ESWA 5ALVA 4QAWA 3GDGA 4KI0A 5EMMA 3I3DA 2PUBA 4TV9F 1TQXA 4GLFA 3RHTA 1GZ6A 1S2OA 3WMCA 1Z0IA 3P9ZA 2XTAA 5CT9A 4OPMA 4DMGA 1T4CB 1V5EA 3OOEA 3BOLA 4DLWA 3C5CA 5CHYA 4BQQA 3SXUA 3LX8A 2WJWA 3IIEA 3FDGA 2F9RA 3LRKA 1E94E 2ZRIA 3UWUA 3MP5A 2C9YA 3I9V1 4DSOA 6A3HA 4JQYA 1XIHA 1DKWA 3AF6A 3CJPA 3VI4B 2O6HA 1UKAA 2W6ID 3GY0A 1ADJA 1NAL1 4IJQA 1CTNA 5DBHX 5F12A 1JV2B 1BGGA 2YWFA 4Y2HA 2W66A 3VGEA 4RPJA 1WCIB 5IVDA 4MVYA 2BDEA 3DGBA 4PGAA 1YAHA 3TRKA 2Z6UA 5C1BA 2DUJA 3T78A 2WM8A 4BV3A 1Z16A 2IKIA 2NU8B 5JS8A 1Q63A 1KZYC 1ZNQO 3DP7A 1OWQA 4J90A 3O4HA 3HYSA 2IF2A 3N8KA 2ZXDA 3RCNA 1E0JA 3I42A 2V6GA 1ZMRA 3ROXA 2G71A 3AFGA 3GDFA 3BMOA 4HSOA 4O4JF 3W8FA 2DUAA 4PTZA 2CW6A 2JQXA 1UMDB 3T7JA 3M4HA 3HUUA 5LBIA 3DNMA 4L8GA 3RC9A 4M7PA 1OFIA 4TXHA 1B4EA 5SZJA 1P81A 1OZQA 1SVSA 3UY7A 1GYNA 3CH4B 3S5ZA 2VWTA 4YP7A 4BUJA 3UMJA 4R51A 3UR7A 2GUBA 2Y0DA 3EAQA 1VIZA 5EKXA 1ECEA 3IC5A 2NT3A 2NU6A 4TYMA 2HMUA 1BXGA 1E0TA 4QKQA 1RZRD 4DM2A 5K01A 1NDUA 4LYEA 1ZH8A 2XFWA 1BF6A 3BRWD 1U3DA 3GVVA 5ER9A 3UG3A 4HVXA 5L3SA 4E31A 5K8UA 3NW9A 1D07A 5IJ0A 1U90A 3RR4A 3F73A 4NCIA 4JDYA 3C48A 4K8GA 2L2QA 4ZEPA 2GFTA 4FX5A 3AI3A 1NP3A 5E70A 2AGKA 2P6OA 2QT9A 1ZICA 2H00A 3WRVA 3AONB 4MXDA 3IAS6 3GKFA 1M1XB 2ZSEA 3I6EA 2IUSA 1H61A 2VH1A 5FF7A 1L2TA 1UA3A 4MW6A 2VBCA 2POQX 2IP1A 1S1MA 1TUBA 2WM9B 5CZ0A 1GUAA 5F2GA 2UZ1A 1C0LA 1D7KA 1ACMA 1RYMA 1VB3A 4IFEA 1E0WA 1KAEA 5FL0A 2F61A 5EZSA 3UVAA 3VC5A 2D3LA 4GMHA 1KBJA 3TQIA 1YS7A 3Q87B 2XUCA 5D2WA 2R7MA 1R4MA 4NWIA 1ZLXA 4HFRA 4BFZA 2GM5A 4ZVLA 3WBBA 4N0DA 3QY7A 3JASB 1V7ZA 2DC1A 2J3KA 4ZZIA 3OCJA 2G0TA 4X1IA 4WBXC 3K8ZA 1U6IA 3HMKA 5F23A 5EB8A 1PQ4A 4GFDA 5G4HC 4TWRA 1AVTA 3QEJA 1WUJS 4GOND 2B7BA 4C7JA 5DHQA 3DFUA 5IXYA 4UEJA 4EGJA 2Y0PA 4UU7A 4DWJA 2QA5A 4FINA 1SGWA 4WLVA 1KZ4A 1P9RA 4L6AA 3DMDA 1FWIC 5A0VA 3WJSA 3UG5A 3MMZA 1SWVA 4HEA6 3GLHB 3NUZA 3U7HB 3HRIA 2VSXA 3V1UA 1SQ0A 1PNVA 5EXPA 2P9HA 4QDPA 1OFQA 4O17A 3QFRA 3LQLA 4G1UC 4AICA 5KYKA 3SVLA 4V3BA 5LXXA 1KRMA 3O8LA 1C1XB 4UMAA 3LSYA 2CUKA 4HAUA 3K2EA 3XISA 2HK1A 3CX8A 5K99A 3HJGA 2ZBTA 5H1YA 5HRCA 4B47A 1LRQA 3HB0A 3AR6A 5FO1A 5E4JA 4IGKA 2NOAA 5IDXA 3CPJB 3WDMA 2ID4A 1E7QA 2Q09A 1VHQA 3TYAA 4IQJA 3LTYA 1A4UA 2IGBA 3TQ0A 4G67A 1PO9A 5D51S 2AF4C 1WCYA 5G2WA 4EAYA 4G56A 3SW6A 3LPLA 4YAJA 2QTAA 3H12A 5ADVA 1KEPA 1UFKA 2BOFX 1OMOA 2HMSA 4UBIA 4OH7A 1SFRA 1T9HA 2I2WA 2JHPA 2WV8A 1FYXA 4JBXA 4BMPB 1R87A 3VIGA 1XRLA 1ZM2A 3T7IA 3W4KA 1E5JA 4B3GA 3V1KA 3I58A 1L4LA 4BY9E 3HMQA 1ODJA 1WDPA 5AW1A 3OA0A 1QWGA 3WDQA 3QBTA 4HZUA 1T1SA 1R15A 2QUAA 4AXXA 4JENA 2ZRMA 3H53A 4U3JA 4LVAA 2OT1A 1R3DA 1OB2A 1A77A 4B81A 3BCDA 4EPRA 1B3BA 1DE5A 2HCTA 1JCMP 1AD2A 5L6LB 1YRYE 1L5LA 3T4PA 4FLFA 1F6BA 4A8NA 3V5OA 4ZI3A 4GJ1A 3ZN2A 2EIXA 2AD1A 1GFSA 1OXKB 2X6TA 1M7GA 2WVTA 1EWYA 1ZD1A 1RXOB 2CHQA 3VM7A 1YS2X 3AGQA 2L42A 4X24A 3SAZA 4ZP1A 2JJQA 5ELLA 3WB2A 3A9VA 4X8OA 4K0RA 4UDNA 5AUNB 3UF9A 3K9NA 3LHVA 4ENWA 3BREA 1Q16A 3IIKA 2GETA 1I0BA 3DAYA 3OI7A 5BNKA 5CFMA 3VR6D 3P2JA 3QC0A 3ITDA 3B0VC 4DANA 5AICA 4AEEA 1TVNA 1RYDA 2RGEA 3EPKA 2YZRA 1Z0KA 2DULA 2JH8A 4ZOLA 1P74A 4AJ9A 4PYNA 4YHGA 2D00A 3UCCA 5ADWA 2OKTA 3A5VA 3LDVA 4JBGA 1SBQA 2ZAYA 4Z86A 1IUNA 1A4RA 3C4QA 4L9RA 3UBTA 4KFPA 4HLCA 3U1VA 2DSZA 2OM6A 1AK1A 3ZV5A 2A9KA 4RIIA 5HKLA 2WSYB 1PEDA 1TE6A 3TM4A 3PLRA 1WG8A 4ZJZA 1H62A 5FAXA 1AIPA 3TQFA 3ADDA 1GLVA 1ZLYA 3L8DA 1WDTA 1I6MA 2EPOA 4FAMA 1MNSA 4WLNA 4GBDA 4R40A 5A3JA 4BDSA 3H22A 3ABSA 5IHXA 2Q46A 4LK3A 1U8TA 1P0CA 3PIRA 1WBHA 2MMCA 3OFKA 1BE6A 1A9PA 1EHAA 1NBAA 2NADA 2OCKA 2EAUA 3R2GA 5HR5A 1AQNA 4UCGA 4Y6GB 4M0EA 5HIIA 4FR1A 2VDOB 2O59A 2WG0A 3S1UA 4IZOA 1HKHA 3ZHOA 2AZDA 4AIIA 5FWNA 1XRPA 3K13A 3PZRA 5LXTA 5EA2A 3OY7A 2JCSA 1TKAA 4B6RA 3FJYA 1J9ZA 2J4FA 2J0QA 4Z1YA 2NUAA 2FWJA 2VHJA 1XSEA 2WCSA 3PGKA 1V3VA 3I45A 5HIMA 5IBQA 2OFWA 4G26A 2PGLA 4JHMA 1XN4A 3R3VA 3H83A 1RBAA 1FRQA 2W27A 1PKEA 3OKFA 5CT4A 2Z3WA 2AYXA 1R8JA 1JG4A 3WQOA 2X4IA 4S3DA 5K4ZA 3LA4A 1EDZA 4RIFA 2YJZA 5KNCA 3L65A 2JGMA 4HCJA 3H55A 3A9IA 5K4XA 4BHYA 2LNDA 3QEBZ 2FQXA 1UH3A 4INJA 3ZWVA 3HGRA 4O18A 2IUZA 2OZKA 2GKSA 1GZJA 1VMEA 3ADBA 4KX3A 1LDBA 1JG9A 4Q6JA 4HU4A 2ZYVX 5H91A 4YQFA 2BHSA 3HKCA 5E6RA 5FL7A 3DDHA 1E9DA 5TGTA 2VNSA 3BFVA 3EBLA 3PQEA 2QVCA 1YJQA 3GJ7A 4R83A 3W2NA 1TECE 1NMXA 4D4HA 4ZBCA 4QHRA 1VHTA 3Q72A 2R2AA 1VI6A 4JLNA 2GX6A 4N3AA 5CFPA 2VENA 1VL1A 4BAZA 3MANA 5AYBA 3APYA 2C98A 1YDFA 3N13A 3HGOA 4PG5A 2PRSA 4FXRA 1O7JA 4PTDA 3ASVA 5T7BA 1QOQB 1Q44A 5MHTA 5I7EA 1FY6A 2HCVA 3V2UA 4D26A 1QO2A 3TZ6A 3PVZA 1J8YF 2H2GA 3T1VA 5C0OE 1ITCA 2CHOA 4JUIA 2VA9A 3GKAA 3LG2A 2AUTA 4I9HA 5LSAA 1RVDA 2RHOA 3J81k 1GV1A 5CFOA 1QO9A 3EA3A 3ZVIA 4MS4B 2JBHA 4WOJA 1JIXA 1R3WA 3TR2A 3B2NA 1WX1A 2D69A 1E5XA 3ZCRA 1MQRA 1NV9A 3PPXA 4O10A 3M6MD 5B1IA 4YUZA 5JNWA 1E72M 2NUPB 4RE4A 4OHPA 2ECPA 1KYIA 4G84A 1QFJA 3IQWA 1CGUA 1OCJA 1XQ1A 2DT8A 2DU8A 3Q6NA 3GTIA 1EFTA 2B98A 4K6OA 3WYGA 5IABA 4R1MA 4ZQBA 3TE7A 2FPRA 5EMNA 1QATA 1LG1A 2B5WA 2ISSA 3LPCA 2HSJA 2A58A 1JU9A 1LWHA 2D1QA 3WQWA 4EIVA 4IXNA 5K3AA 1N6PA 1YHTA 4INPA 1Y1QA 4EIWA 3H4XA 3W7RA 3SZ8A 4Q01A 1FU4A 4Y9AA 3MAJA 4PS1A 1YBQB 4YT8A 4RL3A 5I79A 2PJDA 4AXKA 3E0VA 1NPYA 4D02A 4P31A 4REOA 3PUIA 1DIOA 4AEOA 4UTFA 3TNYA 4PRTA 1LRKA 3SCQA 2RGDA 2ECKA 4C6CA 2WK1A 1Y8CA 4M89A 4ZCSA 2CWDA 2JZNA 4TMWA 1J0DA 3IKMB 3ZZTA 1PVNA 3G5LA 1ODSA 1J7JA 4JC4A 3PE4A 3SN0A 2DFLA 4E13A 1R6TA 4OLAA 1GPYA 4MDHA 4RVFA 3TFXA 3KU1A 1NP2A 1KS9A 1RBLA 5JU6A 3IRVA 4A1FA 1LBIA 3P7MA 1QI5A 2I5PO 1SO5A 2ZDRA 4M46A 3OO2A 4NZFA 1BWKA 1BEUA 1QG2A 4TXJA 3HXQA 5AJVB 4YCOA 2D3NA 4IEIA 1U0OC 4JUDX 2CCRA 3I0NA 4OB8A 1XLAA 5HYVA 2C83A 3QPCA 5FLKA 3I1IA 1MO6A 3VXKA 2QLYA 1WUEA 2HR1A 4G89A 3B3DA 2QUVA 5AKXA 3AK4A 1G2IA 1FH7A 3EFEA 1H2YA 3E3MA 2F67A 2Z9DA 3SGGA 2RAFA 1WXHA 1FMLA 3KETA 1H2XA 2WJ3A 4Q8WA 5K4AA 1HGWA 1SKUA 1QFYA 4KJXA 1USWA 3IIMA 2R5WA 2W00A 5TVKA 2O2YA 2YYZA 4C3OB 3MUIA 3GFZA 4YV1A 1L6IA 3CZ4A 1NN3A 4HB0A 2IGTA 3QU9A 3CAVA 2VD8A 1ZSYA 5KDLA 2UUAB 1XP8A 3UK2A 1H22A 3PWKA 4E32A 4FWIB 1THZA 1U9JA 5GONB 3UIEA 1F8XA 5CUQA 4HQ0A 5FUMA 4RTOA 2ZR0A 4Q8OA 1DAFA 2IP4A 1V1RA 3WB0A 4K6HA 1BU8A 1LDGA 2BV3A 5FORA 2VRKA 2QQ0A 3MD9A 5TAOA 5CLJA 3ZHBA 5BY2A 3MS8A 1ZU4A 2Q7XA 1XJWA 4N4AA 4A22A 1TA0A 1JQKA 1II8B 1PF7E 3R58A 4R6XA 4C6JA 4AP6A 3U0HA 1VZ2A 1UP2A 1X1ZA 4JTCA 3RVRA 3FDZA 2CE7A 3GXMA 4GM4A 4KN9S 5I4IA 3A05A 3FLUA 3GZ3A 5DBEX 2A57A 2XFRA 2OXNA 3SCTA 4F0MA 1DTSA 1GEHA 4E22A 3DM5A 5E3JA 4GKVA 3ZJVA 3ESCA 3WD1A 3PXCX 4NVTA 3VU3A 2NG1A 1VYPX 3JTMA 2RKBA 1Z7WA 4O1HA 3I73A 3POCA 3IUMA 3PPIA 5DTIA 1LDCA 5BV7A 1VJTA 3ZDAA 4G2DA 4DB2A 1TKRA 3OMXA 4PYOA 4YYFA 3IJLA 4RYLA 3CVOA 1DIHA 1SRRA 5BW6B 4WHMA 4AMZA 1QG6A 2AQIA 3QE2A 1IWPB 4LQCA 3M1AA 3G1AA 5C3MA 1FUUA 3RIKA 4XB6B 3BQNB 4KRXA 1MX3A 3W00A 4AZ3B 2FPOA 1ZGAA 1FUYB 3KQSA 1DT5A 1KFBA 3CB4A 1T96A 4H8UA 2HA3A 5HKKA 3K2GA 4LPKA 4NJMB 3MMUA 3JARA 4ZR8A 1RWVA 3RMEA 1RKBA 3GSMA 4YC7A 2YS6A 2XUOA 3VZXA 2PR2A 3GVPA 1UWQA 2H1OA 5HQJA 3V5NA 3JQGA 2GBGA 3VIHA 3SBFA 3THAA 4UFKA 3IURA 4NAFA 2YB1A 2WEKA 4NV1A 4XAYA 5GJCA 1TMYA 2DQ4A 1J0CA 4BKNA 3DCJA 1FRBA 2ZICA 3UQNA 3EXFA 1XVVA 1RJ9B 1A5OC 1RA0A 2DPEA 4ZVVA 2MINA 1VC4A 5C1DA 4UOJA 2IBSA 3AEQB 4MZYA 3BFPA 6GPBA 3UBMA 1HJQA 3II6X 4XKYB 3P9YA 2R5NA 4LWZA 1FUEA 3OIWA 1Z3NA 1QIEA 4EGQA 4HUTA 2WFMA 3BURA 2B83A 3TIIA 4F9GA 2BMFA 5MF6A 1E20A 2OLSA 5JD3A 4AISA 3KVNA 4O14A 3V5FA 4Q3CA 1AZ1A 2E25A 1LBSA 4MMXB 3LERA 1G1AA 4QU5A 2IQIA 3GJ8A 4PRKA 4FXSA 2QMJA 2CLFA 1UINA 2PU1A 1FP8A 2VPQA 13PKA 3ZZ0A 4GOJA 1QFMA 1K98A 4E03A 1XRRA 1SJDA 1EA0A 3JCZA 2AG1A 4FFWA 1QP8A 1QE0A 2CSXA 3HFYA 3V7UA 2VYQA 1AF4A 1ZZEA 1CUCA 2IOFA 3JW8A 4ZVTA 2DCMA 2P6NA 3L84A 1V5XA 5DBOA 3V0UA 2PRKA 3IXLA 3PRKE 4GJIA 4O4HA 5JQ9A 1XBYA 3PE3A 4B7ZA 3VIJA 1TMOA 4AK9A 4GXPA 1N34B 1O4WA 2QUMA 4UTJA 4DTIA 3WF2A 5K4GA 2OX4A 1I3KA 3GB6A 1T25A 3FW1A 2O2JA 5TEVA 2HHJA 4B6PA 5B53A 4X60A 5E3HA 4DWDA 1VCVA 3RAPR 4XGRA 4PB5A 2VDIA 1AMYA 2ZIZA 4DIUA 3NWBA 3NEJA 1ZUD1 3MMTA 3LVFO 4UBKA 3V8NA 3PB2A 4L0DA 3P9SA 4DXVA 2ZIWB 2I2FA 4W5UA 2VC2B 4KRFA 1FNDA 3WK0A 1ZNWA 4QIHA 4EYSA 1CGVA 3WKEA 3PUHA 1SURA 1OYOA 3N6QA 1C0PA 3GVIA 4LCQA 4TU1A 4Y18A 2X7HA 3IP8A 1UC4B 2WMFA 3ZWDA 1HFJA 3EVNA 1KZ9A 3DC8A 3T7RA 5D2TA 3PI7A 4RPGA 3GAYA 4X94A 2O0TA 5IFKA 3ARYA 2BMEA 4YCDA 5BPHA 3KAKA 2MNRA 2ATVA 3L4VA 2P0AA 1ML1A 1MV8A 2QL5A 2EATA 2FZMA 2XU2A 2AHRA 3ETCA 4PSAA 2O57A 3DE3X 4PLPA 5M04A 1DWOA 4AURA 2YIDA 2BVNA 2R1UA 2Z56A 3VYTB 5AXAA 3W1RA 4RY8A 4ZC8A 3L18A 1K97A 3EDFA 3H9QA 2V96A 3K2QA 4ACZA 1P6QA 1DRUA 4WZAA 5D3MA 3GXIA 2GRUA 2VJBA 2PDMA 5JSYA 3WO1A 2Z7KA 2VYVD 3DE6X 3JVAA 3U61B 1AO0A 1K86A 2HNEA 5KNDD 1ZBKA 1K4GA 4US0R 3OUUA 4E5DA 3GBVA 1ARZA 5C7YA 3KBWA 4B5NA 1E5DA 4UNKA 3TBHA 2LIVA 1ISZA 5BZAA 2WU8A 3WNVA 3NAVA 1ZQ9A 4KXVA 2JGDB 2QLFA 3IUYA 1T7LA 1D2MA 5BRPA 1QBKC 4KQWA 4XLLA 3SURA 5F2LA 2UYQA 1N2CE 4WBNF 2WAAA 3W02A 2QJJA 3OZYA 5JH2A 3SQXA 4UVEA 5DK4A 1YJAA 3NHJA 4HDRA 5JZMA 1SXIA 4TTPA 3TC6A 1EBUA 1ESNA 2YW2A 3T9BA 4TT3A 3KB2A 2ZM6B 1IHDA 4M1OA 4EA7A 5DYGA 2QE7A 1LQUA 4NCXA 3GIYA 3DGRA 2YDAA 1ZJZA 3USES 1Z4OA 3UOWA 3B6EA 4LZPA 3DOEA 1SIUA 2QVLA 1M2NA 2WJEA 2DSTA 3WBEA 1IBMB 2QCEA 2FMIA 4QJ4B 4K6KA 1FLDA 2BEKA 1E99A 5F73A 3LNTA 1ANKA 2H0AA 3C41J 2PUJA 1VL8A 3KX6A 4P35A 4HBZA 4E1AA 4EI9A 3UAWA 5ENVA 3HMJG 1M5TA 5CRIA 1HPLA 3O3OB 4AO8A 5K8CA 4I55B 5BXYA 4X1YB 4JDUA 2D23A 3LLXA 1YNSA 4UW9A 1OXBB 1V3QE 1B00A 2NYRA 3OZXA 1NMSA 5EXEA 3T99A 3L4UA 4QS6A 1N2HA 5BUQA 5TX7A 3BMWA 3WJWA 1W4RA 3U16A 6AT1A 4DTCA 3BOXA 1QNQA 5FTKA 4LYKA 3T0TA 5TV2A 3IALA 3ZDEA 1VI2A 3TVAA 3IUJA 4FNSA 2YWXA 2IPAB 1KP2A 1XKQA 1EFVA 2NO7A 3D8SA 4ER0A 4V0NA 3KL2A 3G13A 4ZHQB 1PR9A 4E5YA 4C6KA 4AZTA 4Y6GA 3BLOA 2C4VA 4DF3A 2J3IA 3KPJA 2HWKA 2FZDA 2HNHA 3RSGA 4HGXA 3KHUA 1QVBA 1PX8A 4IDGA 1GG0A 2XKAA 3CT6A 4S1TA 3LQGA 3T7AA 3WSTA 4N0MA 5AC8A 4GO9A 1RBYA 3WWYA 4D9KA 1EIWA 3JD4A 2F3SA 2R00A 4TV8F 3OFNA 3GHYA 3C1UA 2FI1A 4MI1A 1UKOA 1V2HE 2BC9A 4UD6A 1PQWA 1VM6A 3NO1A 2ZIDA 2HU2A 1F6WA 1NXWA 3LENA 3C6XA 4UPVA 5H9VA 3CS2A 2FWIA 3VZSA 2YS7A 4HOWA 4OQZA 1B76A 1L7XA 5A6JA 3C8UA 4MP3A 5B1YA 3IRUA 3I9FA 3VILA 2GXAA 5TLSA 4XIYA 4X66B 4NPAA 4HV4A 3R09A 4CD6A 4MJXA 4OO3A 1WB9A 1E3ZA 4CCWA 1WB5A 1IXQA 3V2GA 4GLLA 4E6EA 2ZYFA 5JYBA 5HUQA 2HPVA 3RYSA 1GZ5A 3W5BA 2VF5X 4C5ZA 1T6YA 3S81A 1NWUA 3GUCA 3ZV7A 4IJ6A 5CPNA 2XQVA 3ZVKA 5SY6A 1ZAKA 1NWRA 2JJ8A 3UKDA 4IQEA 3GDTA 3NYRA 4ZYXA 4FFMA 4IOTA 4ZQCA 3EISA 5JCOA 4EGSA 2DY0A 4IGHA 5FAJA 1CZ1A 5KVCA 4OXKA 2AMFA 5FL7D 3P5SA 4M8NE 2QF7A 2JKEA 3ZBPA 2QT3A 4KIFA 2EQBA 4Y0VA 5GY7A 2ERYA 1VSQA 3D3AA 2REOA 4EKIA 1SZRA 1XRNA 5DGXA 5HCUA 4FPSA 3I09A 3ZU6A 3SF0A 4PEKA 4RF3A 3TWAA 2Z1XA 2CXOA 3IV9A 4WDRA 1Z7EA 4QUGA 4MYDA 4FA3A 5EKUA 4CG1A 1W7AA 5IKOA 5FEMA 2HV8A 4HWGA 3TFCA 1WY7A 4Z1CA 4A0SA 4GPEA 4LUCA 3EXAA 4DIAA 2E5CA 3ESRA 2BZ0A 3I2IA 1U98A 3V3WA 1SXPA 3LOQA 4ZDWA 3QIAA 5IJAA 2VKTA 3NWRA 1T6NA 1O0CA 2I7TA 2PX0A 4RPLA 1V5IA 1W581 4OZOA 4LTNA 4PCSA 3HCAA 2R65A 4JIEA 1R0ZA 2GSHA 4MS1A 1IYZA 3FN4A 5A6LA 3T8LA 4FFSA 2YVQA 4X3CA 2CJWB 2OVFA 4JWTA 4H0FA 4MAMA 4YTTA 4MY1A 3KS6A 5JASA 4B5TA 3CLKA 4NZCA 2RDUA 2G9ZA 1KOJA 3M1YA 4Z0TA 1Q3KA 4RGVA 1CPUA 2NQTA 1KGXA 3PJFA 2ZT7A 4QS5A 1LUCA 1AKMA 1AUXA 2JARA 3L40A 3RUCA 5FI8A 3DFTA 4OMFG 3IAEA 1A0EA 1FXSA 4G25A 3AOEC 4GPAA 3S1LA 4X9YA 3QUQA 2WB5A 4Z51A 1N2JA 4EENA 1AL8A 3TTEA 2JCYA 2XITA 4C60A 3JQCA 3H5WA 4QVIA 3B89A 1XZDA 2A59A 3SVZA 1NW9B 3K05A 4BL5A 4I1YA 1DWIM 4MKHA 1EGAA 4QYIA 3NTRA 3A3OA 2FPVA 1L7PA 2QZSA 2ZIXA 4DZRA 1JUKA 3FDKA 3ONCA 1GL9B 3RT7A 1GOMA 1GGJA 1E56A 2WSPA 2DJIA 3OT1A 4NDAA 1EX7A 2H51A 4O2BB 1RQ7A 1L5YA 3NKLA 5IUNC 4RGBA 4XEUA 1KMHB 3M1LA 2PH7A 5A2QA 1F3TA 2RIPA 3FYCA 4OCZA 3QRWA 2FJKA 2WMYA 3TEJA 2A1TS 3EPMA 2GAOA 4Y2GA 4E8DA 1P8JA 2OXEA 2VQFB 4QZVA 5A3QA 2XUZA 5DHRA 4YAIA 4F04A 1XCBA 1I51A 2JHGA 3ESAA 3HO8A 5SYMA 1FFGA 1GV0A 4PZZA 2BMAA 1T41A 3KG2A 4Q3LA 1YTEA 4ZJUA 1FQWA 4AS2A 1SVKA 1A5KC 4NHEA 2IYZA 2BXVA 1BSLA 3HKCB 3VC2A 1CTQA 1MTZA 2XWSA 4D9GA 5DBGA 4NOJA 1DTUA 4QPCA 3DLBA 4H08A 1PEAA 5J9FA 3GQVA 4F6LA 4TXMA 4YRJA 3AOGA 1TKKA 3CFYA 1OSNA 4LBVA 4R1TA 2OMEA 1VF8A 3NPVA 2VAXA 4RY2A 1JG7A 3MJTA 3SIRA 3UWVA 3IS4A 2QYGA 5CC5A 1ADDA 4QAQA 1BFUA 4GOOD 3GNOA 2PBGA 4FUTA 4U6SA 3D6UA 3GM8A 1F9AA 4RF2A 3QBJA 2XA2A 3ZVHB 3EDYA 3CC8A 1YDOA 3JR3A 3FOAA 3EOEA 1GAXA 4PPQA 3ABQB 1P4SA 2DXIA 4OHYA 4DKJA 3TW0A 4YRRA 3EY9A 1KQGA 4LWPA 4CKWA 3P8ZA 2D1FA 4JHXA 3GWZA 3VIFA 3TI9A 3PBUA 1TIKA 3H4VA 5AK4A 1QVZA 5GJNA 1BRLA 5I3JA 1W5OA 2ZI6A 5E4TA 1MVNA 1F14A 5LNWA 2RKWA 1QJWA 2XE8A 4P58A 1P3DA 4FN4A 3LT1A 4E0BA 2VUNA 3I2KA 1EX9A 1KC3A 3C1AA 5TPZA 4GIEA 3C52A 3NCTA 2C92A 1UFRA 2QR3A 3S46A 1JUBA 2GM3A 4AZVA 1SULA 4HLUC 1RWKA 4JUFA 2QTHA 3L1JA 3U7FB 1ECQA 3K20A 1LYXA 1XEAA 4F72A 3WICA 4KO4S 2VCHA 4LBRA 1HORA 1TRHA 4OYYA 4E0CA 4BPRA 1QPBA 4LYFA 1KC1A 1E15A 3HKDA 3AR7A 4J0HA 1UKQA 3PGLA 1RC8A 3IIOA 4LGYA 1DDGA 2NNWB 3KZPA 4FMDF 1L8LA 4FX2A 3CISA 2YOCA 2HREA 1ZAIA 2HCRA 4R8LA 4URIA 1LFDB 4IUYA 1XTBA 4V1XA 3VC7A 2JD2A 1ZOPA 3ZGXA 1YHYA 2JFOA 2RH5A 3EUEA 3FPKA 1V3UA 5ADHA 4MJZA 4N6FA 4I5UA 3D6AA 3GEDA 3E1F1 1B0PA 1WCXA 3KXIA 3WISA 3VVBA 3PVCA 3V36A 1HUVA 3ZVNA 2WWHA 1JJBA 1V77A 1ENYA 1U5AA 2GVGA 1ZK0A 5A3RA 4RVCA 1DBPA 1WJGA 2V0GA 4QARA 4IICA 5H80A 3NV9A 3I0MA 3K6SA 2VELA 1EUCB 2BFEA 1HF3A 3GG8A 4IJBA 1M7XA 3HDJA 1U3WA 4WCFB 3QMSA 4S0ZA 3F74A 2M6SA 5T91A 4ZVOA 4JIIX 4AUNA 1JA0A 4LS1A 2F6XA 1IIGA 4NOKA 1VIAA 2IPOA 3HK2A 3WYDA 2ZZ5A 3BKWA 4PTVA 4G0NA 2WIBA 3VNKA 3HKDB 1A3XA 4JIHA 5COAA 1AGNA 2FUEA 3ZWOA 1CCWB 1M34E 3H4IA 2OSBA 3ITYA 4PZYA 5AIBA 3CPRA 3SN4A 5BXSA 4HTFA 1KY3A 2E5FA 4DMHA 3U17A 1LLWA 1T0BA 3QE4A 3KL4A 1EUZA 1CY0A 2VZOA 4L4SA 5IPFA 2IQTA 1XK7A 1WQ5A 5HA5A 4H7CA 5I6DA 2F2HA 4NU5A 3Q2KA 4LFBB 1G8KA 4GKLA 1OPXA 1N6LA 2IYXA 3B97A 1N55A 1W3NA 1RLTA 1R1DA 2EKBA 2VNHA 5CFRA 1QGAA 3TLBA 1SO4A 1EVEA 3CR8A 1VPQA 1BHQ1 2HZBA 4Z9YA 3QYAA 3FCXA 4K36A 2IXTA 3TR5A 4FONA 3KJZA 1GVSA 5LXEA 1UXKA 3WNLA 2QMQA 2JC3A 1OIFA 4QJ1A 3I32A 1ISXA 4O59O 3VVGA 1IEQA 3OQIB 2OG1A 4NZPA 3FVVA 3GVWA 5JQGA 1CY2A 2C7GA 4ENUA 3ZQJA 2CW5A 3AIMA 4HH3C 3REFA 5I07A 2UYYA 1YPFA 1NMEA 5AW3A 3VYUB 3A47A 1Z63A 3OE5A 3U48A 3T4EA 4DIDA 4CD4A 3DAOA 1S1CA 4D3SA 2M6KA 4MUNA 2Y3IA 5A5VA 4EI7A 4QNWA 3U3RA 2IOHA 4GMGA 3W23A 1CQIA 3LI0A 3SLRA 4C0LA 3MB5A 1XAHA 1JSCA 2PX2A 2HT6A 1F73A 1BVRA 4PMJA 1LLFA 3KB1A 2O7QA 2P9BA 5AKJA 2Y70A 1T8UA 4ER7A 1AJ0A 5FOWA 1BD0A 3U9IA 3O1NA 4C7KA 1M2WA 2ZRNA 3R5SA 4O6VA 2I9KA 2BONA 1ISVA 2JLSA 3H9JA 1L7OA 4OD0A 1NE2A 1O8CA 1P5HA 2P69A 1LEHA 5K0JA 1TFVA 3S5NA 2PYDA 5ICCA 1NSTA 1YVUA 4QGSA 2AFHE 4B9ZA 2MUCA 4QO7A 1KVRA 3FYUC 2ZA2A 3UCFA 5D3MB 1NLMA 1XLEA 4FIQA 3I04A 4L57A 2PD3A 2GCIA 2VF2A 2EW2A 3L0PA 4Y8EA 3M33A 3P62A 4ARVA 3DEZA 3PF8A 4ZOLB 3LX5A 5DBUA 2ODPA 5FJPA 4OH1A 5K3EA 1KPIA 3RBXA 1UUOA 1QAOA 5CBPB 2X13A 5B7GA 1JWAB 3TS1A 1I14A 3SGLA 4TVOA 4RHYA 1UUMA 5JDCA 4FLOA 3VO2A 3ITGA 3A13A 3EC7A 2OCLA 1RP8A 2HCJB 5B3KA 3BSFA 2ZQYA 5T6BA 3ECAA 1BHSA 4EHLA 2JKZA 2BP7A 4FCTA 1IEIA 3OF5A 2O8CA 3SZUA 2E6UX 3H3FA 5I7HA 5KYUA 1UWAA 4A27A 2BKEA 2NQ9A 4YRDA 2J7HA 4FWBA 4AZIA 2OBYA 4ZT5A 4DX3A 5HAOA 3WYNA 4O4JA 5HILA 2VTFA 4JJIA 5JZOA 3UWZA 4J07A 4FU0A 5CSYA 4D6DA 3QK7A 4GNVA 2R1LA 3HY3A 1JIKA 3PCRB 1Y5WA 2WC7A 2AUNA 1AHPA 4NBKA 2X2EA 1PQYA 1V5GA 1NJ2A 2BKVA 2OLHA 1EVIA 3EXRA 5FQNA 3NQ41 2GYWA 2IYVA 2V38A 4J27A 3A9WA 4XZIA 1H2JA 3LW7A 1EEXB 4KQEA 1GNVA 1RAEA 3V18A 1CY1A 3VMMA 3FTNA 3R5EA 5DTQA 4LOJA 1K66A 1HOXA 1O54A 1YACA 3P9PA 1FP2A 3BHMA 2Z8YM 2CYBA 3MHFA 4PBRA 1A2OA 5B12A 4COOA 1YK0A 1T8PA 2BSAA 5JAOA 2G80A 1ZC4A 3R20A 2XW6A 3NL3A 2P3QA 2CXQA 4HP5A 3BOFA 3GTFA 1H7XA 3RUIA 1QZTA 2B7CA 3CX3A 2X8WA 2FFCA 3OODA 2MHCA 4S38A 3FTFA 3DEFA 2P5SA 4WBNA 3F7TA 2VIIA 1ETUA 2CSUA 1HL3A 4FKZA 2CPUA 4TSFA 4ENTA 3IV8A 3NQAA 3UMYA 4DXDA 3HG4A 4S1VA 4GIAA 4J3UA 1Y37A 4PYLA 4PV7A 1U4NA 2FG6C 4Y9SA 1W4BA 5JCOC 3Q5DA 1E7YA 4CCAA 2V69A 5DMMA 3K6KA 3G2HA 5C9UA 3OOSA 1DARA 2CERA 4N9CA 3GBPA 2J85A 3HZZA 4NBLA 4G9PA 2F2KA 5B4VA 3U2OA 4Q4AB 1Y33E 4EY5A 1SVOA 1NKTA 3HJHA 1UKTA 2XYVA 5JSFA 3GUWA 2JDID 1EDEA 2QYHA 4Z17A 4KH0A 1IXZA 1VGVA 2VJCA 3GB9A 5EAIA 3KU4A 3PWIA 1LUCB 4F3TA 1YQGA 2W22A 2AQVA 1RBMA 1Q11A 3ELUA 3VGPA 2PY6A 4QX6A 2KHZA 1T2UA 4KQKA 3OCZA 1YMUA 1TWIA 4GWEA 1TQHA 4HEQA 1UWLA 4UJ3A 4CM4B 5D03A 2GFIA 3ZS9A 1C0IA 1LLCA 3B8VA 3RS0A 4BKUA 4IG2B 3OVPA 5DLPA 4A3YA 2UZ0A 1X8JA 3LLCA 1RWWA 5KITA 2HSZA 1KMIY 3VAAA 1EFRA 1LSSA 3RAEC 4GABA 2DF8A 1P0IA 3IUBA 3Q9SA 4DNOA 2HV5A 4HA0A 3R3YA 3QEAZ 2XN2A 5HR6A 4PFQA 2BR3A 4O8RA 2QV5A 3TW8A 2HEJA 3C3XA 3FZYA 3NYWA 2DSUA 3LDUA 4RZHA 1XH0A 1CIPA 2XMQA 4C0XA 3A6JA 4KK3A 2NIPA 4IJ5A 4RCYA 3WD4A 1YOBA 1YVDA 3QVTA 1XMSA 1LZKA 3PBGA 1XSKA 2ZOXA 1XIEA 2POTA 4DV5B 1YE5A 2C5EA 3CW2A 2HLDA