4G56A

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
626
structure length
617
Chain Sequence
RVSSGRDVACVTEVADTLGAMANQGFDFLCMPIFHPRFKREFYKEPAKSRPGPQTRSDLLLSGRDWNTLIVGKLSDWIKTDSEVSRIRKTSEAAMQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHVGHHSTMFWMRVPLMAPNDLRDDLIENEPGEERTWIWWHNFRSLCDYNKKIALAIEIGADLPSGHVIDRWLGEPIKAAFLPTSIFLTNKKGFPVLTKVHQRLIFKLFKLEVQFVISGSHHHSEKDLCSYLQYLEYLSQNSPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQILMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQVTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDDGVSIPGEYTSYLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFHHPNKDDVIDNNRYCCLQYRVDLNTVLHGFAGYFNTVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPMREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hsl7 protein
publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transferase
total genus 169
structure length 617
sequence length 626
chains with identical sequence C
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4g56A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4g56A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4g56A02
3OE5A 1NW5A 3CBGA 1S5MA 3C0SA 3UJ8A 2OU4A 5AVNA 4HTFB 3UJ7A 1JG4A 3UZUA 3CQHA 2BR3A 4CKCA 2ONZA 3CJQA 5FA5A 5ERGB 1A0CA 4HNOA 1AV6A 3M6VA 2UZ4A 4E2WA 3V97A 5I7GA 1JQDA 3SSMA 3Q7EA 5E8JA 2YUIA 4AX8A 1DXIA 1IY9A 2UYOA 4K6MA 5DXJA 3BKWA 3AYVA 2Z6QA 1XCLA 3ITLA 5K09A 1OADA 4AUKA 3KQOA 3KQSA 3DTNA 5EMJA 3KTCA 5KS2A 3P2KA 2OBFA 4E2ZA 3LDFA 4DF3A 5E2AA 3HA7A 2HV9A 3DLCA 3P9KA 3FTFA 4QE1A 2ZZKA 2ZZNA 4ER6A 1L3BA 3BWMA 3HVIA 3BGVA 4EKIA 3P71T 5BXYA 4E32A 3RODA 2FHPA 2I62A 2ZIEA 5CIYA 1O54A 3A26A 1RJFA 2AOUB 5HFJA 2O05A 1XVAA 3DMHA 3T7TA 1R00A 5XINA 4BLUA 3EGVA 4XCXA 3O4FA 2XISA 3SSNA 3NVKI 1NW6A 5E9JA 3BZGA 4RSRA 8MHTA 3OZTA 4DVOA 4PFHA 1OR8A 4U7TB 5CVJA 5FUBA 3M6XA 2GVEA 2CWWA 1H1DA 1WXXA 9MHTA 3TC3A 2A14A 1BXCA 4US6A 2B2CA 4E33A 5HZMA 2G0WA 3DX5A 3A7DA 2EG5A 1MJFA 4R8RA 5LQAA 4P7GA 5DLYA 3LL7A 3KCOA 5GP1A 2AR0A 2QUMA 4ZTBA 3E8SA 2GLUA 3EGEA 1TW3A 1QTWA 3V8VA 3MCTA 5LQUA 3GJYA 4MWZA 5E1DA 5FULA 3R6TA 3BWCA 3P2EA 2PX5A 3LBYA 5GWXA 4DCGA 4C07A 3ORHA 5K0FA 4X41A 4OX9Y 1XDZA 3FPGA 2CMGA 2AN4A 2PVCA 2AOTA 3N4AA 2Z6UA 3KWSA 2BM9A 4XISA 4MIKA 5CUQA 5DM0A 2HR1A 5EVJA 2J6VA 3TR6A 4PYLA 3EEYA 3KQPA 4MTLA 1P1CA 4QQKA 3DLIA 4ER0A 3UJAA 2YTZA 4R05A 1DE6A 2OY0A 1XLHA 3JWGA 4YTUA 2ZW9A 3FYCA 2PJDA 4QDJA 3M0YA 3UWPA 1TZ9A 3TOSA 4AZWA 1DCTA 2OXTA 3AYTA 3CWHA 2VDUE 2G71A 4PINA 3M0MA 3R0QA 5E8RA 3FUUA 3HCCA 4HGXA 2ZBRA 1XCJA 2O57A 5E9QA 3B3GA 2ZFUA 3DOUA 3QOXA 5J8LA 5DM1A 1NBIA 3M0XA 2ZCJA 2P40A 2YXDA 3VC1A 4ER3A 2GB4A 2O0LA 3G2QA 3WSTA 2GLKA 1BXBA 4DKJA 2PX4A 3I58A 2V7EA 1M0EA 4R6WA 1UFKA 3HCFA 1XISA 4YV1A 3LX6A 2ONYA 1QAQA 4RX1A 5LQJA 5HIJA 2Q41A 3HCEA 3QXBA 2AS0A 4Q7IA 4FT2A 3XISA 2IPXA 3KBNA 3KPWA 2EFJA 1MNZA 4EAYA 3GRRA 3LHDA 3NWEA 3LSTA 2C7PA 5K0JA 2GYIA 5JR3A 3THRA 1XLAA 2VS1A 3NVMB 4CWAA 4FSDA 1ZGJA 1NW3A 2PX8A 4GBED 3BDKA 1G6Q1 5FQOA 4XIAA 5MHTA 5K0NA 4PIMA 1QUMA 4DQ0A 4K3ZA 3VNJA 5U4XA 3ER8A 3I9FA 2P35A 1SKMA 3BZJA 1RI4A 5K0GA 3TVAA 3DXXA 4A8IA 4Z2YA 3NTVA 2OB1A 4PYQA 2QRVA 1O9GA 1XLBA 2H00A 3DULA 4PYIA 1M6EX 1EJ0A 1XLEA 2IFTA 3R3HA 1NBHA 2HK1A 2YXLA 3ITXA 4OQEA 2JJQA 2HK0A 3JWIA 1IM8A 3GNLA 1EJ6A 1ZHFA 5C0OE 1RJEA 3AJDA 4Y2HA 1PRYA 1JSXA 3TPZA 3EMDA 1HMYA 2UYHA 4C04A 1XIHA 3H2BA 3Q87B 4C03A 2AVDA 3FTEA 1WG8A 2EJUA 3UVAA 1G8AA 3LGAA 5CVVA 3B5IA 3PLAE 2ZZMA 4DUOA 3SMQA 1I9GA 3UBTA 3HA5A 4E2XA 4GC9A 5CM2Z 2AOTB 2NQHA 3CQJA 3UA3A 5HIIA 3JU2A 1MUWA 3JWHA 2AZTA 1JSZA 4POOA 5F2NA 3B3JA 3BANA 2ZIFA 3LCCA 3KR1A 2P8JA 5EEHA 3KQMA 4OQDA 4QVKA 3GRZA 3G88A 1X1AA 3HVJA 5CCXA 4XKMA 1KP9A 3E7PA 4AZTA 4CKEA 5B80A 4LWOA 3FUWA 1JG3A 1WS6A 3BKXA 3HCDA 1AF7A 5DTMA 4J4KA 2XYQA 4E3VA 3P97A 3GO4A 5EG5A 5ICEA 1JG2A 1QANA 4KWCA 3T7SA 1PJZA 1DL5A 5DX1A 5CVEA 2EJTA 2G8NA 1QZZA 2UYQA 4YMHA 3FPHA 1X1BA 4IV0A 1GW9A 1XXLA 1P91A 4MHTA 4BLWA 3C6MA 3KR0A 5EC8A 5HILA 3TFWA 5C9ZA 3NW9A 3KBWA 5TNVA 1QAOA 3A7EA 1XLFA 4RVFA 2IP2A 4C05A 3M0LA 1D2CA 1DUSA 1XINA 3P14A 1SQGA 3IYLW 3OZRA 1N7JA 3QV2A 2NXCA 4F85A 1YZHA 4O29A 3BGIA 2AOVA 4M7RA 1VP9A 2ZBQA 1X1DA 2X7WA 2PXXA 4YTRA 1Q0SA 2PSSA 2YVLA 3BXOA 3BWWA 1L3IA 5FHQA 2LD4A 1JQEA 1K77A 5LQNA 3THSA 3G5LA 4P58A 1VE3A 5FCDA 4XSMA 4RVHA 1RI5A 3P8ZA 3TM4A 3KBJA 2ZULA 1TPYA 3MQ2A 1EAMA 5EHIA 2NQ9A 1XTPA 1SUIA 5LQKA 2Y1WA 4BLVA 3SX0A 2O07A 1N2XA 2BM8A 4QEHA 3MGGA 4QQNA 1VL5A 1CLKA 2QRVB 1XYAA 1YUBA 3CC8A 2NXJA 3O31A 1I60A 4HGZA 3LECA 2N47A 4RWZA 3EVDA 2CMHA 3C0KA 4QDPA 3RW9A 4M36A 3A4TA 2HMYB 2F8LA 4RVDA 4AZSA 4F86A 4XUDA 3HP7A 3CCFA 2NXEA 3PT9A 3G2MA 4KRGA 1NV8A 4QPPA 2V74B 1VP3A 1F3LA 2PT6A 2C7RA 5H02A 5K0BA 2OB2A 4GLEA 3CJTA 4KIGA 3KQYA 1XIMA 4MQ4A 2B78A 3KR2A 2AOXA 5DPMA 2ESRA 2WA1A 2G4JA 3G89A 3KPVA 1SQFA 1BKYA 1NE2A 3LMZA 4HRAA 5D1NA 2ZTHA 1KR5A 3D2LA 4ER5A 3QZAA 3C0LA 3GWZA 5BW5A 5GM2A 1KXZA 4ZB5A 3TRKA 3HA3A 4PWYA 3U81A 4E70A 5EMMA 3MTEA 1ZGAA 2R3SA 1XIFA 1XLJA 2ORED 4GC5A 3AALA 4PYNA 3PB3A 3KQVA 4A8LA 4WVLA 2FRXA 5DM2A 1G38A 1VLMA 3GDHA 4CTKA 3UU0A 5EMKA 1XIIA 1XJ5A 4PIPA 5KYGA 3VNMA 2PKWA 2ZBPA 5FHRA 5H6HA 1G8SA 1KYZA 1KPGA 2AVNA 5DTRA 4GOND 1VPTA 3KU1A 1XICA 3KQWA 1XDSA 1XIDA 4QDWA 2AN5A 1NT2A 1XIBA 2VZ9A 4GEKA 3XIMA 1XLGA 2QY6A 4PGHA 3DXZA 5GOZA 3G8AA 3UFBA 4HGYA 4FZVA 2JHPA 1TW2A 3OE4A 4PYOA 1VQ1A 4NECA 4QE5A 3GRUA 2P7HA 2NYUA 4HH4A 5DRYA 4CTJA 3HTXA 3I64A 4CKBA 3KHKA 4FR0A 3VNKA 3KBSA 4M37A 3E23A 4RTKA 4JXJA 2PV0A 3HNRA 3IUDA 2BR4A 3CQIA 4PYKA 3SXJA 3AXTA 3GRVA 2PWYA 4A8RA 3QOWA 5D1HA 3BGDA 2GAFA 3FTDA 1S5NA 3ITTA 2GH1A 5ICGA 1YB2A 5XIAA 4B17A 3PX2A 3KKZA 3EGIA 3LBFA 1NW8A 3E05A 2CL5A 3AXSA 5DX0A 4X63A 1XLDA 1YFLA 5CVDA 3EVAA 1Z3CA 3DMGA 4KDRA 5DSXA 1YFJA 2XBMA 4KW7A 6XIAA 5GINE 5K03A 4GOOD 3EVCA 5DT2A 2PT9A 4ZBCA 5LR6A 3QC0A 2H11A 1F38A 2PGXA 2XIMA 4RV9A 4FS8A 3UJBA 3U3HA 5E9WA 3KBMA 2ZIGA 3SR4A 3OPNA 3DUWA 5K05A 1KIAA 4PGLA 3I53A 3LDGA 5FADA 5C1IA 3KPYA 1XLMA 4QVGA 2YQZA 1O1HA 5E1MA 3G8BA 3BWBA 3LDUA 3OFJA 3PTAA 1T43A 4FP9A 4OBWA 1JTFA 2XYVA 1MHTA 4RTQA 2OKCA 1UIRA 4KVZA 1DIDA 1XYCA 3VYWA 2Z6AA 4W4QA 5E1OA 3K0BA 1R74A 1XIJA 4L7VA 4WXHA 3C3PA 1SG9A 2QYOA 8XIMA 1QYRA 2PX2A 3I5UA 3ITYA 3S68A 4XSLA 1XIGA 2P3LA 2DPMA 2IGTA 1R8YA 2I7CA 4KDCA 4DCMA 1VIDA 3IUHA 2IBSA 5GIOE 3IUIA 4DMGA 1Y8CA 4YMGA 2JG3A 4YUXA 3DXYA 3LKZA 1KYWA 3NJRA 3EPPA 2C7OA 1EG2A 2WA2A 4FT4A 2Y1XA 5EKUA 5CD1A 2GA9A 3NMUF 5F2OA 3TQSA 1L1EA 3GXOA 5CVUA 2P3QA 2HTEA 1FBNA 4ISCA 3ELYA 4QPNA 4E31A 2ADMA 4EVIA 2OYRA 3C3YA 1XDUA 1RJGA 5ICFA 3BT7A 3UJ9A 4PONA 4X1OA 3KQTA 4BY9E 4IWNA 3P2IA 1XLKA 3A25A 2ZWAA 2KW5A 2ZDSA 3EVZA 3M70A 2IIPA 5DSTA 3IEIA 2NP7A 2I57A 1FP2A 2XYRA 1WXWA 3DMFA 4C08A 5K0LA 5H1WA 4Y30A 2XINA 3HVHA 4QTUB 2QE6A 3P6LA 4RYLA 3OBEA 4RTSA 3PFHA 1EIZA 1RJDA 4RTPA 5DTQA 3C0QA 4F84A 3OU2A 2YXEA 3PS9A 1BOOA 1Q0TA 2P3OA 3MHTA 3BWYA 3CKKA 1V39A 5DM4A 1FJXA 1U2ZA 5HIMA 5XIMA 3R9XB 3UJCA 2IH4A 2FYTA 4UOEA 4KIFA 2QULA 1SVUA 3G2PA 3UA4A 4A6EA 4XIMA 4G56A 3ELDA 3G2OA 1XIEA 2QW5A 2ZWVA 4K1GA 3VNIA 2AOWA 3HEMA 5FQNA 2NP6A 3MCZA 5EOVA 3VC2A 3NDJA 3DBNA 2OZVA 1L3CA 3B89A 3LCUA 3EVEA 1JG1A 1X1CA 2PY6A 1SUSA 2QM3A 2ZVRA 3ELWA 3P9NA 5G02A 3ELUA 1XYLA 3M4XA 4OA5A 4RTMA 2I6GA 5GM1A 5JUWA 1P1BA 3WQOA 3MERA 2PXAA 2HWKA 1I6NA 2Q02A 5FTWA 2JHAA 4RTNA 5B7YA 5K0CA 5KVAA 3DH0A 4HSGA 2XVAA 3KPJA 5DRTA 3OU7A 3FVMA 3KCJA 4YV2A 2XVMA 3UJDA 2ZVJA 4M38A 3GU3A 4GQBA 3DP7A 3CVOA 2GPYA 5E1BA 4BP3A 3M33A 4GOLD 2I56A 1DE5A 3RIEA 9XIAA 3XINA 2NQJA 3PFGA 5EMLA 2EX4A 2P7IA 5AVHA 2P1DA 4LECA 1HNNA 2ZSUA 3X0DA 2IDKA 1VBFA 3FTCA 5HEKA 5EIFA 1ORHA 1BC5A 3EVFA 3P9IA 2OPBA 5BW4A 4QE4A 5FWDA 3HVKA 1XYBA 4HHLA 1N7IA 1P39A 1QT1A 2WK1A 4H0NA 2CKDA 4IV8A 3A27A 5FWAA 4DM3A 5EKXA 1A0EA 3GIWA 5IH3A 4EMSA 1AQIA 3ITVA 1FP1D 3U0HA 2B3TA 4YUWA 1KHHA 1R6AA 3O7WA 3SM3A 5K0EA 3CJRA 2I9KA 4C4AA 3FYDA 2YX1A 4RTJA 1D2GA 3FPEA 2G72A 2K4MA 5EEGA 1INLA 2YR0A 3L23A 3FPFA 4BP1A 1A0DA 1WZNA 1RI2A 1NV9A 4LNCA 4QDKA 3ITOA 4YTTA 3PVCA 4PCAA 2IDJA 4ER7A 1G60A 4EKGA 4RVGA 3QYSA 3UXIA 1KPIA 2X7VA 1UWVA 2FPOA 2DULA 4PCLA 3NGFA 4XUEA 3M6WA 2VP3A 3AAMA 1KPHA 4QTTB 2VDVE 5F2KA 3ID6C 3LKDA 3FRIA 3KCLA 2FK8A 3L8DA 3AY0A 4V0QA 3VYLA 4YUVA 5ICCA 3CGGA 2OO3A 1XYMA 3EVBA 3KQQA 2BR5A 3IHTA 3TM5A 5EIWA 4LWPA 4HTFA 1DIEA 5FA8A 1XP3A 4ZB2A 2BZGA 3M0HA 5B1SA 1JQ3A 3TLJA 5BP7A 4P7FA 5K8VA 2PWPA 3MTIA 3GNXA 2PXCA 1ORIA 3KPUA 1YZ3A 2PLWA 5LQCA 4HG2A 3GGDA 1I4WA 4P7KA 3PX3A 4EK9A 3NDIA 4X61A 1O9HA 4DA4A 1BHJA 6XIMA 3FRHA 2G70A 4U7PB 4ATNA 4YTSA 3IV6A 1B42A 5P8WA 4YTQA 3DR5A 2ERCA 3GCZA 3BUSA 3KBVA 4E30A 3OFKA 4XUCA 5DWQA 3B7PA 1NKVA 1XLLA 5EZSA 1ZQ9A 1QAMA 3UJ6A 3HCBA 5CCBA 1FPQA 4YUZA 5T67A 1RI1A 5LQRA 3REOA 1YF3A 5DXAA 3G7UA 5HIKA 2FCAA 4FSXA 7MHTA 2BH2A 2JH8A 1I1NA 3ERCA 4PNEA 4IKPA 2VDWA 3OU6A 4R8SA 2AOUA 5B7ZA 5M5BA 4C06A 2QUNA 3LPMA 2JHCA 1R18A 5E2BA 3MAGA 3ME5A 4X60A 4HC4A 4PYMA 3ANXA 1XLCA 2IH5A 4DZRA 3VSEA 4PYJA 4GJJA 1ZG3A 5EZQA 3EVGA 4YUYA 4OVXA 5HOQA 4P7JA 1EQAA 4GJIA 3SGLA 1D2HA 2GUBA 3FUVA 2IBTA 5EGSA 2NNWB 7XIMA 4OA8A 3EEOA 5GIPE 1XLIA 1R8XA 3K6RA 3OZSA 1WY7A 3M0VA 3FPJA 3R24A 5T6BA 1L9KA 3T7RA 3TKYA 3AWIA 3VNLA 3CNYA 3LCVB 3TMAA 2R6ZA 2H1RA 3OCJA 4GF5A 2NXNA 1NW7A 2C7QA 4GUAA 3KR9A 3SSOA 4QEEA 1AQJA 5T64A 2JH9A 2HCVA 4E2YA 5KQRA 4AZVA 2AN3A 3M6UA 2ZLBA 4LG1A 1RI3A 2P41A 3T0IA 4GOMD 9XIMA 5EQJB 4V0RA 4CXMA 3ER9A 3C6KA 2HNKA 1JR4A 3MB5A 3SVZA 4KW2A 4EACA 3JWJA 2PBFA 4FGZA 1IXKA 3CQKA 3F4KA 3HCAA 5K01A 4RTRA 3NWBA 2G1PA 3TKAA 2B9EA 4PGGA 1ZKDA 8XIAA 4EQZA 5IKMA 3FUTA 5DX8A 2IH2A 5LSAA 4RTLA 4A6DA 3P9CA 4R6XA 1M6YA 5EHGA 3GRYA 1X19A 3EMBA 10MHA 3B3FA 3FZGA 4A8NA 1G55A 2FK7A 1D8WA 4YV0A 3BZBA 1JTEA 2UYCA 3FUXA 5KQSA 4HHMA 3HM2A 3G5TA 5EPEA 4RTOA 2E5WA 2GS9A 1YX1A 2O06A 4ZB0A 2B25A 4OBXA
chains in the Genus database with same CATH superfamily
1LOLA 1NW5A 1FH9A 3FOWA 3ESQA 1W2WB 3AVPA 2IHVA 2QLYA 1XC7A 1OWNA 1HPLA 3IT0A 3LERA 4DAOA 5LJLA 4H1UA 1QE0A 5ERGB 2R8ZA 3ZOZA 4JELA 4D43A 1ZFJA 2NGRA 3N2ZB 3R8HA 5GV8A 2RSLA 1GGVA 1WZCA 1PDOA 5AYBA 1EWTA 5LZ8A 2X1IA 2C88A 4J1NA 3D3JA 2Z6QA 3AI2A 3ITLA 3NSNA 3AMVA 4DUWA 3A6PC 1TC1A 1VKHA 1V0MA 5JE8A 4QISA 3CN7A 3W25A 2QDGA 3W7KA 1OYOA 3RR1A 4LUIA 1YWGO 4TGLA 2WILA 4GZJA 4XZIA 2PUHA 4O18A 4B09A 1PUXA 5IYZF 2XT6A 3ND8A 4UC5A 3GG2A 3S83A 3SJZA 1T9DA 2FXVA 3M6YA 3APTA 4WXEA 5TQ2A 3VHLB 2Q9CA 3GNTA 3D3WB 4GYYA 1OK6A 5ALXA 4F5ZA 4V0KA 2Q09A 2YIVX 4LEQA 3HUFA 4DQKA 1HE4A 1AE1A 5HFJA 3JPWA 4UM9D 1E5QA 1IBCA 4LV5B 3B1YA 1F0YA 4XB1A 4P82A 1FFEA 2J6HA 3WLTA 4I6GA 3G0IA 4RSRA 1RABA 4KCTA 1KBQA 4GCXA 2J3EA 4IWYA 2H52A 3HPXA 2K2WA 3F8SA 1H7RA 2C8NA 3FLMA 2IYPA 5CVJA 4EANA 3IX7A 2CWWA 1H1DA 4A23A 1BMDA 4XLZA 3K0KA 1K3TA 2Y1KA 3GH1A 1YIDA 4GVPA 4B91A 3LTNC 3UP8A 2HJSA 2DEUA 3TSMA 1OC4A 1Q21A 3H5OA 3TRIA 1EPUA 1D2KA 3RF7A 1H4SA 2VEFA 1RBZA 3K73O 3EXRA 5F1VA 5ALVA 3L0OA 3NDZA 5FBZA 3LI2A 1H9BA 1L7DA 2I33A 1E9EA 5C32A 1CZRA 1XPOA 3T12A 4ENVA 2A2IA 3FBTA 4J7AA 2H48A 3GXPA 1IG3A 2Y0EA 1QFYA 3WTBA 2EPMX 3IMKA 2QSYA 1JDFA 2ASHA 3W2IA 3PEEA 2PU1A 2AG5A 2PX5A 3IL2A 1WXDA 2YXGA 2CMGA 3GR7A 2BZ0A 2Q29A 2A3CA 2PVCA 4LJSA 1G8FA 3NQGA 5FI3A 1G3RA 4MIKA 3ITKA 3LOQA 2HROA 1C1DA 3D5QA 2ZR8A 1EJBA 4I55A 2AQOA 1LWJA 4EA8A 1UIOA 1N2CB 4DLMA 2Y27A 5HCUA 4Q8NA 3ZNNA 1MQ8B 1ZL1A 4GSLA 3IPLA 3QPVA 2VXCA 4ZCIA 4R8KA 2VOTA 5JZMA 1ODJA 2QRUA 1I1OA 5B6PA 1OG6A 3ALGA 4N8DA 4JC4A 1M7JA 1RQEA 4NOKA 1C7ZA 4PINA 2FSVA 1UPFA 4HAIA 1SZGA 4W7VA 3DOHA 1NJSA 3WYDA 4MO9A 1QNVA 4RL4A 1GA6A 2ZR9A 5EP4A 4DNOA 3MWLA 5JATA 3Q67A 4IH3A 3A2KA 3EIFA 3VAAA 1X7YB 3CTPA 4LDNA 4JYBA 3BAXA 4CNPA 3MZ0A 1T0JB 5DMMA 1ODLA 5DM1A 4BPBA 5TMBA 1CECA 1ZALA 1RZVA 3G1SA 2QRMA 3DTVA 3G2QA 3OGRA 4LFAB 1X1RA 2WG2A 1Q1BA 3LUGA 5PNTA 3RC9A 1T0IA 3SCZA 4N18A 3DFSA 2O3QA 5IZCA 4IZHA 3VPXA 4ACBA 4GWKA 4LTMA 3AFIA 2Z2UA 2AMGA 2YL5A 3AGPA 3NAQA 2CFRA 3CISA 3R2JA 5CB4B 2NZYA 2EW1A 4GP7A 1BXZA 1N8WA 2IPXA 2HNEA 1U1FA 1ZISA 4AC9A 4YMTA 1NBOA 3WQPA 4UMDA 3L6DA 4NZ9A 4C76A 1Q8AA 3KL0A 4I5GA 1JRBA 4GFDA 2RIPA 2OV1A 1Z26A 3T15A 3VKHA 3R4IA 5I24A 3GVHA 2SKCA 3PWIA 4EABA 5I4BA 1CZKA 4R98A 2ZANA 2BEJA 3UT5B 1QHPA 1AD4A 3DJYA 2Y1HA 1Z3NA 3R58A 1YO6A 2IYXA 1ZP4A 4FB4A 5BMXA 2NLIA 3ER8A 4OYYA 5ALFA 3CMMA 5SY6A 1YZLA 5EIEA 1FUYA 1PK9A 4QS5A 2QROA 3WLOA 1XHGA 5KAPA 3QE4A 1Z22A 2WMIB 3PE4A 3UIEA 3N9KA 1O9GA 4Y6SA 1A3HA 1NXPA 4IS3A 4XWKA 3UXHA 4ZC8A 4D3YA 4BV8A 1V5EA 3RHTA 2H65A 2A3AA 3L0ZA 4PV7A 2O8BA 1AK1A 3R09A 1FIUA 5NULA 2HOQA 5IC6A 4K2SA 3DFFA 1IM8A 3ZWTA 5ENVA 1MO5A 2J4GA 4EJ6A 4O1MA 1GRCA 3SOPA 3QY7A 2C2OA 5D3KA 1N77A 1UOQA 4DG5A 4F04A 1QRTA 4FR2A 4IMIB 4C04A 5FUWA 1XIHA 1Z6QA 3WL0A 3FTEA 4S1NA 3GEHA 5CVVA 1OFVA 1TMGE 2WDPA 3W04A 5HUJA 1IY8A 1L4UA 1VHNA 4LVAA 1XI2A 3MSGA 4R9OA 4S23A 3WNMA 5J2UB 1TTQB 1RQXA 2X1LA 5TEWA 1HJVA 1TYGA 2BGTA 5AVRA 4HQKA 5CSUA 3VMOA 4G8BA 3LCCA 3G1HA 1WCWA 3WTCA 1Q6DA 2P8JA 4RGQA 4AROA 2BKEA 3GFXA 3Q0EA 5HFNA 4GUHA 1HQYE 5L6LB 3ZY6A 4QC2A 4U2ZA 5HRUA 4TVBA 3V5OA 5JNWA 4OYRA 4R2JA 4OLHA 5ILQA 1ZS9A 4Q7LA 3V9PA 2PP0A 4NRSA 1KL7A 3BKXA 3PPIA 3I2YX 2OMAA 1CY8A 2CE7A 4GI9A 5KTLA 2REXB 4DV2B 2FPIB 2IPFA 4PZAA 2H31A 4ASTA 2INFA 2IA5A 4H16A 2HXUA 3ESZA 3T4PA 3OJLA 4B3CA 1V0LA 1NF2A 4H18A 3FOCA 1MXHA 4JY7A 3C4VA 4BY3A 2N9UA 5ADHA 3ZGVA 4OAPA 5FWXB 4MHTA 3E38A 5TQ0A 3KR0A 3ZBPA 4NE9A 1K8YB 1T29A 3PPXA 4MQEA 4DLAA 3BD8A 1A9YA 1SKAA 1QB7A 2GPJA 3ONBA 4PODA 4MVYA 1G7UA 5JO0A 4NXMB 1WX1A 1ZAKA 1XKTA 4U6NA 4QASA 4Z2KA 1SZNA 3DYOA 4BI7A 1MTOA 3VR4A 2XMBA 5IBPA 1PIGA 3ELFA 1UMBB 4HVCA 2AOVA 3W7LA 2V2HA 1ECCA 3Q88A 2QCMA 4L4PA 5E4JA 1N9GB 2EBUA 1A9XA 2XWEA 2RARA 1LW7A 5IP5A 2O2CA 3PXDA 2YA1A 2RJOA 2DWCA 3Q3IA 1LRKA 3EVTA 1UBRS 2C79A 2V7UA 3PFFA 3SECA 4P58A 1SJAA 4P8WA 3IXQA 1AA6A 2F7SA 2PWBA 1IXPA 2GJRA 2A94A 3NNNA 3K1AB 2IPWA 3NTRA 5BR7A 3WYEA 3HRHA 3GTNA 5FUQA 3U6KA 3BLOA 2BFBA 1JA1A 2XXAB 2FKPA 4A6XA 3DKRA 5B3LA 5GZ6A 4QEHA 1W48A 3FCYA 4RGBA 3NO5A 3MTDA 1M04A 1ZJ6A 2IW1A 5CNMA 3U5YA 1GZVA 4TV9A 1EFVA 2CMHA 3SFKA 3ABOA 4Y6QA 2QGNA 4DX3A 4KEAA 5AFSA 2XB9A 3NEVA 1TJ2A 4B8WA 4F86A 4GIAA 4FLOA 4B7XA 4AIRA 4AL4A 4V0MA 1H5QA 4KSBA 1BKHA 5LU9A 2KZHA 1VA5A 2J0QA 3E18A 4WF7A 4MRMA 3GEPA 5E38A 1DJGA 4EY4A 4KIGA 1KAGA 1JRCA 1N33B 3P60A 4WQ6A 1E60A 3UUGA 3KUDA 3STXA 5GNYA 3FPAA 3CRRA 3LMZA 3WUGA 2NNLD 1OFHA 3UGRA 5D1NA 1SXHA 4NZCA 3OZ7A 3T2PA 3OAAD 3NJ4A 1IIRA 1ZU8A 2O2IA 2FPTA 5SYAA 2WV9A 4PWYA 3THAA 1WZKA 1IZ7A 5BU6A 4WSHA 1VLQA 1PJSA 3KM0A 5HMDA 3B20A 1G38A 4YAFA 1P2SA 4E3TA 3DG3A 3DOOA 5BRAA 2Q3FA 3MT8A 2F43B 3NO4A 2JJ1D 5C1OA 4DS3A 3MUXA 1GWJA 5DTRA 1Q0QA 2WJFA 4JI7B 1XIDA 5JS6A 4RX0A 1GKUB 3TFOA 3N28A 4NBSA 3TX6A 1PX8A 1KI3A 3RMEA 2UZ0A 2BWGA 1S96A 3ATZA 3FA3A 3WWYA 3GP3A 1XLGA 3GUVA 3VZCA 3CX4A 2RGCA 3HB4X 3UXKA 1H7PA 4HGYA 3BTNA 4YAIA 4KQCA 5JOQA 1PE1A 4XKYA 5KOHB 6TIMA 4IEFB 1Q5MA 3RITA 1PBNA 2FZ9A 2P7HA 4JLKA 2IWHA 2CVZA 2X0KA 2DC1A 3VUSA 3ES8A 2AXNA 3PUDA 5KSWB 2Q2NA 4IL0A 3L7JA 3ZI7A 1JHOA 4PTXA 4MV1A 4MI1A 1YDHA 2YHBA 5L3QB 3SZ3A 1Q6CA 4YN5A 4QFDA 2OZEA 2YRFA 4R7JA 3VPDA 1G5HA 2MSCB 4EJFA 1VE6A 3DMYA 1FNBA 2I87A 4RJEA 1YB2A 3EGWA 3MTQA 2W90A 2MYNA 5DX7A 1U28A 3TYAA 3N11A 3PFWO 3ENNA 2JASA 1IHIA 1ECJA 3QUSA 4MYTA 2RJHA 1C9EA 2ZJ2A 2YFKA 1PS0A 1EPXA 4D80A 3W8FA 2RIRA 3SCRA 1EIXA 1RZMA 5JSQA 1GKKA 2POCA 2ZZ7A 3K6KA 2Q9BA 4TXJA 5FUYA 3A4LA 2REBA 5JU6A 1VBRA 3O9MA 4GGHA 1K97A 4JL8A 2R6HA 4RV9A 1D8AA 4GXMA 1OF8A 2PCLA 2IKJA 1Y33E 2X42A 1W9VA 4WKCA 4G4SO 4JYPA 3RR2A 3ESDA 1ZH0A 4GPEA 1RQLA 2YOCA 1KIAA 1V3JA 1Q7TA 2WF5A 3BBPA 3KL5A 3A1VA 2XI4A 2WMGA 2VOEA 2ZYRA 2V7WA 3CW2A 3OZVA 3RS7A 4LUSB 3KDOA 4HYYA 3KOXA 3TE7A 2JNWA 4XJVA 3ZCXA 1CPUA 4FEYA 4DDKA 5A8PA 3FVWA 4IUBS 5CT9A 4XRGA 3SCOA 1UIRA 3W74A 5I0DA 5HR5A 2CLKB 1WVGA 3QYJA 1YVPA 2EKGA 1LPOA 3MJMA 2YQ5A 2G07A 4AN4A 1V6TA 1XFDA 5B4UA 2QGHA 4OFWA 3TJXA 2VI5A 3WLSA 1W5NA 4F8YA 2QYOA 5KIAA 1NFRA 3BL3A 3BRWD 4J9UE 3ITYA 3S68A 5A2BA 3F3MA 1U6IA 3RPTA 2OO5C 4UEKA 3RRFA 1U5CA 2DPMA 1XQXA 1R8YA 4DUZB 5EXPA 2B4KA 1ACLA 1F0KA 4H04A 1HC7A 3W8RA 4UFPA 3CR7A 1YGYA 3DEFA 3P61A 4MGEA 3ZR4B 4GDFA 4LF7B 1CB0A 4CGYA 1B57A 2WKLA 1FWEC 1Z18A 4G5SA 5CH3A 1U5BA 2CNBA 1SW3A 3CFYA 1Y8CA 3AR8A 3UK7A 3JQBC 3ZBQA 2PKEA 1M1NA 3BV7A 2E85A 3TIXB 1GG0A 3V35A 4RUBA 3GARA 3W5SA 2KX9A 1C8QA 3PENA 4DLXA 1YXMA 3U5ZB 4MVJI 4NDZA 1KC1A 2D13A 4BIMA 2P3QA 4DM7A 2ZDHA 4WJEA 1S4MA 1SSGA 3C3AA 2VP6A 4E31A 4M87A 3LI0A 3GC6A 2QI9C 3OQPA 2QCFA 4JSYA 1L6YA 4JI3B 2GMWA 1GU7A 2QLLA 3WV4A 4CDMA 3PR1A 1W6RA 1Y5RA 1M2EA 4DAEA 1VYTA 1DINA 3MB9A 3OH8A 3TQOA 1YKGA 4P2BA 4MUYA 2FQIA 1HA3A 4MVJF 1B00A 3NCOA 1GL6A 2X2PA 1UP4A 5DNVA 5HOEA 4LI3X 4O0MA 3A11A 4RZ4A 2AXQA 1RLCL 3UMGA 1LTDA 3LOTA 4ROQA 3K09C 4ZC1A 3WLMA 4YU1A 4NTZA 4QQ8A 4RTSA 2QV7A 2AV6A 1TJRA 1ANKA 1A82A 1H05A 2DBRA 1RQNA 3PS9A 4TV5A 1FDIA 3DOFA 2ZZ2A 1VG9B 3BMNA 1BYDA 2HF7A 2Y7FA 4GKBA 1BG9A 3TZNA 2QULA 1KO7A 4BASA 1NG1A 4IG4A 4EQ6B 4HNTA 3JQBA 3ABSB 5BN3A 4NAFB 4EVRA 2VTEA 2QW5A 3FVDA 3VNIA 1KFWA 5E2IA 1Y5IA 3MCZA 4QLKA 3LLVA 1Y8RB 3PKIA 1SJBA 1EEXA 3VC2A 2A35A 5AKYA 3K3PA 3F5LA 3OT5A 3GPLA 3PQ3A 1HL9A 1YA8A 5BUQA 1OYAA 4WY0F 3IIZA 1U0NA 1V4BA 1KM2A 2OYKA 3O94A 1E6EA 3ANVA 3VGGA 5DOZA 1AK9A 3EZGA 1CETA 1K02A 1DCFA 3WNLA 4XWGA 3CMCO 5IVDA 2GL5A 2I9PA 3BYZA 4M89A 4KR6A 5K0CA 3LPGA 1MYRA 3LLXA 4QHRA 1QR6A 5HK4A 3LPNA 1A7KA 3I3OA 2VPWA 4ZVJA 4POAA 3S0JA 4EY3A 4PC7A 4QNWA 1EDZA 5U4QA 1OABA 4O0KA 2V7XA 4IIXA 4UULA 1HQKA 2X2GA 2QR2A 4BS0A 2FDCA 3PFGA 1HT6A 1Y9EA 3FGCA 5L9AA 3SURA 4LECA 1YQDA 2ZSUA 1FMCA 1P1JA 3GR8A 5ERXA 4Q4QA 3KC2A 4J7CA 1PJ2A 3DDOA 4OJTA 3ZO9A 4EB8A 2GZSA 3ZYCA 4HVXA 2FAXA 1FXPA 3FF4A 5CB4F 4S35A 5D8WA 4HHLA 3EPMA 3TO5A 3H65A 4OHQA 1JIIA 1O2DA 5DCLA 2C1GA 4EMBA 1GCUA 1Z38A 4P3KA 1G21E 1YJAA 3N6JA 4BO1A 4G1VA 1RYNA 3ITVA 3GDKA 1NFQA 3H0CA 4QARA 3A2LA 3KDAA 5C8BB 1ZUNB 4K7JA 2HLDD 2ZBVA 4E6EA 3F5DA 1QGZA 3GDTA 3NXSA 3SXUA 1IUPA 3IRVA 1L5RA 1E9ZB 5L3ZA 2QEQA 3PZNA 2H2IA 4GVGA 1EJTC 1E4EA 1INLA 2PCJA 2YR0A 2IUSA 5B53A 3TSAA 5DHFA 4P3OA 3N2OA 3KLMX 1RADA 2R1ZA 2ZJ4A 3VBEA 4QDKA 3E8XA 4J2MA 4RLSA 4CGZA 2IDJA 4C5CA 1P8JA 4J4TA 2WD7B 4EE9A 4A0QA 4D8YA 2DHDA 4N6OA 3BMVA 1SW7A 1RT9A 4ZIRA 2VZVA 2Q4DA 2WAXA 4UJ3A 4AS2A 2GEUA 4HK7A 2P68A 2XAAA 1G66A 1B3YA 5HATA 3ARTA 3CO5A 5JSZA 4N0EA 2BKLA 3DC8A 4IQ4A 3OZGA 4ZTZB 2QJMA 3JQ9C 3UMVA 3VYLA 5KJEA 1CBUA 1U7ZA 1EGMA 5FEUA 4F0RA 3T05A 2WU8A 3UY7A 4LWPA 4GM4A 5AJHA 3MJYA 3REGA 4MKZA 4RJLA 4ZVOA 1UOPA 1Q3KA 1PJ3A 1C92A 3ZZ0A 3T07A 1RQ7A 1W9HA 1A27A 2Q1XA 4E5VA 2OGTA 3NTOA 4TL9A 1DTSA 4FMPA 2XQIA 1ZXXA 4Z2HA 3SJ3A 1K08A 2L42A 3AIQA 4LRWA 4DA9A 3HJHA 2KM1A 5KC9A 1HFBA 4HQFA 4EK9A 3OM8A 1TIWA 4IG2B 1FMLA 2VCAA 3O1LA 3JCZA 1S89A 2CEQA 1D07A 3R4VA 2C8LA 2XM1A 4B87A 3F5MA 3LPOA 1DJZA 3PIRA 4J6FA 5HGXA 1YB1A 2RHGA 3RLUA 3TLLA 2I7DA 2VCEA 2KWIA 3PY2A 4AHQA 5KINB 1F8GA 5KYYA 4AWBA 2YYSA 1MT3A 5K45A 3N6VA 2BHNA 5AJTA 3UPBA 4CZ2A 2PDCA 4S2CA 4NZJA 2FCAA 2POZA 7MHTA 4E8CA 4LY3A 3L07A 4IMJB 3EPOA 3QVMA 2C03A 2ZRIA 1BQ4A 3CAKA 1NSFA 3W7NA 2XSBA 2HPHA 1G4PA 3SDOA 4RADA 4NZ5A 1GUVA 5CFMA 1UOOA 3IERA 2ZSBA 5KJCA 3MN1A 3NFRA 2A7RA 4CQLA 2PZJA 2IYTA 3P9YA 2XOKD 3HBJA 2GN6A 3O93A 1RXWA 2HE8A 1D2HA 3HGTA 3ARQA 4CMGA 4DABA 3W8EA 4AUEA 2R7MA 4B45A 5EIOA 3GYBA 4AM8A 5TGDA 3M4YA 1EC7A 3A3XA 3I52A 4BP8A 4DIOA 4YJGB 1MB3A 3WWZA 3ZV7A 4ZO6A 2O9PA 1I5OA 3CRMA 1ND6A 4YRLA 4KGJA 2YCLA 4RK0A 1WDPA 2AFVA 4S3EA 3CB3A 1ESMA 2AMXA 1BWPA 2C31A 2V7BA 4Y2WA 4IJWA 4ADSA 3SM9A 4FSHA 3TPFA 1T9CA 2HNAA 4JFVA 1GCYA 1EWQA 2Z1WA 4NXNB 5A6SA 1VKNA 4DJ5X 1P5BA 3E0FA 1W9MA 4I7VA 2ODBA 3UJFA 4IKOA 3W9ZA 1QG0A 1JBKA 5JXIA 4ERIA 1ZK1A 1BG4A 2CNNA 5LLSA 5EGRA 5KQLA 4MWGA 4MLCA 3CZKA 4GI6A 1MJGA 3OOYA 2IH2A 4LAZA 4C43A 4B81A 3LFUA 2QPLA 2BP1A 4DB7A 5FOSA 4F3RA 2ZIDA 4KR0A 4M9QA 5K7JA 1YADA 1BXRA 221PA 2R97A 1Z0KA 3UPUA 1YHNA 3QFTA 2GGSA 4PH6A 2BDEA 2ZDRA 3CBGA 1DTWB 2D1ZA 1JFTA 4TM7A 2QV4A 2LGJA 2ZI5A 4QT4A 3GLHB 1IMOA 5IJZA 4IF6A 4HD5A 2LV8A 3UG6A 4CKCA 3FNGA 4ZCLA 5HKOA 4UOQA 3AR4A 3G17A 2ZPAA 3H1BA 3BIOA 5CR9A 1RPKA 1G8JA 4G0YA 3ELBA 3N2KB 3BK7A 1SCNE 4RDVA 3TYZA 4DLWA 2YUIA 3IAS6 1Z83A 3H4GA 2WAAA 3DC7A 4P84A 1XMPA 1OADA 4V1YA 1R7AA 1GVQA 5H8UA 3DO8A 3ZLFA 3QC3A 3BB4A 2WNHA 1TV3A 1OGIA 5T91A 1WOMA 5AD1A 4KX5A 1FWSA 3TH6A 3ETGA 4HU0A 4IP0A 3E3MA 3G6MA 4RZ5A 4RCVA 4D3SA 4O33A 4HZUA 3GRPA 4HN4A 2D59A 2BVWA 3LHKA 1KCZA 1P81A 4RHTA 4PZLA 3LLMA 5A04A 2PZFA 3SU8A 3ZT5A 1TPEA 4CR6A 3T4CA 1CI1A 1AQMA 2FHPA 3QVKA 3L2IA 2B8NA 1W91A 8OHMA 1XGDA 4ZTUB 4NJMA 2VDWB 1V3VA 3HQ4O 3SY5A 2VVNA 3I7SA 16PKA 2W48A 4YIWA 3DTVD 2CLLA 2XB6A 3R5XA 1W73A 3LM7A 2IPGA 5F64A 3KX6A 1RWOA 1GAEO 3RBZA 2OEJA 1MB9A 2CLOB 4FPSA 5AHNA 1K8ZB 4DT1B 1Y98A 1PS8A 3PNPA 2QHAA 3F5SA 4QREA 2WSYB 5IXYA 3ONCA 1TV8A 4KFUA 3PITA 1ES9A 2A14A 1PJLA 1DEKA 2B2CA 1V7PC 5FPYA 4FFDA 2ZRNA 2DZXA 3GWQA 5CXQA 1MZPA 3EDRA 3PXGA 1IXNA 1XD2A 5I47A 2E6DA 4KCVA 2F48A 4MDFA 3OT1B 5DN1A 1GUDA 3S2FA 4BMCA 1TZCA 1JR6A 2XWDA 2VP9A 3VO9A 2M6RA 4MYCA 1W3HA 1XK7A 4CT5A 3DSRA 1JEQB 3OQMA 1ITXA 4JFWA 2VNKA 2PMWB 1ZICA 4RZXA 3MKVA 2DPXA 3V8VA 1WSAA 2ANBA 2FUG1 3WUBA 1PGOA 2FXIA 1Z82A 3G2KA 2QXUA 1VKJA 5BWOA 3ENVA 2PSEA 2YJGA 5EIAA 2JD1A 1UWCA 4RM3A 3T5MA 3ORHA 4DM1A 1VJCA 3A6GA 3N3BC 2XCTB 3N12A 2AC4A 2YLLA 4CN4A 3OBBA 2XUGA 4B3ZA 2VDLB 1YRBA 1M41A 2HR1A 3UWOA 3EZ9A 3BIJA 4W5RA 1DC6A 3VPCA 3UJAA 3FKQA 5ICSA 4YK7A 2E5CA 3MYRA 3BEOA 4C88A 4ZMSA 2XNSA 1RIFA 4AB1A 3R9WA 1C50A 3QX8A 3HSSA 4O54A 1D2NA 1ZESA 3KZCA 1F74A 1PHRA 3PQCA 2ZWOA 3K92A 1QPNA 1PSZA 4OL9A 4Z0NA 3MDUA 2C4KA 4DNMA 3VTZA 3EB3A 3RUCA 3UW1A 1XTQA 5ALWA 1IZ9A 4DUGA 4W87A 5KSYA 2DQYA 4HMQA 4RNCA 3MMTA 2L18A 4AULA 2ZXDA 4E2DA 4KEZA 3ET4A 2LNDA 3VAZA 3Q0IA 5C1BA 3OF5A 3V80A 2GB4A 2JCVA 1U0RA 3WADA 5HA5A 2SNIE 1CJTC 4Q6XA 3K94A 3O3OB 1M1UA 3FSEA 3BRCA 4ZT6A 2H57A 1EE1A 4ENSA 4YMIA 3PT5A 1X42A 4M6WB 4HQNA 3TNDA 1XLWA 4AZBA 5LQDA 4YT8A 3PR3A 1VYRA 4E4RA 1QJ4A 2P8CA 4PSDA 4GFIA 1WCYA 2Z4RA 4PEKA 2DETA 1I4DD 1TKRA 4ZU6X 2VGIA 3KPWA 1F07A 5BN4B 3TUZC 2GZMA 2W11A 5HQMA 2ZJBA 4WJZA 2PAFA 4IUCS 5JQWA 4V0OA 2PA6A 3H1AA 5C7HA 1UWUA 2F3RA 3BH7A 2XTKA 1W75A 4EKDA 5EZ6B 2GGHA 1T3TA 4US2R 4NE2A 3K0AA 3F6EX 2YINC 1DG9A 3TSWA 3PBKA 4B4HA 4ENLA 2C5LA 3CUEF 2EG7A 1G6Q1 5IJWA 2OD2A 3FKRA 1K8RA 4M7SA 2E6KA 4EJSB 4W9MC 4I2VA 1I13A 1H4PA 1KEWA 5DLCA 3OAAA 2C1EA 4D6CA 3PBMA 4PBFA 4YYCA 3Q2DA 5K0GA 3B6KA 3DXXA 2AFIA 3VR4D 1DQZA 2OB1A 2WUFA 3I0MA 2V0CA 1DWIM 1JR2A 1N6LA 5DEIA 2H00A 2Q7DA 4HUJA 4KXWA 1SHLA 3IRSA 1T3GA 3F73A 2GVLA 4DBZA 2CLEB 1HLGA 3HXPA 5H8WA 3DL7A 4IIJA 4NQ1A 3L6UA 1TOAA 3CIXA 3GSMA 3I65A 4ONVA 1QFEA 2XNDD 2NSDA 1DJXA 4Q01A 1JYVA 1JYNA 4V1CB 1ZD4A 1XTZA 1K0UA 2FN9A 1W4ZA 1V25A 1FNDA 3UAXA 2PGAA 2PEZA 2P6RA 1DWOA 3O84A 1S6YA 1JDNA 5K8LA 3LK7A 4A03A 4IHJF 2IP1A 3H2BA 3K8QA 1JXJA 1ZLPA 1GLGA 2GBFA 3PTZA 4HCHA 4BCEA 4FYHA 1F6PA 4IIVA 4FPXA 4D2IA 3Q8LA 3H18A 3MSDA 1R0CA 2IZZA 4A0FA 4YECA 2BGSA 1IWOA 4WLEA 4JHZA 4FBMA 2VF8A 1GVNB 1A3XA 5CZKA 2XJ9A 2C82A 1QE5A 3ITEA 4OH1A 1N2ZA 1WP9A 4Z86A 2XCRB 4L95C 1HTWA 5AC4A 2ZB2A 3KQMA 4ERXA 1YR8A 1ZP6A 1V6CA 3H5IA 4JROA 2J6XA 3IUJA 3IVTA 3E81A 3T3GA 1YI8A 2VR2A 2MSDB 1C3JA 1TJPB 4EG5A 1WAWA 5LZ5A 2RG7A 1I2BA 2OO7A 3SS7X 5EG5A 1XNRB 3FBGA 4MQBA 5JSUA 4EM6A 4BWGA 4LY8A 4GWGA 3B1JA 4NBKA 4CR7A 3WLQA 4IQ0A 1P0PA 2HBRA 2B1JA 3G1FA 1P91A 3YASA 3CX6A 5LU8A 1L4NA 3AF6A 4XBKA 3C2VA 3RQSA 1D2AA 3PFNA 4C05A 5A6AA 2VUHB 5EQFA 3H8JA 4YP1A 5NLLA 4YNGA 3KTDA 2E6AA 3MJTA 4MDEA 1TCCA 3ZHYA 4OI4A 4X94A 1MJ5A 3W4JA 4C6NA 5I78A 1T3HA 3ANUA 3WBWA 2DSTA 4IFTA 2ZI9A 3GGCA 1QP8A 3KJEA 1K5PA 3AR7A 2OWDA 4ZAYA 3X2EA 4FXJA 3R7MA 4FEZA 1F2TB 3KE9A 1E6CA 3DGBA 1PTJA 1E5JA 3BJRA 1ESZA 4QULA 4DF2A 4FNOA 1XNQB 1A4XA 4PX5A 4YTRA 2O8DB 3FHLA 5GAJA 2UDPA 1DJLA 4DDWA 1RCUA 4F1JA 4EUEA 3EDFA 2A7XA 4MARA 2BD0A 3K13A 5H0IA 1NC1A 5EYPB 3SLRA 3UWKA 1XPGA 4BEUA 2JKYA 1AODA 3BQ5A 3R0XA 3NEHA 3M43A 3U7JA 1TVCA 5DNUA 2WLTA 3BJZA 2PWGA 3FY4A 4CF7A 1OSNA 4A0SA 3EZXA 1P1FA 1HO1A 1NU5A 4LUCA 3M41A 3S2EA 1Z34A 4KTTE 4Q6BA 4GYJA 4R2HA 4ITUA 3P19A 1VLLA 4QQNA 3N5KA 3QHQA 4GLOA 5H3CA 3G0DA 3F6CA 1LJLA 1DWGM 2PTGA 1BQGA 4JL1A 1KM0A 3LKBA 4MB1A 4P4NA 4YVVA 4DR6B 4M36A 4RCYA 1O6FA 1R3YA 4C87A 1NVAA 3H8AA 3GJ7A 4QPPA 1W9XA 1UXJA 3ZY3A 1XEWY 3A3HA 3SLGA 3VKCA 5BW8A 5AJWA 3F6YA 3W76A 1G3UA 2IXGA 821PA 3DQPA 3GUZA 4MQ4A 2ZXAA 4ZQHA 1A2QA 4CD5A 3G89A 4LCEA 3ZLJA 5IS2A 2PRKA 1P2DA 4KN6A 2VRKA 4B16A 4OHRA 4DYVA 1ILEA 2V9DA 2D0IA 1H2HA 4MPQA 1EDOA 3V7NA 4FXSA 4BMVA 1K4KA 1XKJA 1E5DA 2O0KA 2Z6VA 5L9FA 2HBVA 3IDOA 5HRAA 4UXDA 3AY3A 3B36A 1TO6A 2O2YA 1H0RA 1HYBA 2ECFA 1Y1TA 2OOKA 1GN8A 4A2WA 5KYXB 3JALB 2XWJI 3R5EA 1KYZA 3E12A 2W6MA 4JN6B 1GG5A 4QU0A 2H3BA 4MUMA 2EEPA 1A9TA 1E7WA 1NPTO 1WY5A 1D04A 1J99A 2C15A 1VPTA 4OJMX 4O14A 4CNOA 1YUNA 3QWBA 4CEHA 2I3AA 3VFCA 4X8OA 3T3OA 2HVNA 5CQ1A 1QV6A 4I46A 2QY6A 4Q03A 3KJXA 3GWGA 4H9VA 2JGKA 2GZHA 1CENA 4RE5A 3M5PA 2QG4A 2JHPA 4OHYA 4YS6A 4RE6A 3DT9A 3RT9A 4PQYA 5H2ZA 2WVUA 1JT9A 1XRJA 1MF7A 2GEKA 2QAIA 2XKAA 4PGAA 4MW6A 4LYKA 4CKBA 4PVCA 1DU4A 2GYVA 2CFFA 4XEHA 4F3CA 4C6QA 3ZDZB 2N46A 2O3SA 4R2MA 4IICA 1V8ZA 3QJGA 4XQ0A 3D6UA 4PYKA 2VF7A 2WV7A 4ROSA 3HE3A 5LBIA 3K4AA 2WRZA 1QJWA 4G67A 1L0BA 4Z8XA 4QGSA 3UO8B 2HSEA 1WDLA 3JD3A 4ZWNA 1JZ6A 1K6JA 3E05A 1G8GA 4IW3B 1AD1A 4QXAA 4AKEA 4MROA 4MFEA 4WY5A 4WL0A 3GFYA 2YVAA 5HPYB 1YKSA 4IUGA 4WW0A 4I1SA 4ZU1X 5IT0A 3SCSA 2HA3A 4EHDA 2DUWA 3HGOA 4V1XA 3D6NA 4N5DA 3KYDA 1BX0A 3MC1A 4E2BA 2AE2A 1NF8A 5CJ5A 4B2DD 4IQEA 3FDFA 4XOIA 1PJCA 4CU8A 2O3RA 2WKQA 3OPNA 1C9YA 1R1DA 4GGPA 4ND5A 1ZCAA 5GJVC 5DHQA 3C5VA 3STGA 2YQ4A 3H04A 1XLMA 5DEZA 4UQAA 3F9CA 5KKCA 5LMZA 3W88A 3LDUA 4MPDA 2CEAA 5DKFA 1E6XM 4TWJA 1GPDG 2XYVA 5G2WA 1ZW6A 1S9HA 4PS1A 1PL6A 5C9WA 2ERYA 4DL9A 2ZM5A 4M9RA 2UUCB 2HLDA 1QVZA 2AKYA 2TODA 1M2VA 1JZQA 3HV2A 3K0BA 4IX2A 3S5UA 2H4HA 1CDDA 3IKJA 5I8WA 3DZ8A 4ES4A 1SG6A 4ZJZA 1AZSC 5CSYA 8XIMA 4EPRA 1SUXA 3WK6A 2BHTA 4ND6A 4MJZA 1WUYA 4D6HA 2D20A 1XIGA 1BAGA 3I1FA 3LXRA 3S1AB 4NZ3A 1MJGM 3O47A 2VQSA 4YRDA 2ZBFA 1XD0A 2ZUTA 1WUIS 3GRKA 5LNWA 4OMFG 2XFYA 3B53X 2J46A 2FUCA 4GIYA 5E4YA 5TC4A 4MWAD 3GLGB 1JT2A 3I4KA 2ID7A 1DG3A 2XPCA 4R1LA 2J6IA 1KGXA 1UFOA 4B33A 2V5VA 1KXQA 4PO9A 3AWNA 2WNSA 4FONA 3GU2A 4RC9A 2D2IA 1LJYA 1O4WA 2NLYA 3L3BA 5ENDA 3BHNA 5KHLB 2GR9A 4UATA 1H94A 4ACAA 2AKMA 2CYGA 3AOFA 2OE2A 4BE9A 4ICIA 4UEWA 3E3HA 2WWHA 3N14A 3PZIA 3VKKA 3WAJA 3MCMA 2ZAMA 3QYAA 3OLXA 2DGDA 2OGWA 4FHCA 3TP4A 4MLPA 3IJLA 3IGHX 2CXGA 2D8MA 1YKWA 4G2DA 3D81A 4L61A 1VYPX 4A22A 2I57A 1UROA 5FB3A 3H4MA 3UPWA 1KM5A 3QKSA 2JLVA 1JHVA 3DKKA 4UU8A 2XINA 3TU9A 4TTTS 4HK4A 1UG6A 1E15A 1Q66A 1U3CA 1ZIYA 1TXGA 2GHQA 3OUUA 3WYGA 3GPDG 1M34E 3WFZA 3UM9A 5B6IA 1OFTA 4WINA 1PYGA 3EDOA 1ZBVA 1V39A 1KO0A 5FD8A 1BH6A 4J3WA 2DPLA 3UJCA 2YY7A 2J31A 4TTIA 5TMDA 4ENTA 2V5JA 1KK3A 3IK2A 3LSYA 4RA6A 4HDCA 4XVUA 1Q20A 1XEFA 1T2AA 4HUQB 1II8A 3PC4A 3GLIA 2FOXA 3GOHA 5KNDH 3E5PA 3LQ1A 3JYOA 3HEMA 5BWNA 1DJIA 1X8LA 4O1IA 3U3XA 2NUYA 5CH8A 4RIGA 1I94B 1E1FA 4D2JA 3PNSA 2B7PA 1U0GA 3C2FA 3HDGA 4QLJA 2XOKA 3H70A 1T25A 3AMDA 1P73A 3H2GA 3P9NA 1LOSA 5AESA 3M4XA 4RTMA 4IJ5A 3H53A 3HXQA 3HC7A 3EWYA 3ITGA 4JUBA 3L46A 3W5AA 1DP0A 3WQEA 3UTCA 5J2TA 5J04A 3A2NA 4JEUA 2HIGA 1JPVA 4GW3A 3LBHA 3R9KA 4ABTA 4P4GA 2BHYA 2CJPA 2N1BA 1KQ3A 1U80A 4V3BA 3A9IA 3HOJA 2FWIA 5KVAA 1JDJA 1NH6A 3IV9A 3KPJA 3OU7A 5IBXA 1MVNA 3UJDA 5HSGA 2H4XA 3RREA 4CE6A 4GQIA 3C7AA 1WOYA 4LVGA 2DQKA 4YWJA 4JX4A 3HB0A 1CUBA 1H1YA 3AUKA 1UKYA 1BSVA 1V3LA 3LI1A 3G0XA 1DE5A 1GLVA 2RAVA 3LHIA 2J9GA 1PCWA 3QFFA 4LF6B 2RHBA 4YRGA 1UXKA 2VWHA 3KB1A 3BCJA 3UMCA 1PZEA 2FSVC 1CZOA 2WHEA 2C1XA 3RS2A 2PDIA 3FTCA 1NIPA 3E4CA 3AK4A 1KP2A 2FMUA 5HCIA 5C35A 4Q4JB 3AIUA 3GGPA 4M1ZA 5A8GA 5K2MA 1XI3A 1O6GA 4DM3A 1UB3A 4RYDA 3JYLA 5HKLA 1B8OA 5JCZA 3HB9A 1UXOA 3NGLA 2Q3LA 1VSVA 1U4NA 1Y9JA 2NW0A 3Q9UA 2HISA 2O3TA 2B3TA 4UTNA 2ORWA 1U2RA 3N7TA 3MELA 5JC8A 3RYIA 2BX7A 1J5SA 3PRKE 1KQFA 3WDIA 1Z4IA 2IZ7A 2DLCX 4K39A 2JCXA 3E1KA 4FXPA 5IZCC 3Q8XB 2X76A 1D2GA 1GZ4A 3FPEA 2OTCA 4V1CI 4D3ZA 3T0DA 3FPFA 3W1AA 1WZNA 1GUYA 4RHUA 1G8PA 2O56A 1T6YA 2XQVA 2RDMA 3GQBA 3AU2A 4FMBB 2CJWB 4F2PA 1V5WA 4O1AA 3CT2A 3UEOA 5I02A 2GGGA 4BNVA 3OQ1A 3UZXA 4LQ4A 1XYGA 1V1RB 4KQIA 4WY0B 1I0LA 3PZOA 2YDAA 4R85A 2Z9DA 4YVPA 2O6HA 2O3UA 5F2KA 5A6MA 5K3EA 4DDMA 3LKDA 4MIYA 3EOUA 4WK6A 4RK7A 5F3WB 4IFOA 1IJBA 1N5DA 3TPCA 2ZFAA 3UYKA 2YWGA 1MH1A 4KQFA 2EATA 4AYGA 1ULBA 1J0CA 1CUJA 3M0HA 4O2AA 1JQ3A 5BP7A 3NSMA 5K8VA 3FKJA 1U6JA 2VDHA 3GNXA 4HHPA 4HZMA 1WKCA 1IHPA 1ORIA 4Z0HO 3RYCB 5J40A 4FUQA 1ZM9A 2ALDA 3RUAA 2KBEA 3E9EA 3BDIA 1PFUA 4DSUA 3JS5A 1CXFA 3W7VA 4JKMA 4ZQCA 1CY2A 4KYUA 3RG6A 1YQTA 2HZGA 4WIWA 4BFLA 6XIMA 1E2DA 3MM4A 5LP6C 3TLGB 2H4ZA 4MV9A 3EX2A 1M5TA 4W9RA 2BGGA 3S2MA 1DS6A 4UB9A 4JQZA 4PTYA 3BUSA 2A6NA 4UTWC 2E4WA 2J9ZB 4EPVA 3OIVA 1XH1A 3HBFA 2F2TA 4QODA 4TWIA 3H87A 3HCBA 2JZNA 3QEOA 4UUAA 3S1VA 3COJA 3P2VA 3AS0A 5BSKA 5KTSA 1QW7A 4DG8A 2QU7A 2TYSA 1GIAA 4MPPA 5L4LA 2B7BA 4IKPA 2F3UA 3D0KA 4WXRA 5A05A 1RM0A 5CNJA 4UIOA 4B3DA 3BCUA 4DARA 1Z74A 3DZBA 5DLDA 5M5BA 4DXXA 3M5CA 3TZQA 2NZLA 1IXYA 3A2MA 2CCKA 2PU5A 3EB4A 2R1UA 2FZLA 3ZVIA 3ANXA 1UH5A 1JJBA 1VCIA 3ESBA 4PYJA 3C6ZA 3S1LA 4L9YA 3IA7A 4UTHA 2V6FA 2VRQA 2EO7A 1R5JA 4H9XA 1SBYA 4GKKB 3AUSA 3M0VA 2PLNA 3H86A 2FPLA 2WVVB 2ZIAA 2PKQP 1Z16A 2Z1KA 2NUPB 4R16A 1XX1A 1N6HA 1SGWA 1UM9A 5LDHA 3T0BA 5LKRA 5AW6A 1T1RA 3ICPA 3EWXA 1SQ6A 4MQUA 3IO5A 5LP6A 4A2QA 1ISXA 1M2JA 3BLLA 4DVJA 2ZRKA 2P2DA 1SOVA 2W79A 3WYBA 1KMNA 2E1DA 2CMFA 3DHWC 4JGGA 4OMCA 4C0HA 1IHXA 1Q3NA 5FWNA 4UTWA 1UD4A 3TDKA 1G20A 1EWKA 5GZ3A 5KYWB 2O52A 3OLVA 3S2YA 3JWJA 4JYEA 4W88A 5EB8A 4IMAA 4DC0A 4QXRA 4WN9B 1KFEA 4TLLB 1Z6KA 4RTRA 2X5KO 1NYTA 3PBYA 1DIGA 3G1RA 3ZU6A 721PA 5DX8A 1UWKA 5HZHA 1SK9A 4Q4DA 3OBKA 2BJHA 1UPPA 4J7UA 1HXHA 4WKNA 3TXYA 5I03A 3O5AA 4XBJA 3SQNA 1WDTA 3IBYA 4G5HA 4JKIA 3KT8A 1N6KA 3SN6A 5EIHA 1AGPA 3V48A 3E8MA 2FK7A 1S8AA 2ZETA 5DYWA 4PPFA 1SXJE 4AJKA 4H31A 1R66A 2ATVA 3NYZA 4IEIA 1JLMA 3GG1A 3EEBA 4XGQA 4NIMA 5DGHA 1N1GA 1NOKA 5FACA 4M22A 1GFZA 2OGZA 5JAPA 3MCOA 1LD3A 2C19A 2ZXQA 1ZIOA 1P1XA 3UJ7A 3TAOA 3LZ5A 1KZ6A 4O1DA 4I9GA 4CV0A 4UQEA 2GJKA 3KVKA 4QLBA 3A21A 1DFGA 4X9YA 1N75A 5JG7A 1Y5XA 5TVGA 4HNOA 3ISTA 5LA6A 1IAQA 1SHJA 2ZB7A 4ESVA 2L82A 3CZ9A 2H8ZA 1E3SA 4OOFA 3N3MA 1VL0A 5JLAA 3BKWA 4F6RB 3UBPC 4NNBA 2WJIA 4QJ5B 2WHRA 2VJOA 2Q1SA 3AZRA 4Y8VA 2EKQA 4E03A 2OQLA 3MUZ1 2RH8A 1T2NA 3M89A 4HQOA 2CDNA 3EIQA 3QOMA 1E40A 3KV3O 1T2FA 3CVJA 4TX8A 2C4VA 5SICE 1NOIA 5CM9C 5HWNA 1QC5A 3QUCA 2WJJA 1B26A 4U2KA 4OM7A 3BK0A 1ADYA 2EGGA 3VKWA 3DDCA 4RQAA 5TF0A 1VBHA 3OP4A 4GUIA 3VOHA 4AFNA 5HDRA 5LIUX 3BJFA 3O6CA 1R4MA 1HLPA 2ZJAA 3BPWA 3L5LA 1PJ4A 4MRNA 2V3WA 1GT6A 4M0FA 3VPBA 2INZA 4A8TA 4DUGD 5FWYB 1VYSX 2XNDA 3ZH9B 2CLMB 2PL9A 1Q17A 3OWHA 3F46A 2C5SA 4C4OA 4HXFB 3DLHA 1KQPA 1IUKA 4NS1A 1W5SA 2VHXA 2PE4A 2QGYA 4C6BA 1PNRA 4JB0A 2QRGA 2XISA 4CFYA 4OQZA 3O75A 3AS1A 3NC4A 3F9IA 3WQ6A 1EKXA 1AJ2A 3BSFA 4RMJA 1YMYA 2IKSA 4BQOA 4MX8A 5G0UA 4H41A 2CNWA 1W0CA 5A2AA 2XY4A 1DIOA 3C8HA 4WX2B 1CBGA 1U02A 3VR6H 3DG9A 3N2TA 2NOAA 5DWVA 1J2TA 1Y3CE 2C9DA 4UE3S 4IGNA 4X84A 1NNLA 5HM8A 3KAQA 1CUIA 4ZFMA 2UV8G 4JGDA 3I04M 4UHHA 3QX7A 1E9CA 4UDNA 3G9ZA 3NQBA 1YE8A 3NBMA 4IPNB 2DVUA 1AKUA 1L5YA 3URAA 3FHJA 2AH5A 5LQAA 4F5EA 2FFIA 2OWWA 4LJKA 3RTEA 2ZYAA 4KEMA 1TZBA 1W2HA 2I2DA 1AMKA 1D3GA 3NNSA 2GLUA 4QX4A 5LA2A 2ZPUA 3MNFA 4UBLA 4JUIA 2GQ3A 2FJPA 4Q3OA 2VNJA 5G1MA 4M0PA 4PG4A 4JI5B 5GWXA 2DY3A 2I7TA 4IIUA 1FDOA 4TVOA 2AN4A 3C45A 1U28C 3N4AA 2Q1TA 5BSGA 1Z4OA 4GVIA 4WKAA 1P7YA 2I7VA 1HE1C 4MIEA 2NSXA 4KGLA 1QGAA 4WZ6A 3AIBA 5A7HA 3HFTA 4F21A 2QAFA 4RKWA 1V51A 1NM5A 3PRYA 4GPTA 4ER0A 4LB3A 5K8TA 1JDPA 4CM4A 1DE6A 5ALUA 2DB3A 3O05A 3OEXA 2DX7A 3W23A 2BT4A 1ECFA 4B74A 4P7QA 1O03A 5ARBA 4JA0A 4E09A 2Z2AA 3WIUA 3FYUB 7AT1A 3HEAA 1EP2B 1ZUWA 3V7FA 4MGYR 4ARSA 2Q3OA 1BGXT 3QELA 3NR2A 4BLRA 2LPMA 1JKMA 3IQXA 4TM8A 4MQFA 4QYIA 2ZGVA 3HR4A 3V5CA 1SUBA 5E0FA 4L75A 5KZDA 3PNYA 2YZMA 3F90A 1J56A 4ND4A 4A3RA 1AY0A 2Q2VA 4CFZA 5GJWC 4K6FA 4WFKA 3MCNA 4LYJA 4GRIA 4QDUA 3CL7A 2BGMA 2ZJZA 1PWZA 1WE5A 3P5YA 1IUNA 4TZ0A 1NVUQ 3BAKA 4NCHA 4CEIB 4JEHA 1QGUA 1Z29A 4ERNA 4I55F 1VG1A 3WXBA 1BXBA 1NRIA 5D03A 5CNIA 4GXTA 1YRYE 2X6QA 3ZVHB 1JEYA 4GZLA 4KJZA 4R6WA 5IDXA 3KYIB 4E7OA 4HSOA 3S8HA 3NUGA 1OBVA 1P74A 2R60A 2O8NA 3QXBA 3RV4A 3HN6A 3FXYA 1JG9A 1U2QA 3TC6A 2A5FA 4QWMA 4OAOA 4EAYA 4WMLA 4RLFA 5IAOA 2ZUCA 3TI7A 5KKNB 4O4JB 4EJMA 2JIWA 2GKGA 2X8AA 3B06A 4UREA 2GYIA 2A9OA 3WO8A 1TCUA 1ZGJA 4XAGA 3N70A 2Y9PB 1YHYA 2FP4B 4IO0A 5AXCA 4EF8A 1KI2A 1KWKA 1PHWA 4BJ1A 5ECUA 4MI6A 4K3ZA 4M3NA 4PUJA 1X6LA 1E9BA 2CWXA 2C57A 3RRNA 4WJXA 2I4NA 2ON6A 4YO7A 3RKRA 2VPZA 4CM5A 5EKYA 1TJYA 2VUTA 1R0WA 1AO3A 4D74A 3TTTA 1VJ0A 2OVBA 4G5FA 3JARB 5U4NA 3UWZA 3IKTA 4DCCA 5DXYA 4J0CA 4OX9B 1IG0A 1O95A 1RQHA 4HL6A 1I80A 3MPUA 1BE6A 3LVRE 3JRNA 3PBGA 1H2FA 4NASA 1H0IA 3A4AA 3EX3A 3D7NA 1ZHAA 2GUYA 1WMFA 3HU5A 1PRYA 4RL3A 2VGBA 5IAGA 1HMYA 1YOVB 4FFSA 2IK8A 1GEGA 3A6OA 4HNVA 4J3TA 4BWLC 1LF0A 1GQSA 4BVBA 2NU7A 4NHEA 1W36D 5CX1A 4IH1A 4EO4A 3W0KA 3PUHA 1S5PA 1Z48A 1ONEA 1AKTA 4B73A 3EXEA 4U39A 4HTBA 4DKXA 1H50A 1TV2A 3QOFA 1I8JA 2FMOA 4BL5A 2FTKE 2BWJA 3PHCA 5HJYA 2IYQA 3OGVA 1D2EA 1R12A 2WG0A 2IEDA 4J3FA 4F2UA 3H2ZA 4KO3S 5K0SA 1YR2A 3PWTA 3KR1A 5AZ1A 1I9CA 2P9CA 5CCXA 1AKEA 1V3QE 2ONJA 4G9PA 2WIBA 4D9EA 1ESCA 1NOFA 4DIDA 5ITSA 3EN0A 4CETA 4WUTA 2XH8A 4QO7A 3WD0A 5TBOA 3TA9A 1SPBS 2BFEA 3CZCA 3VDBA 1E6WA 4W8LA 3NC0C 5EE0A 3LV6A 4MWAC 1ADGA 1QDLB 1TUGA 3SCQA 4W1QA 1NXQA 4I3GA 3WELA 1EUDA 5FAXA 2CLCX 2X0IA 2R6GA 3PD0A 1ELOA 2VJKA 4OL0A 3DEQA 1DL5A 5CVEA 5BN1A 3TTSA 4LRSB 4H7CA 3FFTA 2GJLA 3CWOX 1ZFNA 4B2DA 2G3NA 2D0GA 3WX7A 1IV8A 3FAXA 1K9DA 5TNVA 5KOJA 3NYQA 3TINA 3H4VA 1XWWA 2F6RA 1VIWA 2W6CX 3H5AA 1MX9A 4BWLA 3QLUC 3MI3A 1T34A 4ADUA 4DN6A 3H3JA 2B99A 1KA9F 3M9WA 2BUCA 1NFFA 3U0VA 1N7GA 3U7QB 5IBRA 3QUTA 5AYZA 1UZNA 4ZQMA 4GGMX 3AJ9A 2HCJB 4XDZA 1VFOA 3WKEA 5BSFA 2UY4A 3QV2A 2C04A 4R7TA 2W2XA 1JEEA 1JG6A 1XU9A 4KYTA 4CKXA 4F06A 3W6PA 3WA6A 2H3DA 2C6QA 1L7EA 1WHTB 4V0LA 1ZL0A 3L8EA 5B1DA 2PSSA 3B85A 2WCSA 3KRTA 4AP6A 2IITA 4B32A 2VJXA 4KWVA 4DC9A 1P5HA 1E9FA 5LQNA 2E3JA 3ZM8A 1U7WA 4IHJB 2C9CA 3GP8A 2J3LA 1UT5A 3HFYA 3MQ2A 1W581 1KDTA 2NQ9A 2WYHA 1FDJA 3B5EA 2G76A 4GPNA 1UINA 2HQ1A 3MO7A 3DFNA 4MWAA 4FFPA 2CMKA 4WNIA 3NQMA 1N2GA 2OYMA 1X80B 4NZPA 3AMKA 5TEVA 1J8YF 3DCPA 1WF3A 3R7NA 1LG2A 3CINA 3SCPA 1DQNA 5I23A 5CYFA 3R7LA 3V8RA 4DZTA 1N1DA 1O6CA 4GKVA 3TW8B 4URXR 4MRPA 3QZUA 3L4EA 4ZXFA 5FI8A 5IBQA 4UNSA 2A9RA 2I3BA 4MLDA 4R7WA 2PWUA 4DMKA 5HOSA 1LQUA 1CUVA 1WE2A 2V74B 3RIGA 5T4BA 4I81A 3W2JA 4Y9TA 2C7RA 3DEYX 3DB2A 4JLAA 5K0BA 1I7QB 1DSSG 2OB2A 3QLUA 2A3RA 1Y65A 1X2EA 4XK2A 1QXSA 1YDGA 3EWIA 4F8EA 4DGQA 5CGQA 2C77A 4FE4A 3T6CA 1NE2A 3ETCA 3H2OA 1DTEA 2AMLA 2NYAA 2NPFA 3C8NA 2OCDA 3AF0A 1T8QA 3L21A 1Z6XA 1HYGA 4XLTA 5C9UA 3FW1A 2W98A 5H70A 4CMIA 2ALJA 2FW9A 1KOGA 4UHJA 3ABZA 1FOEB 2OQ2A 2RD2A 1OWOA 5ES3A 2A92A 2DPHA 2XUFA 1ENOA 4NLLA 1OX5A 2BODX 2CLDX 2OKTA 3JD1A 2ZRAA 3VFLA 9ABPA 1L7BA 2YWHA 4EFLA 3RABA 3A6JA 2QMJA 1TNDA 3NT4A 3IELA 1AGXA 1Q7RA 2I0FA 1RBAA 5DHUA 4JJAA 1P0FA 3OQOA 2R4TA 4RF4A 2Z0MA 1TIPA 4C6EA 3PC7A 2XWSA 1LJUA 4DLTA 1WWKA 5I77A 2JHFA 1R3UA 2O2DA 4YWIA 4QGBA 2WJ6A 3DXZA 3EB9A 4Z3DA 4YPOA 3ARPA 3BRSA 2PRHA 1TAHA 3P20A 3SHWA 4J76A 4M9ZA 3W79A 3U56A 3S5JA 2G3IA 4PYOA 5EMNA 2HO4A 3EOOA 3UGQA 4H1HA 1PV2A 3F4BA 2C5BA 2D3TA 2NYUA 4BZXA 1KKUA 5KTOA 5BV7A 1MC8A 2WD8A 1XZEA 5JHGB 3CUVA 3KHKA 3ADPA 2AQVA 3M44A 3MSXA 1AHIA 1L9XA 1UOEA 2YYYA 2QEZA 3O6VA 3VUPA 1C7RA 1HGXA 5IC4A 5J1SB 3LPFA 4OKDA 5TS2A 2Q4RA 3CTTA 2DQSA 2XA9A 1FLDA 3ZX5A 2BEVB 4AY7A 1WPRA 3QFWA 4MI3A 5FTNA 1C93A 3R6WA 4AMZA 4U7FA 1S5NA 3JAWA 3PX2A 3Q65A 1UW9A 2A4KA 3DAFA 1J0XO 2AKEA 4H9YA 3MFQA 2GF9A 4ALKA 4JNYA 4H4CA 2WF9A 2P1ZA 5FA6A 4AT1A 3ZCPA 1U63A 1TGYA 5CB0A 2ZQ0A 4S0ZA 3AB7A 4LGVA 3CPEA 1WXHA 3AEUA 3OFVA 2AFHB 5L40A 1J20A 2OHGA 4GOOD 5K03A 1N9KA 3IWPA 4DEVA 2C54A 1EDDA 2YCKX 1NOJA 3POCA 5JYBA 3RJTA 2Z1VA 5KCZA 3T09A 4D8UA 3IUNA 2GSDA 3RLIA 3D02A 3GFGA 4FA3A 3L67A 1LSJA 1DNPA 3STUA 2C2WA 1DAIA 4ECAA 3QJYA 4AQDA 2OTDA 1KMQA 4URUR 1KZ1A 3QG1A 3DPSA 2HHJA 3NM5A 2Q28A 1TTHA 1GP2A 3K7EA 3VOCA 4LVBA 2QMHA 5K6TA 4BX3A 3F4VA 2NSHA 4J3NA 2PBGA 2UY2A 1JW9B 5K9DA 3FFSA 3L4TA 2CC2A 2PLMA 5A0VA 4YQZA 1CPYA 2DZTA 3JTMA 3QVGA 1F2VA 4HX5A 3U17A 4LKRA 1O12A 4OGGA 2LKCA 1GZ5A 4TVSA 3HP1A 3IT3A 2P3LA 4KDCA 4QNRA 2E6YA 2NO6A 2A9JA 3DUFB 1PCKA 3ANYB 1ZUHA 3PIIA 1OA1A 3ZMRA 1LWHA 4TX9A 2F9MA 4RA9A 2IBSA 3Q3JB 3TOXA 2QLJA 3PF9A 4CKYA 4H6KA 4LAUA 1JSRA 1KYWA 1X7ZB 2DFPA 5JSHA 2C3OA 3JXEA 4YJHB 3H16A 2GA9A 4GYWA 1GJRA 5AJXA 5D5HA 2OK8A 5CT8A 3CURA 3BCHA 5IN5A 2HTEA 1FBNA 4DYHA 5BSUA 4AAJA 1E9AA 3V5NA 3EK2A 2R91A 4AY6A 1OX4B 4MVJH 5G41A 1C29A 1HIZA 2TMDA 1DC8A 1L4FA 1AT1A 4NF7A 4ZTYA 5E6YA 1TUEA 4FWTA 1TU4A 1L5WA 2Y4OA 4X1YA 4DELA 4TMCA 4BQRA 4A0GA 2BFCA 4EW1A 2GFQA 3QVQA 1CXZA 4QECA 1QQ7A 4S3KA 5H4GA 2QL9A 3FRJA 1EIBA 1E79D 3VC7A 2LCIA 3EWWA 3NHKA 1SKBA 2B1RA 5EN4A 1R7OA 1EIZA 4RTPA 3AHXA 1LGYA 1VCOA 1CUUA 4AJHA 4YS1A 2PHZA 1ZNWA 2YIJA 4OHOA 1YDEA 4TS1A 3I9NA 1VB3A 3OIUA 3RJZA 3L04A 2D0PB 4HB0A 4D25A 4K9PA 1ITUA 2NO9A 1YDYA 2I2AA 3FG9A 3RUDA 1JEOA 4PHFA 1JPMA 4Y2SA 1ZN2A 2EQBA 3Q3GE 3IHWA 3H97A 3QHPA 2FTPA 1VI2A 4A0HA 4K1GA 3AZQA 2AOWA 3I28A 1U3VA 4TMBA 4HBKA 1JF5A 5EIXA 4UR9A 4A7PA 1EO5A 1C8YA 3AUYA 3SZLA 4L6HA 3B89A 3EVEA 1GLNA 4XZWA 3B0VC 3HDYA 4W6ZA 5M3WA 4AVFA 3TCEA 2Q6LA 4MYSA 2I55A 4TKZA 1V9CA 4EUFA 1LX7A 1FFYA 5GADl 2IIBA 4B84A 4FIDA 1H62A 4PS0A 1PHPA 4ARAA 4QOJA 1KWGA 3EDYA 5K4XA 1JB9A 1B3ZA 1EM8A 4LPCA 3AR5A 3BGOS 4K9NA 3KP1A 2ODEA 3L7KA 2MTBA 4HBZA 3ZU2A 2ZR7A 2V8ZA 2UUPA 4M1SA 2WHYA 3U5UA 3A6EA 1V9LA 3DP7A 1I2NA 1E8MA 4XW2A 2GVGA 2IXFA 2ZJ0A 2GPYA 2K7ZA 1X2BA 3M5WA 1SKYE 2WWCA 2NYVA 2O7VA 4PC2A 3SDBA 2V1XA 1CT9A 3AH8A 1W87A 4G9GA 1TWWA 2NO0A 4N0DA 1CP2A 4S1PA 1CUFA 2NQJA 5CKSA 3F49S 1EESA 1QK0A 2ZEJA 1NQUA 1WULS 1R46A 3OA3A 3O7UA 2IQDA 2W4IA 2QI9F 3ZJ8A 3DGRA 5C8ZA 2KI5A 3KL3A 4AJIA 2IL1A 1THFD 1F4PA 4XDHA 4IL2A 3VZQA 3Q45A 5HQEA 3DDNA 3THCA 2IOYA 4Q7JB 4NAUA 4LB4A 4AUBA 1VJGA 2OPBA 1GNXA 1RLTA 2BELA 4Y3UA 3ZDBA 3UHPA 4FBLA 3DHEA 3GIWA 4FGLA 3KRZA 1AQIA 3NGMA 4O4JF 3LEPA 3GLTA 5LSMA 1UD3A 4YUWA 3TGPA 3EEQA 2H1FA 1HVQA 1ZGZA 2X0SA 4C3VA 1SZCA 5CYPA 1TYCA 2P3SA 3CZQA 2B5WA 3PTDA 5FO0A 1EX6A 3FAZA 4RQBA 4G5DA 1RACA 3GR4A 2XB2A 2B35A 3OC6A 2WDZA 2W6PA 3JZUA 2PSHA 4YTTA 3QOYA 4UFMA 4X3PA 1RWXA 3RUHA 3BGJA 1IXZA 1M74A 2WSMA 2V5DA 2G08A 2AJCA 3M0ZA 2WM3A 3CNLA 5DELA 3RRZA 1FWRA 4LZOA 4O59O 4C91A 2GM5A 4AY2A 4GX8A 2Z5GA 2I7GA 3NQFA 1LLWA 1T9KA 4YMLA 3L7MA 3QBUA 3WH6A 5DW0A 4ND3A 5MKGA 1XFBA 5AHMA 3FN9A 3ABIA 1VMIA 2FK8A 5L51A 2AT1A 1HZJA 5FEMA 2HNHA 2OO3A 4ZPJA 4EGFA 4RNJA 1I1XA 5EIWA 4RANA 4FB5A 2IXAA 1ML3A 3FJLA 1JV2B 5CFOA 5DQPA 5B1SA 1I5RA 3IIMA 4CKWB 2RH9A 3LQ4A 1PWMA 4UMAA 3SUUA 4ZGGA 2AX4A 2WKSA 3INNA 4U31A 1JBQA 2I9UA 4CCWA 1Z37A 3LENA 3B70A 3VDAA 1VFNA 1Q6RA 4FEGA 5JIWA 4ETMA 4YP6A 4ZCPA 1GO2A 3VD3A 4FGWA 1S38A 5FBQB 4GL2A 2W2LA 4WH0A 1PYMA 3ZBUA 1X7XB 3L0CA 1F7BA 2ZI3A 1WKVA 2RDWA 4HJRA 2ZWMA 4Z6KA 3F7JA 5J23A 2G88A 1ONBA 5CCBA 4BEJA 2FEKA 5CSSA 3L02A 1E3WB 4CU7A 2WJGA 5FTMA 1MFVA 3HMQA 2R1NA 3GHTA 1KKMA 1DV2A 2HRZA 1YE6A 3QEAZ 1C5KA 4TQ9A 3KRSA 1V3MA 2C29D 1YV9A 2X5JO 4GWLA 2D3LA 1FWCC 3CF0A 2GXQA 1TWDA 1LM1A 4OHBA 4C7MA 4O1CA 1GCAA 3M47A 4LBVA 1Y1PA 5E6ZA 3PWGA 1B0PA 5HTOA 4MS1A 1SU4A 5HOQA 3FVVA 2VQEB 3QY9A 4Z4QA 4HDSA 2GUBA 3S2CA 1TCAA 4UFNA 3JQ7A 1VRWA 2NVUB 1R8XA 5IM4A 3QHAA 1W56A 4HQRA 3R24A 5CBJA 2F4NA 3RJ9A 2R8WA 2QUBA 1R8SA 2HPZA 4KGDA 3N1AA 1VE7A 3TMAA 4EHJA 4GF5A 3HL4A 4AN0A 3DVLA 4J0EA 2V0TA 1NW7A 5CTAA 2GBIA 2J78A 1AQJA 5C7OO 1RBYA 5AR1A 3E7DA 3GBDA 4EHKA 1IHYA 1NQAO 1SFLA 4DBWA 3NHLA 4LV9A 1ZJIA 1G7TA 3D3EA 7GPBA 2B0JA 1N3LA 1J24A 1FDUA 1U8ZA 4GVHA 4G8DA 2VX5A 2NWQA 4U2FA 2A5YB 5IXSA 1FWDC 3DOPA 1TRKA 4QQFA 2PLFA 3BOXA 1DJYA 2CNWD 3E2QA 1K7EA 5HJXA 1ZGHA 5FOUA 4F12A 3HCAA 3NHRA 1A5BA 2UZ9A 3BW3A 1PTJC 3ECSA 4HV4A 3IJEB 4MY8A 3DBHA 1PL7A 3BL6A 5HVNA 3C6BA 4RD3A 2VK2A 3KYCB 2QKYA 1AL7A 4ACZB 5ED4A 5DULA 1IEVA 4E14A 2QUKA 3W7GA 2H1OA 2Y85A 3UV6A 3NQAA 3WK5A 3QTGA 4EWLA 4KUGA 1GTHA 2GS9A 4FOKA 2B92A 2WB5A 3EF0A 4OBXA 1GQJA 4ZXPA 5KMGB 1W36C 3AIVA 1MMFB 3F1KA 3D1LA 5LKAA 1UUOA 4BJ3A 1BF6A 1R87A 4FMDF 4MULA 4IMFA 4AFYA 4XM1A 4MS3A 1Z2CA 4PLFA 4DY4A 5J3JA 2I76A 4EY8A 3O8AA 4MW1A 3TL6A 2H3EA 2ZUEA 2YYUA 4GXNA 5LIYX 5CH9A 3IVAA 1J70A 3N2LA 1B0ZA 1KC3A 4ZK6A 3HJRA 5A2QA 4KMRA 3U7GA 3NWOA 4J35A 4JEMA 4N4AA 2WJAA 2J0VA 3I1IA 4RXUA 2IY9A 3MY9A 3U19A 2FVKA 4QYSA 2JIEA 1TPB1 2FIQA 5CB6A 1TK3A 1WQ4A 1V4YA 2PRZA 3PC6A 2PUDA 3MV11 5I7UA 3MXOA 1ODUA 3B8HA 1UA7A 4XH9B 3TNOA 2AI2A 4JR1A 4KFRA 2DPEA 1MIOA 3T7IA 3F4WA 1F5ZA 2XZTA 4S1OA 4ZP1A 2XRFA 5A69A 4Y9OA 1UZDA 1VKRA 1LWOA 5L6MB 1V77A 1EWRA 3MTAA 2WNIA 3GD7A 2YOGA 2FH8A 1RJFA 3NZGA 1KERA 1CB7B 3NA8A 5DBFA 4KAJA 4FKBA 4CG3A 2BN4A 4YJ3B 1E59A 1MFZA 4WXPA 2A7PA 2ODPA 2ZZ4A 2X1MA 3VINA 1EUQA 1OJ7A 4M9XA 1AZWA 4HLQB 3L9WA 1D8TA 6PFKA 1DRUA 5AKIA 5JYCA 1IBMB 3W81A 4ERGA 1OHLA 2Z6JA 2WKJA 4LVCA 4U7TB 5AY7A 4Q8TA 1ABEA 5IK2D 4EHHA 5KITA 1EA5A 1ZOLA 4CMCA 4N3CA 1SVIA 3B13B 1DJNA 4IYJA 2VX6A 2AZXA 2Q46A 2R1MA 1LL6A 2HLHA 5FT9A 3KAPA 4BNDB 3NL3A 5SZKB 4IQFA 4IAOA 1KFKA 4B5KA 2UZ1A 3RFCA 4E33A 1HW6A 4DCPA 1KOJA 4W82A 3LXUX 1PT5A 1MJFA 1RYZA 2V0NA 1CE8B 3QH2A 3W5BA 1J8VA 4EITA 2GGIA 1Z7BA 4LV4A 1RYMA