4G56A

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
626
structure length
617
Chain Sequence
RVSSGRDVACVTEVADTLGAMANQGFDFLCMPIFHPRFKREFYKEPAKSRPGPQTRSDLLLSGRDWNTLIVGKLSDWIKTDSEVSRIRKTSEAAMQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHVGHHSTMFWMRVPLMAPNDLRDDLIENEPGEERTWIWWHNFRSLCDYNKKIALAIEIGADLPSGHVIDRWLGEPIKAAFLPTSIFLTNKKGFPVLTKVHQRLIFKLFKLEVQFVISGSHHHSEKDLCSYLQYLEYLSQNSPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQILMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQVTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDDGVSIPGEYTSYLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFHHPNKDDVIDNNRYCCLQYRVDLNTVLHGFAGYFNTVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPMREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transferase
molecule keywords Hsl7 protein
total genus 169
structure length 617
sequence length 626
chains with identical sequence C
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4g56A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4g56A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4g56A02
2Q02A 3LCCA 2XYVA 3D2LA 1VE3A 4M7RA 3SSOA 1F3LA 3HCDA 3HA7A 3TFWA 3HCAA 3FTFA 3TC3A 3R3HA 3EVZA 3P97A 3GIWA 4QE4A 1KP9A 3NDJA 2BM9A 4OBXA 3FTEA 3LBFA 4ZB5A 1VP3A 5DTMA 1XTPA 3C0LA 1SQFA 2ORED 3LKDA 1NBIA 3ELDA 5LQUA 4RTKA 1XYLA 2Z6UA 2OBFA 2HR1A 4YUXA 4M36A 1XICA 3G8AA 5DM2A 1XLKA 1FBNA 1AV6A 2UYHA 1K77A 3G2QA 2EJUA 3EVCA 4XUEA 4E32A 3SSNA 5DX1A 1XLAA 1G55A 3H2BA 3B3JA 1NBHA 2ESRA 4X41A 2ZVJA 3G2PA 4GOMD 4L7VA 5AVHA 4PONA 4KIFA 3SGLA 5FCDA 1UWVA 4AZTA 1XLMA 5XIMA 4PWYA 5LQKA 1QYRA 4FT4A 3M0MA 3JWJA 5E9JA 4C03A 2FCAA 3HA5A 1P91A 1I9GA 2DPMA 3EGVA 4PNEA 4R8RA 3KQMA 2PLWA 1NW5A 2PVCA 3DXYA 4AZWA 3CJTA 4E2YA 4QVGA 3R9XB 4RTMA 1XIIA 1XDUA 2PY6A 3BZGA 3EMDA 1A0EA 4PYOA 5IKMA 1SKMA 2IP2A 2P7HA 3DH0A 5K01A 1FJXA 3LECA 2ZBRA 2KW5A 3MGGA 1O1HA 1AQIA 3OBEA 2G8NA 4EKIA 4RTLA 2ZIFA 4QPPA 3QOXA 5DPMA 2PXAA 5CVJA 5DTRA 5K0GA 2P8JA 4RTNA 3B3FA 1TW3A 1RJGA 4KWCA 2XISA 4QEHA 8XIMA 2V7EA 3KPJA 3LBYA 3UA4A 3KQSA 4ER0A 1KPHA 1QAOA 2P41A 4DZRA 2XVMA 4ER6A 4PYMA 1QTWA 3IYLW 3RODA 1BKYA 4ER7A 1RJDA 2B2CA 3BGIA 2B3TA 2ZZNA 3U0HA 2CL5A 5ICEA 3VNMA 3FPEA 2QW5A 3IEIA 1OADA 4RX1A 1XP3A 3OPNA 1VL5A 2AS0A 4PYKA 2ONZA 1YFLA 1WZNA 1Y8CA 4KIGA 4E31A 3PTAA 1XINA 3BWBA 3EVDA 3BXOA 4FSXA 1XLIA 5F2NA 2QUMA 1I1NA 4RV9A 3UJDA 2ZTHA 1M0EA 3AY0A 4ER5A 4GBED 3M0LA 2IDKA 5DTQA 5T67A 1N2XA 2NNWB 2GUBA 2PT6A 3P9KA 3PB3A 3UJ8A 5DM4A 5P8WA 1M6YA 1I6NA 3FRHA 3B3GA 2PX4A 2AVDA 3HNRA 3UU0A 4A8LA 3P71T 4P7FA 3TRKA 1XIMA 4YMHA 3ER8A 1KXZA 1TZ9A 2H1RA 5LQCA 1VBFA 3ITXA 1XVAA 3UA3A 2IIPA 3KWSA 1YUBA 4PCLA 2JHPA 2GAFA 1D2GA 3THRA 2I56A 3I53A 3DBNA 2O57A 4KW7A 4LECA 5EEGA 3S68A 2VDVE 3DMGA 4RYLA 4FP9A 1QAQA 3KBWA 2FRXA 3CGGA 3MTEA 3PFGA 4F86A 3EVGA 3EEOA 2QE6A 2GLKA 2QYOA 3ITLA 2QRVA 1NW3A 3EPPA 3BWWA 5JR3A 5EHGA 3IUHA 2I57A 3P6LA 2OKCA 4RTQA 4QDPA 3GRYA 3ID6C 1A0DA 4KDRA 4PGHA 4R8SA 3JWGA 1RI2A 3QOWA 5KQRA 2P1DA 1BXBA 4U7TB 5H6HA 5B7ZA 3GRUA 3N4AA 4HNOA 3ERCA 1Q0SA 2BZGA 2IGTA 3KPWA 5K0EA 3IUDA 4XSMA 2VDUE 2HK0A 1RI5A 3CC8A 3CJQA 3EVAA 3OE5A 4IV0A 5LQJA 5K03A 3HVIA 3TM5A 4A8NA 1MHTA 4RVHA 5C9ZA 3KQWA 4OQEA 4Q7IA 2QM3A 3KQYA 5H02A 2ZIGA 5H1WA 1JG3A 1YX1A 3KBNA 4QEEA 3P2IA 4HG2A 3UFBA 4E33A 4KDCA 5K0BA 1ZQ9A 3LCVB 4K6MA 1S5MA 4RTPA 1UFKA 1F38A 1WXXA 1JSXA 3HTXA 3PLAE 4QVKA 1RJEA 3FTDA 3TM4A 2NYUA 3U81A 2PBFA 3NJRA 2C7QA 4R6WA 5T6BA 1R18A 2CMGA 4YUWA 5IH3A 3CVOA 3OZSA 2VDWA 2K4MA 3NDIA 1I60A 4MQ4A 5EMKA 1DE6A 4XISA 2H11A 4RTSA 4BLWA 2P35A 3T7RA 3LHDA 3M70A 1ZHFA 4PGGA 1RI1A 4DF3A 5DX0A 3ELWA 4YUYA 3KCLA 2XYQA 5E2AA 1A0CA 2IH5A 4DM3A 3AXSA 1DCTA 1VQ1A 4CXMA 3G2MA 4FSDA 5GIPE 1DE5A 3MB5A 5KQSA 5GM1A 3FPGA 2PXXA 4PYJA 2BR3A 2XINA 2PWPA 3UWPA 1GW9A 4YTSA 5FQOA 4LWPA 1EJ6A 2ZFUA 3I9FA 5FA8A 5M5BA 4LG1A 3P9IA 5F2KA 3REOA 2PX5A 4HRAA 2JH8A 4PYNA 5EQJB 2BM8A 5EMJA 2XIMA 3EVFA 3GXOA 3O4FA 5HIKA 3G88A 4EACA 3AXTA 3UJCA 5TNVA 4HHLA 4NECA 2BH2A 2AOUB 3LMZA 4ISCA 5DRYA 4MHTA 3ITOA 4YTUA 2PX8A 4HH4A 2EFJA 4PYLA 2GB4A 1YFJA 4XIMA 1QZZA 2PXCA 5EMLA 3PT9A 2GVEA 5BW5A 2J6VA 2PV0A 3OCJA 8MHTA 1XIHA 3VYLA 2VS1A 3MCZA 1XLBA 1X1DA 3OU2A 4Y30A 1YF3A 1R8YA 1QT1A 1M6EX 5HIIA 9XIAA 6XIAA 3LL7A 5GP1A 5DXJA 4EMSA 4US6A 1XLFA 3AALA 3A7DA 4HTFB 2QRVB 1L3BA 4E2WA 4EQZA 1N7JA 5K05A 5CCBA 2XVAA 1HMYA 2UYCA 2OB2A 1H1DA 3CNYA 1B42A 2ZULA 1JG1A 1YZHA 3DXXA 5DSXA 2G70A 1SUSA 1R8XA 5EGSA 2JH9A 5BXYA 4HTFA 3M0HA 1XDZA 2AOTA 5B1SA 3TKYA 1L9KA 5FULA 2XBMA 4XUCA 2BR5A 5HIJA 1SG9A 2UYOA 2HMYB 3ITTA 1SVUA 3TLJA 3FUUA 3GO4A 3GRVA 2IH2A 1JTEA 4PCAA 4DCGA 4HGYA 4AZSA 2JG3A 1SQGA 2C7PA 3KBJA 4QQKA 1XYMA 4W4QA 3LDGA 3HVKA 4OA8A 2WK1A 3KCJA 3SVZA 2GS9A 4GEKA 4GOOD 5K0JA 1INLA 1HNNA 1JG4A 1MJFA 3DOUA 4MTLA 4YV2A 1RI3A 1KHHA 1XLJA 1BC5A 4OVXA 5DM1A 1DIEA 2BR4A 5LQRA 1KYWA 2GYIA 4A6EA 1TW2A 5JUWA 3NVMB 3QYSA 2Y1WA 5ICFA 1Z3CA 3TKAA 5ICGA 5FQNA 1R74A 4OBWA 4V0QA 3FPHA 3LDUA 2IDJA 4RSRA 4V0RA 3DXZA 3T7TA 5F2OA 2ZVRA 1XLEA 5DLYA 3EVBA 3K0BA 3PVCA 1XDSA 4F85A 5CM2Z 2LD4A 3OE4A 3KCOA 5DX8A 10MHA 4QDWA 4M37A 1DL5A 1XJ5A 5LR6A 1XLHA 1D2HA 1X1AA 3CKKA 3FUXA 2AN5A 5FHRA 4DVOA 1XIEA 3GDHA 2ZDSA 2HTEA 1XIJA 3KBSA 4IV8A 2IBTA 3NWEA 5EZQA 3Q7EA 2NXCA 5EZSA 3UJ9A 4X61A 1FPQA 5DM0A 1PRYA 2ZBQA 5EC8A 2JJQA 3KQVA 4FR0A 2I9KA 3MHTA 2DULA 1WG8A 3CCFA 2YVLA 1YZ3A 2WA2A 3FYDA 5B80A 2F8LA 3R24A 2O06A 4A8IA 2VZ9A 2R6ZA 4BY9E 3BT7A 2PJDA 3G7UA 4EAYA 5GWXA 5KVAA 3LGAA 2QULA 1ZKDA 2JHCA 3OZRA 1R6AA 2B78A 5EIWA 3EGIA 2AOWA 1R00A 1TPYA 4POOA 5EPEA 3SMQA 1JQEA 3FRIA 3HCEA 5DRTA 3E8SA 3HVJA 4E30A 2C7RA 1YB2A 2NP7A 1XIGA 5E1DA 2IPXA 3B7PA 3P9NA 5E9WA 5HZMA 3F4KA 2Y1XA 4YTQA 3G5TA 2ZLBA 5E1OA 5EHIA 3MCTA 4CTJA 5B7YA 2JHAA 5CVEA 5K0NA 5DWQA 1SUIA 3HCCA 3UJ7A 3G89A 4P7GA 3P2EA 4Y2HA 4C07A 3A26A 1O9GA 1P1CA 1UIRA 2AVNA 3AWIA 2ZWAA 3BKWA 3DULA 3RW9A 2NP6A 2ZZKA 1U2ZA 3LPMA 1MNZA 2CMHA 1JQ3A 2P40A 1FP1D 4JXJA 4QE1A 3UJAA 4PGLA 4YV1A 5CCXA 1JTFA 3T7SA 3BWMA 3L8DA 1XLGA 3KBMA 1RJFA 3C3YA 4GOND 5ERGB 5FADA 2ONYA 1DXIA 1X1BA 2ZWVA 4EK9A 5AVNA 1V39A 3FYCA 1NW6A 4QDKA 5EG5A 1XIBA 3SSMA 3P14A 4KW2A 3ELUA 1JSZA 2YXLA 3CQHA 3ELYA 4XUDA 5HFJA 3TOSA 5FA5A 5HEKA 3E7PA 3ANXA 4WXHA 3I64A 5KS2A 3HP7A 5LQAA 4DUOA 1X19A 2VP3A 3DP7A 3BZJA 5K8VA 1G60A 2EJTA 2R3SA 1OR8A 3BGVA 3VC2A 2PT9A 3KQQA 5EOVA 5EKXA 3GRZA 3O7WA 3LKZA 4XIAA 5EKUA 3SR4A 2X7WA 3PX3A 2FK8A 3FUTA 3OFKA 3DMFA 5EVJA 2OB1A 2EG5A 4PIPA 4E2XA 4E2ZA 2ZZMA 3CQKA 4DCMA 3C0SA 2YQZA 3M6XA 2Q41A 9XIMA 2AOVA 3TVAA 3HVHA 3NTVA 4EKGA 4K3ZA 3HM2A 1G6Q1 2YXEA 1XIFA 3HCFA 1P1BA 5CVVA 5GINE 5HIMA 4U7PB 5BP7A 3M0YA 4YTRA 1KR5A 1VLMA 3I58A 3MTIA 5EIFA 4LWOA 2NXEA 4CTKA 5CIYA 4RTOA 3VNIA 3GCZA 3O31A 3RIEA 5LQNA 3JWIA 3NGFA 1QUMA 1N7IA 2HV9A 5J8LA 3KHKA 4YV0A 1PJZA 1O54A 3GWZA 1WXWA 3C6KA 4R6XA 4IWNA 5FUBA 1VIDA 7MHTA 3G5LA 3NW9A 3VNJA 3P8ZA 1XLDA 4O29A 4YUVA 3K6RA 5EEHA 4B17A 4Z2YA 4QDJA 1NE2A 5GM2A 4BLUA 3FUVA 3CWHA 3GRRA 1O9HA 3E23A 3MERA 3SXJA 3KPYA 2C7OA 1XYAA 4A8RA 3VC1A 4AZVA 4P7JA 5ICCA 3THSA 2ZBPA 3CQIA 1KPIA 2NXNA 5FWAA 2OPBA 5XINA 1XLCA 3GU3A 4OQDA 3LDFA 2NQ9A 3AAMA 2G4JA 1EQAA 4XCXA 2IFTA 5T64A 4GUAA 5E9QA 4AUKA 4AX8A 5GOZA 3IUIA 3KR2A 3FVMA 3GNXA 3MAGA 2P3QA 1G38A 4ATNA 1WS6A 4GF5A 4CKEA 2EX4A 3G2OA 3OU6A 3BWCA 2AOXA 3UJBA 4BP3A 3NVKI 1XLLA 2GLUA 4GOLD 3C3PA 1XCLA 2ZCJA 5CD1A 2G1PA 4C06A 1NW7A 3QXBA 3HA3A 4BLVA 4M38A 4XKMA 3UJ6A 3ITVA 4GJIA 1JG2A 4FT2A 2PGXA 4R05A 5E1BA 4DQ0A 1L3CA 4CKBA 3CQJA 1I4WA 1QANA 4E3VA 1XXLA 2O05A 4WVLA 2G72A 5FWDA 5EMMA 2I6GA 3AJDA 4RWZA 3A25A 2QY6A 3HCBA 4MIKA 1DUSA 5DXAA 3T0IA 2IBSA 1IXKA 2I7CA 3KR0A 1JR4A 1BHJA 4C08A 1DIDA 2H00A 1WY7A 5K0FA 5K0CA 5GIOE 4ZBCA 3KQTA 3KKZA 2P7IA 3KQPA 5CVDA 3ME5A 1CLKA 3M0XA 1FP2A 2NQHA 1VP9A 3KU1A 4H0NA 3B89A 3BKXA 2A14A 2OY0A 3CJRA 1EIZA 4LNCA 3PFHA 2V74B 4FZVA 3BANA 2AN3A 4PYIA 5E2BA 4A6DA 3Q87B 5MHTA 1D8WA 2OU4A 3UBTA 1XIDA 4ZB0A 3UVAA 5C1IA 2ZSUA 4PFHA 4CKCA 3PS9A 5DSTA 4GJJA 1ZGJA 2PKWA 4XSLA 2AOTB 4GLEA 3EEYA 2N47A 1T43A 1BOOA 3DTNA 3EVEA 3QV2A 1KPGA 3UZUA 3EGEA 1AQJA 3GGDA 1XYBA 1KYZA 4F84A 4P7KA 3B5IA 5I7GA 4X63A 5CUQA 4YUZA 2IH4A 4C05A 3XIMA 3U3HA 4E70A 2CKDA 2FK7A 4QTUB 3TQSA 1G8SA 3M0VA 3G8BA 1IY9A 4HSGA 3CBGA 3DLCA 3AYTA 5C0OE 3TR6A 5D1NA 5DT2A 2FPOA 3VYWA 2YTZA 3ER9A 6XIMA 3KR1A 3KPVA 4C4AA 1QAMA 5G02A 3DLIA 4PYQA 3WSTA 3DX5A 2PSSA 3GJYA 4PIMA 3DMHA 2O0LA 2ZIEA 2G71A 4X1OA 2UZ4A 3KPUA 4ZB2A 4X60A 3NMUF 3KTCA 1NV8A 1RI4A 1ZG3A 2OXTA 4K1GA 3FTCA 8XIAA 3M6UA 4OX9Y 3P9CA 2AN4A 2G0WA 4HHMA 5KYGA 1ZGAA 2CWWA 3KR9A 4C04A 3UXIA 3GNLA 1EG2A 3LX6A 3ITYA 3XISA 4MWZA 4QPNA 3SM3A 2Z6QA 3TMAA 3BDKA 1EJ0A 3KBVA 1P39A 2YXDA 3E05A 3FZGA 2NQJA 3PX2A 5D1HA 3R6TA 1MUWA 4CWAA 4DKJA 5E1MA 2GH1A 2YR0A 2HCVA 3C6MA 3JWHA 3P2KA 2UYQA 3FPJA 2XYRA 3BGDA 2PX2A 4OA5A 2OYRA 5E8RA 3C0KA 2PWYA 2HK1A 2P3OA 2E5WA 3EMBA 1EAMA 3TPZA 1KIAA 3A4TA 3AYVA 1G8AA 2AOUA 2AZTA 4J4KA 4BP1A 9MHTA 1IM8A 1XISA 2OZVA 4IKPA 4KRGA 4PINA 4RVDA 2P3LA 3OFJA 2FYTA 7XIMA 3XINA 3FPFA 3OU7A 3A27A 4KVZA 3QC0A 3IHTA 3V97A 3I5UA 4GC9A 5K09A 3M6VA 4YMGA 3ORHA 5E8JA 2YUIA 2YX1A 4FS8A 4RVFA 2O07A 3FUWA 3NWBA 3M33A 3SX0A 4DMGA 4QE5A 3IV6A 1NKVA 2GA9A 1BXCA 3DUWA 1D2CA 2NXJA 1ORIA 2ZW9A 5HOQA 1Q0TA 3R0QA 4HC4A 1JQDA 3A7EA 4FGZA 3KQOA 3DR5A 4GQBA 3BUSA 3LSTA 4DA4A 3VNKA 1XYCA 1AF7A 4RVGA 1X1CA 5CVUA 2WA1A 3HEMA 3JU2A 1NV9A 4YTTA 1ORHA 2QUNA 3L23A 1VPTA 3C0QA 3X0DA 2ERCA 4ZTBA 3BZBA 2HWKA 3WQOA 1NW8A 5XIAA 1L3IA 2B25A 5LSAA 4RTJA 4ER3A 2Z6AA 1L1EA 2HNKA 2I62A 4QTTB 4UOEA 3M6WA 3BWYA 3LCUA 3OZTA 4EVIA 1XCJA 4QQNA 3M4XA 4HGZA 5U4XA 4P58A 2B9EA 3V8VA 2X7VA 5FHQA 2ADMA 3MQ2A 3VNLA 2AR0A 2GPYA 4GC5A 4G56A 2OO3A 5BW4A 5K0LA 3QZAA 5FTWA 2FHPA 4HGXA 3VSEA 5HILA 4RTRA 1S5NA 1NT2A
chains in the Genus database with same CATH superfamily
2PVPA 3EFOA 4R88A 2PDCA 2WQDA 5ABFB 2J74A 2PMFA 1BWRA 3F7OA 4B4KA 1A9PA 4JYMA 3PULA 4OBRA 4XWTA 4PONA 5FWYA 1C7RA 1W5QA 2NPIA 3B03A 3MC5A 4W8LA 2AQ8A 2OVFA 3GNOA 2HRDA 2BLLA 1RXEA 1V6XA 2RHTA 2BFMA 1M1NB 3AFMA 4QEHA 3KQSA 4EI9A 2HBXA 3PUVA 2V3EA 1LV7A 4OX9B 3LF1A 4N0QA 2V7TA 3PVSA 1WXHA 2OLKA 4FDAA 4PBEA 3OLGA 1T7LA 3AFHA 4BECA 3HDYA 1NBMD 1YMUA 2PX4A 4MIMA 1UEIA 1S2GA 3WNZA 3W8EA 1OC7A 4MG4A 3U60B 4F0KA 3GMSA 3NPXA 4CG2A 3T99A 3DTTA 3OA3A 2VYNA 5GZ6A 3DMGA 5JWRA 4OZOA 5EJEA 1LFDB 3SN4A 2QE6A 2YV3A 3UHOA 4KAAA 1RYHA 3IUHA 4GVXA 4R81A 2XNSA 3JWGA 1BVZA 2ZX5A 3FJYA 3DO5A 3BD8A 1GQRA 1E71M 4XCQA 3UCDA 1W2HA 1C3XA 3PB0A 1LI4A 4IY1A 3NIYA 2QZZA 2VR4A 3ZE0B 4PB5A 2NYUA 4JL8A 1W5TA 4WBNF 2FX2A 2B7NA 3TE9A 4M6WA 5M34A 2ICAA 4W8GA 3A9VA 2KX9A 3MMWA 4DXXA 4TT3A 3FKKA 4HS4A 1EL3A 3RCYA 4U4AA 5E6ZA 5FL1A 2BH2A 3N2TA 4BRUA 3PEWA 4W5UA 3VIJA 1H60A 3RYCB 2GWNA 3ZD9A 3QV7A 1A7AA 1RRMA 2NVWA 1KBJA 3GARA 1KI3A 4RE2A 4BBZA 1A49A 4HYWA 2QSYA 1SB8A 3CK5A 1TIPA 1W85B 1WZUA 3NHPA 1XEWY 5JCZA 1HTBA 3IUSA 3IOEA 4WSKA 3SZ3A 2NO5A 3WB1A 1T5TA 3D4BA 4L5CA 2XAAA 3R3VA 3PVCA 1JI1A 1KEKA 2PGOA 1OIFA 5LR6A 4ESEA 5BW6A 4TXJA 1CGWA 4URVR 4OFZA 3L6DA 2D0PB 5JAMA 2IIBA 3A2KA 3AS3A 3L0NA 1JIJA 4XRRA 3PFFA 4LYQA 5TS3A 2YWJA 1JQEA 1I10A 4U2BA 5H4GA 1ZONA 3JASA 2GOUA 1BCSB 1PT6A 4EB8A 2C9YA 2WJDA 2DQ4A 3OZEA 4G25A 4HDMA 4QUKA 1EZ2A 4HKPA 5HFJA 2QE7A 1K8ZA 3OSUA 1MN6A 2F8MA 4CM6A 1BDHA 1FBAA 3UUGA 3NG1A 1KRMA 4A4AA 4A0RA 2HSDA 2O8CA 1UD4A 2VRQA 2ODBA 2X1LA 1DKLA 4YRTA 2NXEA 1JULA 1UAGA 1X3LA 3MW7A 3D6MA 2NXGA 1GSHA 3OCZA 1SKAA 4Z9BA 1N0VC 1Y5NA 1CG6A 4YPJA 2OK8A 5CXQA 2P9EA 2BV3A 4JXZA 4I7VA 1XTKA 3MB8A 5ANRB 4MRPA 5AR1A 4GC3A 4OJYA 4IDPA 2XIQA 2M1XA 2QCEA 3C61A 2J5BA 4IWXA 3L67A 3KR0A 4WLCA 4J3VA 5KNLA 4G6ZA 1BSIA 4CF3A 4OYYA 2H9YA 1FQOA 1C7EA 4B6RA 1UH3A 5M2QA 3D3AA 4CKCA 4RIHA 2VPIA 3COVA 1AT1A 3K4DA 4FP1A 1H05A 3B5IA 3TN5A 4AHOA 2JGEA 2WNIA 3R5EA 3CMGA 1U1GA 3NQFA 1JDAA 5BV0A 3IOBA 1HMPA 3VV3A 4RY2A 4J7XA 1A4MA 3BCHA 4A5SA 2ZAMA 4PZEA 4YONB 4K0RA 4WXPA 2YXDA 3TYBA 5BSMA 2EARA 4RKEA 4ZCMA 1NMQA 4WGGA 3V48A 4JOSA 2I7GA 1DLJA 1GLGA 1PR9A 2Q9UA 1TUEA 2C31A 1I30A 3RM3A 4B8ZA 2AE2A 3OHSX 4E4UA 4RA6B 3BILA 5B4TA 1FDUA 4HC4A 3H5VA 3GJ3A 5C81A 4UDYX 4L4RA 3BXWA 3RSFA 1I3CA 2ERCA 5A9SB 1E2EA 4UTOA 4UOEA 3OZTA 3TFQA 3ZU3A 2NX9A 3D1VA 4F0HA 3Q3CA 3M7IA 3CLHA 2QR3A 1UMCB 1KM5A 4L2IB 4PLCA 5ICSA 1V3IA 1QBKC 3UGVA 1PX0A 1RXVA 4H1ZA 2EPLX 2IHNA 1WUHS 1XKLA 3MPOA 4MROA 2GXSA 2AF4C 1U5AA 1LD3A 1V26A 1SZEA 2X3FA 4PBGA 2VFFA 4KPLA 5M29A 5FCDA 5F7OA 2ONJA 1GYQA 1LCIA 1SR8A 4ZI5A 3X1DA 2A0UA 4BOYA 3FBTA 2QJGA 3VPGA 3EKLA 2ZUUA 1KK2A 1QHOA 5H8WA 3GHUA 3W7EA 1ZRQA 1DELA 1ZC3A 3BLLA 4ROQA 1VMAA 3W72A 3HACA 3AX6A 2GZSA 1JPKA 3W34A 3ZX4A 3UJDA 4QCFA 3KOWA 1U22A 1R8JA 2JCXA 2G1UA 3ES9A 3RT1A 1HORA 1VBFA 3UA3A 2REBA 3THWB 2OSWA 2L17A 1Y0EA 1TJYA 4BNNA 3F5SA 1NXSA 3MD9A 3MS7A 2FEMA 3FIUA 3F2CA 4NX5A 1KS9A 1FCQA 3FDJA 4IFTA 4UAUA 1DWPA 3O95A 1F38A 4NZNA 3NWRA 1SIBE 5LMNB 5JU6A 5D33A 3FN4A 5T6BA 2BSQA 1MJNA 2IPWA 4DUGA 1GQNA 3MBKA 4PZ0A 1N8TA 4RIEA 4RVCA 2YW9A 4CL8A 3V8RA 3EMVA 2VAXA 1R9YA 5F2KA 1YC5A 1O9BA 1JZSA 1HE4A 5JSKA 2YHIA 1AF4A 2A5FA 5AOUA 1QZZA 1HKJA 1QFMA 3CPSA 3VCNA 2CBIA 3T7VA 2VAPA 3WLMA 5ECVA 4JNCA 1DADA 3PC2A 2JGAA 1GW1A 4EMSA 3NASA 4BEUA 5EIBD 3MI6A 5C53B 4HNNA 5BMWA 5KJFA 2V96A 4YXGA 1JR3A 1VSBA 1HDXA 1DRKA 4PXYA 3RJXA 4HQOA 2HJWA 5K7SA 3BB1A 4IBOA 3AHEA 2HVMA 2UY4A 5JCOA 3OOSA 1KE2A 5CRIA 3DFUA 1UP4A 4NLLA 3CAVA 3VBEA 3RKRA 3PBYA 4DJJA 3QUTA 4FTWA 3AI7A 3G8CA 9LDTA 3C4QA 1ECFA 2H2AA 2GDJA 4RR4A 4FQ7A 3UFXA 4JY7A 1C3EA 2DMRA 3D6NA 5C7LO 4M1WA 5FI5A 1I7LA 3DAPA 2AC4A 2BUAA 1FVHA 2HSWA 4POOA 3G1WA 4JN6A 3OF5A 4A03A 3Q7PA 1W5SA 1T36A 2H08A 2PA3A 1W2WB 4TPKA 2MYUA 1VC4A 5KNBH 2FMKA 4X66B 1XMXA 2W6IA 4EWJA 4TZ0A 3B9QA 1O94C 4QDKA 4UKDA 3P14A 3L4JA 4OAOA 5KS2A 5LQAA 1Z45A 3D8UA 4RM2A 4KFCA 4MCHA 2UUCB 3VKHA 1S8AA 4Z2KA 3C7KA 1R5YA 3T2QA 4EGSA 1U7ZA 4EYGA 3QYJA 1Y7PA 4PN2A 3RK1A 1NTHA 3H0EA 1S3GA 2BI7A 4QU9A 3BXHA 3M0YA 2NUTA 3R7AA 1N7IA 2VP8A 1EC9A 4MPRA 1TZBA 1Q7CA 4N4AA 4B44A 1EWVA 3KVKA 4Q8NA 2ZBPA 1ZGGA 4F3NA 2JFPA 2POZA 4JIHA 1N1EA 3WHPA 3LBMA 5ADVA 1EZZA 5JJIA 3PYMA 4ZFNA 3IMFA 4RC9A 3ZZ1A 1OGSA 1M5WA 1T3TA 1NI4A 1P2UA 4IIJA 5G4LA 3E6EA 1PZXA 3BIFA 2KLBA 3Q0TA 4ND2A 1D8WA 3UVAA 1VLQA 3NETA 3M81A 1DV1A 1XUUA 4R3UA 2H1VA 5KVCA 3E9ZA 4JNKA 3LD5A 1NYQA 3PF8A 3VAZA 1U8CB 4Z4HA 2X6QA 2GCOB 3CZRA 1ESCA 2GDVA 4KQ2A 2HPHA 3AOEC 1M8GA 4RW3A 2QY9A 4YDHB 1D4ZA 5CFQA 3WUFA 4N39A 5ER9A 4F06A 1PX8A 2DDXA 4B0OA 5AHRA 2D5BA 2VXCA 3VKCA 1UUFA 1OYWA 1FP9A 1JHUA 3VFCA 3UW1A 3AJAA 1I80A 1IV8A 2ZJ3A 2UYQA 3IJIA 2NPOA 4G1MB 1KD0A 3GEEA 4D3FA 2FHBA 1MEWA 5CSYA 2NWQA 1G21A 5K09A 3PDIA 3SVLA 5B2EA 3BCUA 2WF8A 3PEUA 3F71A 3R77A 5AZ1A 4BZPA 1V9SA 1BH2A 3I5MA 3JX9A 3TA9A 1W1PA 3LLSA 3UWDA 1ZB5A 4QUHA 4Q4SA 4UC0A 1L7BA 1LL4A 3QPBA 3UEQA 4MGIR 3D2CA 4QATA 2RK6A 5EWLA 1S8OA 4TT8A 1J0IA 2EJCA 1VE3A 5J2UA 3UJFA 1NY6A 3SQOA 1QCYA 2DSKA 3L2OB 1XFAA 2NTVA 4FDVA 4LUSB 3NDPA 1DV2A 4EGAA 4PLZA 3MMZA 3NEHA 3TZQA 2MT9A 1QG6A 4NHVA 3CKMA 4OD0A 3JARB 3NGLA 4R5EA 1Q4WA 4DAFA 3GV0A 1O1HA 4QPPA 3OQPA 2HRZA 4C5BA 3GYCA 4ARUA 2I4IA 3ENVA 2VRKA 4ZANA 2ZZNA 4J7UA 3PGVA 3FWNA 1R3SA 4FIZA 4HAYA 3GTIA 4L4OA 3L1KA 4D9NA 3BYZA 5BSEA 4H16A 4PZUA 4HNVA 4UFHA 2PT6A 1IHDA 4X2PA 5LYJF 3B7WA 1W88A 1JJFA 3WNBA 1ECCA 4JL2A 1TTHA 5AKJA 3K0KA 1US2A 1H4QA 5TRTA 3TZHA 1NLFA 2RHDA 4AY2A 4Q4LA 3V32A 2C5HA 3PF3A 2QPXA 5CGQA 2FLWA 3KT6A 2NLIA 2FZ9A 2X1RA 2GGHA 3QMWA 4NBVA 4U7TB 3DGFC 3HF3A 2J6XA 4DLSA 4CBVA 1OFPA 1SO3A 3ZS4A 4NXSA 1LJUA 3GVIA 4B5TA 3RYFA 4KQHA 1IHOA 4EI7A 2JAOA 3JCZA 1V16B 2XMDA 4JIRA 3WWOA 3UMFA 2I2BA 4QLJA 1EM8B 1NLUA 1KAGA 1TEZA 2FW1A 3CG4A 5A6KA 2PGRA 3E81A 3LCMA 3WNMA 5CAEB 4GYPC 3P7MA 2OG2A 5KCMA 4RORA 4BFAA 4I4IA 2F9LA 1CBUA 5CZSA 1HR0B 5F98A 1G20B 3CR3C 4GKJB 2V5VA 3T7DA 4F7DA 1YCHA 4TTAA 2HRCA 3O3NB 4LANA 1SPXA 2PXCA 3LCLA 2PPVA 3HXOA 3DKIA 3M7WA 3UYLA 2ZYAA 5IZCC 3TTTA 1E9VA 4L51A 4PNZA 1IM2A 1ZFJA 2PGAA 4X1YA 3QW4B 2R82A 4HX2A 3KJXA 2R1PA 5GZ1A 4GBUA 5DM1A 2E7FA 4RPCA 2J5QA 2ZROA 5ICFA 1P4SA 3FI0A 1G4SA 2CNDA 3KYDA 2AAMA 1I6KA 1OYBA 2BOVA 2XH0A 4FDUA 1MB3A 2ODWA 2P11A 2FWPA 4ZKEA 4TTVA 2ZRNA 5IFKA 2UY3A 4RKRA 1GFIA 4L6DA 2HREA 5I01A 3CZQA 4LZNA 2Q2NA 3PK7A 2OHIA 2OQRA 3G5TA 5CVEA 3MWEA 5KYVA 1UBHS 4MRVA 1KY3A 2NQ2C 3F4LA 1E5XA 3B9AA 3CM4A 3P9RA 3ZHYA 1ULUA 4PGLA 3I3DA 2WIDA 4ZARA 4MW5A 4EHDA 3A4JA 1CE8B 4LJ6A 1W49A 2VENA 1Q12A 1DHKA 3GTHA 1B26A 1RRPA 3UETA 4LK3A 1MB9A 3S2ZA 5KOYA 4HRYA 4IFEA 5JHGB 3RMEA 3TVAA 5I4CA 3HGOA 2VZVA 4US1R 1E55A 3GWZA 1JWLA 4UZEA 4B17A 5CPQA 4PPQA 4JC5A 3DKJA 3GU3A 2O4CA 2QMJA 4HLUA 3WIVA 4I55A 4XD6A 4B4OA 3VGJA 4N0EA 5LDHA 4NFSA 1ML4A 4AQ7A 1JEOA 1MQQA 4YO8A 1NRIA 2YA1A 1UC4B 3E9CA 3ZWQA 2Z2UA 3W28A 4KE7A 2QTGA 2HLDA 1FNBA 3CMFA 1Z3IX 1XFBA 4HXGA 2QJJA 4KGVA 1XT6A 1XYFA 5IBXC 3HKBB 2PUVA 3DXFA 2DIKA 4AECA 3SQXA 4OLJA 3UZXA 4R1UA 4CUCA 1Y1LA 1OJLA 2EJVA 3U7VA 2FQ1A 4LMRA 3E05A 2C3YA 3WQEA 4RKQA 3ZDBA 3BRCA 2DH2A 1M33A 3AXKA 1BMDA 3A6FA 3DD5A 3HJRA 4NP7A 2C5AA 2C9ZA 5LZ9A 1FRZA 5EYWA 2P2DA 4DMGA 2PN1A 2IS2A 3ZGYA 4E4TA 2C78A 3JAMA 3QY7A 4WXZA 1Q3HA 4OXQA 4U0JA 3TR0A 3K9FC 2OJPA 1B76A 4QYIB 2HDOA 4DNPA 1WO2A 5DELA 1NOFA 3NL6A 1NGSA 2WKLA 2J33A 3DZKA 3WX0A 1I7PA 2FUCA 1C9YA 2H2GA 3OVQA 1OSEA 5IXEA 1WWKA 4UEWA 3PP8A 2H4JA 4X9YA 3DKKA 3DEKA 1KI6A 1EUDB 2UDPA 4QJBA 3U4MA 2Q8NA 4PEVA 4RTLA 2P90A 5C32A 1UD2A 3ZSSA 1U28A 4RTNA 1SHZA 1TYCA 1TW3A 4X90A 2J45A 2Y89A 3T15A 1P73A 3Q10A 3EWIA 1E6SM 5F9FA 3ALFA 1W4BA 4FDMA 3SHWA 2W58A 5MKGB 1XP3A 2F7FA 1LQUA 3WJSA 2H85A 1ZJ4A 3ZKWB 3COWA 4N0PA 3LNMA 3PUEA 2PIAA 2V0NA 3W86A 3IEPA 4WK4B 5JXHA 1ONRA 3W0KA 4F1JA 2LKDA 5A04A 4NAHA 5K3VA 1Z83A 4MDFA 1D8CA 4HFJA 3FR7A 4TX8A 5LZLA 5HG0A 2HWXA 1N4AA 3H2ZA 1S3IA 2LPMA 3D3JA 2ZC8A 4U5IA 3VA8A 3TVYA 1KHTA 3AS0A 3IOYA 5K03A 2BGNE 4KWEA 3NM1A 1XRVA 4F3CA 1V6YA 2YX0A 6PTDA 4FB4A 2VP4A 1BHGA 3RM8A 5EUMA 3FI9A 2C03A 3DDNA 3FTDA 3TJRA 4WFKA 3AT1A 1XROA 4BLWA 3TUUA 4X7MA 1M8FA 5KWVA 4DCVA 16PKA 4G5HA 2EEZA 4G26A 3OP1A 3GUVA 4XASA 1OGJA 1BQ4A 1YDGA 3DYMA 4QA9A 4PMXA 3JAKA 5CDUA 3K2BA 2TMKA 4HDOB 1Z16A 3EIWA 4OKDA 4J3SA 1JT2A 1FWRA 3UAZA 2XMRA 4E6MA 1X1DA 1IUNA 2WF6A 1E4YA 3NHMA 1XJWA 2GTPA 1LVGA 1OB2A 1F8FA 1QIMA 4DNXA 1MJ5A 4K2SA 3SI9A 3PCTA 1FX6A 4HMNA 2FZ4A 4AD8A 1JAZA 4UU1A 3F7MA 3VR2D 2ZE7A 1DJMA 1UMDA 3UWWA 1BO6A 1WSAA 5C4GB 1ZYUA 3NQMA 5LB4A 3B2QA 1KKOA 1T2VA 3KB2A 4YJ2B 3OZPA 4LUJA 2VCEA 1GTL1 4XIGS 3ZQ6A 1MT3A 3MJCA 4EZBA 1KV8A 4IV8A 2NXCA 4CE6A 4MWTA 5EJFA 4DA8A 1AHNA 2F8LA 2OZTA 2YBDA 3ITDA 3EZFA 1ZKDA 1E32A 3KFXA 1XZBA 4N9WA 2WMIA 1CPYA 2YS7A 3W7VA 1X42A 5JNLA 2D7CA 2ST1A 1LDCA 4MW4A 1Z62A 3DR3A 1E2PA 3GDLA 4WXMA 4UIOA 2ODAA 4WOQA 5HZHA 3M5WA 4EJ6A 3DFMA 5F4BA 1G60A 1U7XA 3RKUA 5FBWB 5CLWA 5EKXA 4JFWA 2JLVA 2QS8A 2J9ZB 4XB1A 3W6ZA 4MJZA 2GK6A 1RM4A 4UTTA 4E2ZA 1T4DA 1L9XA 2OD7A 2ZZ6A 1OCQA 1UBUS 1U6JA 4JCLA 3ZV7A 4C01A 1H9BA 2WSQA 4TVDA 4E14A 2BZNA 2ZIWB 1TWWA 3IMKA 4C7JA 3E0LA 3CRRA 4KXVA 1XBZA 4YY3B 2Q0XA 2AGVA 3ZOZA 2OSVA 1M2HA 3CHYA 4EQ6B 4PPNA 1MYRA 2RGUA 3PXCX 1PT8A 4JFVA 1AXRA 3TWOA 4RF3A 3UY7A 3O75A 1V48A 2GPSA 4P3KA 4WGHA 1JZ3A 3ZZ0A 2DBRA 3H86A 2B30A 4QS5A 4ZQFA 4DQ0A 2ZEJA 1QNFA 4NI8A 3QJAA 1LI5A 1JR4A 1U5BB 1JD7A 3H99A 5BSVA 3R7WA 2R96A 4FOKA 4LJSA 1VP9A 1T5IA 2XFWA 1M2JA 2FWAA 3U9TA 4YJ3B 2ZYHA 5GJNA 2IU4A 1U9IA 1LOQA 4XZIA 4OQLA 1BA3A 4M6UA 4FOLA 4KPUA 5TPWB 4Z17A 3L0DA 4J1QA 3CONA 5LQSA 3BLIA 1JBQA 1FTNA 3KWFA 5BRNA 1LW7A 4NASA 8A3HA 1Y9EA 1FLNA 2OT3B 1UBNA 4WOBA 2JIPA 1MNAA 1KGWA 4L4LA 3IKMB 1MZRA 4LNUA 4X60A 2D2GA 4KG7A 1ZG3A 1HW6A 3KTSA 2HTMA 4K1GA 4H2DA 2FZ8A 5IRCD 2XZ9A 1EZWA 1PR0A 2AJTA 5DN9A 2HWUA 5LMCA 2D5CA 2IOFK 3T3DA 1YL7A 3CH6A 3PZ9A 2DPHA 1SZJG 1VCVA 4UQBA 3R0KA 5AY7A 4HCJA 2FR8C 5AK6A 5BV2P 4Q1VA 2Y5SA 5JH7B 2Y92A 2OVLA 4BIMA 4LZOA 5JNTA 3E15A 3A7EA 3DE6X 4ZYUA 1FLVA 3QPYA 2EHJA 1Z6TA 4WKAA 2PRJA 4GKKB 3MZ0A 4OI1A 1ONEA 1J42A 3QYAA 1M9NA 3WBJA 2DFVA 3LCCA 3L4VA 3A1SA 3FOKA 2R9VA 1JPMA 2PH1A 3WGNA 1MGPA 2R91A 2GEVA 3S5JA 2POCA 1BTMA 3VJMA 1BXKA 1IPEA 5LBTA 4Q33A 2ZZ2A 1H2FA 5FBKA 3KSAC 4DA6A 2WJWA 4QSMA 1XL9A 3ZJKA 1R87A 5IKMA 4MLCA 3NDRA 3THDA 4MQEB 3ZY4A 5F77A 4FLOA 1X7DA 5ALMA 1P7CA 4W9RA 1QBGA 4ATWA 5H3LA 4HPNA 5JCJD 2ZTMA 3FFXA 5KITA 4LF5B 4ER7A 2Y93A 4EEXA 2HADA 2W43A 3CUZA 2ONZA 4BKUA 5H9VA 4H9GA 3UATA 4HSNA 1MMFA 3D6UA 1YZKA 2CHNA 1H3NA 1HNZB 1RRVA 3RRNA 1WKVA 2PMCA 3LWDA 4P7FA 3WEOA 5AIBA 3Q4DA 4OHPA 4G9PA 1GV0A 3KCQA 2V8BA 1YUBA 2SCUB 5BYJA 4DS3A 3ZHTA 1QH8B 5EPDA 4RS4A 1PJRA 1B0AA 3GFVA 3DE3X 1JI2A 4QOSA 2QRVA 1VKZA 1OAOA 2WZDA 5AOBA 4Q3OA 1IJFA 3L0GA 3M1AA 4M8IA 4OXKA 4ZVOA 1WPCA 3RFVA 1K89A 3SCUA 4RLIA 2CLLA 3TJXA 1KF0A 4EKNB 1POJA 4L5AA 3EEIA 1SG0A 4BWYA 3DC7A 2QRHA 3ZI4A 3DZJA 1HEYA 3RHSA 1PCWA 1GG5A 4G1KA 5AOVA 2RGWA 3MBOA 4EK7A 2JIZD 3R5HA 3ND7A 3GLHE 4E2OA 3WENA 3EUFA 3FAWA 4HZ6A 2O14A 3DEZA 2R00A 1PG0A 5BQOA 2KX7A 3M4YA 2XIMA 5HIKA 4D57A 1XA4A 3ND6A 1AODA 1FK8A 3EUWA 1OK6A 1F3OA 3N25A 2EFJA 4J2OA 2BODX 3PT9A 3RGGA 5BVHB 4TO8A 3K1DA 5CKSA 4US6A 1HJUA 1DZ3A 2FP4A 1AMNA 3U2ZA 3AETB 1PZ0A 3W7HA 2J9RA 1L9KA 2C3PA 3DAQA 3DEQA 1KQNA 2WO5A 5BR7A 3KWLA 2YYZA 1NFPA 3TKAA 2FOIA 1XLUA 4R2WA 4RFSB 4XTRA 3ROPA 4IGMA 4CHGA 2VPPA 5TBOA 2LBPA 3PJUA 1TTTA 3HFGA 1CDZA 1YS9A 1UH5A 3JQFA 4ESHA 4ZOAA 3GH1A 1A82A 4QXQA 4DCJA 5DBEX 3ALGA 3M1YA 5GQSA 4DR6B 2Z1NA 4C1KA 1DRJA 1USWA 4PE5B 2O54A 4WFQA 2BJWA 1YJXA 3NOXA 2VYVD 3NZ1A 2FSSA 4BFXA 3B4UA 3OQOA 1JXAA 3O38A 3NM3A 4JIPA 3POHA 2PLAA 1I8JA 3UM9A 3W1QA 2FDXA 2VLBA 3RUDA 1B31A 2JFEX 1IWAA 3PHJA 3KVLA 2FGLA 2QVYX 4GQGA 3LERA 4HWSA 1YB5A 3LBHA 4BX2A 3O16A 4PR0A 3IIVA 4EKGA 3DYOA 2W6NA 4FNGA 4LWOA 5LXEA 4WY2A 4WF7A 2DY0A 3E2QA 8ADHA 4KAJA 4UHJA 3DTVD 5JBDA 1MW2A 1VRWA 4ZEPA 3E70C 3K0SA 1OC6A 3UXLA 4LRQA 1Y9ZA 3LCHA 5TQLA 3JVAA 2NZUG 3KW3A 3G1TA 4F92B 5LYRA 2J3DA 3UJBA 1W9BM 3NQEA 2QT3A 1V4NA 3WKZA 3D5HA 2G1PA 2JQXA 1UROA 4KKXA 3U4AA 1BXGA 2YCKX 3GT0A 1QE5A 3KOMA 5KI6A 2REOA 2FH8A 3RYTC 3GJ4A 4FXSA 3ZS9A 5JEDA 4CDMA 4MJ7A 5JMUA 3STWA 2AWOA 4ZYVA 5CEEA 3K0HA 4XJXA 3FROA 3PS9A 1EVKA 3A9CA 4C22A 1TB3A 1V93A 4US0R 4QJ3A 4L07A 1G8HA 1Z63A 3G2JA 3EDEA 1Z6PA 1ZNYA 2OTDA 1UJBA 1K2WA 2OLJA 1HJXA 1YFZA 5B55A 4NI3A 2PV7A 3TTEA 2PDLA 4MVYA 5G02A 1OLXA 1XNQB 1QXLA 2ODEA 3ONVA 3FTPA 1J9YA 1LT7A 1FTWA 1MB0A 3SUTA 3STGA 4NZCA 4RNDB 2BFCA 4F60A 5BYKA 3ICEA 4I81A 1WPQA 4NCIA 2C2HA 3GC6A 4G5YA 1NQVA 2BGQA 1E18A 1EIBA 1NKVA 5G1PA 3EX2A 1SKUA 2HK9A 3MJYA 1UKCA 3UOGA 3OEXA 3GFOA 3QMMA 4BJHB 4KKXB 5IAOA 1TCCA 4FGSA 4IIYA 3A1NA 5BPHA 3VI4B 4DLUA 4QNRA 1KYTA 1QPRA 5HRAA 4N18A 5IG2A 2PKCA 2C19A 2Q02A 1MO5A 3TROA 5C7OO 1BEEA 3E6AA 4QG8A 1Z4JA 2AC7A 5G2HA 2Z08A 2P5TB 3QOMA 4BV3A 3SCSA 3RQSA 3S2NA 4IG4A 1QVAA 4L65A 5JAOA 3PZIA 5B6IA 2PRIA 5JH1A 1DPMA 5GJWC 4I1YA 2QDXA 2I8LA 4JT9A 5KNDH 1AGPA 3OFNA 2O8VA 5JPCA 3LXMA 3LENA 3FTQA 2NVCA 3ET5A 1BVHA 4HFMA 2C5BA 1HFBA 1QXSA 3R5KA 1DO2A 4KKVA 2ADAA 2ZYSA 5DTQA 2B7BA 4CEIA 4LA4A 1B3BA 5JFOA 1OT1A 1MEIA 4AP5A 4B4WA 2PGLA 1KTVA 1F4PA 3FY1A 4LFCB 4KFOA 1YWGO 5CYFA 3MT9A 4OGFA 2O8EB 3THOA 2W62A 1XRFA 4KRZA 3LXAA 2RJ3A 1PIGA 2WVVB 2WYSA 1TGYA 6CHYA 4PR4A 5KOHA 3SFWA 4B3BA 5JNVA 2C3OA 2VDUE 4LV5B 1Q15A 1Q7EA 3NAVA 1W9XA 3ABZA 4JOBA 1TRDA 5IC5A 1WSWA 2VRCD 3OG2A 1A1VA 1ETUA 2HWWA 3JD3A 1QHNA 4ZI2A 3D54D 3R8CA 2D20A 4Z08A 5JZVA 3ZZNA 4GQAA 3RVKA 4XGIA 1SC4A 1PSZA 2FPXA 4Q4AA 4AFYA 4F3RA 4PF1A 1GFWA 5D2XA 4JJIA 2WJEA 4EBFA 2FR0A 4FZ3A 2AL2A 5CFNA 5AKYA 3DENA 4I1UA 1IFXA 1YE8A 4EM6A 3VZPA 4OUIA 5DN6D 2A9FA 4LAUA 5NLLA 1XQXA 1XQLA 2Z1DA 3LV8A 4I6EA 3V7YA 2E09A 1XQ1A 1KFBA 3VYVA 4DR2B 4WJKB 1LYXA 4Q47A 5HBFA 2Z1BA 4YCCA 1AUVA 3QOYA 3M34A 2IELA 2IQTA 3H5WA 1XH2A 4I4TB 1YMQA 3RPMA 1QQ7A 2IW0A 3FM9A 3GL9A 1O03A 4RD3A 4ZAFA 1JB1A 1FH9A 1CENA 4XX0A 4PCPA 4DZTA 4M51A 3B1JA 2ZWYA 2OC4A 3UWOA 1JHOA 4TKMA 3RLGA 2YINC 1UANA 3BCFA 4DBLC 1P81A 3TNJA 1BKHA 1OCJA 3OE7D 3RVJA 2AGTA 3AILA 2BMEA 3E8SA 4QEDA 4FA3A 3RAFC 4MUFA 2NUWA 3IVSA 3QUSA 1MO4A 2Z2IA 2IYZA 3GU9A 4AIOA 4YI5A 4UTIA 2J79A 5M04A 3FYCA 1EGMB 3MY9A 5FESA 3OM1A 5KAMA 2W2TA 4S0ZA 2DF8A 1IR1A 1CR2A 3VC2A 1JDVA 2FRDA 3SX2A 2PUWA 2X7WA 2GTHA 3M6YA 1TZKA 5AVVA 4TRNA 4ZVUA 4MPJA 1VHQA 2Q41A 4N6NA 3QBTA 3VNSA 1FLAA 1W1WA 1E4IA 2IV3A 3JQ7B 5E6YA 4AK9A 1GU0A 3QXJA 5D87A 4KC0A 2EFHB 4GYPA 3ETNA 3QV8A 3KPYA 4ZQCB 4I50F 3QBEA 3SQDA 2ZSJA 1RLCL 3LDFA 5E0CA 1HQYE 1D9EA 2P78A 3GNXA 4NIMA 4ZHQF 1TV5A 2EX4A 1QP8A 5HPOA 1UZHA 1RMTA 3T61A 1E7QA 5JNWA 3SURA 4A73A 2FMUA 5IHXA 4AZ3B 1Y1TA 2G96A 4UXHA 5KYWB 3WIUA 1L8QA 1LH0A 2H31A 4RK1A 3T9CA 2DUWA 3CJRA 5E2BA 2ZI9A 3ECAA 1IVYA 3OBKA 2A5DA 4F21A 4PFHA 1PD0A 4D5EA 1ZN2A 1JJBA 3GGDA 3QFHA 5FBVB 4M0UA 1H1LA 2WJJA 3UOAB 2V58A 1JPJA 4GSYA 1L4GA 1P9LA 2HN9A 3UTDA 5FF4A 4UXJA 2CLOB 3KTCA 5B58C 4PU0A 4JBIA 5BQ3A 5JO0A 3SLRA 4Q3DA 2PPGA 1ZGAA 4C6DA 1EG2A 5G0UA 4YCLA 2F8QA 1H0GA 3ESYA 1S96A 2HHHB 4OA5A 1QZ3A 4LF6B 4W7HA 5CXXA 1PEYA 1T2DA 2I17A 3MGAA 1H0HA 1YOBA 1XQ9A 2H1WA 3L41A 1GG1A 3PRYA 2VZTA 4IXHA 1F2UB 2B8WA 2RHOA 1WXJA 2NYAA 2J4GA 1XZ8A 4KRTA 1SVOA 4ILEA 3MWJA 2Q2WA 1C8XA 1E0DA 4MV1A 1EJWC 4PUJA 4Z2AA 1OXXK 3UK2A 1W1IE 1DIOB 2M6KA 4H9VA 1O6FA 3VOHA 3LG2A 4KQKA 3WV5A 3KKMA 1E6KA 2DR2A 3JTEA 2BP7A 3O8QB 1J8VA 4KXQA 1K03A 4AKEA 3VIFA 3RAPR 2PD4A 1P75A 2EF0A 4Q3EA 5EIXA 3ZCTA 3IT1A 2G8NA 1LLWA 3OYZA 3F9CA 3OY7A 3QE3A 4DWSC 4FDTA 3QGVA 2V7EA 5CXUA 2D0GA 3EGDB 2R87A 4MDOA 2B2CA 3JATA 3HLYA 4S35A 1AKWA 2AQOA 5L45A 4FI3F 4B5SA 1MAHA 1GPWA 1T2NA 5A6JA 4IDBA 2CZGA 3EVDA 1WMSA 2HPZA 4C7GA 5ARCA 3Q2DA 1GQ2A 4AXKA 3I2FA 2W63A 4B0PA 4LYYA 1SH7A 4HU3A 2BD0A 2C95A 5AJHA 1MW9X 3OH8A 4JU8A 4KXLA 5AI9A 4EKDA 2QNBA 5KSWA 1W1ZA 3LJKA 3NZPA 1FTQA 1NX9A 4FMBB 4GZ7A 4H9XA 1X2BA 4JN8A 4RMIA 3M89A 1K8YB 4ZZ9A 2V6BA 3KRZA 1GM5A 4C30A 1L6WA 4MGKR 1O2DA 5EQTA 1ZCBA 4PZ9A 4OYRA 2R0QC 3U81A 3VDQA 4YXFA 2OBMA 3DJYA 5KYKA 1EG7A 2HHAA 4UFNA 3AXSA 3CKLA 3RE1A 2ZWIA 2GN9A 3HB5X 3BAZA 2C7GA 3FFTA 4PYNA 4GI2A 3WGIA 3CSDA 4HDRA 2MUCA 4BNFA 2QZ4A 4BMVA 3AALA 5I5EA 2XVAA 3KLPX 3PD1A 1JG1A 2Y05A 4KO3S 4E07A 4AO7A 3PPYA 4R1MA 5F3WB 3MTBA 4IFIA 1PFUA 1T1JA 1NR1A 5EZ6B 1PNRA 1B1AA 3LDGA 4JLMA 1KAMA 4ABYA 4CVWA 1H4PA 2ONEA 1KFBB 4LCBA 4CLOA 1T6BY 2PUGA 1MRQA 3U37A 3MV11 4RSRA 1T9KA 3SCQA 3FJNA 4PG8A 1AQLA 4QDWA 3CWCA 1USVA 2D1QA 1FQ0A 1I36A 2HCJB 3EZ9A 1XIEA 4LWZA 4YRZA 5THXA 4GLBA 1QS0A 1L6IA 3FYDA 3T1VA 4LDPA 1DKMA 7CGTA 3ILSA 4OHMA 1YBMA 4GRAA 5DXXA 3M6LA 1TYZA 3PTKA 3LFHA 1R6UA 2AX4A 1LOSA 3S4YA 1MAAA 2FKAA 4G9EA 2WHYA 4M53A 2G09A 1L5ZA 3DFKA 1UBOS 3HH8A 3D1LA 4X0NA 3KZKA 1YTEA 2XQJA 3H6HA 5A8GA 1DEAA 1GT91 5KVQA 1NN3A 4B34A 1W3JA 1XHEA 2X0NA 1IVNA 2ANCA 2C1IA 1GZ7A 4I6JA 2XQIA 3FJ4A 4GO9A 1E2JA 3O7WA 2EFDB 4I0WB 1RKVA 4R1TA 4D97A 3ZVLA 1RHQA 4DCMA 4A3QA 2BGGA 1Q5PA 3GFRA 2PZJA 4KODA 1OT3A 5HATA 5IDYA 5AYIA 5A95A 3E8MA 1WTCA 4ZI7A 3FA3A 3JZFA 2YKKA 2QKYA 3STHA 4J3UA 2BMWA 2H16A 2AMLA 1YL5A 3AM5A 5AYVA 2QUHA 2VA9A 4M9CA 3ORFA 3U1VA 1VA4A 4HY3A 1Y8RB 2QK4A 2WK2A 4UVIA 1NFGA 3L4EA 1F12A 3W77A 2PSEA 4QQUA 1KI9A 1AS2A 1LTQA 3LQGA 2YN2A 1GNTA 3LW7A 4DMLA 4DAEA 3OPQA 1ADDA 1X6UA 3KFVA 3I01M 5AHLA 1UOPA 2QCDA 3BZUA 1F9EA 3W7LA 1FDIA 4AJLA 4P0QB 3L0PA 3KKNA 3K0CA 6XIMA 1NM9A 3TQKA 2HPMA 4PIMA 2ZI7A 5FUYA 1NIUA 3IAS6 2VK2A 4TM7A 1M1ZA 4C6QA 4PAMA 3IR7A 4ZOBA 3VILA 1OJXA 1JPNA 1GOKA 2DTDA 2H8XA 2H18A 2CZEA 3GFZA 4MRRA 3ABOB 1QAPA 4IIUA 1LQ0A 2G3JA 3FVDA 4BV8A 1MHPA 4X64B 3I5UA 1Z07A 5FUXA 3KSRA 4FYYA 4C6NA 4GQQA 5EN4A 4ADUA 1CUJA 2XODA 4DG9A 1X8LA 1HA3A 4LJLA 1D6NA 1NW8A 2SBTA 5K6RA 4G1FA 4HWKA 2QXTA 4EVIA 2NG1A 4WBNA 1T1SA 2GJSA 3DUFB 5IEJA 4D4HA 1CZ1A 1O97C 1UJMA 2E82A 3PDJA 4FF7A 5DMXA 3TFWA 1ZJHA 4CF6A 5DMYA 1O7JA 2IPLA 5M3WA 3HCOA 3ZLVA 4FX8A 3EVCA 1UMDB 2ZRFA 4II2A 4GBJA 1IONA 3A1TA 4FGKA 5JOQA 2YOCA 1H8EA 3C3EA 2XRZA 5D04C 2CHOA 3F6BX 1EIXA 2FLKA 5IW8A 1BYUA 3O0TA 5KINB 1MXHA 1UK6A 4D02A 3O6VA 4E12A 3ZJ6A 2BFBA 3QKTA 1BRMA 4H4DA 2BISA 3UOWA 4WN9B 2ZU6A 3QIAA 4JXXA 5LD2C 1D0IA 7ODCA 1S2LA 1GRRA 4BO7A 1OF8A 3KEQA 1W9HA 1PQYA 4WL0A 3DW3X 4F4DA 1C7IA 2EEXA 2V7QA 4YCJA 3UU0A 3Q6MA 5D51S 1P1HA 1TZ9A 3AVYA 3TNOA 5T8KA 3FVQA 2IIPA 2AG1A 4GO1A 4LECA 1L8LA 4GKBA 1S1RA 1T5OA 1UP6A 2O3SA 4B8WA 4LZWA 2QMUA 4RIGA 1VH7A 4KL8S 4UJ5A 4G37A 1SJAA 3QOWA 1PX3A 1E1DA 1VJRA 4HNAB 2J6IA 1BROA 5BSGA 2BBSA 4OQYA 1GTSA 1SK9A 3WYBA 4HDNA 4WX2A 5C0QA 3LCVB 3ZW7A 1NG1A 3SZUA 1T4CA 2JDID 1DQZA 1B9BA 3WK3A 2DVMA 5IH3A 1MA0A 2VNSA 2GDQA 1NN1A 2OECA 1JNEA 2BTEA 4Y2WA 4DIEA 1ZD9A 1X1OA 1L0PA 4W1SA 1RWNA 2X7JA 4Z1MA 3MW8A 3ZTTA 4CMHA 2A78A 5FORA 1PIFA 4TZTA 2CJWA 4FSAA 4CRWB 2Q1UA 2FZCA 1P0FA 3P4YA 3AXTA 3T3GA 3JQCA 4C6KA 3IJLA 2QPSA 1TE1A 4F48A 5G1YA 2GUUA 2HCFA 4X95A 1HP4A 3WWPA 4QYIA 2E89A 2IZZA 5JJBA 2D1RA 4EQZA 1QI0A 4O5OA 5A4AA 1A2QA 3SQLA 2FG5A 2ALRA 1RU3A 5A3RA 2EP7A 4KOEC 1CEYA 1ADFA 4E7OA 2AFIA 2CHUA 3AFOA 4DI8A 2W6MA 2HMUA 1WDWA 2AI3A 3TYEA 1D3CA 4MADA 2RGAA 2X8LA 3GQYA 1ZEMA 2H06A 4QPZA 4Q4JB 5B6JA 3U6WA 3NWOA 5TEVA 4LHWA 5A9RA 2O5VA 2OXCA 3IAXA 1AHIA 1KJWA 1U7UA 2SHKA 1NBME 2YVLA 3WX7A 2VZ9A 4DC0A 3GO2A 5LA2A 2V5JA 3QG5A 4D8LA 3AUXA 5EIWA 5BNWA 3WUBA 4B3DA 3B53X 1UF9A 5ALUA 1LBSA 1MXDA 4CQBA 3LT4A 2NXHA 4JB2A 3CWNA 2O8DB 3S28A 4COKA 3AEZA 1SCUA 4Q7NA 3W1TA 4D2JA 3NHZA 1QYVA 2OSYA 3ZWXA 4CIBA 1QQBA 2VWGA 1ZN7A 3ELUA 4ZVPA 2XPKA 3RLHA 1DT3A 2ZWOA 4DREA 3VJRA 4HOWA 4U4MA 1WUIS 4OBTA 1JEQA 2BMFA 1RCTE 3GRZA 2ACWA 1RVV1 1I0DA 3GP5A 2YQZA 4FK9A 4P7OA 5ALEA 3F4BA 1HZYA 4EPVA 1CUVA 2VSNA 4M1YA 4TL9A 1KFEA 1KVSA 1U2DA 1MFPA 1L4UA 3N2BA 2OAQ1 4PPGA 3K15A 1N5DA 3ED5A 2A0WA 2YWEA 5JFTA 4R1LA 1NWRA 4HA3A 4B82A 3TV8A 1F6BA 1JEEA 2WVSA 1Z8AA 1AG1O 1ZWKA 3A1VA 3MOIA 4ZC8A 1W8GA 2R6OA 1EWTA 3FSRA 4UZSA 3AIVA 4ZVRA 2B98A 4B7UA 2LZ0A 1CLUA 1FSFA 5FBRB 3INGA 5HZGA 1YS6A 5KQMA 4TMTA 4X3CA 2DWOA 2IKIA 1P3Y1 4ETWA 4IOMA 1XVLA 4E5TA 4QTUB 3TDKA 1M72A 5AVTA 3KPVA 3S46A 1YQEA 2A9RA 3PNVA 3IR6A 4KP7A 1JLKA 1KTIA 3MSGA 4G5RA 3PQ6A 2AYYA 5AKEA 3TINA 4PR3A 2IPFA 4CVUA 1ZIDA 3D3WA 3G77A 1R9MA 1SCQA 2BFCB 2XYRA 3TPZA 2NMVA 1B3WA 5DCBA 4WKFA 3RFFA 4MWAB 1T3ZA 1GVEA 3TYDA 1I2AA 3D8TA 1XPGA 4QGAA 4CM8B 3PPIA 1TYAE 4HT3B 1QDSA 3FS2A 1JAXA 3WK9A 3ZS8A 4Q02A 3FSEA 4N54A 1VPTA 1E92A 4F5DA 1SKMA 4S2BA 4H9MA 2POTA 3O06A 3QWHA 3WJ1A 1YQ2A 3EGXB 2WJZB 1KMMA 3GZNA 3CLSD 1VJ0A 2A3CA 3GB6A 3U5ZB 3BW4A 1X6VA 2IWRA 3VJKA 4TWAA 2RC5A 3LHUA 4ZB5A 1XU9A 3QWBA 4M86A 2ZBTA 1N2BA 3AHXA 2B5OA 1FQJA 3PGJA 3IBGA 1R7RA 1XLAA 2R6HA 2B2XA 4W87A 4XLTA 2RHHA 3W2IA 3OLVA 4G24A 4TKUB 2PSHA 1F8MA 5FP0A 1OU0A 1KEVA 5K0SA 1SR0A 3W01A 2H1FA 3EFHA 5LKAA 3R0ZA 4TSFA 1ZNNA 13PKA 1WVIA 1SAYA 3GUWA 4FYHA 3QELB 4AC1X 2JFBA 3CT6A 2NWSA 3MPGA 1G3MA 3EODA 4I66A 2G9VA 5DHUA 4CL2A 3Q2KA 2ZJ5A 3RIKA 4HQVA 3UERA 1E0XA 1EFZA 4B9EA 1E8MA 3ZDRA 1WBJA 1LWJA 2CLMA 2QJFA 1G21E 4K6GA 2R1MA 2NSHA 2GJ9A 3S68A 4RBNA 3ZWAA 3SC4A 3VZSA 4EOGA 2VHCA 1TQ2A 3ORSA 3AHZA 3H5AA 1QQ5A 1MRNA 4YHHB 2PBLA 4U10A 2JAQA 3N59A 1REQA 4Q7IA 5FO1A 5FUWA 1DUVG 2KPOA 3CLUC 1ZQ9A 4LFBB 1U1JA 2W2LD 4QQ3A 5MF6A 4UARA 1CGTA 3GT7A 4C6PA 2P2CA 3QU9A 3TSDA 3GLCA 3ONWA 1DWUA 2NVUB 4EI8A 3VAAA 4RPLA 4QECA 1NYLA 4HATA 2PXXA 1SOMA 3FG9A 5M5BA 1KO8A 1NR7A 1GDHA 1OFTA 3PZMA 2VZSA 2I29A 5EPOA 4C6FA 4NECA 1UAAA 3TYXA 4URWR 4ZICA 2DUAA 4Q4AB 2A7NA 4UFKA 5TY0A 4F6CA 3LQRA 1QT1A 4NU0A 2B0JA 4F1KA 1ECJA 5FTJA 1YZHA 3WH7A 3TSCA 4Z0HO 3F90A 4DCGA 4XAQA 2O8NA 2C14A 4M1ZA 1NVTA 4YCNA 4FXJA 4AUBA 4JYBA 4MGZR 5CLGA 3PR2A 1O97D 1Z3CA 3RSOA 1JZ2A 4PH6A 1DC3A 3LDUA 2WHPB 3DAGA 4AWTA 1JWBB 1SJDA 3DECA 4JEQA 4FYIA 2YJ6A 5FHRA 5C2XA 1DHTA 4OCZA 2Y76A 1PRYA 1DQNA 5BYWA 1K66A 4M9SA 1ZCOA 5FRDA 4GPIB 1NDUA 2NTJA 4ZODA 5FL3A 5I00A 1NJ8A 4U3JA 1SZNA 1KTNA 2H8GA 1X39A 3LI1A 4Q6JA 1YCFA 2ZRPA 1RYYA 3IKTA 4LJ3A 4CIAA 3UKJA 2HZBA 5JIWA 2QTLA 2PTXA 2WWFA 3QKZA 1DXIA 2LWIA 3L2IA 4D8ZA 1SD2A 1G7CA 4KREA 3K9LA 1XNGA 3OQNA 2C18A 4P4UA 3WMLA 5FOOA 4RLSA 1X7GA 5AM1A 5EZYF 3S7ZA 1GTHA 1NOUA 1Y8AA 2BIFA 3BD6A 4AVFA 3LY5A 1I45A 4IHQA 3BMNB 4X1KB 5LNWA 1PWLA 1X6LA 1UC9A 1CIUA 1QE3A 1DBWA 3CPUA 4Y9SA 4R2KA 3MYPA 3AR8A 2VM8A 1YEYA 1ONBA 3ZBUA 2QN3A 2YCJA 4YWHA 2VHJA 1A5BB 2ORWA 4XJTA 4AS3A 1PWZA 1CQIA 2XWBF 3VR1A 4O11A 1RKBA 2C42A 3CB3A 4C88A 1JDDA 5KVSA 4XKMA 4GJIA 1DTWA 4TOQA 3K8KA 1Q5MA 1JDUA 5DQPA 3IIKA 1ECLA 1HI9A 2QCMA 4EAQA 3TMYA 3OSZA 2A0NA 2OU4A 4O3FA 3AU6A 2X4LA 3VX4A 1VE7A 1KYZA 2BGSA 3ZV4A 4AD0A 2EBFX 3A24A 3DVRX 3K1JA 4WRRA 5AFDA 3L6UA 4MEBA 1SGJA 2FQYA 3WHIA 4PYQA 4J3ZA 3RG2A 1DEOA 4G5SA 2I6QA 1GOWA 2W0UA 2W00A 4DR7B 1L7XA 1NI5A 1YQGA 4HDKA 3L5KA 5I3GA 2G0WA 4C6IA 5KOIA 1GNSA 1N92A 5AI4A 4RE6A 1R8SA 4OMCA 1NJ2A 3U3ZA 3RXZA 2WJIA 3GZAA 2MYNA 3OKAA 1RAFA 1WB5A 4UUOA 4JJ8A 3EBOA 1W93A 4P5EA 1PKNA 5AMXA 1VBMA 2ZXDA 1GG0A 4DT1B 3TPFA 3RMJA 5JQGF 1G4HA 4TXEA 1CEQA 1SEVA 1RSZA 1XCPA 3MTDA 3NHYA 3NXLA 2QLJA 1LK7A 5FDFA 1UMBA 4O59O 4B4HA 4ERGA 5FJUA 4DM4A 2H6RA 1D07A 1RYNA 4GUHA 4K8RB 2FRDC 1G4UR 3C48A 3NEPX 4UBKA 4XAYA 1AQ0A 5L95A 2CUZA 3OTWA 1BIFA 3JWPA 1RHCA 1EGVB 3NYZA 2JLRA 1J22A 2Z6UA 5HA7A 4H83A 1WSDA 1ZENA 1OT5A 2XMQA 1UKQA 5F1VA 2BEUB 5IMSA 4LBWA 4ZZIA 4HDKB 4L8FA 5AVXA 3MGGA 3IRUA 1RT9A 5EFDA 4I2NA 4A29A 2XISA 1E8NA 4D9EA 4R5HA 2DJIA 4IIBA 5IJ9B 2V5UA 3BARA 6REQA 1HT2E 4IDHA 2MYTA 4HD5A 1E6QM 4H35A 1Y7HA 3QVQA 3K2IA 3PTAA 2FV8A 4HQLA 1JGMA 3IO5A 4UNNA 4Y2QA 3BIXA 4XO6A 3FRHA 1SCBA 5K9DA 1MAWA 4YJ5A 3EXTA 1M2VB 3B20A 1OFOA 4MKRA 4D9JA 4IQ4A 1DJIA 1SCAA 4TXNA 4DQKA 4WCDA 1CX9A 3HPSA 5ERXA 1FRVA 4YBZA 4V33A 3HBMA 2WC1A 2C98A 3DLPX 3GCWA 1YE3A 2IITA 3IAEA 1UT6A 1D4AA 4TLBA 1CP3A 1LSJA 3Q3IA 3ERCA 2HK0A 5LQJA 5DGCA 3AF3A 5GJVC 1SBQA 1V5WA 1Z6AA 3OTOB 1L5OA 3PLAE 1ENOA 2V3CC 4OUDB 4F6RA 4F1WA 2BV9A 1AD1A 4TWJA 3ELWA 4IDDA 2WHKA 4L9WA 4CQMB 5ESWA 3NPUA 4RXMA 2M2IA 1GW9A 3K1TA 3HGSA 3AXHA 1H65A 2BEKA 4ISCA 4DQLA 4DV2B 5FL0A 2FWIA 5EMLA 2NVDA 1A9SA 3JQQA 3WL7A 1CFZA 3K9WA 3OKPA 2NUXA 1BW9A 2UYCA 4GS5A 1NNSA 2Z58A 2WNQA 4FZ5A 3BV4A 1NEYA 3A0UA 3BMWA 2IUTA 3MMPA 1ZS2A 2D5LA 4FDLA 3OLXA 4YIKA 3UJNA 1SR9A 1P2GA 3QKEA 1POWA 3PYXA 3QF4B 3ZYCA 4U6QA 2YB1A 2F1JA 4ZOLB 4W86A 4O4HA 1K8CA 2JGRA 1UEXC 1C7ZA 1ADGA 1XJ5A 4G5FA 4GYYA 2YXBA 4CIDA 1MOSA 2HTEA 4EE9A 1B3VA 1ESEA 3EYAA 2ACQA 1OWQA 1Z47A 1QH0A 4KQIA 2ZRXA 4GU5A 2YWFA 4C7KA 4MWAA 1TPYA 5A69A 1MZVA 1K4GA 1P1KA 2DVXA 3ARUA 2RK4A 1JNXX 3QHMA 3W22A 3ZHOA 4BV9A 2E21A 3CQ0A 3VH3A 4IVPA 4Y2HA 4LYJA 5J4VA 3WJYA 2YUTA 1KJ8A 1N5RA 2QL7A 2P4EA 4JBRA 1E6XM 5AW1A 3CQHA 4BF9A 3ANXA 4DZZA 4IG9A 2N75A 5TR9A 1IN4A 4CLEA 4L4XA 4GT1A 4JD5A 3IJ9A 4LVBA 4DJTA 4R71A 3TZNA 2D5AA 4GX8A 4DWDA 1HP5A 1NKTA 3ER6A 4KFPA 1PZHA 4YCSA 3PSVA 2P2YA 4EECA 1SSGA 3HCFA 1JVBA 4Q22A 5CG2A 4O4JA 4WERA 2HJVA 3JWIA 3NGFA 1UP2A 5BN1A 1TCBA 2QDKA 4BLPA 5CJ2A 1JIXA 1W94A 2Z6IA 1KPIA 5JXJA 4AX8A 3STPA 2I3DA 1V08A 2D00A 4RV8A 4YJ3F 4CQAA 3U4HA 2PA0A 1X0VA 5JYDA 4XPIB 1G8JA 4URHA 1QGYA 1FSSA 4KGJA 1B0UA 4RUBA 3G2IA 4MQLA 4W4TA 1MQSA 2PWAA 3MJMA 1ZL0A 1ISGA 1WPGA 2IX9A 2SKEA 4U0KA 1MGOA 4LVAA 3EIUA 4JDYA 5HDQA 3VKFA 3HKCB 3VIIA 2Y6VA 3QYPA 3AZQA 3BL5A 1JIQA 1SXGA 1LPBB 4C7MA 1C8LA 3RRMA 3V6MA 4KI7A 4MY8A 1ZZGA 3CV7A 3AMVA 4RPIA 1U94A 1XZJA 4ZAGA 2G0TA 2IW3A 4RD2A 1B8NA 1RACA 4PB4A 1P1JA 3P52A 3NT4A 1E4EB 3I9OA 1JIVA 2IUFA 1W5AA 4MO2A 4LOHA 3SUWA 3GG7A 1S2MA 3H5IA 5F7ZA 4WBNB 2W90A 1ZH2A 5HVNA 5LGZA 5D6NA 1KP9A 4ITRC 3TZEA 3AUYA 2IXGA 3PXAA 3WTCA 2Q3JA 4EY6A 4NENA 2GCOA 1OX6A 1BYCA 2CC0A 1NMZA 4XGKA 1VKRA 4BX8A 1AZ2A 4TMZA 2VRJA 3WGOA 4Q1FA 3D0OA 4C7OB 4KQ6A 1T1RA 4X71A 4JLUA 1NY1A 1KMHB 2C7BA 4RDIA 2ZIFA 4EUEA 2G06A 2CLOA 3LLDA 1SW0A 3EDMA 3V4BA 1X7XB 4C3ZA 3WAKA 4GPZA 4IIJF 4JFSA 3PTQA 2ZA1A 4LAMA 2HT6A 4Q1BA 4AJOA 3P27A 2ASEA 1P0MA 3W4RA 2ZUEA 1U6IA 3C8FA 3KSUA 1OFDA 2I2AA 3H75A 2WU3A 3L7NA 1XSKA 2GAFA 1NF2A 1E79D 4UVEA 3W25A 3TAXA 1MX3A 4F86A 4Z86A 3GVVA 1Z2EA 2GN1A 2C2YA 1KMQA 4RTQA 1VXOA 1KU0A 4TGLA 3Q4GA 2QV7A 5KQGA 3SDSA 3K05A 3QNUA 3M0IA 1EIWA 3RILA 2QIIA 1RI5A 3MFYA 3IJ5A 5FKJA 1S2WA 3ZT6A 2J0UB 2Z1SA 4GD0A 3BW2A 2ZAYA 5HKKD 2FGKA 4GXRA 1TA9A 3K9BA 5KWSA 4GDFA 1XCGB 4MNTA 4AO6A 3VDAA 2ZAIA 1K9EA 4CQDA 4C6SA 5B7PA 3B3AA 2PX5A 4OHRA 3AVXA 1G0CA 1VKHA 2GNPA 2X1UA 1Q1AA 2QPLA 4AVOA 4IRXA 4L6AA 1GKIA 5SWUA 4K28A 4W7WA 1I9CA 4YAEA 2Y77A 1IXOA 3NTYA 3B8UA 1EGZA 4OU5A 3C45A 4KEMA 3T9BA 5BOSB 5AKQA 5BXYA 4WR3A 3WB9A 1IUKA 1RYEA 2XA9A 3T7IA 1BVNP 4IH4A 3C5QA 1FFYA 1Z7GA 3KB1A 2F84A 3KYIB 2AJBA 4F04A 5HOEA 2GVGA 1CF9A 3LFUA 5AHXA 1AQMA 4NU5A 5KWEA 4N47A 3IT0A 2Y1EA 2X1VA 1JBKA 3GRCA 2QM8A 3QR1A 4HU4A 1MO6A 3SUSA 1GSOA 3VJLA 4R7OA 3GAAA 1VEMA 1MV5A 3R24A 4U8HA 1J2WA 4DM2A 4NNAA 2A9OA 2G0NA 1YASA 3I3SR 2OCKA 4AIIA 1O95A 1P3JA 2IPXA 3HBAA 2B92A 4TLMB 5J5VA 3F7TA 3UWUA 1AMYA 2QDDA 2FXIA 5GPRA 1KH1A 4KQCA 3Q7SA 3IUEA 3ZVRA 1QRSA 3WNOA 2VT7A 2OA0A 1RKXA 2MINB 2FZGA 3UJHA 2GXUA 4CKWA 2VZLA 1WMEA 3K7EA 2AJ8A 2WQPA 4JT8A 5ARBA 4KN9S 3DWFA 5DGIA 2BTQA 3RYIB 4F46A 4X20A 1IBSA 4KR2A 3W3AD 4YDQA 2Q99A 4JDUA 2INGX 2YHSA 2BBWA 4J0QA 1H7OA 1FYWA 1SXJA 1VCNA 2NUTB 1PWHA 3C5WP 3P8ZA 3PZTA 3RSCA 3N0WA 4IX0A 2F61A 4PCTA 3R2GA 1K9SA 2F3PA 1RQGA 2PBRA 1H9CA 2Q1YA 1WS6A 4MR9B 3I34X 3UWSA 2OLEA 4G1NA 1UT8A 1E56A 4HK4A 4DRXA 4J0IA 1GLVA 2OSXA 5LNSA 1P77A 3S8EA 4FX7A 2GEJA 5ES3A 1GOQA 4XLZA 3QPUA 3KQPA 4GI5A 1H3GA 2Z8ZA 3F6RA 2DLDA 4P34A 2ETXA 1EIZA 3IPWA 1WHTB 2HJGA 1PHRA 1Y3AA 1O4WA 3VKBA 2EZ8A 3OBIA 2PUAA 2YBVA 4LS1A 3SSZA 4JLPA 3DLAA 4L8LA 3RIGA 1VXRA 2TRSB 5DYTA 2J7PD 1CERA 4PLWA 3MZ2A 2H51A 4NMLA 3W7KA 1Y6QA 1C9MA 1J39A 3IIMA 1C9DA 1TTQA 3PUDA 2MSKA 2P9GA 2PUJA 1NURA 2EKQA 2GTIA 1DAGA 1N5KA 1IBMB 3HYRA 1OH6A 1Q74A 1CUFA 1X96A 5A9SA 4FFMA 1GGVA 4ID3A 2JIMA 1BGWA 3DB1A 4KR7A 3K71B 2ZE6A 4Z2LA 2GESA 1UP3A 1P29A 1ZGZA 3SOPA 2JD2A 1FFEA 2HJ9A 2IXFA 3LS2A 4WNAB 1N3LA 1U0HC 1RK6A 1G67A 3OZVA 4EFKA 3N2NA 1EE2A 1DX9A 3I0NA 1TTPA 2ZVIA 3FTEA 3E02A 2KQUA 2CNOA 3PFMA 1MOQA 4XR4A 1ZGHA 3V42A 5GNYA 3IVAA 4XUGA 4ZRDA 4GOMD 2ACEA 2FCAA 4AY7A 3TLZA 2HPAA 3DDOA 4HLDA 2VC2B 4NJEA 4XJSA 1V7PC 3BRWD 1L1FA 1KC7A 1PZ3A 4JAWA 1HVQA 1V8FA 2PXAA 3K6JA 2FZLA 2ANBA 3GB9A 2FEPA 3MWEB 1E2NA 4QFCA 3MG9A 2P41A 3WGJA 2WIGA 3VR5D 3EGCA 3NHLA 3UPBA 1U3GA 1U8ZA 2ZI5A 2GYVA 2IHZA 3D02A 3GXIA 1RXYA 3CR8A 3GKAA 1JIBA 3VISA 1J90A 1F6WA 4J5NA 3JZUA 2H9AA 1XRRA 2H1SA 1D2GA 4IH3A 4LDAA 3EB3A 4UXIA 2FMNA 4DHEA 4B5XA 3VU9B 3TZCA 4U7DA 4B3HA 5J4LA 4HZGA 5EP3A 4UMCA 4PNHA 4RLQA 3BF8A 4I3HA 3ZXYA 3T42A 4MUEA 1C9DB 3FPSA 3ME3A 2IUZA 1XQYA 1T91A 2G3FA 2HMTA 2R11A 4YCBA 1M6WA 3NDIA 2VEDA 4C3UA 5AKKA 3L2LA 2J9YA 5IK2D 3ESRA 4H60A 1KVQA 1SBHA 2A5LA 2GD1O 3E96A 3DZCA 1L5NA 4B5NA 1UADA 2E6FA 2RG7A 1A71A 1KIMA 1ONPA 1PBNA 1EFKA 1PI3A 1YFJA 4MKSA 3USCS 1NSJA 4S38A 2ZK7A 1Y7VA 2IYLD 4JPGA 4ESOA 3PHBE 4CEIB 3TNFA 4BMDA 3JS5A 2VL7A 4NEQA 4Q4JA 1UD6A 1SHJA 1GPDG 1G20E 2VPTA 1E0KA 1TPC1 3WQGA 3ZWTA 4O8RA 1M54A 3KCJA 4IEFB 5SZHB 1W2VA 3N19B 3C3CA 1YLVA 4NVRA 4MS1A 3OCUA 1JR6A 2BGTA 3K30A 3LBNA 2BX7A 1CFJA 2NSOA 2AN5A 4UC5A 4MLRA 1CGVA 4GBDA 3CF2A 4DSAA 2BLNA 4E94A 4KR0A 2ZBQA 4ISBA 1H49A 3EPHA 1Z2PX 1IT7A 3G7UA 4ZR8A 5DNDA 1F5ZA 1UR0A 4ZU3A 4PM4A 1V5FA 1SBNE 3HVJA 4HNHA 3UG7A 3VOIA 1LZLA 2O9JA 1VI5A 5DWQA 5DCLA 3U2QA 1VLIA 5K4XA 4IPTA 4GMGA 1VMDA 1MXFA 5BVGA 1MNZA 5JAHA 1H63A 1FSZA 3I7SA 1DBVO 1O12A 5J4HA 2JCBA 3IEVA 2EZ9A 3TI9A 4WXHA 1Z26A 2G25A 1UBRS 1QFZA 1Z06A 1M76A 3AGPA 1RQEA 3V00A 3DGEC 3E53A 2Y9MB 2QENA 3EDKA 1MBZA 3E9MA 2CLIB 3OPMA 4HTBA 2DV0A 3GW3A 2JAPA 2W6OA 3MQ4A 3GGSA 3HM2A 2J7CA 3NXFA 4OK5A 5EIFA 3O0KA 2OT1A 2ES4A 3NC1C 3C4VA 4HSHA 1Q8AA 3RRJA 2C7OA 3FHAA 3AV0B 3NV7A 4GWLA 3W81A 4G0NA 1CYEA 4AJEA 3D4PA 3WZMA 4LDRA 3AIKA 4LYHA 2G8LA 3QP9A 1N8FA 2OUKA 1KGSA 4X8MA 3P9XA 2EGGA 4HDSA 4LHYA 2WPGA 4EPYA 1QFSA 3VIGA 3ZHBA 2O05A 5MHBA 1YQXA 2WD7B 3QF0A 4AZHA 3GNTA 3TTVA 4ZCPA 5C5EA 1P5FA 4REOA 2CITA 3HMKA 1XIDA 1A95A 1GAWA 5LU9A 1TRIA 2I76A 2Z28A 1IB0A 1Q0UA 3VZQA 1AUSL 4ZO9A 3V2HA 4PA8A 1MABB 4MYUA 3U3HA 3TQSA 1TVEA 1EUAA 4EYKA 1V03A 4Q5IA 2GJPA 4IHJA 1QAMA 3TX6A 4XB6B 1U63A 3UFYA 2OCLA 1FZTA 3FOAA 4GM4A 1EDTA 4BO0A 2VYVA 5F52A 4RV3A 1XV5A 5HF8A 4IOKA 4ECAA 4FOSA 5CC3A 2BTMA 2XXAA 1G6CA 1ID8A 3N11A 3Q1KA 4G7EB 1KFCB 5CSRA 3EEFA 5JAPA 3N7UA 1XZPA 3NHUA 2NZJA 3DFQA 2Q1WA 3LHVA 1Q6YA 4TV8B 2NQZA 3N05A 4NYMQ 3GW0A 3I4FA 3I76A 3I9V6 4QFUA 1SELA 4JGBA 4ERIA 4ZMGA 4I1VA 5F7XA 2NO0A 4OV4A 3VSBA 1L5HB 3ADOA 3AIIA 5JD4A 3GS6A 3HCAA 3B8WA 1UBSA 2R6JA 5BSRA 3A9WA 3AETA 3L0YA 2J13A 2JA1A 4PB3A 2JLWA 3A4MA 4ASUD 1W5EA 5KTRA 4BCCA 2V5CA 4IXDA 5IVPA 4HXYA 3WSUA 2FPGB 2C8VA 4EVQA 1ZAJA 4KDEA 1XYZA 2XZ7A 1NW5A 1SK8A 3AFNA 3QOKA 1P1MA 1BQ3A 1W9MA 3ZLFA 4HLUC 3DH0A 1CQWA 1R38A 2WTAA 5H81A 1PYMA 3BOXA 4KWCA 1Y6RA 5EQDA 4FZIA 3OIDA 3V0SA 4RH3A 4YDSA 1WDMA 3ZPXA 1RWKA 2B7QA 1GU7A 3RFAA 2J8FA 4TYNA 2A9PA 1KVRA 1M7GA 2C7FA 3BUVA 1V1MB 2BCJQ 3W1NA 1OF1A 1N2CA 5IOBA 5IM4F 1PXGA 5C7HA 3TOXA 2C2XA 3RSGA 1OQFA 4P4LA 5IBXA 3P67A 3N8GA 3EEOA 1VZWA 3DL0A 4OQFA 1T5DX 1E5QA 4DEFA 4AI6A 3ZN2A 4R1OA 1V0KA 4GVIA 4C5CA 2DFDA 4TWZA 4YREA 1ML1A 3N4AA 2IYXA 4PO1A 2JATA 2PS0A 3QVJA 3UCQA 3OE5A 3ZHZA 4HG2A 4HSOA 3M5VA 4P38A 3TAHA 4BIIA 3C52A 3GFPA 1GEHA 2CMGA 3HI6A 4UCQA 2IOHA 3HLKA 1CDOA 2FDRA 1T1IA 4GPD1 4V2IA 1HM5A 2FMIA 3MUZ1 4LHVA 1EB8A 4UB9A 2V7BA 4L1WA 2H59A 4CKEB 2BKUA 3ZLGA 2FFBA 2F3QA 3VNDA 2INFA 1FWGC 4Y6SA 3HKDA 2VEMA 4C76A 5TARA 3EOLA 4ZYXA 5DY3A 2RFLA 2B37A 3MS8A 1ZZMA 2QVHA 2O8DA 3KV3O 1QHSA 3AVQA 2X1HA 1P0DA 2DJ5A 4FCTA 1V3KA 1EQUA 2ZXUA 3THXA 3TLJA 1TV7A 4BE7B 1US3A 2CLMB 1YB6A 1NYTA 5JBNA 4WPGA 3F7NA 2YY5A 4RL3A 4WJXA 4DJAA 1PF7E 1W36D 5K7JA 4LUIA 2QGZA 1BX3A 1ZA2A 3LRKA 4YS1A 4DYDA 3G3DA 4PLYA 5D2VA