4G56A

Crystal structure of full length prmt5/mep50 complexes from xenopus laevis
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
626
structure length
617
Chain Sequence
RVSSGRDVACVTEVADTLGAMANQGFDFLCMPIFHPRFKREFYKEPAKSRPGPQTRSDLLLSGRDWNTLIVGKLSDWIKTDSEVSRIRKTSEAAMQQELNFSAYLGLPAFLIPLKQEDNSNLSRLLINHIHVGHHSTMFWMRVPLMAPNDLRDDLIENEPGEERTWIWWHNFRSLCDYNKKIALAIEIGADLPSGHVIDRWLGEPIKAAFLPTSIFLTNKKGFPVLTKVHQRLIFKLFKLEVQFVISGSHHHSEKDLCSYLQYLEYLSQNSPPPNAYEMFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPVKYSQYQQAVYKCLLDRVPEEEKETNIQILMVLGAGRGPLVNASLRAAKQAERKIKVYAVEKNPNAVITLEGWRYEEWGSQVTVVSGDMREWKAPEKADIIVSELLGSFGDNELSPECLDGAQHFLKDDGVSIPGEYTSYLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSDPLPCFTFHHPNKDDVIDNNRYCCLQYRVDLNTVLHGFAGYFNTVLYKDVTLSICPESHSPGMFSWFPILFPIKQPIPMREGDTVCVRFWRCNNGKKVWYEWAVTSPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
pubmed doi rcsb
molecule keywords Hsl7 protein
molecule tags Transferase
source organism Xenopus laevis
total genus 169
structure length 617
sequence length 626
chains with identical sequence C
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4g56A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4g56A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4g56A02
2OKCA 3BZBA 3DLIA 5FWAA 2P3LA 1RI3A 3LDFA 2Q02A 1ZGAA 2HV9A 4RTRA 2B25A 2DULA 3WQOA 3M33A 5BP7A 1WZNA 1FJXA 3FTEA 4PYIA 1A0EA 1BXCA 1IY9A 2ZFUA 1VLMA 4QTTB 2R6ZA 1I6NA 4RSRA 5GOZA 1RJFA 3VNKA 5KQSA 2ORED 3DR5A 4X61A 4RTMA 4PYNA 2C7OA 5DX0A 2AOUA 1YZHA 2FCAA 3FTDA 4YUXA 3DXYA 5K09A 5K03A 2I56A 5CVJA 2ZTHA 3K0BA 4YMHA 5HIKA 2ZZKA 3FUWA 3P2EA 4AZWA 1ZQ9A 1AV6A 3CJQA 4EQZA 1U2ZA 2K4MA 3Q7EA 2ZWAA 5KQRA 1L3BA 3EMBA 2AOUB 3NWEA 3KQWA 3EVZA 4M37A 5G02A 3LHDA 2AN5A 2JHCA 4P7KA 3ER9A 3DH0A 5EEGA 5K0NA 1X1CA 4K6MA 2O57A 5LQAA 4FT4A 1FP2A 3HCFA 3M0YA 5D1HA 3C0LA 4XIMA 5CVUA 3O4FA 5HEKA 3JWGA 5AVNA 4OBXA 3KBWA 2ESRA 2OB1A 3R9XB 3EPPA 2HR1A 1M0EA 2WA2A 2H11A 1XIDA 4FP9A 4RVGA 4XIAA 5DTQA 1JG4A 5DX1A 1XIEA 3G2QA 1YUBA 5EQJB 3F4KA 1XLEA 4L7VA 4BLVA 5ICFA 1KR5A 3EVFA 3C0QA 5E8JA 3KR9A 3P9IA 4HRAA 2P7IA 4KWCA 1ZGJA 5C0OE 3ANXA 3IHTA 2VDVE 4RTNA 4GQBA 4YUZA 1P1BA 3G88A 1DE5A 1TPYA 2PV0A 3BDKA 4GF5A 2QYOA 3ERCA 4AX8A 1KXZA 4ISCA 5E8RA 4PYLA 3OU7A 1DXIA 1UWVA 3FRIA 3KKZA 5EIWA 4PCLA 3PS9A 1A0DA 3L23A 4FSDA 3BKWA 2DPMA 3BT7A 4PFHA 2GA9A 1JTFA 2B2CA 1O1HA 3AXSA 1XLAA 4EKIA 3B89A 4XKMA 5GM1A 3TM4A 2OU4A 1QAMA 4FSXA 4BY9E 1KP9A 3CQJA 4QEHA 4KW2A 1FPQA 2XINA 1RI2A 1JG1A 3CC8A 3IEIA 5LQCA 3KPVA 4QPNA 5EMJA 2GS9A 4YUWA 3MTEA 1H1DA 2VDWA 3B3GA 4QE5A 3SXJA 1NW3A 1NW7A 5T67A 5DPMA 1L1EA 3UXIA 5FULA 3OPNA 1JQEA 2IH5A 3EGIA 3QZAA 4Z2YA 3TLJA 5EKXA 4AZTA 4LNCA 3KQQA 4RTQA 4UOEA 3THSA 1RI4A 2QUNA 2VZ9A 5DXAA 3HCEA 10MHA 1CLKA 1YB2A 2NXNA 3NDJA 3M4XA 3LECA 1D2HA 3G2MA 4XISA 4E33A 4PGHA 1M6YA 3R24A 2JH9A 3P2IA 1XLKA 3ITVA 3MAGA 2PLWA 3RODA 5FADA 3T7RA 3MHTA 1XLDA 5FA8A 2E5WA 4F86A 1KHHA 2NXJA 1PRYA 2IH4A 1NW6A 3UA3A 5CVDA 2ZW9A 2PX4A 4DMGA 3DX5A 1R74A 4KRGA 2P8JA 4M38A 3QOWA 2VDUE 4YUYA 2QE6A 2UYOA 3HM2A 4EMSA 3KPUA 5DTRA 3V8VA 5ICCA 3AYTA 3HCCA 3GU3A 4GJIA 5DSTA 5K0FA 4MQ4A 2XVMA 4PIPA 2OB2A 3MERA 3M70A 4P7JA 2YXDA 3CGGA 2J6VA 5EGSA 4K1GA 3DUWA 1JTEA 5EMKA 3PB3A 3O31A 3HA7A 5CUQA 3NGFA 3KR0A 3THRA 1QUMA 1EJ6A 1R00A 3ITYA 3HVHA 2HCVA 4ZB0A 2CKDA 3FZGA 1JQ3A 3KPWA 2GVEA 3CVOA 2ERCA 3LKZA 3N4AA 1O9GA 3UU0A 2AN4A 3AAMA 5CM2Z 2ZIEA 1AF7A 3EEYA 3TR6A 2OZVA 1XP3A 2GLUA 3CQKA 4PGLA 1P39A 4NECA 4HGXA 1Z3CA 3A4TA 4FT2A 2FK8A 2ZZMA 4QVGA 5CVVA 3HTXA 5MHTA 3BANA 1I4WA 5EKUA 4R8SA 2OYRA 1MJFA 5ERGB 3PFGA 4A6EA 3XINA 4EVIA 3HVIA 3QOXA 1XTPA 2PGXA 2ZIFA 4M36A 2XYRA 5DM1A 3JWJA 3CNYA 3GCZA 8XIMA 3TFWA 3GJYA 1X19A 5FQNA 2NXCA 2FRXA 1NV8A 4LWOA 4CKCA 2IH2A 3KCOA 2G70A 3KR1A 4KDCA 2PKWA 3UJ9A 2BR3A 2IGTA 2AVNA 3GWZA 1XLFA 4QDKA 3UA4A 2AOXA 3SSOA 3G8AA 2ZSUA 4GOOD 5K0CA 3UJCA 1QT1A 2XVAA 5E1MA 1XLBA 5K01A 1KPIA 3DBNA 4GEKA 1A0CA 3TVAA 4HHMA 1RI5A 1FP1D 5K0JA 1VL5A 3KHKA 3P97A 3TM5A 3PX3A 2I6GA 3MGGA 4DVOA 5GWXA 3C0KA 2IBSA 4IKPA 4CXMA 1ORIA 2A14A 4LECA 4X63A 1YFLA 1XLJA 1AQJA 3E8SA 2P7HA 1XLIA 5HOQA 4YTQA 3E05A 3UJ8A 3LGAA 4E2WA 3U81A 3FUUA 3HP7A 5M5BA 1MUWA 1XIGA 3ITXA 2IDJA 3ORHA 4HGYA 2OY0A 1JQDA 3JWIA 3CCFA 4QE4A 3EVCA 3LSTA 3ELYA 4E3VA 2C7PA 3P2KA 2ADMA 2PT6A 2G4JA 1G60A 2YUIA 3EEOA 3BGVA 2P40A 3UJ7A 4EKGA 2GAFA 3FPHA 1HMYA 3UJ6A 3EVGA 4X1OA 2AOWA 4ER7A 5B80A 1T43A 5ICGA 3VNIA 3PX2A 4QPPA 4KIGA 3M0VA 2ZCJA 2QRVA 3FPFA 3BWMA 4AUKA 4U7PB 5K0GA 4RVHA 5LQRA 3SSMA 4QDPA 2QUMA 2YR0A 4AZVA 1G8AA 3OU6A 5EMMA 2UYHA 3P8ZA 5EZQA 3OZSA 1BXBA 4E70A 2QRVB 1XDZA 4E32A 4IWNA 3LCVB 2GB4A 4P58A 1I1NA 4XUEA 3ID6C 3OZTA 4GC9A 2G8NA 1KYZA 4C07A 3WSTA 2H1RA 1QYRA 3C6KA 3FTFA 5KYGA 2IIPA 3DMGA 5T64A 3LX6A 1XDSA 2NP7A 3TMAA 4C05A 2BR4A 5CCBA 2UZ4A 3HCAA 3E23A 1NV9A 3B3JA 2GYIA 2N47A 3SVZA 1GW9A 5FHQA 2EJTA 3ELDA 4R6XA 3OE4A 4PINA 3M0LA 3FUXA 2PX8A 2JJQA 1SQFA 4LG1A 5DM4A 4YTSA 3M0MA 3DXXA 1VP9A 3AY0A 4RYLA 3TQSA 3VYWA 4BP1A 4E2YA 3KQPA 1EG2A 3CQHA 9XIMA 2OXTA 2NXEA 5DSXA 3KQVA 4CKBA 5U4XA 4E30A 1KPHA 2C7RA 2IDKA 5C9ZA 3OCJA 3JU2A 2CL5A 3C3PA 4POOA 3DP7A 5EIFA 3M6VA 4QDJA 2C7QA 2PVCA 2G0WA 4OA5A 3A25A 4G56A 1XISA 4C08A 3KU1A 5BW5A 1F3LA 5EHGA 4C03A 5EMLA 4OQEA 3OFKA 2YX1A 4FZVA 5HIIA 2AOVA 3KBMA 3P9KA 2FPOA 4DA4A 2IPXA 3UBTA 1SVUA 3I9FA 1INLA 4XCXA 4RTLA 3UJAA 2KW5A 1OADA 3UJDA 1JSZA 1UIRA 3SR4A 1XICA 3BKXA 1NT2A 1VBFA 4O29A 4QDWA 2ONYA 5FQOA 3KCLA 1ZHFA 3I5UA 4DM3A 3NW9A 4GLEA 4DQ0A 1TW3A 1G6Q1 3GIWA 3LPMA 5K05A 2O05A 2JH8A 4J4KA 3UFBA 1VE3A 2P35A 4BP3A 8XIAA 2PSSA 3I53A 4ZB5A 2G71A 2Z6QA 5K0EA 4RVDA 3PTAA 1YF3A 1TZ9A 3ITOA 3PLAE 3TPZA 4PYQA 3U3HA 3A27A 2AZTA 1XLHA 4WXHA 5FTWA 3HCDA 4YTUA 1WXXA 3M6WA 4R05A 3DXZA 3TC3A 4ER5A 1RJEA 4DUOA 3TKYA 4YV0A 3XISA 3I58A 4HNOA 5CIYA 2Y1XA 2EX4A 1NE2A 3NVKI 2I9KA 1JSXA 1QZZA 1XVAA 4HTFB 3CJRA 4FS8A 2HK0A 1XIFA 2ZDSA 5P8WA 2V74B 5E1OA 4A8IA 8MHTA 1O54A 4DKJA 1IXKA 4CTKA 1ZKDA 1NBHA 1QANA 3B3FA 1S5NA 3NJRA 5F2KA 2PXXA 4ER0A 2Z6UA 2NQJA 5DRYA 3GXOA 5IH3A 1OR8A 2P1DA 3SM3A 2BR5A 5BW4A 4KDRA 4EAYA 3CJTA 1EQAA 5B7ZA 3LCCA 3BXOA 5DM0A 3M0XA 3HA5A 5F2OA 1DIDA 5ICEA 3PT9A 1WG8A 3BGIA 4RVFA 3UWPA 2FHPA 1XLMA 3VYLA 4E2XA 5FWDA 1G38A 1XDUA 5DX8A 2JHAA 3TOSA 5LQNA 4F84A 4OVXA 1X1DA 4PYJA 2PX5A 4PIMA 1VIDA 4W4QA 3T7TA 5BXYA 5IKMA 4XSMA 3VNMA 4Q7IA 3GRVA 3FPEA 3GNLA 5LR6A 2EG5A 1R6AA 1QAQA 2NYUA 5LQJA 1RJDA 5C1IA 3KTCA 5FCDA 5EZSA 5DWQA 1XIIA 4KIFA 2NQHA 3KQYA 4C06A 5HZMA 5KVAA 3FUTA 1RI1A 2PWYA 1B42A 1DUSA 4KW7A 1P91A 5H6HA 4YTTA 1BKYA 3BZJA 2B78A 3DULA 2H00A 2EJUA 1KYWA 4XUDA 3Q87B 3MB5A 2X7WA 3D2LA 4F85A 4Y30A 3ELUA 1EAMA 5JR3A 3MCZA 2ZZNA 3TKAA 3FPGA 4P7FA 3UZUA 3REOA 4FR0A 2ZBPA 2PT9A 3UJBA 1VQ1A 3R0QA 2ZWVA 3UVAA 2IFTA 4YV1A 4V0RA 5GIPE 1S5MA 4HH4A 3KBVA 1R8YA 3SX0A 4XSLA 5E9WA 3EVEA 1DCTA 5TNVA 2B3TA 3P9CA 1R18A 4RTJA 2FYTA 4LWPA 3DLCA 2GUBA 2ONZA 3AALA 4H0NA 2NNWB 1DIEA 3GRYA 1L9KA 3G8BA 3GRRA 2G72A 1XIMA 4QQKA 1Q0TA 1YX1A 1EJ0A 3EVAA 4WVLA 3SMQA 5CD1A 2GLKA 2AN3A 4R6WA 2ZULA 3QXBA 5DM2A 1AQIA 5GIOE 3G2PA 1I60A 5K8VA 1QTWA 3CKKA 4EACA 1O9HA 5HILA 2PJDA 1SUSA 2PX2A 5DTMA 1EIZA 3JWHA 3K6RA 2EFJA 2HNKA 1PJZA 5GP1A 2PXCA 3H2BA 3X0DA 5DRTA 5DT2A 3FVMA 4HHLA 4QE1A 2BM8A 3O7WA 3LDGA 4ATNA 1XYBA 3NVMB 2GH1A 4E31A 2ZLBA 1XXLA 2QW5A 1KPGA 4YTRA 5E9QA 5LQKA 3FYDA 2HWKA 4US6A 5DXJA 2XYVA 1XYAA 3I64A 1Q0SA 4CWAA 3M6XA 3GGDA 1WXWA 1NW8A 3P6LA 4QEEA 4MIKA 4ZBCA 3LBFA 3VNLA 6XIAA 2QULA 2P3QA 4RX1A 2VS1A 1YFJA 4OQDA 3AWIA 4GOMD 1M6EX 2OPBA 5E9JA 4DZRA 3M0HA 4YMGA 1KIAA 1K77A 3EGEA 3OFJA 4IV0A 2FK7A 3G5LA 3GO4A 3L8DA 3FRHA 3NTVA 3HEMA 3T0IA 4IV8A 5FHRA 1BOOA 3LCUA 1JG3A 3KBJA 3A26A 2O0LA 5HFJA 2YVLA 2R3SA 4R8RA 4A6DA 4C04A 2V7EA 2P3OA 3GRUA 1JG2A 3KQTA 6XIMA 3G89A 1P1CA 3OZRA 3DMFA 1NW5A 2PXAA 5CVEA 3AXTA 4K3ZA 2YQZA 1BC5A 2ZIGA 5CCXA 4ZB2A 1XLCA 3KBNA 7MHTA 2I62A 4X60A 5XIAA 3BWYA 4OX9Y 3M6UA 5KS2A 1YZ3A 3BWWA 3KQOA 4V0QA 3HA3A 2Y1WA 4RWZA 3BUSA 1ORHA 1L3IA 1G55A 4Y2HA 4GOND 1SG9A 5E2BA 3T7SA 3GNXA 2WK1A 1XYLA 1XYMA 2YXEA 2PWPA 3S68A 5EG5A 3VC1A 4GOLD 5AVHA 4U7TB 4AZSA 4PYMA 2P41A 2AR0A 3OU2A 2ZBQA 5FA5A 5XINA 1R8XA 3FPJA 2B9EA 2F8LA 4QTUB 1UFKA 5J8LA 2PBFA 3FUVA 4M7RA 4MTLA 3BWBA 2LD4A 5EOVA 1MNZA 1JR4A 3LBYA 3IYLW 5B1SA 3LKDA 5E1BA 5E1DA 2XIMA 5HIJA 5EC8A 5K0LA 2UYCA 3AYVA 3E7PA 4OA8A 1X1AA 2YXLA 3NDIA 4RV9A 3QYSA 3ELWA 3B5IA 1XIHA 2BM9A 5EEHA 3ITLA 3CWHA 3R6TA 3KPYA 4PCAA 2PY6A 1XCJA 4C4AA 5F2NA 1XIBA 2AS0A 4ER6A 4BLWA 4PONA 4RTPA 3G7UA 2ZBRA 4ER3A 3VSEA 4YUVA 5H02A 3MTIA 9MHTA 4HTFA 2QM3A 1XLGA 3ME5A 3TRKA 4A8LA 3IUIA 2VP3A 3ER8A 1Y8CA 3OBEA 2CMGA 1WY7A 3LDUA 4KVZA 3HNRA 5EHIA 4A8NA 1N7JA 2UYQA 5EPEA 2O07A 4RTOA 2JG3A 3G5TA 1SKMA 1XJ5A 1SUIA 3C6MA 3BZGA 4GBED 2BH2A 4QQNA 3XIMA 1QAOA 2CWWA 3EGVA 3KCJA 3VC2A 5EVJA 3DTNA 3QV2A 3EMDA 4HG2A 5T6BA 1MHTA 3DOUA 3P14A 3FTCA 1DE6A 1NBIA 4RTSA 3HCBA 2JHPA 1D2CA 2HMYB 3NMUF 2G1PA 3CBGA 4PWYA 4B17A 5XIMA 2YTZA 3A7EA 4RTKA 4DF3A 1V39A 3ITTA 1XLLA 4GUAA 1XIJA 4DCGA 5FUBA 5GINE 4MWZA 1XYCA 3VNJA 2O06A 3KPJA 3KBSA 4HGZA 3KR2A 1XINA 1BHJA 3PFHA 2CMHA 2I7CA 3LMZA 2WA1A 4HC4A 2Z6AA 5I7GA 3MCTA 5LSAA 3P71T 3B7PA 1X1BA 2AVDA 3RW9A 4CTJA 5LQUA 3U0HA 1TW2A 2NQ9A 1VP3A 3OE5A 5K0BA 3SSNA 4CKEA 1D2GA 4GC5A 4JXJA 1SQGA 4HSGA 3EVBA 5D1NA 3KQMA 2IBTA 3EVDA 1DL5A 2GPYA 4OBWA 3GRZA 1ZG3A 1RJGA 1FBNA 4FGZA 1IM8A 4PYKA 2X7VA 3RIEA 1L3CA 3KQSA 3NWBA 1WS6A 3HVKA 4GJJA 9XIAA 2Q41A 2QY6A 3HVJA 1N2XA 5E2AA 3A7DA 4X41A 4ZTBA 3DMHA 2IP2A 2XISA 4A8RA 2ZVJA 3IV6A 1G8SA 1N7IA 4PYOA 1D8WA 4E2ZA 4EK9A 2I57A 4PGGA 3KWSA 4DCMA 2XBMA 3LL7A 3IUDA 2NP6A 3AJDA 3C0SA 3R3HA 2XYQA 3P9NA 4MHTA 2ZVRA 3SGLA 3MQ2A 5HIMA 5GM2A 2AOTA 3GDHA 2HK1A 5H1WA 1F38A 4XUCA 1XCLA 4P7GA 3FYCA 5JUWA 7XIMA 4BLUA 3IUHA 3PVCA 4PNEA 2OO3A 2BZGA 3QC0A 3G2OA 3BGDA 3BWCA 2AOTB 4QVKA 3CQIA 2OBFA 1HNNA 5B7YA 3V97A 5DLYA 3C3YA 1VPTA 2HTEA 1I9GA 4YV2A 1NKVA
chains in the Genus database with same CATH superfamily
3USBA 3ROZA 1J0XO 4LBUA 1QVWA 1G2PA 4JLUA 3N2TA 2YCKX 3KKQA 4KRUA 3RNLA 3EDDA 4DA7A 2VCCA 4FLOA 4EGCB 3HPXA 1GPDG 1Y6QA 3C24A 1J93A 3LSBA 5C7HA 3H84A 3O7UA 2Y4SA 2G3JA 5JOQA 3K9BA 5JQGB 4DR6B 4C5BA 1I3MA 4RLSA 3CHCA 1IQUA 4UE3S 5BYKA 3L2OB 4G7FA 2OD9A 2WVTA 1G20E 3GJ8A 2FWPA 2FVYA 4M80A 3WLSA 4LYAA 4C6BA 4LAUA 3A6FA 4CNUA 1GT8A 2WOOA 4HYWA 1WKDA 5KINB 2WR8A 2CT8A 3VNQA 3WG6A 1M34B 1S5PA 3HYCA 1N6IA 3W8FA 2J4DA 4Z1MA 1WB5A 3QMRA 3MJFA 4AIIA 5A7HA 4B7XA 3C8MA 1OZMA 3O06A 1NX6A 5KJFA 5BYBA 2CBXA 3PVZA 1WOMA 1K08A 1PT6A 1X1OA 1NLMA 4HCJA 2CDBA 2VQDA 1KIFA 3KQWA 4JI6B 2QV4A 4WKOA 1D1SA 1RHKA 2ZTKA 3E15A 3BW3A 4HEJA 3CPRA 1H2ZA 4TLBA 4XWGA 4IAOA 1AUVA 2H18A 1VFTA 2HGSA 3RUHA 2X2FA 4N3BA 1MDLA 1RIFA 4JTTA 2OGJA 1UAYA 3SY5A 3SB0A 1ZUNA 1V0KA 3QKZA 1M74A 4BFYA 4EM6A 1B8VA 2P11A 3OZPA 5DHQA 2FDSA 2WG0A 3D8NA 3Q7TA 2G1JA 2RHGA 5JSQA 2IYEA 5M29A 3SE0A 3WLAA 5EQJB 3F4KA 5M7EA 4HO1X 1RWQA 1P0KA 2VFHA 4K7JA 1R3UA 5FF0A 3AFIA 2RH8A 4BTEA 1A7JA 4GO9A 5C0OE 1H1LA 1XA4A 4WN3A 1JNEA 4ZFCA 1PJAA 2WU4A 5EKSA 1RWOA 1EP1A 4GI6A 3H5IA 5D3QA 4BYMA 3VOSA 4F04A 3C3MA 5CNKA 4WR3A 1EUDA 1OT5A 2DIJA 5TPWB 3PNUA 4KOAA 3WJYA 2PCJA 3ITEA 3UENA 3R6WA 1V5IA 4JQSA 2WNSA 3D8BA 1LOSA 2VEDA 4NFHA 2RG7A 2IYWA 3BPWA 4GPBA 4PCLA 1DHTA 3E9AA 4ZHQF 1LDEA 4ZDJA 4PFHA 1DJPA 2BJHA 2B2CA 1OZFA 3B7WA 1HT1E 3FOEC 4TZ6A 4G25A 4KI7A 2GLXA 1GNQA 1XQ6A 1QIDA 421PA 2WM1A 2DU2A 1MMFB 3L6CA 2EXOA 4AQLA 1XTQA 1Y7PA 4ENVA 2QUIA 1TQJA 1YDVA 3OLCX 1WR8A 2XINA 1UKZA 2BLLA 4PZEA 3CB4A 1OYYA 3KJXA 2I80A 2ZYTX 3VOBA 1L9XA 3GVXA 1N92A 1YFZA 4KCUA 3L5OA 4TL7A 1FLVA 4TL9A 3WB0A 1ZUWA 5D84A 3OP1A 1PT7A 3F6CA 1T41A 1JGMA 5CYOA 1K0FA 2B8EA 4JCOA 3QZAA 1JAXA 4DQUA 2XF8A 4X3OA 3DEYX 1C29B 1E71M 1UQTA 2ZC8A 4UOEA 1GADO 4KL8S 2WVUA 3RFTA 3ONNA 4O3MA 2MSNA 1LNQA 2Z0MA 2ZJYA 4Z4HA 4JQ4A 3CV7A 1Y4AE 4DUPA 3LHUA 3SJAA 1T6BY 3EWYA 1U1CA 2R5WA 2VXCA 1W9BM 3V75A 1QYIA 3SYTA 5GADl 4PO3X 2D0DA 1JDVA 1PS9A 2FZDA 2PZFA 5IULC 2B4AA 2E5WA 4NFLA 4ROPA 4QXPA 5CEEA 3ZHSA 2FX2A 1PRYA 3EIOA 3S81A 4C4TA 3HYRA 3LYHA 4OJNA 3U9TA 1RA5A 1H2AS 4DMGA 4NICA 4O1FA 6REQA 1GSHA 4ALMA 3IQDB 3GJXC 1C8YA 4ZJZA 2C0CA 4IUBS 2XWQA 3ZDYB 2QM8A 3QLVA 4EJ2A 4NYIQ 3P27A 2P9CA 1XCFA 4DRXA 2GF0A 2ZB8A 3ACCA 3IBTA 4QHSA 2PA6A 2OELA 5TB5A 4HH3C 3T5AA 1BDBA 1HYBA 1ME8A 3A4WA 2XF2A 4DUXA 3IIVA 4P36A 2DZAA 1FEZA 4XB6B 5EGSA 1T8YA 4HFJA 5B64A 4PH6A 3UMJA 3NRCA 2XFWA 1T2AA 3NBAA 5AVSA 1G01A 1JEAA 3JQPA 1QUMA 4P0TA 4JEMA 3Q7SA 1XQWA 3HBLA 4BGUA 3CCCA 2IQDA 4ZB0A 4ZV9A 4CD5A 4L8WB 2IXDA 2ZE0A 3WQFA 1AQFA 1XMPA 2ERCA 3PZUA 2BY3A 3INYA 3G8YA 1E1NA 3QPEA 5KZ6A 1JEYB 2Z7KA 4WH0A 1W1UA 4G3XA 3THYA 4Q8TA 1YVEI 3FM9A 2FNAA 2QL7A 3SI7A 4CF5A 4NECA 1STOA 2FFIA 1PDOA 5CU7A 2X2YA 4QXQA 4UMCA 3T52A 1C8QA 1K70A 5SICE 3EWZA 3I3BA 2J7GA 2NAFA 4S1FA 2XPKA 1MA3A 1NNUA 3WN6A 3QEZA 4M6PA 5JROA 1NFGA 3MVIA 1O7JA 4CKCA 1P3JA 5ALNA 4N9QA 2HI0A 1TNDA 3TSOA 4DT1B 2GHTA 4AMVA 2C91A 1GPKA 5CM9C 3NCOA 2DSVA 4O10A 1DKUA 1RKUA 3MLEA 2ZSUA 2JBAB 2WANA 2PUTA 2ZUWA 3VX3A 3AI3A 1BVRA 2WSSA 2JAOA 5HKAA 3PB0A 1CQIA 4PX3A 4FF7A 3WKBA 4PE8A 4YALA 1Z3IX 3TRFA 4XM1A 3AF5A 5C8YA 5HOEA 3WQDA 5F2GA 3B0UX 1U28C 1L4HA 5MN6A 4AG0A 2QCDA 3U4FA 1JHAA 5LYJF 3PU6A 5FR2A 4ZQEA 5FPKA 2RAPA 1EINA 1OV4A 4JBWA 2ONEA 1UQYA 1Y7TA 1Y1SA 4NL4H 3BMQA 1HY3A 3OLVA 2XUCA 3EQZA 4WKNA 4UVEA 1YFLA 2J30A 4HYTA 4IOLA 2WJVA 2FTYA 3GY1A 5EWJA 5I3ZA 4EUSA 4BNWA 3H18A 3B1JA 5DGDA 4AO7A 1DQPA 3TYAA 1AKVA 4ZIRA 1DPGA 1Y4UA 3K4AA 4MVCA 5LGXA 1KJJA 3W2JA 1MUWA 3IKJA 4QSHA 1GJPA 3S83A 1M2OA 3L0DA 3ITXA 5K4XA 5EMNA 4Y6GA 2NVWA 3ZDQA 2VC9A 3DOEA 4PBTA 1WVGA 1L8PA 1M76A 2AE2A 3OWXA 1JQ5A 1VPQA 5A4DA 3HDHA 4P3PA 3JTMA 3UJ7A 4V15A 1YGYA 2IS1A 4WAUA 4EB6B 1PE1A 5IDZA 3WTBA 1MW9X 2Z27A 4L27A 1LX6A 2ZI7A 2OM2A 1I0DA 1SPXA 4KRZA 3GRPA 2OZTA 3RTEA 2ZYDA 3I28A 4KIGA 1HL8A 1DJGA 5L4LA 1TJ0A 5HR7A 1H2EA 4NJJA 3H65A 1TZKA 1YXCA 2FB9A 2FXIA 5IANA 3LYEA 1C4KA 1ZL1A 3NHJA 4BXOA 2N0SA 3ZWQA 3OVRA 4PO8A 4DWWA 4Z0SA 1QB7A 3VXGA 4D5GA 1Q8AA 2AMVA 2CB0A 3PE6A 3DLHA 2PGFA 5KVQA 4NCBA 1KEZA 4UTWC 1WBJB 5AW9A 3FCEA 3W2IA 1W54A 3MIIA 3AICA 1TT5B 3LUFA 3HZZA 3A6HA 1IOZA 3GJ7A 4XWOA 1UWQA 1P5FA 4OJKA 5EUQB 4GBDA 3C5EA 1XG5A 5GVRA 3FJOA 4K6CA 3JAKA 1CVIA 1HSZA 2FZKA 4HB2A 4IHKA 4L9WA 3B1VA 4JQCA 5EHXA 2QZPA 4DLWA 1VP9A 1L6IA 2ZYRA 3P84A 2PD3A 3CCBA 4GU5A 5E4YA 2I29A 5T9CE 4YNGA 3THXB 3NBFA 1BJKA 4PMDA 2GQ3A 1YZQA 4QGCA 5DF1A 3LI0A 2XXJA 5C9ZA 3OCJA 3PC2A 4WHBA 4TQ9A 3UT5B 1XQLA 1A97A 3KSZO 2RDXA 5EE1A 2PTGA 1JHXA 5C31A 5D4YA 3H2GA 3EARA 5GPBA 2G0WA 5AVTA 3RNOA 5L3RA 4C08A 2CJWA 4O1BA 2XI4A 1RBZA 3UJHA 4YH1A 4MA0A 4GZEA 2CZCA 3DKRA 1Y9AA 3UBMA 1CULC 4B3HA 4UHDA 5JU6A 1P0MA 1HFEL 3HRHA 4A0HA 3K5IA 2LV8A 5CA1A 3CLMA 3ETJA 1TPUA 1BYAA 1WPGA 4AIRA 2AOVA 4ARIA 4LJ6A 4LB3A 4REQB 2QD5A 1WO8A 4JNYA 1NDVA 1IVNA 1L5GB 3O83A 4MKZA 1IXZA 3ZWWA 2JK2A 1FP6A 4KLRA 2PAJA 1KU6A 3UPWA 3MJTA 1U0JA 3UXDA 3PFIA 4YJFA 3OTGA 4R3NA 1DXEA 3W2MA 1NDQA 2WV9A 5HRAA 1FK8A 3O26A 4N65A 5TQ2A 3MOIA 1UPBA 2BHTA 4U39A 4LY9A 2OP1A 3KKPA 4MINA 4IQFA 2FR0A 2Z83A 4O4LA 4J4KA 3AEKB 3R0KA 1N7GA 1GNVA 1ZCAA 5CDTA 3W8NA 5U9CA 3W5UA 4D3DA 2CESA 1Z35A 1M2VA 4O4JF 2WG2A 4QREA 1YF3A 3QUQA 1ZM9A 4UTPA 3VU8A 4GCAA 4X94A 1W3HA 3DMNA 4GGOA 4AJNA 1YH3A 3W4RA 2WWTA 4UOQA 2EJBA 1QOPA 2FW8A 3NHMA 2G5PA 1C30B 4ZMBA 1XYFA 3CHDA 3RABA 4AS3A 1XVAA 2Z2KA 4FS8A 1RACA 1JZ2A 4FZ3A 4YP1A 5BXSA 4MRSA 4MVXA 2LDXA 3AFBA 1SK9A 3IB6A 4ZEXA 2LUOA 4HGPA 2WWVD 3F98A 4ER0A 5DIZA 4F6RB 3Q10A 3DTVA 4O4VA 1JA1A 2QUTA 1FDSA 2BR5A 2MJLA 4MKFA 4DC9A 2UZ3A 4QX4A 5B7ZA 2B35A 5A71A 1DADA 4GP6A 1L4UA 2HRZA 3S5UA 3BXOA 1YZFA 1MW2A 3DHYA 3W2NA 4UBOA 2B4QA 4WADA 4C4ZA 2W11A 1VGQA 1V3MA 4CE6A 2GTIA 4HDSA 4D6PA 4Y9DA 4AIEA 4GRDA 1VHWA 1X15A 4YVPA 2DF8A 2M1XA 2OE2A 1ZB5A 4QDUA 4Q1DA 4QAJA 2BLEA 1UMBB 2A0UA 4PG7A 4CIBA 3RC8A 4G5QA 4IH9A 5K3FB 5BXYA 3DI0A 5HULA 4GUDA 5BSGA 5KITA 4CCWA 4ARUA 4Y2TA 1WV0A 3I04A 5FCDA 2HJWA 2Q5HA 4I8DA 5DWQA 2QT0A 4PS1A 2GSHA 2G0NA 3Q9UA 3SFVA 3G0BA 3NCTA 1S2MA 1QOXA 3QHMA 4Z49A 1TR9A 2C2KA 1JCLA 1XFDA 3TTQA 3RTCA 2XB9A 2DBQA 3QXGA 1AU9A 4NBWA 3CZAA 5ER6A 1HZYA 2WAYA 1N5JA 4BO7A 3AJ9A 4FKZA 1WKEA 1E2DA 3II1A 4DUYB 3VD3A 3BZJA 2FKPA 2W9XA 1F73A 4OQ4A 2A1IA 4FU0A 2QN1A 1ODIA 3EOAI 1CB7A 1LC3A 2I76A 3OBIA 4XUDA 3EOBI 3OUTA 4LSBA 4OL9A 4FFRA 3OG2A 1C7RA 1VSVA 2E5LB 1HSOA 4W8LA 5DI9A 1M2JA 1VBKA 3WYFA 5E7JA 3J7HA 4J4HA 4RR4A 3A21A 5KMGA 4RNIA 4MGYR 4YQYA 2GNAA 2FJUA 2RG1A 4MWOA 5KHLB 4DZIA 1GJUA 4XSLA 3A47A 2OCBA 1DCTA 2PDLA 3DEAA 4JN6A 2G4LA 1JCXA 4Y0VA 4NYUA 3VUPA 4LE0A 2FR1A 2Y27A 1EWTA 3QXJA 4A8HA 1UJNA 1DIBA 4WCJA 2DMRA 1EHCA 4JL6A 4L9RA 3WRYC 3BHMA 2VP5A 1JHZA 1XIMA 4X24A 4D1YA 1XK6A 4L8YA 4K87A 1V8BA 3NURA 1PEAA 1K6EA 4G1CA 3CRRA 2ZR7A 3PLNA 5H4HA 4QUAA 1TX2A 3T0GA 3OEXA 4ZDKA 4PLTA 1H62A 3RJMA 2IYFA 4WZ6A 3CN9A 3ZHTA 3RUAA 5LWQA 1FX0B 3G2NA 4XCVA 1FQWA 1Q6GA 4Z4GA 2PX2A 1IULA 3DF7A 1DE0A 4QG3A 4NEGA 3CRQA 4HPXA 3MUAA 2FZ5A 1KBOA 2FSPA 2VTVA 4RF5A 5AKIA 2OO5C 3FVMA 3ZO9A 3PY2A 1JIUA 2Q3BA 4MLCA 5HNNA 3E9YA 1O6FA 3PKIA 5IJXA 2QXTA 3QTGA 4E31A 3JQ7B 2ZZ4A 3AQIA 2QW5A 4M54A 5IP5A 4RPKA 2HWKA 3GC6A 4UVDA 1MFPA 5AHRA 3TOPA 3TBFA 5AHKA 4IMIB 2B8JA 3D54D 3M6XA 1QR7A 1FP7A 2XVZA 4YI3A 3QWFA 2PDHA 4PO1A 1FNMA 2Y62A 3BH4A 1UM9B 3NNNA 4DLMA 1G5RA 2DPYA 3Q12A 3RSGA 2DTEA 1NU8A 1HP5A 4QELA 4UUOA 3WB2A 4KPUA 4CZ2A 5IAOA 5CPOA 3HSKA 4EFNA 3JZAA 3LU1A 3BX1A 1CUVA 1R3WA 4POCA 4D0NA 1UKTA 3H8SA 2PODA 1XF9A 2BTQB 3CZJA 1ZGZA 4QJ3B 3WK4A 2XNJA 1YTDA 1D9XA 3QSTA 1I24A 3LKBA 1Q7ZA 1AQYA 3QLEA 3HCOA 5JTUA 5AUNB 1OXBB 3HDGA 3CSSA 4MW5A 4ZO8A 2DBRA 1QPGA 1O6IA 3EDQA 1C0KA 1PWHA 2IXEA 1KGWA 4LUJA 5BV0A 4MWEA 1KXVA 2PN1A 2Q4BA 4ZR8A 2G50A 4RC9A 5BQOA 1OTXA 1M10A 4DDMA 4NP6A 4F3KA 4JTGA 1VR6A 3DP9A 3NAMA 5CCEA 2IODA 3OHIA 3WQPA 4A05A 1JAEA 4W1SA 3H2ZA 4BV2A 1GFIA 1K68A 1AG9A 3DMRA 4ZPXA 2VJOA 3URQA 3ESXA 1MRZA 4WA7A 3BAFA 2PPLA 1ZSNA 4BFWA 1G55A 3MSRA 1QQ5A 4HNGA 3AKYA 5EYPB 3U57A 1DO0A 5G4KB 3U7JA 2IS2A 4PSRA 1JIIA 1MUCA 2P62A 1TYGA 3PFRA 5A6LA 3LBMA 1B2LA 4MAMA 1R3RA 9ATCA 4DG5A 1E3EA 1I4LD 3QH2A 3ES8A 1JQKA 4LWQA 1G21E 4QBIA 4ACZB 3LGXA 4B6GA 1AK1A 2W4MA 3MT0A 4MNLA 3OJ0A 5IBPA 2AK3A 3SCVA 1XLWA 4B09A 3BORA 4BX2A 1A1VA 5A1AA 1QE3A 1UANA 2DSKA 3BF8A 5E6YA 1PDWA 1I3OA 1IHIA 2PSNA 1N5MA 2IKSA 3OEHD 5C2XA 1SXJC 5C7YA 1SD5A 2BGJA 1UAGA 4UNSA 4H08A 1OU4A 3W5IA 5HA5A 2HEIA 1X80B 4INPA 4TRJA 3KLKA 2P9QA 3WMRA 1XPRA 5AC8A 3KLOA 5LIKX 1U0FA 5KUTA 2UUBB 2E7FA 4OGZA 2XVGA 3KHUA 1MPTA 1PGOA 4PLYA 2XRFA 4D8XA 5F33A 4AZ3A 4XIJA 4C43A 4W8AA 4OU5A 1BCSA 1LK7A 4DDHA 4BEJA 2VZTA 1QFYA 4JLBA 1TJ3A 4Q4SA 3SIZA 3W6UA 5HFNA 3ME5A 1OGBA 1P0DA 4TXJA 5BWFA 1N6HA 3ETLA 5JEDA 3AR4A 3IUEA 4ROTA 3KKKA 1OE0A 4TX6A 5CDGA 3O90A 4UULA 4NE9A 2NZVG 2QR6A 4L3WA 1ID1A 1F5SA 4R1OA 3H21A 5EFFA 2CVHA 1P77A 4DVJA 2V97A 3IQXA 4G5RA 1WMAA 2NLIA 2X4DA 4G36A 5I7SA 1Q65A 3G5UA 3MI2A 4EJFA 3C6MA 4LVNA 3V9AA 5G2HA 4NX5A 3MYRA 3UQNA 2W6RA 5D6NA 4Q7QA 4KDEA 3H5OA 4PY2A 5LA2A 3WHIA 2OCAA 3RC9A 5EVCA 4Z7OB 4Q22A 4I36A 5EIOA 4JOBA 2Q8NA 1NIPA 1LTHR 3T5MA 2OVBA 2VZUA 1QO0A 3ISJA 3W6MA 4H4DA 2CETA 2M6LA 1MO5A 4RTSA 1D2CA 3ZU4A 1NQAO 3CBGA 3GLIA 1GVOA 5LD2C 3ORFA 1ZMBA 4E15A 3OIWA 3REQA 1KL7A 1V47A 3CM4A 3A7EA 3W85A 1ISSA 1EWEA 3GKAA 1XLLA 4GUAA 4I7WA 1O94D 4M9ZA 1PL6A 1GFWA 4RABA 5I8PA 1GPLA 5EJAA 2YCBA 5AM5A 1Y5WA 3C5QA 3TK1A 5A2CA 1NZJA 5LIWX 4B6PA 5JJKA 3QMSA 1AUQA 3DAPA 3CWQA 3JWPA 2PLMA 1C7SA 1UH4A 2IMRA 2GM9A 1MAAA 1C8VB 3N73A 5CLTA 4I5DA 4GFSA 1GUFA 1VA4A 4O6VA 1TPEA 2J07A 2CIPA 2GHIA 4RF3A 4CKEA 1I3KA 1RT9A 4GC5A 4LYPA 4C7GA 4G4JA 1YADA 2O5VA 4WOKA 5H7XA 3ZZ1A 1FVFA 1PWYE 1AZLA 4W84A 2BVNA 4A03A 4NY2A 3U2ZA 3N0TA 1HYGA 2QORA 2ECKA 5EJ4A 2ZCGA 4TT3D 2Q50A 5JSKA 4AO6A 4Y7DA 3UETA 1RJGA 3WQ8A 2D0OB 1TMLA 3RIEA 3RS7A 2FWAA 3ZWAA 1MUMA 2YL5A 1IL0A 5DN6A 3VM7A 1WZLA 3OBKA 4QNMA 2DKNA 3AJ8A 3N2IA 4EPTA 1NU5A 3VAAA 4ALKA 5F3WB 1HKUA 2DX7A 2QY6A 3AVPA 1KRMA 4N7QA 1JR2A 1XV5A 3VZQA 4HEA1 4HQKA 4V03A 2PJRA 1JF6A 4MCAA 3ZW9A 4CNTA 3TIIA 3DFZA 4CR8A 3EAUA 1XYVA 1Y5XA 1Q3TA 2FPGA 4GQ0A 2WMFA 4OL0A 1PEKE 1ZINA 2X9LA 2MSKA 3D59A 2VQ6A 1OYVA 1TPZA 3ENVA 2HK9A 1LWNA 3KOYA 4BQ5A 3RAFC 4PG4A 1F2TA 4QU5A 2XGGA 4AMUA 4O63O 3ICCA 4KXMA 4FWTA 3E2SA 4QGSA 6ENLA 221PA 5NULA 3PVCA 3BH7A 4UDOA 4IVQA 1SZGA 2QHAA 4II7A 1ZP6A 3OJXA 3FSEA 1JL3A 5ADHA 1YBQA 3CLKA 1W5EA 3OETA 1PCKA 1AUPA 4NJOA 5AW7A 3V2IA 1RXVA 4U9HS 2ZWIA 4F91B 2L18A 2NXWA 1DWPA 3IJ5A 1XZ8A 1E1QA 3R0JA 4D41A 2I3GA 3PDHA 1OUMA 1BGGA 3OHPA 5CA0B 3QGKC 2CLMA 1B90A 2NZYA 1BXCA 5GJNA 4B92A 4FW9A 2KX9A 2UXCB 1XZHA 5TQLA 1DIOA 3K4QA 5KQLA 2ORED 5AHNA 5IBQA 3RF7A 4X44A 1AX9A 5HWSA 3GLGB 1DHPA 2VWTA 1I80A 4ZXLA 5I3KA 1N2BA 5F1UA 5CM8B 3C6BA 2VKZG 2C5FA 4WX2B 2X5JO 3KQKA 4AZWA 3RVMA 2PWVA 2D1ZA 1CU1A 5H9WA 1E99A 1ADFA 2J77A 4EOGA 2XA1A 4V2IA 4MITA 4AUNA 4DRYA 4PTDA 3UERA 3I4CA 2PDGA 3V1MA 5MKGB 1Z83A 3MI6A 3PVFA 1YDMA 3N86A 3KXPA 1UDBA 3A2LA 3F7NA 1P4GA 2Z2XA 4XZMX 3IAEA 1AKNA 4FN4A 2UZAA 1LORA 3V7UA 4IWWA 1Z38A 1TXGA 1N77A 2C59A 1OFTA 3FYSA 2ZRCA 3AB7A 2PMEA 3DLTA 3ARRA 2A1UB 2F61A 4RDXA 4BNIA 1G4SA 3WH9A 1DQUA 1PZ3A 1JLLB 1DHRA 2PZLA 2GTHA 1JRLA 5ECUA 2JASA 1KQZA 3WQ4A 4LVFA 4U00A 5D6OA 4IXXA 4LMPA 3GDRA 3OCXA 3H9CA 4NMMA 3RM3A 1N4DA 5I51A 3J7AC 1EPXA 2ISSA 2V6JA 3S6TA 4HRAA 3GMTA 3LBOA 3P52A 4H4CA 4FYKA 5BN4A 1T8XA 2BFMA 4DV7B 3LG2A 3S47A 3H5VA 5D01A 1S2AA 2JFOA 4OCZA 2EP8A 2WB2A 1TJ5A 2XSZA 4AZ0A 4JLOA 4NVTA 2P4UA 3BDKA 3WAKA 1YK1A 5B57C 4AJLA 5I47A 3LX8A 2OFOA 4JKLA 4C30A 1FVHA 4I9GA 1L5HB 4CCZA 1WA3A 2BG5A 1GAQA 2ZWMA 3AGQA 4Y6SA 2FPKA 1E9FA 4LX0A 4ZT4A 2JLYA 4ARZA 2IIBA 2G5WA 2VP6A 4PSDA 2F9RA 1OC2A 3X2FA 3MWLA 4EKIA 3UNXA 4ZVKA 1ISJA 1V43A 3APYA 4I55A 3MF4A 4FSXA 1R0LA 3RNDA 4RD0A 1H2XA 1OBOA 2A3RA 3D5HA 3WO8A 1AN0A 2YZRA 1OB2A 3CC8A 4YY3B 1YS1X 3EODA 2Q6VA 4ZC8A 1BHGA 2BJWA 4HVXA 3LQLA 1B5TA 2N9UA 5ELXA 1VE7A 2YN2A 2IIVA 4EEZA 4AP6A 3B3GA 3IPAA 3GVHA 4BX0A 2WOJA 3PGKA 2XCQA 3DN5A 2HQSA 2IHNA 3EDCA 3TLJA 3TD9A 5BNKA 4V0KA 4C7JA 2FEXA 1WW8A 3RAEC 1CUIA 1HL7A 4JL2A 5KYVA 4ZFMA 2NYRA 1QNQA 4UTTC 5FDFA 4LZPA 3EB9A 3PXEA 3GELA 4XFJA 4C6RA 4NZPA 5DXAA 2B98A 1FHLA 4KPFC 1UPUA 1TWDA 5KTMA 3IJLA 4Q1VA 4XA8A 3E0FA 2FH8A 4Q3MA 4XRRA 3EXG1 2ZYHA 4NNBA 3SX2A 2A6LA 3EG9B 5DKFA 1JXQA 3HJAA 2BDEA 3UOGA 1X94A 1P2UA 1RCXB 3G8RA 3BL3A 1QE5A 2C5BA 1D2RA 1KE1A 3PNBA 1ZL0A 2YLAA 4QU0A 4NYIR 1IZKA 4M1OA 3JCZA 2V5DA 2X7JA 5HBFA 2OLSA 3QEKA 3R10A 1VMAA 1XHLA 4A2QA 2WJFA 4FYPA 3G3EA 3W7BA 1NMSA 5AT1A 3AUOA 3IGXA 3U7FB 4RPHA 5FLXA 2RJOA 5DDIP 2J1LA 3W7QA 3A6JA 3I34X 4FDUA 4TV5A 2Q62A 4QTXA 1OFEA 2FLIA 5KETA 3LZ6A 3W9UA 3C3AA 4DWVA 3EA1A 3O31A 4L28A 2L42A 2DWQA 5GVJA 2Z98A 4X1YA 1A98A 1UG6A 3I3DA 3IDQA 2OJPA 5H70A 1RAIA 4CM4B 1T2VA 2DHQA 1CZRA 2RI0A 2P75A 4NONA 3LHZA 1ZUHA 2X8AA 3RDPA 1PX4A 1TZZA 5CB4F 1O95C 1ZJIA 2Z2JA 3N4AA 1XXHA 4X1IB 2D0IA 4RM2A 3LHKA 2AN4A 1Y6FA 1PZ2A 3QBVA 4ZXFA 5B3AA 1CUGA 3TH5A 3PBMA 4KBGA 1AFSA 2HXSA 2ET6A 3NPVA 5BW6B 1EKXA 3A4TA 1NVGA 3ZW8A 3BIJA 1Z4QA 1EXVA 3WGIA 3JYNA 5EKUA 3A22A 3NPUA 1BTMA 3H99A 5JBEA 3FSJX 5IN5A 1QP4A 5B7PA 5T57A 2TPSA 3QOXA 3C3EA 3ICPA 5LDDC 1WZUA 2OX1A 3BGAA 3BIXA 5HJYA 4EG6A 4BUZA 1LF1A 1VSUA 1LH0A 3IDSA 3AVQA 1PFYA 2PUCA 5C7OO 1R66A 2JKAA 3MWDA 4LZNA 2V0CA 1T8TA 4U5IA 2DHDA 2IGTA 4Z2KA 1WUKS 1B3WA 2V68A 2B6NA 2VI5A 1EFLA 2H85A 2VFDA 2ZYGA 1C0PA 1RMYA 3OPMA 4IIEA 2QN6A 4I4CA 4UJ5A 1EFVB 1KFBB 3RT1A 4KS0A 4HGNA 4ORIA 1SMDA 2ZIXA 3W2EA 1JUDA 3KD2A 4L6DA 2R5NA 3HY6A 2QUJA 5AHWA 1EQUA 2QRMA 3NPWA 1KEKA 1K9FA 3HXTA 1DJLA 1U0RA 2Y1KA 3CSDA 4DZHA 4D3FA 3NXFA 5B36A 3T7CA 4PTXA 5E4FA 2R60A 1RK5A 5ARCA 3UEQA 4IG4A 5GWXA 2BGMA 4NOKA 4ODIA 2R9VA 3L79A 3BMCA 1U2EA 2VURA 4UR7A 4KAJA 2XWEA 2JF7A 1ORIA 3FX4A 4HL6A 3COZA 4UC5A 1FKWA 2RONA 5A2BA 1C50A 3QOYA 4I4LA 4DS3A 3HR7A 3RHSA 5LA0A 1ZS9A 4B7UA 1GKYA 4IYRA 3MN1A 3U4QA 4QLOA 3HLKA 4X84A 3OG9A 2I54A 1UBSB 3CM0A 3Q8KA 3VBEA 2X7HA 1ICPA 1QC5A 3G6WA 3B5EA 1H2JA 3P2KA 1J0JA 2A67A 4MV3A 3HV2A 4EKGA 2VMFA 3CUXA 4JV5B 3TZCA 1ENZA 3UOWA 1X7GA 2PS2A 1NP3A 1JUBA 5CLJA 1KA9H 2VCYA 1DTEA 5CCDA 2BDQA 1XGEA 2FOXA 2Q7OE 2X1IA 2DZXA 3U61B 4E21A 1IVYA 5DBEX 4XDHA 3IE2A 3UUGA 3L07A 2ZCJA 2OZPA 1DJXA 1KKLA 1SY7A 1NOFA 3BLIA 3TDKA 3TJLA 4KH0A 3QE4A 3IIJA 4XZBA 3UXAA 1JJIA 2R6GA 4ARAA 1XKQA 1L8XA 3ZV5A 3PQ3A 1IY2A 1BXBA 2ZSJA 4BU1A 2QRVB 3VOTA 1QYVA 3TR5A 4E32A 2HBXA 4Z4IA 2GL5A 2QVXX 3NL6A 4PW0A 4IQ0A 3UMRA 5D2WA 3G5MA 2BY2A 3U8GA 3BEOA 1MQRA 3NTQA 1XDSA 3N6JA 3AGPA 1F5ZA 4C05A 1VGAA 4HD5A 5BRNA 3SVZA 3U3ZA 2R1TA 1AS3A 4M3NA 1JQVA 2H5IA 5ES3A 4ZWNA 3HB4X 5FBHA 2YV3A 3F1LA 3S2IA 5H8WA 4EZBA 1FXUA 5CMLA 3LUDA 1QGZA 2B7LA 3OLIA 4C6IA 3NC1C 4BNJA 4AN4A 3SBOA 2YMLA 2FJPA 1WQ4A 4L0CA 1GXSB 1B4EA 4AEEA 4J2MA 2PP0A 3N7AA 2H3BA 1PZ1A 2CVZA 1JZQA 4ZT7A 3O8QB 2FKAA 4J2HA 2X1HA 5EIFA 1SXJE 4Z2LA 3B3AA 3GBEA 2AFIE 4HQFA 3AR3A 3W7KA 4CMCA 4G56A 3LY0A 2P6OA 4C3ZA 1XBVA 3WFLA 4B71A 1L4YA 2IS4A 3L9WA 3LX9A 4JT9A 4WGXA 2YX1A 1QTRA 3SEPA 4FXOA 1L1RA 3CLTC 1G7RA 4O50A 3D7KA 3GVGA 4JFUA 3N17A 4P5UA 4XGKA 2BI4A 3P26A 4CDRA 3RJZA 5KDDA 1JI1A 3TONA 2GJSA 2BZNA 1D7FA 3EXHB 4YWJA 1YQEA 4E0BA 1AT1A 1QOQB 4BEVA 1P29A 5TVGA 3BKXA 5D8WA 2YNMA 3UR8A 4WQMA 4HSNA 2DIKA 4M1QA 3AYXB 4X20A 4EKEA 3VOCA 1UKAA 3DTTA 1JSCA 1YASA 4JTEA 1UH3A 5CGQB 4QOHA 3CZPA 4Z53A 5CX4A 3G0CA 3G1XA 1G7VA 1IXPA 3HBAA 4BFUA 1E4NA 2H4HA 2JH8A 3EC2A 4MRMA 5CG2A 2EERA 3PSWA 5K0TA 1K7EB 2C5EA 2D74A 3OZIA 4I6VA 4DWSD 3NDPA 2XUFA 1CS0A 4DYHA 2PMKA 3T0BA 1F6DA 1EXNA 3IDOA 1XTUA 2Z8YM 4KCWA 2AXEA 2XAAA 5MFZA 2H2IA 5DK6A 1LLZA 4YRPA 2XRZA 3ABIA 3PC7A 1VFHA 1LFDB 2CXOA 4HNHA 4K9KA 3CMJA 1EWRA 2FQWA 4DUOA 1BSLA 3HVRA 1A71A 3RVLA 3WFAA 2AX4A 3KUDA 2IEZA 1O6GA 1PR1A 5AJUA 3OCWA 2J41A 2BEWA 4YCOA 3TLBA 3DJFA 3EK2A 3RYHA 1FDVA 1HJXA 4LYKA 4NAFA 4XUYA 3MWEB 1DU4A 2HUPA 1IXKA 4M6WB 1R3YA 4XTIA 3PUZA 3VR0A 4UQ9A 1M7OA 3FA4A 3GXOA 4FCTA 3K53A 1S46A 1GUDA 4G5FA 4AEOA 2ZSFA 1FB5A 2EZ8A 3EZXA 4CU2A 2NV2B 3W5CA 3LCCA 4G8TA 2Z30A 1MIOB 2H7XA 1I7QB 4YEDA 1UKYA 1TUXA 3FZQA 2Z43A 3PFFA 3ETEA 3QFFA 1LXCA 4JTHA 3OOYA 2IOFK 4M0EA 2F62A 4IMFA 5ALGA 2ZT6A 3VNRA 4M1WA 2CLEA 1O03A 2YS7A 1DJOA 2BFBB 4XM2A 1G38A 1GU7A 2ISQA 1PYOA 1XDUA 1UEJA 3R7SA 4RHYA 1F6KA 1XJ0A 3HABA 3EX7C 1W3NA 4OVXA 4N3NA 2E28A 2P9GA 2DT0A 4Y9UA 4JBIA 6AT1A 1Q12A 1Q22A 4F2DA 4GM0A 3GRVA 3PVSA 5LQJA 1VCMA 3SDZA 4PNZA 2QRQA 2RKWA 3VR5D 5C51B 1YS4A 4Q9KA 1VBJA 1MAVA 1P7VA 3RX3A 4S3EA 3P94A 3DV0A 2GCEA 3LD9A 3EWCA 2P9FA 1SB9A 1A50A 5H6HA 4YTTA 3V5CA 2GAAA 4R1TA 1XC6A 3AU6A 4URWR 1H7PA 1JDPA 1K8XA 4HDAA 3QRWA 4CIVA 2WHMA 2EFGA 4YIHA 3N6HA 2RGYA 5J4LA 3RK1A 5D2CA 3S2YA 5SY4A 1VLIA 4S3DA 3OOWA 1U7OA 3BJZA 2V1XA 2O2EA 4P7FA 1OLSA 4Y1FA 4YXGA 4QATA 1SJ9A 4XJXA 2BS9A 121PA 1U1DA 1VQ1A 4WK2B 3MI3A 2UVDA 2XQKA 3AM1A 3G24A 1KE2A 2Q2WA 1N8FA 5A03A 3SX4A 5JQGF 1Z13A 3EVEA 3G49A 1ZJWA 4L2IB 4OV4A 1WCXA 2FQQA 5HQJA 2QD1A 3KE0A 1VL1A 1XH0A 1P4HA 2Y1FA 4URYR 3FTQA 2NWQA 2J24A 4Q01A 3RJYA 3T3PB 4H0NA 3QPAA 1NWTA 3BICA 2WJZA 4ICMA 2O2CA 1V8OA 3GH7A 2XXBA 3DMYA 3SVTA 1E1CA 1B57A 1VRCA 3KUKA 3A9RA 3WLLA 5HQLA 4BJ5A 3EVAA 3HDQA 5JADA 3WLOA 3H23A 3TJMA 1MOSA 1QJ4A 3QC3A 3ZE6A 2NPIA 1R2RA 1EHAA 3VHQA 4H6KA 3HKDB 1XHEA 3TX2A 1ITXA 1VJ0A 2HRDA 3LC1O 1GHSA 3N0WA 3WF2A 1L5VA 3TA9A 1LBQA 2YYZA 4PFJA 5EWLA 3N6XA 4I46A 5IFTA 2GSWA 4GQIA 2W4QA 1SJBA 4G8DA 1Z37A 5CAEA 4YAIA 1P9OA 4X97A 3LG3A 4QE1A 4LPSA 3CUVA 5A3SA 2GESA 5CLFA 3COVA 2HCTA 3KCNA 1U1EA 1XYBA 1YLVA 3C2YA 4JZ5A 3IALA 5EIXA 1XZDA 1O5XA 1WEKA 4QJ4B 4YTRA 1BEZA 3ZCRA 4WXYB 4I1RA 3GLFB 2Z4RA 5A06A 2FV8A 4EYOA 4PB5A 4Z4EA 1BVNP 4QBTA 1KC1A 4FD2A 4Z9AA 1S5WA 3C2FA 5F4ZA 4X9SA 4GOJA 2WP0A 2XCSB 1QPOA 2AZ4A 2V81A 3GZTB 5K8CA 1DJNA 4XJSA 3QVSA 3MJMA 1YE4A 2V7GA 4B84A 4W7UA 1A5SA 3IBCA 3LHVA 2WIKA 1A76A 2VUYA 1LRTA 5AHEA 5DT5A 2G8ZA 2BWGA 3GG0A 3SN0A 3DBHA 1E70M 5B2ZA 4PZCA 4DLKA 5C52B 1G1AA 1L1FA 2JAXA 1F4LA 1JCYA 5AHIA 4HQVA 4U3CA 5CLIA 2D0GA 4E03A 1P3Y1 2IEIA 5ALMA 4POAA 4HZUA 3C48A 6XIMA 3WWOA 1E43A 1F2UB 4MLRA 1QF9A 4MVAA 4MJ7A 4J0HA 1C1XA 3OOQA 4D8TA 1ZC3A 2QVYX 2V7BA 2YW3A 3HR4A 4Q3EA 2ZYUX 5FPSA 2ZIGA 1XP5A 3B2EA 5CCXA 3TAOA 3KBNA 5IAGA 7MHTA 2I62A 3T9FA 1FYXA 3T1NA 2EZUA 3ETCA 3L1KA 3H7AA 1EFCA 3FSRA 4OX9Y 5F5LA 3JY6A 1JT2A 3F8SA 4J27A 1UP6A 1JWAB 2XUDA 3BUSA 1IWPA 4Z0TA 2GCOB 1Y8ZA 4LPKA 1SCIA 4MRVA 3WLKX 3WIBA 2RAFA 2QTVA 1OVGA 4MEBA 4BO8A 2Q3CA 3EEZA 1ZD8A 4M7SA 3F3KA 4YGXB 2IYTA 4KE7A 4QDXA 4Y9OA 4AYGA 4UU1A 4RUKA 2QCFA 1GCGA 1GOXA 3VFCA 2N3ZA 3H11A 4R9VA 3NQ8A 3ZHQA 2D54A 4A91A 2NPFA 3PBUA 1T4DA 1N2HA 1MW3A 1R8XA 3F1KA 1R8LA 4L9SA 4RVCA 2F8LA 5BVHA 4QROA 1QK0A 4IDBA 4K8HA 2C9DA 3MTWA 1YNPA 2P91A 3UYCA 1UFKA 4EGJA 7A3HA 5LZ2A 3D3JA 3PNOA 3RUEA 5F2LA 5FSDC 1MNZA 1I9CA 3UPUA 3CZEA 3IJRA 1V9LA 2UYCA 2WSYB 4OA8A 2Z1VA 4KXYA 4OHUA 3WWEA 1J97A 2UVPB 5C32A 2VP4A 1GZ4A 2VHJA 3LPPA 2D73A 1BYDA 4O5AA 1E7MA 3ITLA 4JFWA 5A9RA 2NNLD 4NZJA 3ZDCA 1Y65A 1T0IA 3EWWA 4M82A 3QRHA 2UY5A 3QPWA 4YPJA 3WF0A 1PE0A 4UTIA 4IY1A 2VJMA 3LFHA 1ZGCA 3NUQA 3TRKA 4Z0JA 3JRKA 2YFQA 3VTRA 1LT7A 3QA3E 1ECBA 4LVUA 3DZ1A 2WPBA 3GNPA 2G0TA 3ZWDA 3RRFA 2JHGA 2CMGA 2E1PA 1N2ZA 1Y9DA 5LUAA 1H0IA 4YA6A 8ADHA 1AL7A 4A2RA 3T3MB 4LVBA 5DN9A 2CCJA 3MPOA 5CB6A 4F56A 2WFLA 1GPMA 3IVRA 2QKYA 4MFDA 1RVDA 4BEWA 2WVAA 2XU2A 3TW7A 2QN7A 2C1IA 3H8VA 4M99A 4Y18A 3COWA 2CFOA 1NQKA 1KC7A 3H19A 3KNZA 1EH5A 4YJ3B 1V1MB 3FNFA 1XOIA 5T8KA 3QWBA 2EARA 2GXSA 4XEUA 4WLFA 1SYTA 1P9NA 2WO5A 3FTCA 1LEHA 3ANLA 5BWMA 4JP5A 4OP3A 1DJMA 4I9JA 1RAEA 2CXPA 1AURA 2QNEA 5FUMA 4IZHA 2X9GA 2VTBB 2A0KA 2HWWA 2I1LA 1T2EA 3FGOA 1XIJA 2NYVA 1JEQA 3ZOKA 5KWEA 3OZBA 4K1WA 1RLJA 1CXZA 2QX9A 4X3CA 2IOYA 1B76A 5A9SB 2YBTA 3B70A 3IO5A 3PNSA 1K2VN 2G40A 4LW8A 3DE5X 2P2NA 4EK7A 3B36A 3VKBA 1OBCA 2GUUA 2ZUVA 2HBZA 4YIWA 2H90A 2R6R1 3ENKA 4LA4A 1NH6A 4U5XA 3OE5A 2NV9A 3SSNA 1RPAA 1SKYE 2W42A 2VC5A 2RI1A 3OZEA 2DPHA 3N58A 2GYUA 5TMPA 4JXJA 7CGTA 3UWUA 2H5EA 1E72M 2YASA 3RU8X 1EVQA 2BXZA 3QV6A 4PZZA 2Y5SA 5D2TA 2Y9MB 3OODA 1L0BA 1L5ZA 4MNKA 3R3SA 1D4FA 4FFLA 2ZRHA 5E6UB 3FNIA 3V8PA 3FE2A 1E0XA 1WS6A 3BAJA 2HC9A 2GK7A 4ZGGA 2ECOA 1JAZA 1A5BB 3QW3A 3B9OA 2F7SA 3UWMA 5FBWB 3A7DA 3GYCA 8LDHA 4BYGA 5JO9A 1Z26A 2XCLA 1IHUA 3IV6A 4G0OA 4GK8A 1Q2UA 2WJHA 2QSJA 4CLDA 4JMPA 3UKDA 2JCSA 1DHKA 5AC6A 2Q3DA 1VMKA 1BRLB 4L4PA 1SHZA 4GGPA 1NQXA 3IUDA 3S1UA 1YR1A 4P9NA 4LJKA 3T4CA 3W2UA 3ASUA 5I4IA 3CUEF 3KZNA 2HK1A 2A5DA 1F38A 3C8HA 4M1KA 1SBZA 1REQB 1APBA 7XIMA 1ZMRA 5FTNA 2ZUDA 5ULLA 3T7AA 1TPC1 1M1NB 5HNTA 4L1WA 3UFXB 4NEHB 4CNPA 2QQ5A 5HDRA 3HCWA 4IX2A 4QAIA 4DANA 3MBOA 4QPZA 3UY8A 4TXHA 2AOTB 3HUTA 5AUOB 1SCNE 3KXQA 2FE1A 1RWPA 5ADVA 1NONA 1VJ1A 2L0XA 2IUTA 3CT4A 4C0BA 2P3LA 1FRFS 1D09A 2DULA 3TSDA 2HV8A 1FJXA 2YXGA 4JOQA 3GR7A 1OIXA 2LRHA 3IT1A 5C5CA 1JU3A 2W2NA 3L8CA 2ETVA 2ZXUA 3W1EA 2CLFA 4F9JA 1LF5A 3VNSA 2PF0A 3W2TA 5KWIA 5BNFA 4YWIA 1RW4A 1VLMA 2PCLA 4ACYA 4QTTB 3UAWA 4IGAA 4PIVA 3CUIA 4OSOA 3A3HA 2OC4A 4K9QA 1I6NA 4UQPA 2E67A 4LYQA 2EG9A 4O5OA 2ZE7A 3GC4A 1QHHB 2O1WA 3QHOA 3KLPX 4X61A 4HUTA 4Y2GA 1SULA 3GW0A 2ALDA 1ZVMA 2ZRPA 3QM1A 3V7WA 3MCOA 3VVCA 4YP5A 2IJGX 4QT0A 1WD7A 2I5GA 3R0XA 1B2YA 2A7NA 3FUWA 4UDXX 1ZMOA 2OHIA 5F7XA 1MAUA 4ML4A 3CJQA 3AIEA 1RXSA 3EMBA 3HY3A 5ER9A 4JTFA 4F4UA 2FW0A 3JQDA 1QO2A 3HEBA 1TK3A 4DDKA 2HPMA 3DQPA 2G6TA 2CLHB 2DBZA 1JHUA 1GL9B 1Q7MA 4NJHA 1L8LA 2VJYA 4MYXA 5D1HA 4QDOA 5HPCA 1N5LA 4H4IA 4R1SA 4YHHB 4YRJA 2JB9A 3A1CA 3OLDA 5E7MA 5BR7A 5I5EA 2F17A 2PUGA 3QG1A 4UHFA 1YJCA 3MOSA 2VATA 2WA2A 2H59A 5FLYA 1LSSA 5BV2P 1XIDA 1OC4A 3USES 3O0FA 1DBSA 4BN5A 4XIAA 4Z08A 1A9QA 5FOQA 3NWOA 1QDLB 3U37A 3AROA 2M1ZA 3LL4A 2YZGA 2DFDA 3VNYA 4G1BA 2AD1A 2OQIA 3EVFA 1BMFD 3AEZA 2J13A 2WSIA 4XYGA 1RJQA 4PNPA 4LC0A 2CFTA 1P62B 3CW2A 4J2TA 3H7RA 1RFLA 1SR8A 4IRXA 3PQ8A 1KM4A 4DWSB 3A0UA 5G40A 2VJXA 4S0XA 2AFHB 1LLDA 1JPHA 4BDSA 5BN5A 1P7TA 3D8RA 1DE5A 3KSMA 3E3NA 5SYNA 2VOTA 3OTQA 2H7VA 2HU8A 3D6FA 2YRFA 1UWIA 4MUIA 2REBA 3SKYA 3N3AC 4CV2A 1ZD3A 4P4TA 3CEPA 3KKZA 4L07A 1YA4A 4IIFA 3EF1A 2J66A 3L23A 4FSDA 1DCKA 4AHPA 3LPFA 3G2IA 3F1QA 3HCPA 1Q6DA 2VAWA 1RJRA 3ONEA 5HP4A 4MMZB 4OQQA 1Z4KA 4KH1A 2JZCA 1U2GC 3UPTA 1QAMA 3TN4A 3K2EA 1M2NA 1ZD9A 4GS5A 1Z15A 2QUAA 2CYGA 5JYDA 1TTPB 3KPVA 5FAXA 4ZDIA 1HYHA 4PTMA 3K9HA 2X40A 5KWSA 5JVLA 2ONJA 2VDWA 1N9GA 1H4QA 2I33A 1NW7A 3C3XA 3UXIA 4IHJA 3PDIB 3CVYA 1EG7A 5LA6B 3CU2A 1BWVA 2A9KA 3GUZA 3LLSA 2IWHA 1UUOA 2GJXB 4F4IA 2B1RA 3U9LA 3VZDA 3FX2A 1D2NA 2AT1A 4HWKA 4YYZA 3KUMA 1JHMA 3IP9A 4AAJA 3HK2A 2QL5A 1TRKA 4NNCA 4ZI3A 5B4VA 3O07A 3U5YA 4DQWA 1A9XB 1DC7A 1YB2A 4PA8A 1EA9C 1SRQA 2FHCA 3HCNA 4R2HA 4BO0A 4CM5A 1OF1A 1WV1A 1V6CA 1QASA 3DEFA 2G3FA 3P2IA 3MT1A 4RE0A 2Q5QA 3PD0A 2P2LA 2XX3A 3ZBTA 2PLWA 1GWNA 1M7JA 2B5OA 4ND4A 3FXGA 5AK4A 1XNGA 5JRJA 1AD4A 3N2XA 2VX7A 4LSGA 4GDMA 3DMDA 3AR2A 3BSSA 4Y2XA 3RYFA 1A80A 4CDGA 1E5TA 1YRWA 5KQGA 4L72A 3OM1A 1OAOA 1XCBA 3IIKA 1I13A 4LCRA 3A14A 4JGGA 2WYUA 2ASHA 4XYBA 3M3PA 1NP6A 3GXPA 1ISVA 1OIWA 3ANNA 3SFWA 1F4VA 3ZS4A 3I05A 3AVTA 1WWKA 2VUHB 5FFNA 2JJ2D 2ALJA 2CFSA 4TRMA 1CGTA 4UM8B 1KK2A 1LPAB 3CL8A 2VX6A 3T94A 1P7WA 5KREA 4IICA 2FF5A 3LRTA 1HZZA 5FI0B 3FNDA 3GC5A 3TE9A 3R5SA 4ZOCA 1PTJC 2H8GA 3HPFA 2GN1A 3PWKA 1AKQA 5HMLA 3MANA 2HCVA 1IZ7A 4NNJA 2CKDA 4IFRA 3RH0A 4DJFA 3CMCO 4DV4B 3V18A 1Z8HA 1SOWA 3E1SA 3DW3X 2ZIEA 2V54A 4M83A 3HWSA 5JD4A 5FUWA 1GRVA 1T1GA 3AWDA 3ZE8A 3A1TA 5EP1A 3JQEA 1DT3A 4ND3A 1P39A 4O25A 3H05A 1DAGA 3CHYA 4FT2A 3PPYA 5MHTA 3RSFA 1QS0A 3EYWA 3DHPA 3IAFA 4JSTA 1D3HA 3VIIA 1FSPA 4ZO9A 5HE9A 3MIZA 3QPUA 3KP0A 1OFGA 2CXRA 3GLCA 3DEHA 3FGCB 4K37A 4NX2A 4X0EA 3OE7A 3CNYA 1NJ1A 3QHPA 3GCZA 2IUEA 1SZNA 3TFWA 3G0GA 2IX9A 5DTJA 1R87A 2FSVC 5H5JA 2O20A 2E4UA 4F7WA 5LIYX 1B9ZA 4ZOQI 2XHYA 4EI2A 3MFQA 3AUFA 3IDAA 5CW1A 3OIVA 5HCUA 2XGZA 2XVXA 2AEFA 4ZQBA 4RDHA 4P8UA 1W46A 3EKGA 2GPAA 4WZAA 1P5HA 1ODKA 4EARA 1OIMA 5IRCD 2VA9A 1OH5A 2YXPX 4C6JA 4CTNA 2XGBA 4UQCA 5D87A 4NMHA 3QVGB 3UJPA 3Q2IA 5J59A 3BAYA 2A7PA 1HQYE 2I6UA 4EHBA 1MU0A 3MDWA 1V6AA 1U8FO 2BZ1A 4B46A 4CXMA 5COQA 2Z8YA 4L08A 1Z8FA 4V27A 3PNLA 2BGIA 4OU4A 4URXR 1TO2E 3DO8A 2XLCA 3AUJA 4CQ8A 3ZNPA 3N28A 1XI3A 3WD0A 3QFTA 4AZ7A 4RFSB 4NSBA 3WDMA 3M6IA 4N4PA 4YJDA 1A49A 2I4RA 5K6AC 1ZXXA 2VQSA 5FF7A 2QLNA 3UJRA 1U8YA 2OG9A 4BF5A 4C4XA 3KAPA 1X8JA 4AKTA 3GEPA 2GOUA 2QAJA 3JWIA 4QE4A 5JSUA 3FDZB 3ELYA 1KLYA 4GYPA 3GLVA 1HL9A 4LOIA 4ESOA 3UD6A 4DCTA 2ZJ4A 2Q7XA 5BN3B 1M33A 3WD4A 3UJ6A 2YN0A 4X1OA 3QMPA 1HK7A 4YO7A 3TRIA 2WJDA 5B80A 1Z7AA 2QTAA 3ZLJA 1RIIA 4BMXA 2GT1A 4U2EA 3ZDEA 3TUIC 4FQ8A 4RVHA 1UMLA 1FWBC 4AZVA 1CXEA 5M17A 1KETA 3VV2A 3M4HA 2DFAA 4BQRA 5T6MA 4EGQA 1W32A 2EHJA 4A6XA 5FOSA 5FL7D 2Y8KA 4FYMA 2P3EA 1TGYA 1L0PA 1K3UB 3T2OA 2CHOA 5CGMA 1MOZA 4HN9A 2Q3OA 4IWNA 3VQTA 3ATZA 5BR4A 1H6AA 3H6OA 1O12A 3WSTA 2GZ2A 1K7XB 3NL3A 4W7VA 2VRWA 4B1FA 4LI3X 4KEUA 3JQFC 5B3JA 2CF5A 1I51A 2NP7A 4JUCA 4H60A 3SFKA 1XQ9A 1OC5A 2P9TA 4DQDA 3ISVA 2VBFA 3IQEA 2D3LA 4Y7EA 3KS9A 4AKEA 3V7FA 4BGEA 5K5EA 4ZALA 1G5FA 3H5NA 3CKLA 3VYWA 4KWHA 1QLJA 4S04A 1NARA 5JARA 3LERA 5KKNB 3PJDA 3CB2A 2RBGA 2PAFA 5EJMA 3HGQA 4G5OA 3DOFA 2HA4A 3JU2A 4DBLE 3SC4A 3BMWA 3K6KA 4LCEA 2AZDA 4N0EA 4PUMA 1EFAA 1RH9A 1XEWY 2C7QA 5DEOA 3QEJA 4OA5A 5ABPA 3VR4A 3H2HA 1VECA 1NF0A 4O4IA 3WJZA 2H06A 2FHSA 1TMHA 2M98A 1QP8A 3OT5A 3TIXB 5CZ0A 3TR9A 5HIIA 1KH1A 3A1DA 1IF2A 4QRDA 4FGUA 1E8MA 4YONB 1V2HE 1X7YB 4FMCF 1SVUA 4PGMA 3QJ5A 2G3NA 2Y9PB 1Q6FA 3B13B 3O38A 1CY4A 1GPAA 1TF2A 4I3FA 2GF2A 3A3YA 3BJSA 3AVOA 2P9HA 5JY6A 2FN9A 5ALHA 2ONYA 4PN3A 4RD2A 4GLEA 2SKDA 3AR9A 4L15A 2IOHA 1Y3HA 2F43B 2IKQA 4X1KA 2I9PA 4U3JA 5K05A 2VTFA 3GYBA 2X5NA 3OIYA 4DJED 1J2JA 9LDBA 2H4JA 1AVTA 2PRKA 3JARA 1VE3A 2CZGA 3Q6IA 2VGIA 5EHNA 4IPTA 4P0QB 4IV5A 3H2CA 3I53A 4KXQA 1HE5A 4RVDA 4PF1A 3R58A 1Z5GA 1EGQA 1J56A 1NUHA 3U3HA 1PL0A 3A27A 2AZTA 1J0BA 1JHPA 3VA7A 2FMXA 1MX9A 5TQ0B 1DBPA 1ZR2A 3QGAC 5IC6A 3M9WA 1NY5A 4YV0A 2Y77A 1JEZA 1KEWA 1PS8A 4OJQA 2A0WA 1XGKA 3WUGA 2VTDA 4FMCB 5TT1A 3WLHA 1T5SA 2ZDSA 3M9LA 4Z42C 1FS4A 1XRSA 4BQ3A 4ZYWA 4UQAA 1O54A 4H3KB 3STTA 4GUIA 2PSJA 3B3FA 5TS3A 4M76B 4QU8A 4G4SO 2OHGA 3OHSX 4PUUA 3IJ8A 3K1TA 2PWUA 2QV5A 1EQAA 4K05A 2J27A 1JWLA 4H7EA 1RQRA 4B0OA 4KI0A 2VK2A 2PUVA 3L7MA 4IXMA 3AILA 3P1JA 1RQ2A 1MJ5A 4RH3A 4W8GA 3EA4A 2YJ6A 3SNHA 1NAL1 2PP1A 2P6RA 1JHYA 3VR2D 3AHYA 4XBJA 4TMCA 4JT4A 1V02A 2BFCB 4BQQA 4JIGA 4O4HA 1TX4B 4CGZA 3NFUA 1KU0A 1KWKA 4RAOA 1YE6A 4OJYA 5JBNA 3P9RA 4QAQA 1KKMA 1OREA 2VYVA 3S1GA 3DOIA 3QVKA 4HY3A 4LXGA 4R83A 4JJ8A 1E5XA 1NHGA 2PQ6A 2ZZ5A 1XZNA 2JCVA 1UC8A 4BKNA 1V7PC 1NN3A 1Z36A 3GT7A 3NAVA 3ZKWB 5HZMA 3WLRA 4MB0A 1VYPX 1SUDA 1Y6JA 5I45A 3VC5A 1EK1A 2ATCA 4OMFG 3RVJA 5CIWA 3ISIX 3GG7A 4Q1AA 4W93A 3AMDA 3OP2A 1CY6A 4GICA 1YWGO 5LNSA 2CE7A 3RUDA 2ZZ7A 3PR2B 3KWFA 1AB6A 3QBTA 3U13A 4P35A 5K8JB 4GLOA 1BSVA 3ZWCA 2VUTA 1QRSA 3RCNA 3D2LA 2VZ8A 1WXZA 4P98A 1M0WA 2YOFA 4H6RA 4F8YA 5IZCC 2PUWA 1FOBA 4B6OA 4H7FA 1CZOA 5CA0F 3PEYA 5K3VA 1N0HA 3DKJA 4HNLA 3E1KA 3O9VA 2A6NA 4XG1A 2IFTA 4YV1A 4LMBA 3LI1A 1S5MA 1GZSA 3N76A 1RWNA 3IRUA 3TYUA 4WFIA 1V4BA 3FYTA 4AN0A 1LL7A 2J3KA 4KEAA 3QR1A 1AXRA 3DLCA 1CZHA 3I9MA 1FWGC 5FNVA 2CBIA 2JARA 3ARSA 1DIEA 2QD2A 3T78A 3RS0A 2DUNA 3JR2A 4MV9A 3OEEA 3DC0A 3AFHA 1YX1A 3UMBA 4YAEA 1L4MA 2ZTUA 3RSZA 4QU9A 4NS4A 1CUHA 3VKWA 4CM8B 1U5VA 3DZ8A 2GD6A 3GIQA 3ZNQA 3W1TA 4L5ZA 4AYXA 6NULA 1CXLA 4DRZA 3G2PA 1I60A 1CV2A 5LGZA 4D8ZA 1PUJA 5JDCA 1J1IA 4MQBA 2Y4NA 2IA5A 2HA0A 3KTAB 1BZYA 4OI2A 4ZICA 1ISYA 4D2IA 3G79A 3X0DA 4R85A 3DA8A 4EY8A 5HDQA 1ZU4A 2X0YA 2ZROA 1OZ0A 2GUWA 2XPCA 4MW2A 3ID7A 1YI0A 4X90A 3CGTA 4LJ9A 4W5ZA 2N46A 1PS0A 1T6YA 1L7RA 2JNWA 5CHEA 3TRDA 4N9EA 3AF4A 1Q57A 4O2LA 2DZDA 3CLRC 3SIMA 1KQOA 4FNTA 4OIFA 3EA3A 4NE2A 2ZUTA 3UB4A 1JKJB 3K9CA 3MM4A 3KV1A 4GI7A 3EIWA 5A0VA 1ZN8A 4J0DA 1E40A 4LFYA 4EW6A 2I4OA 3NHKA 2ZYSA 3OE1A 4AIOA 4DZRA 1ZITA 3HZOA 4MVJH 1I10A 1BHQ1 4PU0A 1CUSA 1R30A 1UBLS 1VCHA 4UFKA 2OO7A 1G4PA 1JD7A 4M8LA 2ID4A 4CDMA 2XN2A 2CZ5A 3DUFB 2WAAA 3OEWA 1C9MA 1PR5A 4R71A 1OWMA 4CLEA 2BVDA 2JHFA 3WGZA 2V7EA 3GRUA 3R3YA 4X62B 2V9ZA 4NMXB 2P53A 3G89A 3MB9A 4U2ZA 2QP3A 1NW5A 3STCA 1YR2A 4BC1A 1HFJA 1E4MM 4NZ5A 3BULA 4AW9A 4EJSA 1IXQA 1T6XA 5EE0A 1PNTA 4XZ9A 4BZYA 5CB0A 3WWDA 1YU9A 3EXIB 3N2NA 3LP6A 2X3YA 1QG2A 1PIIA 4JX6A 4ATDA 3G1WA 1P6UA 3CO4A 2P2CA 3GQVA 4IJVA 1RBLA 1PHWA 3K8YA 2LZ0A 4QSMA 2RB4A 1T36A 1ECPA 5GJPA 5F4SA 3RE1A 2OSXA 2Z1MA 3M6MD 4DPMA 4QRHA 3GHRA 1MSSA 3EH2A 4V2XA 3ESZA 1IB6A 4IIUA 1QIIA 2FW9A 1Y3IA 2ODOA 4NSNA 2W2LD 1MB0A 2PR7A 3BQ9A 2JLUA 4XQ0A 4ERAA 1KOLA 5EIHA 4MRRA 1WDQA 2XFYA 3NANA 4YLWA 4PFMA 3E0LA 1E0TA 5XINA 4XW2A 4CNBA 2C4NA 4OKSA 2I7VA 1M3UA 2FGZA 1V35A 2O8DA 3UMMA 3D8SA 2ZIZA 1QIFA 1Z47A 4RPLA 1R86A 3WQ5A 3ALFA 4B2IA 5AYIA 1GA4A 1NPTO 1GL3A 5DVZA 1O6ZA 4J3FA 4RK6A 3V2HA 1FDJA 5E1DA 1X39A 3FDKA 2CJFA 2VC7A 5L7YA 2P8BA 4EHFA 4PCUA 4OY3A 5KSYA 4J91A 1WPQA 1Y5LA 4ZMSA 3LCJA 4K9PA 4JJFA 4G5YA 4BTVA 1CW2B 2WNWA 5AHXA 4U2YA 3LLVA 4XFKA 2FRDA 2J0UB 4GACA 1BX3A 4CMAA 4F6LA 1P1JA 1Y4SA 4BLWA 3ASYA 3CV2A 4RIHA 3RHTA 4WY0A 3ZWYA 5CXSA 5AI8A 1ISWA 1JDAA 2XZ9A 4GVHA 3VOFA 3LV6A 1AS2A 2YFYA 4DN1A 4GECA 1Z0FA 3PWIA 1X3SA 3E5NA 3GC2A 2J8GA 3VO0A 1GCUA 4FBGA 4AFYA 4A8LA 2QRPA 2OGUA 4L61A 3GR4A 3KL0A 4JVLA 4LZWA 4IIVA 3WDQA 2VRJA 3NHFA 1TD1A 7REQB 3C45A 4PZAA 3MT7A 2WSMA 3O3MB 1A4XA 4CQJA 2GFTA 3CE9A 3W3ZB 2BI8A 1T3ZA 3GCDA 5AMXA 4MDEA 4GBED 4GQGA 4M46A 2OENG 4YRIA 2HSDA 3NJ3A 4KO3S 4AM8A 1O5QA 4EB3A 2XJ7A 3G1AA 4WCFC 1SCJA 1VD6A 4YP6A 2CWNA 5C18A 1O5TA 3A3XA 3DOUA 4J6FA 2VT7A 2R1NA 2PM8A 2NUTA 5DGIA 2KLBA 2ISVA 4A3QA 4J3JA 4HP8A 2DW7A 5DLEA 3AERA 5BV1A 1CUUA 2VDMB 4TQTA 3SR3A 1G5TA 1ZK0A 3B9NA 5LZ8A 2ORIA 5HPOA 4NJEA 1FSFA 2H4WA 1LWIA 3LUJA 2OBNA 3AUKA 4G9PA 4IJKA 3L82B 3WDJA 1V16A 1YQXA 4N0DA 2NUPA 1BH6A 4HT3A 1FP4B 1XD2B 3KR2A 2G9UA 1NLFA 4FR6A 3IOEA 3FFSA 2HJ9A 1I2RA 5HM6A 4N6GA 3B7PA 2PKQO 1MZVA 3GVWA 3S7ZA 3AH8A 5GV8A 4PB4A 2QIWA 1AA6A 3U1BA 5LQUA 1FXQA 2NQ9A 1MXSA 1CGXA 2GDQA 4GXWA 1C14A 1F4PA 1ZAKA 2I2XB 4G0YA 3OZ7A 1Q6CA 3KFLA 3E5RA 3HP4A 4EIVA 4AY3A 3A3WA 3KQMA 1A7KA 4OSPA 4S3JA 2WNIA 3GRZA 3WBAA 3WL6A 1U0GA 4BO5A 4FGZA 3E22B 3M0JA 1PJLA 1PX2A 5D3MB 3KWLA 2WKSA 3I9JA 1K97A 4FYVA 4NDNE 4BNVA 2G17A 4MQ5A 5UKDA 2D7DA 1PD1A 4CI0B 1J0KA 4B4HA 2D1QA 4EL5A 3ATYA 1QHXA 5FI5A 1NY1A 2HIHA 4OQZA 4L51A 1LS6A 2RMKA 3UK0A 4P4SB 2IZ5A 3AEYA 4F92B 4E14A 3EY9A 3NO3A 3BB4A 4PYOA 1XWIA 2VKQA 4RX0A 1N7KA 2QJOA 4HEQA 2I57A 1RA0A 3K20A 4MDFA 2ZTLA 2YDQA 4MR7B 4JY9A 4B44A 2VUSA 2XBMA 3RKSA 3FJYA 4TQGA 2PGIA 5JSZA 3ILYA 2XYQA 4XUGA 3TW6A 2NQ2C 2QI9F 4HN4A 4EY7A 1IZ8A 2WJ6A 1JGIA 1J9ZA 2VDRB 3ZY3A 5H1WA 3V1PA 3N0VA 4XUCA 1W0CA 2ZBDA 3W53A 3NUGA 1CIUA 4OMUA 2C84A 1OV6A 1Z18A 1RYEA 1P0NA 1W3LA 2CD7A 1OVMA 4JQZA 1XI2A 4TMWA 3ZR4B 2HF2A 1NMEA 5GGXA 5HGJA 3G2OA 1FMLA 1HE3A 4EPYA 3GJSA 4UQDA 3W7OA 4RA6A 2OSBA 1VG0B 4MVYA 4TSFA 3R8HA 2P2GA 2Q0SA 4MTVA 4G9EA 4I1IA 2UWFA 1UPFA 4JUBA 4WXMA 2Q02A 4P8VA 2NPOA 1OGYA 2X0NA 3PZGA 4WECA 1GUAA 1TM4E 4G2DA 2GEJA 1TUFA 2Y6ZA 5EWMA 5JG7A 4Q4KA 2C18A 4D57A 5KVCA 1K0UA 1UPPA 3S5JA 5CCZA 2QG6A 2ZU0C 5AM3A 3LGDA 1E98A 4QOIA 2UXDB 1W5TA 3BXGA 1XNHA 3SCOA 2WWCA 3AJRA 2YFHA 4ROSA 4YCAA 3NDYA 1XO1A 1K6MA 1YZHA 2FCAA 2XMGA 4G1EB 3ZJ4A 1R9NA 3FCSB 2WU8A 2W2KA 2HE5A 2DSWA 3TCNA 4ZZ0A 1M73E 1ACJA 3RS9A 4PPQA 3ZLBA 1AV6A 4MUAA 2VLBA 4X6YA 5FJUA 2ZWAA 4FDVA 1ZJHA 2P69A 1J23A 4YCPA 2PH5A 2WCAA 3ZWPA 3NQ6A 5G02A 5EKTA 3IQIX 1GYMA 2HX1A 1F20A 4WNYA 3LHDA 2JHCA 2TECE 5AW5A 1EB8A 1VDZA 4WD3A 5LQAA 4N3AA 2ZB3A 1A4UA 1CUJA 2I2DA 5CVUA 4OV6B 2IPNA 1U4NA 1BXZA 4MPQA 1Z7BA 2X14A 3DVRX 3NYWA 1EP3B 3GJ5A 1JL8A 1EBGA 1G7UA