4G57A

Staphylococcal nuclease double mutant i72l, i92l
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4g57A00
4QF4A 2PZTA 3DMUA 2HQEA 4ODGA 1EY6A 4WRDA 4EQPA 4WORA 5E1FA 1STGA 3P1HA 4K5WA 3HZXA 1TQOA 1SNQA 3MEHA 2EY6A 4K8IA 4NDXA 2EY5A 3SK6A 2OF1A 2SNMA 1A2TA 1RKNA 2F0IA 4QB4A 5KRUA 1ENAA 3D4WA 4HTHA 4OL7A 4K8JA 2OXPA 5EKKA 5KEEA 4B9XA 2OEOA 2PW5A 1KAAA 4KJNA 1KDAA 1SYFA 2F0FA 4KY7A 5DEHA 3H6MA 3OMCA 3NK9A 5NUCA 3EROA 4KD3A 1TT2A 4F8MA 1U9RA 3EVQA 2F3VA 2RBMA 1JOOA 4HMIA 3MZ5A 2M00A 3D8GA 4K5XA 1EY0A 1AEXA 1NSNS 2QDBA 5CGKA 1STHA 1SNOA 1A3VA 2F0EA 1ENCA 3DHQA 4TRDA 2F0SA 2F0GA 1IHZA 5IGFA 2RKSA 1EY9A 4KV6A 4G57A 4YIJA 3R3OA 2O4XA 3D4DA 2F0NA 2EYJA 1STYA 1EZ8A 3OWFA 5E3FA 4KTAA 4KJOA 1A3UA 3SHLA 2F0PA 4K5VA 1EYDA 4PNYA 4NMZA 4DU9A 3LX0A 3P75A 2ENBA 3OSOA 5C5LA 4KHVA 5IGDA 5CR3A 4RKBA 4KY6A 5IIFA 2F0UA 3ERQA 3NUCA 3C1EA 4KY5A 4B9WA 1SYDA 3SK4A 1F2MA 2F0DA 3OMGA 2SOBA 4ZUIA 3QOJA 5J22A 4I65A 4J6HA 5K5PA 5C6AA 4J1MA 2F0LA 2F0JA 3C1FA 4N9PA 3SXHA 4ZUJA 1F2YA 2F0HA 1SYCA 4IALA 5F2DA 3SR1A 3D6CA 5C4ZA 5KIXA 1NUCA 5M9OA 2F0WA 3RUZA 5C3XA 5I6YA 3SK8A 3ITPA 4K2LA 1EY7A 4DF7A 2EYHA 5EKLA 1SYBA 3S9WA 1II3A 1KDCA 3NHHA 5CV6A 4DGZA 5IGCA 5C4HA 1JORA 2WACA 3T13A 4EQNA 3SK5A 5J39A 5CV7A 3TP6A 2PZWA 1TR5A 3U9OA 5IOCA 1KDBA 5JOBA 1EZ6A 2F0VA 5CV8A 3MVVA 2F0MA 3V2TA 2EY1A 1EY4A 2EYLA 2PYKA 1STAA 4RKLA 5I9PA 5ISRA 4IZ8A 4K2KA 4NKLA 3NQTA 4NP5A 5C3WA 1A2UA 2F0QA 3BDCA 5IODA 2F0TA 3BDLA 2EYMA 2EXZA 1SNPA 1KABA 1EQVA 2LKVA 1SNCA 2KQ3A 4IUNA 4KD4A 4ID6A 5DAUA 4K14A 4H7BA 5J1ZA 4N9TA 5CC4A 4R8NA 2NUCA 1SYGA 3NP8A 3QB3A 1JOQA 5IGBA 4ME5A 1STBA 3HEJA 2F0OA 5IGGA 1STNA 3MXPA 2EYFA 1JOKA 5I6WA 5CV5A 5I9OA 3MHBA 4S3SA 4DFAA 5EGTA 5KYLA 2KHSA 1SNMA 3E5SA 4ZQ3A 5KGUA 3EJIA 5CV9A 4PMBA 2EY2A 5HURA 4EVOA 1EY5A 2EYPA 1SYEA 4MIUA 1EYCA 1EY8A 1EYAA 2F0KA 4K6DA 4QMGA 5CV4A 5JAVA 2PZUA 2RDFA 3NXWA 2F3WA 2PQEA 3T16A 4PMCA 3VA5A 4E6IA 1A3TA 5HGTA 2EYOA 1F2ZA 2PW7A 3QOLA 4F7XA 3TP5A 5IGEA 4HMJA 3TP7A 4LAAA 3TP8A 5C5MA 2SNSA 4EQOA 1SNDA 3TMEA 5KYIA 3PMFA
chains in the Genus database with same CATH superfamily
4EQPA 1I4RA 5BN3A 5JEAH 4KK7A 3HOUB 2YTXA 1R4QB 1B4OA 1NJIC 2R7ZH 4LNQA 3J80c 4LUOA 3J81L 2D9UA 1C8CA 3VYRA 1WFQA 2EDGA 3EQLC 2R93B 1E0BA 3ZJYC 1L2FA 5KNDA 3HOUG 1CFMA 3L7ZC 1IL2A 2GVBA 3S1MH 1EWCA 1XTDA 1AE2A 1Z6HA 3MFYA 1XPUA 2ZTDA 3L9AX 5LL6X 1XX8A 1UAPA 2D0PA 1E2ZA 2QDBA 2R61A 3Q8DA 3DEPA 4BWGB 4YCWA 2BE5D 1HNZL 1JR0D 1T9HA 3R93A 5C5LA 1EIYB 2F0UA 3HOZB 1JB7A 5IE8A 1TIID 4LF9Q 3K5MA 1QVCA 5K5PA 1Y1VB 1SRUA 1PTOH 1J8IA 5F2DA 1CUKA 1MKHA 3ITPA 2MFIA 4TKOB 1QZGA 2QF7A 3T56B 4DV3Q 1VQ4A 1ET9A 1SMXA 5C4HA 4DR4L 5J39A 3PO2G 3HOYB 1EZ6A 1ML0D 3S2HB 3MVVA 4LF7L 4J15A 1IYJB 4HCEA 1IBML 4DV1Q 3PO3B 1Q8IA 4NKLA 4NP5A 3SVMA 4C3IG 4HIDA 1SFOB 3TBIB 2PQAA 3PQIA 3M7NA 3GTGB 1AH9A 3NEMA 2NN6H 4C3IB 2B3GA 1I4QA 4P75A 4CKCA 1VQ6A 1Z47A 4A3MH 4HEDA 1G8ZD 1K8MA 2KHSA 3E5SA 2MO0A 5DNFA 1FGBD 4ULLA 3HGBA 3CCVA 1A6XA 1EYCA 2I5LX 1D7QA 1QG7A 1TS5A 2OTJA 1EUJA 3RR5A 2JA5H 1L1OC 3DM1A 3ERSX 4R4OA 3B6YA 1Q8KA 4P74A 1TS2A 1QWYA 4GLXA 2EVBA 4MTKA 4A3GB 2NWGA 4DUZL 4K5WA 1TQOA 2SEBD 2E8GA 3A56A 5ELOA 2EPBA 2WINB 4BY1H 2F0IA 3FPUB 4DV5Q 2BH8A 3GQBA 1XMQL 5EKKA 2O5JC 1HZBA 1EIGA 2XN9C 3HOXB 1OO9B 3EN2A 2K5WA 4IOAA 1DOKA 1QNUA 3P7JA 4LF6Q 2DNCA 4A4IA 2DY8A 2PMZE 2EJFC 1QNKA 3S1QH 4QCLA 2BH2A 2UUCQ 1OXTA 1LACA 3GDEA 1N32Q 1S40A 2F0EA 4TRDA 4A3JB 3LWEA 3IFDA 3DWAA 5GAHC 4B3RL 2K6AA 4OONA 1T5XD 2PI2A 1A3UA 4LFAQ 4KHZA 5LMNL 2RDGA 5C44B 3P75A 3A7AB 3KF8A 1TXYA 3Q24A 1HH2P 4BY7G 2F0DA 2R7FA 1Y14B 3MTSA 1S3OA 3NELA 1U4MA 4HSPA 3OHXC 3UDIA 1AFPA 5EKIA 1H9SA 3CXCA 1AN8A 2JA8B 4GN3B 4DV2L 1D6EC 1P16A 3OTOL 2A6HC 5IGCA 3IRBA 1QCBD 1ZKOA 1TWCB 2UXCQ 1L1OA 1UUPA 3U9SA 1BXTA 3U4ZA 3S15H 1SE2A 1Q1BA 3HOWG 2B8GA 4LF6L 4C1NK 1IYUA 1GUGA 5IP7G 1A2UA 3KDFA 1QOHA 2AKWB 1D5ZC 4X6AH 1Y1VH 4RH6A 2LY7A 3PV0A 4P71A 3W2DA 2WV6D 2VS1A 4KI0A 2VW9A 1H9SB 3VDYA 1X54A 4R8IA 1VQKA 3MXPA 5KGUA 1RIPA 1KRTA 1H9JA 3NBHB 2EYPA 2KOLA 4NXML 2JK8A 3GTGH 4PG3A 4AQYL 1PH2A 2B2WC 3T16A 2NYZD 2JA6H 1CHPD 1PFNA 1PTOF 5DLQE 4F7XA 5IYBH 3TEHB 4GOPB 2E2JH 1VQBA 4LMQD 3WWVA 1EY6A 1WD1A 5FO7B 1M4VA 1PH5A 3J7YW 2UXCL 1A2TA 3D4WA 4K8JA 1SYFA 4X3SA 5DEHA 1YI2A 2MQHA 4DV4Q 3CCSA 1PXUA 2Z9HA 4KD3A 1UEBA 3GTQH 3HKSA 2F3VA 4HMIA 4HJ8A 5D3IB 4K5XA 3UI2A 1EQQA 3K80C 4LF5L 3J7ZC 4PZ6A 3H15A 1N8RC 4A3LH 1NBWA 4QIWB 2ZXPA 4A3GH 1I6HB 1X56A 3R3OA 2O4XA 3K7UC 4YY3L 1EZ8A 4KJOA 3SGIA 1EYDA 4NMZA 4PQXA 1MSHA 4YWLA 5JEAG 2WB1B 2R7ZG 1GUSA 2K75A 4KY6A 4C2MH 1GVPA 3EA6A 3NE5B 3I4MG 1S5ED 1IBLL 4O42A 3AB9A 3PUYA 3GP7A 2YYZA 4L5RC 4GNXA 1DYQA 2WFWA 2JJQA 4LJZC 4ZCKA 2HT1A 4RCOA 4GKKL 4BS9A 4UP7A 1JCKB 2UUAQ 2GA4B 1I4PA 5CV7A 3U9OA 4DR1Q 3NWSA 1YNXA 3M4PA 3FKIH 3OIQA 1XMOQ 1PRTF 2EYLA 2NVYH 3S16H 4IZ8A 2A68C 1S5BD 3GTOB 1ASZA 5M5WH 4PMWA 2JA9A 3OYYA 1F9RA 4DAYA 1HR0L 3I7FA 4CDCC 1O7LA 4LFBL 3I3CA 2NN6I 2OT2A 1I4GA 4ZK9B 1JOQA 3FPPA 3ER0A 1B3QA 3BVZA 1G91A 4NPSA 4DFAA 1M1KC 2UUBQ 3EJIA 1QUQA 2ZJRA 3V96A 4LW1A 5GROA 5CV4A 1EYAA 4KN4C 3TSSA 2PZUA 2K52A 1GD7A 4A3EB 1GHJA 2PW7A 4FXGC 1PVOA 4HMJA 2TSSA 1LTGD 4EQOA 1CZGA 4IFDG 4DXFA 4DAYB 3PO3G 3URYA 5FLMH 1O7ZA 4F87A 5GADC 4GKJQ 4ODGA 4LUZA 2X6LA 1HUNA 5E1FA 4NDXA 3CCJA 3HZXA 1SNQA 2EY6A 2UXBQ 4QB4A 1BCPF 2OXPA 2BE5C 2Z4IA 1XMOL 1LTTD 4RMFA 4GNXC 1NY4A 5NUCA 1Q1EA 2B2TA 2RSOA 3EVQA 5JEAJ 2LXKA 1HNWL 2FMCA 2D5DA 1LM0A 1WYDA 4JW0A 1Q82C 1F9PA 2GVAA 5JVG3 2KHIA 4YIJA 2HQLA 1Q90A 4LF9L 3TN2A 4ABNA 1TY2A 1X3QA 2B2VC 2F0PA 4K5VA 2JA7B 3K58A 3GTPB 4V190 4N8X1 5A2QE 2M9VA 3ERQA 1MGSA 1YNND 3HG9A 1ESRA 2SOBA 5C4JB 1KIXA 4CJ1B 4L5TA 1G291 1EWHA 4FF3A 2A69C 2K01A 2IX3A 3KLRA 1LO5D 1ENFA 4Q5VA 1K73C 1XNRQ 4B3ML 1KLUD 1BO0A 1FNWA 1I5FA 1K3RA 4A3KG 1KDCA 4BA2I 1S5DD 2NVQH 3SK5A 3T1YL 2QILA 3CCLA 1HNXL 2E2DC 5M3FH 3V2TA 4ZRZA 2HIXA 2N55A 4U673 5IODA 2R7DA 3MXNA 3AEVA 2K50A 2R7ZB 1NCVA 1U0LA 2EYFA 1JOKA 5CV5A 4F88A 5I9OA 5BR8L 1FNVA 4JCVE 1I6VC 5GAEC 3W1GA 3P20A 4IN3A 1SR3A 1XYIA 3VA5A 1E3PA 3I4NB 5IGEA 1GXDC 4H02A 1J5EL 1Y8OB 3MAQA 2V4DA 2A68D 1XNRL 4M8AA 4MHEA 1WTWA 3U50C 3KF6B 3NENA 1FR3A 1RKNA 1HNXQ 2B2UA 3A55A 5KEEA 1YJ9A 1K83H 1CKNB 2OEOA 1PTOD 2HIVA 2I07B 3OMCA 4A3BG 1N34Q 4Y7NB 2UUCL 1N32L 2R3ZA 1WTPA 1TT2A 3E3XA 2NN6G 5IT9c 3M4YA 4FO2A 1EY0A 3J7AV 1JC7A 1X6OA 2FJ2A 2B2WA 5LMNQ 5IP9H 4LFAL 4G7ZC 1LLRD 4DAPA 1Y1VG 4X66L 1HQMC 2N49A 4HSVA 5EPLA 3S2DH 1TU2B 3STBD 4YCVA 3I4OA 4LFCL 4A3FH 4B9WA 1F2MA 1QILA 3M3YH 3RMHA 5FJ8G 1XJVA 1BCPB 4QL5A 3LWUA 3K57A 3SR1A 3G4SA 2E2IH 1G6ZA 3HFZB 4C3IH 3D6WA 2K14A 5M5WB 4K0KL 2E76C 1PYBA 4C1NI 1MJEA 1EIFA 5FLXc 1DJRD 5I2XA 2PZWA 4WJ3M 5FOBB 3H3VI 1A63A 1N34L 4UY8C 3M4OB 4A3KH 1E22A 1NR2A 2YTYA 5C4XB 2AUKA 3MC0B 4B3SQ 4JI5Q 3MA2B 4A3DH 2EYMA 1Y1WB 4P72A 2EXZA 5M5XH 3L3OC 2Z8LA 2HDMA 4K14A 3BS1A 4JI3L 1HUMA 5CC4A 3GTJB 1H95A 4KLKA 4G7OC 2WB1E 4IJLA 3EFXD 3I73A 3QJYA 4BY1B 4C3HB 5D3DA 1RTNA 2F1MA 3BDOA 2HCIA 4PMBA 5LL6S 1G6PA 3C2PA 1BQQT 3D4RA 5I4DA 4I7AA 4IPHA 3TQYA 5JAVA 5I9PA 5HGTA 2NBFA 1A3TA 2PO4A 5FLXL 4R9WA 2XWBB 3K0XA 1SMYC 4OL7A 5AJ3L 1G2SA 3Q0AA 3L0OA 5IYCG 2C9OA 4JI8L 2EY5A 3DXJC 1OTCA 1WTXA 1JE4A 4KKSA 3CCRA 1LT4D 2RVLA 2VB3X 3VYTA 3CMEA 4B3SL 3M3YB 1W6KA 4OEMB 1IZ6A 3KJPA 1LTRD 3OW7A 1I4HA 1DOLA 1Q12A 1CK1A 1CT1D 2D0OA 1STHA 1SNOA 4DK6C 4DK0A 4K6LA 4OWTB 2NVQB 3E6ZX 1VQCA 1HRJA 4OWWB 2AUJD 1HR0W 2L1BA 1PLFA 5CBEE 4JI6L 4TQUS 1VS0A 4KY5A 5FK9C 1SYDA 3SK4A 2MNAA 3ICEA 1PTOC 1BF4A 3CW2C 3CMAA 2F0HA 3UE1A 4GZYC 1DONA 1SBBB 1RODA 4RG1A 4JI8Q 1A8VA 2Z0SA 1S4ZA 2VL6A 3RUZA 2RQXA 5C3XA 4DR1L 4P73A 2ZT9C 3CCUA 5E4XA 5I2YA 4IFDJ 2JQOA 1EWIA 4DGZA 1C7YA 4L6TB 3ND9A 1VDZA 2F0MA 3J81i 4DV3L 4C3HG 2CHBD 3AU7A 4H44C 1TWFB 4KKUA 2F0QA 4IQZA 3BDLA 3G6EA 1EU4A 1MJCA 4OO1I 2DUDA 4IUTA 3S1NH 3E0JA 5LMUL 4GN4B 2NUCA 1CQFA 2Z6KC 2R6GA 2JA5B 1N33L 1D1IA 4FP5D 2QEXA 1SN8A 4A3CG 4B3TL 1TWGB 4JYAQ 1VQLA 2A5HA 1VQDA 3S16B 2KA7A 2LXJA 4A3DB 2WKCA 2AWNA 4QIWE 2ATWA 4EVOA 2B2UC 4JI7Q 2ZXRA 1KTKA 1Z7TA 4RFBA 1R4PB 4HCSA 1EEID 3TP5A 2RSNA 1QJOA 1ZYRD 2CH4W 3M7GA 1LTAD 1T5EA 5COYA 2SNSA 1O7YA 1SNDA 2PNHA 4WRDA 4IJHA 2IJ0A 5JJIA 2HDLA 2ZM6L 4JI1Q 1NR4A 2OWOA 4MNOA 2XVSA 4XT1B 1G2TA 4YHHQ 2PW5A 4KJNA 4A93B 1A0IA 1PZKD 2ALYB 3Q6SA 5L37A 1PZID 1K8OA 3H3VC 1ET6A 1AEXA 4O0AA 1A3VA 3KBGA 1RTOA 3DHQA 4DV0Q 2R92B 1N36Q 5C4XG 1KL9A 1KNAA 3VA7A 1EY9A 2RA4A 4CHTB 5TSSA 3JAMi 3A54A 3HOUH 1STYA 5E3FA 4DK1A 2JP1A 4OX9Q 1F9QA 3CC7A 3VR5A 3CPFA 1D8LA 3K8AA 1EU3A 1Y8PB 5M3MB 1XPOA 2NZ1D 2CH4A 1B1ZA 3K7AH 1BBXC 2Q2HA 4I65A 2Q8IB 5FO9B 2JA8G 1EOTA 4GS3A 1UNSA 1VQ7A 1RF2D 3K6OA 2CQAA 2N88A 2AWOA 3RD4A 2MJ8A 5ELDA 5M9OA 3TRZA 2CQOA 4A3IH 4X3TA 3HRZC 3FVQA 3RLOA 5EKLA 5C0XI 3MXGA 2WACA 4EQNA 1VQOA 1JJGA 2VQEQ 4LF8Q 3KK7A 5JOBA 1SJED 2GN5A 3M85A 5CV8A 3PCOB 3R2IA 3RLNA 3QO2A 2H4OA 4DV7Q 4JOIA 5ISRA 2K5VA 3BDCA 2KECA 2WP8J 3PGZA 3T51B 4UP9A 4DV0L 2LKVA 4LWCA 5BN4A 1N9WA 5CORA 3PO2H 3NTKA 5GAGC 3K59A 2K1BA 1X65A 1ZEQX 1QVGA 5KNCA 3IFTA 5LHY1 5KYLA 2NVYB 3S24A 1WCMG 1WTOA 2K04A 4BBRH 5IT9E 4MIUA 1SYEA 2F0KA 2OQKA 4X3KA 3S17H 4FF4A 4IPGA 3JC66 1WCMB 1I50H 1YNNC 5C5MA 1FVIA 4R4CA 3K5NA 3KBXA 5FKAC 5EAYA 3GO5A 3MFGA 4A75A 4AH6A 1NE3A 1VF7A 4LF8L 4DR3L 2JEBI 4LF4L 1BVSA 1DD2A 3SE0A 3TDQA 5H1SE 3C3LA 1HA6A 1C48A 2L11A 4ZKBB 2NVXH 4HN7A 1B8AA 4X66Q 4DV4L 2B63G 2VUMH 1G51A 4A3DG 4P2CB 5CBAE 1VQFA 4ZLTF 1PTOB 4HJAA 2B2TC 4Z9CB 1Y8NB 4JOIC 4TVAB 2EJGC 2D2CC 3HOVG 1HHVA 2XWJB 4RKBA 4YY3Q 1FD7D 3CC2A 3OOCA 3F1ZA 2F0JA 1VMPA 1MIUA 1LTLA 1FNUA 4H0LC 4IALA 4DR6L 1E2VA 4V0BA 3WOEA 1BDOA 1R9TB 3H3VH 3VR3A 4DR3Q 1WI5A 3I91A 3S2DB 2LSSA 3CCEA 4JI5L 2KUMA 5IWAQ 2IX1A 1TWGH 1OXXK 2WAQB 1NMFA 1IYVA 1U4RA 1JB3A 1NMGA 1STAA 4A3MB 4OHJA 4JI3Q 3OIPA 1PYWD 4DV6Q 1L1OB 1SNPA 4HAEA 4IUNA 5J1ZA 4JPBW 4UHVA 2FINB 1YEZA 1K8GA 1K0RA 4RWSC 3HOWH 3GTLH 2K5NA 1LT5D 3RZDB 2FHTA 1HNZQ 3HOXH 1YHBA 1L0XB 2DGYA 4TSSA 3HOYH 1CZWA 4DR7Q 5M3FB 4ME3A 2EXDA 2F3WA 4DR6Q 4LAAA 4DNTB 3MEFA 3QR8A 4JC0A 2K05A 4Y7NH 1CQVA 1SE4A 1TS4A 3ONAB 1I3QH 2KEDA 1U9RA 1PH9A 4LK1C 2F4IA 1DM0B 1S5FD 2QW7A 3GV3A 3SK6A 1PYSB 3I4LA 3N52A 3V05A 5IP9G 1LTBD 4GKJL 4CBVA 4Y52H 4R4TA 5IYBG 1KQSA 1IW7C 4KY7A 2L12A 2IWHA 1DXMA 1QUQB 2RHQB 4FDBA 3AYHB 1KD1C 4UDUC 4AYBE 4LF7Q 3W5OA 3Q23A 3J81c 4DV6L 1LTID 4DV1L 2JA7H 1F77A 3MWYW 3HOVB 5M3MH 2F4VL 3CP0A 1NSNS 3CQZH 1XPRA 2PPBC 2OQ0A 1E2WA 3R8BA 1JE5A 4RHSA 2CW0C 4KTAA 1RL2A 1SDFA 2DY7A 4DU9A 3PIO3 2HHHL 2VUMG 3NSWA 2F52A 4YWMA 2BCOA 4DR7L 4HIOA 4JBMA 5IYDH 3K5LA 2ICIA 4O1NA 4FYDA 3GTKH 1IKMA 2M2LA 4FXKC 3FRPB 1IBKQ 5JJKA 1F2YA 4A3KB 1LT3D 2Y0SG 1K3BC 3CKIB 4QGUA 2AQ2B 5I6YA 2Z4HA 3BVMA 4OWXB 5M3FG 2EYHA 2MGSA 1SMYD 2K03A 1ASYA 1EFID 3H0GB 1FJGQ 3I4MH 2K4KA 2EZVA 2A6EC 3H94A 1UE5A 5C44H 4DV5L 2R92G 2A74C 3DWQA 2K33A 4XYOA 1HZCA 2XGTA 3A0JA 3HP3A 4B3TQ 1B50A 1EQVA 4JYAL 4KD4A 1WVLA 4X64Q 3AMUA 5JJLA 3UDGA 4BY7B 1SYGA 2WB1G 4HJ5A 1ICFB 1ICWA 1KC8C 4DUYL 1ZYRC 3I72A 3DEOA 5IGBA 1PA6A 2E5LL 2HHHQ 1STBA 2XRSD 1DGSA 5IGGA 2KENA 3O13A 1J9OA 5EGTA 2OTLA 2EY2A 4NXNL 4K6DA 5K36G 3NXWA 3M4OH 2PQEA 2EYOA 3BG3A 3PIP3 1K9MC 3UDXA 4QUCA 4CJ2C 3BZDB 3TMEA 4FXDA 1TWHH 2WAQG 3CPWA 1STGA 1B44D 2G9DA 4K8IA 3A5ZB 4I7ZC 2O5IC 5CMDA 4DR4Q 2B2YA 4A3BH 4DV2Q 1LV9A 3UDFA 4A3IG 1JWUD 3OTOQ 1KDAA 2K5HA 3H6MA 3CC4A 5IY0A 2VQFL 5FLMG 3BZCA 4CKEA 2CWPA 5ELBA 2VY3A 4A3CH 1PRTC 3ULLA 2QA4A 1MBYA 4JG2A 4UP8A 1BCPD 4KV6A 3CU7A 5C3EH 2DN8A 3T1HL 3S1RB 2QDLA 4A93H 4X62Q 5IGDA 4HJ9A 4JBKA 1XXGA 1CM9A 4PZ8A 1EOVA 3JAML 1YJNA 3H0GG 2F0LA 3HKZG 2NZHA 2VB2X 1W3SA 3G6JB 3SDZA 3EIVA 1SE3A 3OWEB 1GHKA 1EY7A 1JJ2A 3GTPH 1HXYD 2HD3A 4C56C 1I6HH 4IUPA 4DV7L 1BR9A 1Q81C 3T13A 3RZOB 1BNZA 3TP6A 5IOCA 2K5QA 4L63B 4R4IA 1GUTA 1GUNA 1DCZA 4L8JA 4JBJA 2VQFQ 1M90C 4ZAIA 4IUQA 3IAYA 3GTKB 1S5CD 5JPNC 2EIFA 4KHPL 2B2VA 2KQ3A 1EFWA 3T1HQ 1VCIA 3HOZG 4ME5A 2OCEA 4OO1H 1V1PB 5D65A 4GOPC 1XWEA 1STNA 2ZJQA 4JV5Q 3TREA 1X55A 2AMCB 1OXSC 4NW2A 1PMRA 1PH6A 2ES2A 4XIGS 2AHOB 1V43A 4LUVA 4FVMA 1PFMA 2FFKB 4POFA 1F2ZA 3M9BA 4H13C 4A3LG 5IYCH 4WJ4A 1DZ1A 3N6RA 4IPCA 4ZYSA 1VQEA 1TWAH 2BOSA 2Z6KA 1BOSA 1WJJA 1PFBA 1RJTA 2Q2IA 3TZUA 1U4LA 3I70A 2DJFC 2E75C 1RHPA 3FP9A 1PFSA 5ELNA 1WTQA 4B9XA 3MXUA 1KAAA 2IHEA 2XRQD 1WTVA 3KF6A 4RGMA 2F03A 4QJFA 1JWSD 2XIWA 2L0CA 1VMCA 4DR5Q 3J80L 4JK1C 4A3EH 1JT8A 3PIOA 1TWHB 3DUZA 2L15A 1IXRA 1KHIA 1E7ZA 2G5DA 2O2LD 4C3JH 2F0SA 2F0GA 2NTSA 1PH4A 1HR0Q 3GTMB 3T53B 4JI0L 5EPJA 4BBRG 2KCMA 3FKIG 5EQ0A 1B53A 1D5MC 2YTVA 3OW2A 2XSCA 3LX0A 4AQYQ 1CKMA 3BYYB 5IIFA 3PUXA 2NB0A 3FEWX 2UUBL 3C1EA 3OMGA 1D5XC 2DJGC 1PH3A 1HFGA 4JI6Q 2LS01 2UXDL 1LT6D 2KCNA 5C3EB 5KIXA 1QE6A 3JAME 1H9KA 1B9MA 5M3MG 3ND8A 4OELB 1GUOA 1SAPA 5A2QL 3NQIA 4IURA 3EBEA 2ZTCA 1TR5A 4DAMA 1X3EA 3ZYYX 4FNFA 1QB5D 5FLXE 3PF5A 4HIKA 2KHJA 3NQTA 3CRKC 2JXMB 5GQOA 2I0QA 4R1JA 2YU9H 1HNWQ 3Q22A 3S17B 2WKDA 4N8FA 1VQIA 1SE8A 2Q2TA 4CKBA 1B70B 2Y0SE 4BA1I 2TMPA 3KJOA 1PH7A 2IPKD 1EY5A 3LNNA 1YNJD 3FMCA 4DKAC 4PMCA 3A8KE 1YJWA 2UXDQ 1NAPA 4A76A 3PO2B 3DLLA 3CAMA 4JI7L 1Y1WH 1TVXA 5IGFA 4GKKQ 1BKBA 2NTTA 4WORA 3I56A 1SXTA 2OF1A 1CKOA 4B3MQ 2IL8A 5KRUA 4HTHA 4A3FB 3I4NG 3KOJA 4C2MB 1L0WA 2FMMA 4XQJA 1B9NA 4BBRB 2BDOA 1PV4A 2A19A 2BDNA 4F8MA 4YHHL 2WAQE 2RHSB 1YIJA 3K7AB 5ELCA 5CGKA 1I50B 4JI4Q 4M1UB 2EYJA 1EIHA 2BA0A 2ENBA 4PV1C 4ZKCB 2JA8H 1F2LA 3VYUA 5BR8Q 1IBKL 1HZAA 3K5OA 1CKNA 4OX9L 3LGJA 3ULJA 1B3AA 1LABA 5T1IA 3CQZB 3I8ZA 5M5XB 3RLFA 3J7AF 2Q8RE 1K8AC 2IX0A 2CW0D 2L9HA 2LFNA 3J80i 3L2PA 1HPCA 4DN4M 3WDNA 3RZDH 1YITA 1SYBA 4DNIA 2CVRA 4GOPA 1JICA 4L5QA 3U4VA 3KUPA 5C3WA 1ESFA 3PF4A 4MN3A 1IW7D 3HOYG 2E5LQ 1U5KA 1O7IA 1VQGA 2E74C 4OXPA 3TS0A 4AYBB 1SEBD 2MO1A 1WCMH 3H0GH 2B39A 3S2HH 3HEJA 1GKHA 3MHBA 4S3SA 3TS2A 1PH8A 1SNMA 2E2HH 4AYBG 5CV9A 5HURA 5C3EG 3S1MB 3GV6A 1YHAA 3FKIB 1EEFD 2ID0A 4OGQC 5C0XH 2K32A 3HKZE 1TWFH 4DUZQ 3VR4A 3K81C 2L4NA 3QWNA 3VR2A 3F8TA 3WOFA 2KVMA 5T1GA 3OPOA 1VQ9A 3GTLB 2N8NA 5AFWA 2JA7G 1JQYD 1XMQQ 1CA5A 1XTCD 4WJWA 3BJUA 1Q3LA 2C35B 3MEHA 1Y1WG 4BBSH 2CFMA 3D3RA 1STEA 2SNMA 4C3JB 2K7VA 2C5CA 1H9RA 2MHVA 1E1TA 5FO8B 4A3GG 3NTIA 5KNBA 3CHBD 4BY1G 3NPPA 3KFUA 1A62A 5C0XJ 2B63H 1I3QB 2I46A 2B2YC 4DAVA 4HR7B 2A6ED 1O78A 5IYDG 4B3RQ 1BBUA 1ENCA 2I5MX 5JJZA 3I90A 4X65L 4JI2L 1CTMA 1TY0A 4G57A 3D4DA 3CD6A 3OWFA 4KMUC 3X3NA 1YHQA 3F2UA 4A3JG 5CR3A 1PDQA 3UE0A 4GNXB 1VQMA 5J3BA 1PRTD 3S1QB 3GTOH 3F2DA 3QOJA 1J5EQ 3E9HA 2ICEC 4J6HA 5C6AA 2UU9Q 1FGUA 5C44G 2R92H 1D2BA 2D62A 4ZUJA 1CI3M 3STBC 1KAWA 2QGQA 2VZAA 5C4ZA 3J81E 4NB3A 1UE1A 4Q0FA 3ULPA 1LTSD 3DWPA 1CSPA 1II3A 2MP1A 5IT9L 4FF2A 4G4KA 4IUVA 4XDXA 1H9MA 2EY1A 1MSGA 1WOCA 1C4QA 3KLSX 5IWAL 2JN4A 2RDHA 1JMCA 4A3FG 1M8AA 2Z1CA 1BUVT 1SNCA 2X6GA 2G9HD 5E7NA 4XT3B 4X65Q 3J7A5 4A93G 5IP7H 1XNQQ 4GLAC 1CSQA 4A3BB 2H5XA 4NXMQ 2JYOA 1SSOA 4DR2L 5I6WA 1HJPA 3PO3H 4RHRA 1Q86C 1K0SA 2HCCA 3A74A 3CCMA 4U68A 2RDFA 2KEEA 2IW3A 4XYQA 1GOZA 4UPAA 1IL8A 1EQTA 1VQ5A 3C46A 4K0KQ 5KYIA 1KRSA 3PMFA 4QF4A 2HQEA 2X69A 5BN5A 1X32A 5CYUA 1Q46A 1RD9D 1PZJD 2PI2E 4RAUC 1X9NA 1ENAA 1WTHA 3A5UA 4QQBX 2JA5G 1J6QA 2E2HB 2N78A 2AQ1B 2YV5A 4LF5Q 1GJXA 3G7LA 4CDEC 1V8QA 4WFN3 4IFDI 4IOCA 4JI0Q 3HOZH 4OO1G 4A3IB 1XNQL 2L5TA 1VQ8A 1FYCA 4JBWA 1ZXTA 4DNRB 3QIAA 1DOMA 2B29A 2CKZB 2RKSA 3R2TA 5LMUQ 1HA5A 4DR2Q 2J4XA 1LYLA 2P5ZX 2ZXOA 1N33Q 2H1EA 1AP0A 4JVZA 2RCFA 3FHWA 3OSOA 1IBLQ 2KCTA 3BVGA 2Y0SB 1Q7YC 2J7ZA 2NZOA 4FF1A 1RCVD 5J22A 3W3AA 4A3JH 1KLGD 1X3GA 2L55A 4CDDC 3S15B 3C1FA 4OIJA 2LMCB 3CF5A 3A8JE 4EQ5A 2UUAL 2AQ3B 4UAIA 3SK8A 4R4QA 1GUWA 4K2LA 4DK3C 1GM5A 2B8FA 5A35A 3PIPA 4BY7H 3I2ZA 1HTLD 4JI1L 1KDBA 5G3LD 4POGA 1VQNA 3IKJA 4XTCS 2Q2UA 1O80A 1I4XA 1EY4A 3HS0C 1MD2D 2BA1A 1FJGL 3I4NH 1LUZA 3E0EA 1UEAB 1YNJC 2Z6BA 1C0AA 1IBMQ 1VQPA 1KABA 4AIMA 5DAUA 1W6JA 4H7BA 2A1AA 2VXWA 3J80E 1YZ6A 3NBIA 1E1OA 1HFNA 1N36L 2F0OA 4X64L 3RN2A 1ILQA 3AQQA 4ZQ3A 4DUYQ 1TWCH 1L0YB 2JEAI 1NNXA 1EY8A 3NTHA 4QMGA 5EBDA 4PZ7A 4KN7C 1MHWC 5EBCA 1VQHA 4APVA 5C4XH 3QG1A 4GLVB 4NXNQ 3TP8A 1SROA 2UXBL 1TS3A 4C3HH 3H91A 2VUMB 4O2DA 3IL8A 3GTQB 4CGYB 2KCCA 3DMUA 4A3EG 1HQRD 3GTJH 2MPMA 1BBWA 3AFPA 3H09A 1FL0A 3P1HA 2NVXB 4GN5A 2EOTA 3F2CA 4IFDH 1D1KA 4YWKA 2QKIC 2JA6G 1V1OA 2DNEA 3T4AC 5M5YH 3TZDA 2F0FA 3S1RH 2PNRC 3VR6A 2VQEL 2NVTB 4X3UA 3NK9A 2E2JB 2IY5B 1CHQD 3KLWA 4JI4L 1JOOA 3MZ5A 2E2IB 2CWAA 4EX5A 4CDFC 3F2BA 2A73B 4XQQA 2VNUD 4QY7A 2V1CC 1TWAB 1HZ9A 1UE6A 1WTRA 1AW7A 2F0NA 4B08A 2Q8TA 5DM63 4IO9A 1R9TH 3HKZB 2PCFB 4BXXH 4KHVA 2KBNA 3G48A 3X3MA 2R93H 3PSIA 4BBSG 2ASBA 4RCNA 1UWVA 4X62L 3RZOH 4RGOS 2N3SA 4ZUIA 3W1BA 2HUGA 4J1MA 5E4WC 4N9PA 1E24A 1SYCA 2CCZA 4J8QA 2JSOA 3D6CA 1IKLA 1QVFA 1NUCA 5C0XG 3T1YQ 5DM73 2ZM6Q 3AFQA 3HOWB 4DF7A 2YU9B 2MUYA 2EQSA 1F9SA 1JORA 5CV6A 1AZPA 2SDFA 1P8LA 5EPKA 5C4JH 2ZTEA 4KKTA 1VF5C 3GD7A 1HTPA 4QUFA 1SJHD 2PYKA 4IUUA 1I94L 1EQRA 3RN5A 1VQJA 3S14B 2F0TA 2I5HA 1KNEA 3BZKA 5ELFA 5G3LF 2QEJC 2JA6B 2A6HD 1MI2A 4R8NA 5EJWA 3NP8A 1ILPA 4IPDA 1OXVA 2K28A 4L5SA 1CA6A 4ILWA 2PMZB 2RF4A 4KHPQ 1PRTB 4XXEA 3JAMc 1SFOH 3BU2A 2K5DA 2XTIA 1AZQA 1EL0A 3S1NB 4DPGA 2EE1A 4JV5L 1JWMD 2FXQA 2PQAB 3A7LA 5D14A 4OIKA 3M4QA 5HGQA 1AE3A 2PZTA 1PHJA 3D0FA 3HOVH 4ALPA 4HJ7A 2ZJPA 4RGNA 5K36H 1V1PA 3GTMH 4RA8A 3A8IE 1I94Q 1YVCA 3NBHA 3EROA 1KXLA 1EYGA 4C3JG 2RBMA 3K0YA 4JI2Q 1A15A 1OXUA 2M00A 3D8GA 3RNUA 4YCUA 1ONLA 1U4PA 4DR5L 1IHZA 1K83B 3U58A 4LFCQ 1W2BA 1K28A 2JE6I 3CRLC 3SHLA 3I4MB 2KJXA 1B7YB 5LMNW 4PNYA 4EGVA 2UU9L 3MXNB 1V1QA 3NUCA 2WIIB 2QCPX 1Z9FA 3S14H 1VQAA 1C9OA 3PUWA 4BXXG 4CJ0B 1HCZA 1SLJA 3SEBA 3SXHA 2R93G 1TKWB 5ELEA 3KF8B 1Y69U 1NTGA 1JJCB 2J0TD 2F3IA 1GO3E 2F0WA 2RCNA 5FJ8H 3HOXG 3NWTA 3FDTA 4LF4Q 3S9WA 3NHHA 1S72A 4HIMA 1X3PA 1RDPD 1UE7A 2F0VA 4G7HC 3DM3A 3J81j 1V9PA 3D31A 4RKLA 4K2KA 5JVH3 1BCPC 2IT1A 4DXGA 4MZ9A 3PUVA 3I55A 5HY6A 3VYSA 4ID6A 4MTNA 4N9TA 2F4VQ 4A3MG 4RGTA 3QB3A 4XQNA 3CCQA 4BBSB 4DA2A 3BYTB 3E9IA 3KDFB 1WD0A 4LFBQ 1QZHA 1YBYA 5M5YB 1X3FA 1B2TA 2XNAC 2B63B 5JPMC 2A69D 2EJMA 3G71A 4E6IA 5AJ3Q 3QOLA 3KLSA 3TP7A 2NVTH 1PH1A 3PUZA 2A8VA 3KYHC 2IHFA
chains in the Genus database with same CATH topology
4EQPA 1I4RA 5BN3A 5JEAH 4KK7A 3HOUB 1R4QB 1B4OA 3J81L 2D9UA 1C8CA 3VYRA 3EQLC 2EDGA 2R93B 1E0BA 5KNDA 1CFMA 3L7ZC 1EWCA 1Z6HA 3MFYA 5LL6X 3L9AX 1XX8A 1UAPA 2QDBA 1E2ZA 2R61A 3DEPA 4BWGB 2BE5D 1JR0D 3R93A 5C5LA 2F0UA 3HOZB 1TIID 3K5MA 5K5PA 1Y1VB 1PTOH 1J8IA 5F2DA 3ITPA 4TKOB 2QF7A 3T56B 1ET9A 5C4HA 5J39A 3HOYB 1EZ6A 1ML0D 3S2HB 3MVVA 4HCEA 3PO3B 1Q8IA 4NKLA 4NP5A 3SVMA 4C3IG 1SFOB 3TBIB 3M7NA 3GTGB 2NN6H 4C3IB 1I4QA 4CKCA 1Z47A 4HEDA 1G8ZD 1K8MA 2KHSA 3E5SA 5DNFA 1FGBD 4ULLA 3HGBA 1A6XA 1EYCA 1QG7A 1TS5A 3DM1A 1TS2A 1QWYA 2EVBA 4A3GB 2NWGA 4K5WA 1TQOA 2SEBD 3A56A 2EPBA 2WINB 2F0IA 3FPUB 3GQBA 5EKKA 2O5JC 1EIGA 2XN9C 3HOXB 1OO9B 2K5WA 1DOKA 1QNUA 3P7JA 2DNCA 2DY8A 2EJFC 1QNKA 4QCLA 1LACA 1OXTA 2F0EA 4TRDA 4A3JB 3LWEA 3IFDA 3DWAA 2K6AA 1T5XD 1A3UA 4KHZA 2RDGA 5C44B 3P75A 3A7AB 3KF8A 3Q24A 2F0DA 3MTSA 1U4MA 4HSPA 3OHXC 1AFPA 5EKIA 1H9SA 1AN8A 2JA8B 1D6EC 2A6HC 5IGCA 1QCBD 1ZKOA 1TWCB 1UUPA 3U9SA 1BXTA 1SE2A 1Q1BA 2B8GA 4C1NK 1IYUA 1GUGA 1A2UA 1QOHA 1D5ZC 4RH6A 2LY7A 3PV0A 3W2DA 2WV6D 4KI0A 1H9SB 4R8IA 3MXPA 5KGUA 1H9JA 2EYPA 2KOLA 2B2WC 3T16A 2NYZD 1CHPD 1PFNA 1PTOF 4F7XA 4LMQD 1EY6A 1WD1A 5FO7B 1M4VA 3J7YW 1A2TA 3D4WA 4K8JA 1SYFA 4X3SA 5DEHA 1PXUA 4KD3A 2F3VA 4HMIA 5D3IB 4K5XA 3UI2A 4QIWB 2ZXPA 1I6HB 3R3OA 2O4XA 1EZ8A 4KJOA 1EYDA 4NMZA 4PQXA 1MSHA 5JEAG 2WB1B 1GUSA 4KY6A 3EA6A 3NE5B 1S5ED 4O42A 3AB9A 3PUYA 3GP7A 2YYZA 1DYQA 4LJZC 4RCOA 4BS9A 1JCKB 2GA4B 1I4PA 5CV7A 3U9OA 3NWSA 3OIQA 1PRTF 2EYLA 4IZ8A 2A68C 1S5BD 3GTOB 4PMWA 1F9RA 4DAYA 1O7LA 3I3CA 2NN6I 2OT2A 1I4GA 4ZK9B 1JOQA 3FPPA 3BVZA 1G91A 4DFAA 3EJIA 3V96A 5CV4A 1EYAA 4KN4C 3TSSA 2PZUA 4A3EB 1GHJA 2PW7A 4FXGC 4HMJA 2TSSA 1LTGD 4EQOA 1CZGA 4IFDG 4DXFA 3URYA 1O7ZA 4F87A 4ODGA 2X6LA 1HUNA 5E1FA 4NDXA 3HZXA 1SNQA 2EY6A 4QB4A 1BCPF 2OXPA 2BE5C 2Z4IA 1LTTD 5NUCA 1Q1EA 2B2TA 2RSOA 3EVQA 5JEAJ 2FMCA 2D5DA 1F9PA 5JVG3 4YIJA 1Q90A 3TN2A 4ABNA 1TY2A 1X3QA 2B2VC 2F0PA 4K5VA 2JA7B 3K58A 3GTPB 4V190 5A2QE 2M9VA 3ERQA 1MGSA 1YNND 3HG9A 1ESRA 2SOBA 5C4JB 4CJ1B 1G291 1EWHA 4FF3A 2A69C 2K01A 2IX3A 3KLRA 1LO5D 1ENFA 4Q5VA 1BO0A 1FNWA 1KLUD 1KDCA 4BA2I 1S5DD 3SK5A 2QILA 2E2DC 3V2TA 4ZRZA 2N55A 4U673 5IODA 3MXNA 2R7ZB 1NCVA 2EYFA 1JOKA 5CV5A 4F88A 5I9OA 1FNVA 1I6VC 3P20A 4IN3A 1XYIA 3VA5A 3I4NB 5IGEA 1GXDC 1Y8OB 3MAQA 2V4DA 2A68D 4M8AA 4MHEA 1WTWA 1FR3A 1RKNA 2B2UA 3A55A 5KEEA 2OEOA 1PTOD 2I07B 3OMCA 4Y7NB 2R3ZA 1WTPA 1TT2A 2NN6G 3M4YA 4FO2A 1EY0A 3J7AV 1JC7A 2FJ2A 2B2WA 4G7ZC 1LLRD 4DAPA 1HQMC 4HSVA 5EPLA 1TU2B 4B9WA 1F2MA 1QILA 3RMHA 1BCPB 3LWUA 3K57A 3SR1A 1G6ZA 3D6WA 5M5WB 2E76C 4C1NI 1DJRD 5I2XA 2PZWA 5FOBB 3M4OB 1NR2A 5C4XB 2AUKA 3MC0B 3MA2B 2EYMA 1Y1WB 2EXZA 3L3OC 2Z8LA 2HDMA 4K14A 3BS1A 5CC4A 1HUMA 3GTJB 4G7OC 3EFXD 3I73A 3QJYA 4BY1B 4C3HB 5D3DA 1RTNA 2F1MA 3BDOA 2HCIA 4PMBA 5LL6S 3C2PA 1BQQT 3D4RA 5I4DA 5JAVA 5I9PA 5HGTA 2NBFA 1A3TA 2PO4A 5FLXL 4R9WA 2XWBB 1SMYC 4OL7A 1G2SA 3Q0AA 2C9OA 2EY5A 3DXJC 1WTXA 1JE4A 4KKSA 1LT4D 2RVLA 2VB3X 3VYTA 3M3YB 1W6KA 1LTRD 3OW7A 1I4HA 1DOLA 1Q12A 1CK1A 1CT1D 1STHA 1SNOA 4DK0A 4K6LA 2NVQB 3E6ZX 1HRJA 2AUJD 2L1BA 1PLFA 5CBEE 4TQUS 4KY5A 5FK9C 1SYDA 3SK4A 1PTOC 1BF4A 2F0HA 4GZYC 1DONA 1SBBB 1RODA 1S4ZA 3RUZA 2RQXA 5C3XA 2ZT9C 5E4XA 5I2YA 4IFDJ 4DGZA 4L6TB 3ND9A 1VDZA 2F0MA 4C3HG 2CHBD 3AU7A 4H44C 1TWFB 4KKUA 2F0QA 4IQZA 3BDLA 1EU4A 4OO1I 4IUTA 3E0JA 2NUCA 1CQFA 2JA5B 2R6GA 1D1IA 4FP5D 1TWGB 2A5HA 3S16B 2KA7A 4A3DB 2WKCA 2AWNA 4EVOA 2B2UC 2ZXRA 1KTKA 1Z7TA 4RFBA 1R4PB 4HCSA 1EEID 3TP5A 2RSNA 1QJOA 1ZYRD 3M7GA 1LTAD 1T5EA 5COYA 2SNSA 1O7YA 1SNDA 4WRDA 2IJ0A 2HDLA 1NR4A 2XVSA 4XT1B 1G2TA 2PW5A 4KJNA 4A93B 1PZKD 3Q6SA 1PZID 1K8OA 3H3VC 1ET6A 1AEXA 1A3VA 3KBGA 1RTOA 3DHQA 2R92B 1KNAA 3VA7A 1EY9A 2RA4A 4CHTB 5TSSA 3A54A 1STYA 5E3FA 4DK1A 2JP1A 1F9QA 3VR5A 1EU3A 1Y8PB 5M3MB 2NZ1D 1B1ZA 1BBXC 2Q8IB 4I65A 5FO9B 1EOTA 1UNSA 1RF2D 3K6OA 2CQAA 2N88A 2AWOA 3RD4A 2MJ8A 5ELDA 5M9OA 4X3TA 3HRZC 3FVQA 5EKLA 5C0XI 3MXGA 2WACA 4EQNA 3KK7A 5JOBA 1SJED 3M85A 5CV8A 3R2IA 3QO2A 2H4OA 5ISRA 3BDCA 2KECA 2WP8J 3T51B 2LKVA 5BN4A 5CORA 3NTKA 3K59A 2K1BA 1ZEQX 5KNCA 3IFTA 5LHY1 5KYLA 2NVYB 1WTOA 2K04A 5IT9E 4MIUA 1SYEA 2F0KA 4X3KA 4FF4A 1WCMB 1YNNC 5C5MA 3K5NA 3KBXA 5FKAC 3GO5A 3MFGA 1VF7A 2JEBI 1DD2A 3SE0A 3TDQA 3C3LA 1HA6A 1C48A 2L11A 4ZKBB 4HN7A 4P2CB 5CBAE 4ZLTF 1PTOB 2B2TC 4Z9CB 1Y8NB 2EJGC 2D2CC 1HHVA 2XWJB 4RKBA 1FD7D 3OOCA 2F0JA 1VMPA 1FNUA 4H0LC 4IALA 1E2VA 4V0BA 3WOEA 1BDOA 1R9TB 3VR3A 3I91A 3S2DB 2KUMA 2IX1A 1OXXK 2WAQB 1IYVA 1U4RA 1JB3A 1STAA 4A3MB 4OHJA 3OIPA 1PYWD 1SNPA 4HAEA 4IUNA 5J1ZA 2FINB 4RWSC 1LT5D 3RZDB 2FHTA 1L0XB 4TSSA 1CZWA 5M3FB 2F3WA 4LAAA 4DNTB 2K05A 1CQVA 1SE4A 1TS4A 3ONAB 2KEDA 1U9RA 4LK1C 2F4IA 1DM0B 1S5FD 3GV3A 3SK6A 3V05A 3I4LA 3N52A 1LTBD 4CBVA 1IW7C 4KY7A 2L12A 2IWHA 1DXMA 4UDUC 3Q23A 1LTID 1F77A 3MWYW 3HOVB 1NSNS 2PPBC 1E2WA 3R8BA 4RHSA 2CW0C 4KTAA 1SDFA 2DY7A 4DU9A 3PIO3 3NSWA 2BCOA 3K5LA 2ICIA 4O1NA 4FYDA 1IKMA 2M2LA 4FXKC 3FRPB 1F2YA 4A3KB 1LT3D 3CKIB 2AQ2B 5I6YA 2Z4HA 3BVMA 2EYHA 2MGSA 1SMYD 2K03A 1EFID 3H0GB 2EZVA 2A6EC 3H94A 2A74C 3DWQA 2K33A 4XYOA 3HP3A 1B50A 1EQVA 4KD4A 1WVLA 3AMUA 4BY7B 1SYGA 1ICWA 1ZYRC 3I72A 3DEOA 5IGBA 1STBA 2XRSD 5IGGA 3O13A 1J9OA 5EGTA 2EY2A 4K6DA 5K36G 3NXWA 2PQEA 2EYOA 3BG3A 3PIP3 4QUCA 4CJ2C 3BZDB 3TMEA 4FXDA 1STGA 1B44D 2G9DA 2O5IC 4I7ZC 4K8IA 5CMDA 2B2YA 1LV9A 1JWUD 1KDAA 3H6MA 4CKEA 5ELBA 1PRTC 1MBYA 1BCPD 4KV6A 3CU7A 2DN8A 3S1RB 5IGDA 1XXGA 1CM9A 3JAML 2F0LA 2VB2X 3G6JB 3SDZA 1SE3A 3OWEB 1GHKA 1EY7A 1HXYD 4C56C 4IUPA 1BR9A 3T13A 3RZOB 1BNZA 3TP6A 5IOCA 2K5QA 4L63B 1GUTA 1GUNA 1DCZA 4L8JA 4ZAIA 4IUQA 3IAYA 3GTKB 1S5CD 5JPNC 2B2VA 2KQ3A 1VCIA 4ME5A 4OO1H 1V1PB 5D65A 1XWEA 1STNA 1OXSC 4NW2A 1PMRA 4XIGS 1V43A 4FVMA 1PFMA 2FFKB 1F2ZA 4H13C 1DZ1A 3N6RA 4ZYSA 2BOSA 1BOSA 1PFBA 1RJTA 3TZUA 1U4LA 3I70A 2E75C 1RHPA 1WTQA 4B9XA 3MXUA 1KAAA 2XRQD 1WTVA 4RGMA 2F03A 1JWSD 2XIWA 2L0CA 1VMCA 3J80L 4JK1C 1TWHB 3DUZA 2O2LD 2F0SA 2F0GA 2NTSA 3GTMB 3T53B 5EPJA 5EQ0A 1B53A 1D5MC 2XSCA 3LX0A 3BYYB 5IIFA 3PUXA 2NB0A 3FEWX 3C1EA 3OMGA 1D5XC 1HFGA 2LS01 1LT6D 2KCNA 5C3EB 5KIXA 1QE6A 3JAME 1H9KA 1B9MA 3ND8A 1GUOA 1SAPA 5A2QL 3NQIA 4IURA 1TR5A 3ZYYX 4FNFA 1QB5D 5FLXE 3NQTA 3CRKC 2JXMB 3Q22A 3S17B 2WKDA 4CKBA 4BA1I 2TMPA 2IPKD 1EY5A 3LNNA 1YNJD 3FMCA 4PMCA 3A8KE 1NAPA 3PO2B 1TVXA 5IGFA 2NTTA 4WORA 1SXTA 2OF1A 2IL8A 5KRUA 4HTHA 4A3FB 4C2MB 2FMMA 4XQJA 1B9NA 4BBRB 2BDOA 2BDNA 4F8MA 3K7AB 5ELCA 5CGKA 1I50B 4M1UB 2EYJA 1EIHA 2BA0A 2ENBA 4PV1C 4ZKCB 1F2LA 3VYUA 3K5OA 1B3AA 1LABA 5T1IA 3CQZB 3I8ZA 5M5XB 3RLFA 3J7AF 2Q8RE 2IX0A 2CW0D 2L9HA 2LFNA 1HPCA 4DN4M 3WDNA 1SYBA 2CVRA 1JICA 3KUPA 5C3WA 1ESFA 4MN3A 1IW7D 2E74C 4AYBB 1SEBD 2B39A 3HEJA 3MHBA 4S3SA 1SNMA 5CV9A 5HURA 3S1MB 3GV6A 3FKIB 1EEFD 2ID0A 4OGQC 5C0XH 2K32A 3VR4A 2L4NA 3QWNA 3VR2A 3WOFA 2KVMA 5T1GA 3OPOA 3GTLB 5AFWA 1JQYD 1CA5A 1XTCD 4WJWA 1Q3LA 3MEHA 3D3RA 1STEA 2SNMA 4C3JB 2K7VA 2C5CA 1H9RA 2MHVA 5FO8B 3NTIA 5KNBA 3CHBD 3NPPA 5C0XJ 1I3QB 2I46A 2B2YC 4DAVA 4HR7B 2A6ED 1O78A 1ENCA 5JJZA 3I90A 1CTMA 1TY0A 4G57A 3D4DA 3OWFA 4KMUC 3X3NA 3F2UA 5CR3A 1PDQA 3S1QB 1PRTD 3QOJA 4J6HA 2ICEC 1D2BA 5C6AA 2D62A 4ZUJA 1CI3M 5C4ZA 3J81E 4Q0FA 1LTSD 3DWPA 1II3A 2MP1A 5IT9L 4FF2A 4G4KA 4IUVA 4XDXA 1H9MA 2EY1A 1MSGA 1C4QA 3KLSX 2RDHA 1M8AA 2Z1CA 1BUVT 1SNCA 2X6GA 2G9HD 4XT3B 4A3BB 2JYOA 1SSOA 5I6WA 4RHRA 2HCCA 4U68A 2RDFA 2KEEA 2IW3A 4XYQA 1GOZA 1IL8A 1EQTA 3C46A 5KYIA 3PMFA 4QF4A 2HQEA 2X69A 5BN5A 1X32A 5CYUA 1RD9D 1PZJD 4RAUC 1ENAA 2E2HB 2AQ1B 1GJXA 3G7LA 1V8QA 4WFN3 4IFDI 4OO1G 4A3IB 2L5TA 1FYCA 4JBWA 1ZXTA 4DNRB 3QIAA 1DOMA 2RKSA 3R2TA 1HA5A 2J4XA 1AP0A 2ZXOA 2H1EA 3OSOA 3BVGA 2Y0SB 2J7ZA 4FF1A 1RCVD 5J22A 3W3AA 1KLGD 2L55A 3S15B 3C1FA 4OIJA 2LMCB 3A8JE 2AQ3B 4UAIA 3SK8A 1GUWA 4K2LA 2B8FA 5A35A 1HTLD 1KDBA 5G3LD 3IKJA 4XTCS 1O80A 1I4XA 1EY4A 3HS0C 1MD2D 2BA1A 1UEAB 1YNJC 1KABA 5DAUA 1W6JA 4H7BA 2VXWA 3J80E 3NBIA 1HFNA 2F0OA 1ILQA 4ZQ3A 2JEAI 1L0YB 1EY8A 3NTHA 4QMGA 5EBDA 4KN7C 5EBCA 3QG1A 3TP8A 1TS3A 3H91A 2VUMB 3IL8A 3GTQB 4CGYB 2KCCA 3DMUA 1HQRD 2MPMA 3H09A 2NVXB 3P1HA 2EOTA 4IFDH 1D1KA 2QKIC 1V1OA 2DNEA 3T4AC 3TZDA 2F0FA 2PNRC 3VR6A 2NVTB 4X3UA 3NK9A 2E2JB 1CHQD 1JOOA 3MZ5A 2E2IB 2A73B 4XQQA 2VNUD 1TWAB 1WTRA 1AW7A 2F0NA 4B08A 2Q8TA 5DM63 3HKZB 2PCFB 4KHVA 3X3MA 4RCNA 4RGOS 4ZUIA 2HUGA 4J1MA 5E4WC 4N9PA 1SYCA 4J8QA 2JSOA 3D6CA 1IKLA 1NUCA 5C0XG 5DM73 3HOWB 4DF7A 2YU9B 2MUYA 1F9SA 1JORA 5CV6A 1AZPA 2SDFA 5EPKA 4KKTA 1VF5C 3GD7A 1HTPA 4QUFA 1SJHD 2PYKA 4IUUA 3S14B 2F0TA 1KNEA 5ELFA 5G3LF 2QEJC 2JA6B 2A6HD 1MI2A 4R8NA 5EJWA 3NP8A 1ILPA 1OXVA 2K28A 1CA6A 4ILWA 2PMZB 1PRTB 4XXEA 2K5DA 1AZQA 1EL0A 3S1NB 2EE1A 1JWMD 3A7LA 5D14A 4OIKA 2PZTA 4RGNA 5K36H 1V1PA 4RA8A 3A8IE 3NBHA 3EROA 4C3JG 2RBMA 3K0YA 1A15A 1OXUA 2M00A 3D8GA 1ONLA 1U4PA 1IHZA 1K83B 3CRLC 2JE6I 3SHLA 3I4MB 2KJXA 4PNYA 4EGVA 3NUCA 2WIIB 2QCPX 3PUWA 4CJ0B 1HCZA 3SEBA 3SXHA 1TKWB 5ELEA 1Y69U 2J0TD 2F0WA 3NWTA 3FDTA 3S9WA 3NHHA 1X3PA 1RDPD 2F0VA 4G7HC 3D31A 4RKLA 4K2KA 5JVH3 1BCPC 2IT1A 4DXGA 3PUVA 3VYSA 4ID6A 4N9TA 4RGTA 3QB3A 4XQNA 4BBSB 4DA2A 3BYTB 1WD0A 5M5YB 1B2TA 2XNAC 2B63B 5JPMC 2A69D 2EJMA 4E6IA 3QOLA 3KLSA 3TP7A 3PUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QF4 A;  2PZT A;  3DMU A;  2HQE A;  4ODG A;  1EY6 A;  4WRD A;  4EQP A;  4WOR A;  5E1F A;  1STG A;  3P1H A;  4K5W A;  3HZX A;  1TQO A;  1SNQ A;  3MEH A;  2EY6 A;  4K8I A;  4NDX A;  2EY5 A;  3SK6 A;  2OF1 A;  2SNM A;  1A2T A;  1RKN A;  2F0I A;  4QB4 A;  5KRU A;  1ENA A;  3D4W A;  4HTH A;  4OL7 A;  4K8J A;  2OXP A;  5EKK A;  5KEE A;  4B9X A;  2OEO A;  2PW5 A;  1KAA A;  4KJN A;  1KDA A;  1SYF A;  2F0F A;  4KY7 A;  5DEH A;  3H6M A;  3OMC A;  3NK9 A;  5NUC A;  3ERO A;  4KD3 A;  1TT2 A;  4F8M A;  1U9R A;  3EVQ A;  2F3V A;  2RBM A;  1JOO A;  4HMI A;  3MZ5 A;  2M00 A;  3D8G A;  4K5X A;  1EY0 A;  1AEX A;  1NSN S;  2QDB A;  5CGK A;  1STH A;  1SNO A;  1A3V A;  2F0E A;  1ENC A;  3DHQ A;  4TRD A;  2F0S A;  2F0G A;  1IHZ A;  5IGF A;  2RKS A;  1EY9 A;  4KV6 A;  4G57 A;  4YIJ A;  3R3O A;  2O4X A;  3D4D A;  2F0N A;  2EYJ A;  1STY A;  1EZ8 A;  3OWF A;  5E3F A;  4KTA A;  4KJO A;  1A3U A;  3SHL A;  2F0P A;  4K5V A;  1EYD A;  4PNY A;  4NMZ A;  4DU9 A;  3LX0 A;  3P75 A;  2ENB A;  3OSO A;  5C5L A;  4KHV A;  5IGD A;  5CR3 A;  4RKB A;  4KY6 A;  5IIF A;  2F0U A;  3ERQ A;  3NUC A;  3C1E A;  4KY5 A;  4B9W A;  1SYD A;  3SK4 A;  1F2M A;  2F0D A;  3OMG A;  2SOB A;  4ZUI A;  3QOJ A;  5J22 A;  4I65 A;  4J6H A;  5K5P A;  5C6A A;  4J1M A;  2F0L A;  2F0J A;  3C1F A;  4N9P A;  3SXH A;  4ZUJ A;  1F2Y A;  2F0H A;  1SYC A;  4IAL A;  5F2D A;  3SR1 A;  3D6C A;  5C4Z A;  5KIX A;  1NUC A;  5M9O A;  2F0W A;  3RUZ A;  5C3X A;  5I6Y A;  3SK8 A;  3ITP A;  4K2L A;  1EY7 A;  4DF7 A;  2EYH A;  5EKL A;  1SYB A;  3S9W A;  1II3 A;  1KDC A;  3NHH A;  5CV6 A;  4DGZ A;  5IGC A;  5C4H A;  1JOR A;  2WAC A;  3T13 A;  4EQN A;  3SK5 A;  5J39 A;  5CV7 A;  3TP6 A;  2PZW A;  1TR5 A;  3U9O A;  5IOC A;  1KDB A;  5JOB A;  1EZ6 A;  2F0V A;  5CV8 A;  3MVV A;  2F0M A;  3V2T A;  2EY1 A;  1EY4 A;  2EYL A;  2PYK A;  1STA A;  4RKL A;  5I9P A;  5ISR A;  4IZ8 A;  4K2K A;  4NKL A;  3NQT A;  4NP5 A;  5C3W A;  1A2U A;  2F0Q A;  3BDC A;  5IOD A;  2F0T A;  3BDL A;  2EYM A;  2EXZ A;  1SNP A;  1KAB A;  1EQV A;  2LKV A;  1SNC A;  2KQ3 A;  4IUN A;  4KD4 A;  4ID6 A;  5DAU A;  4K14 A;  4H7B A;  5J1Z A;  4N9T A;  5CC4 A;  4R8N A;  2NUC A;  1SYG A;  3NP8 A;  3QB3 A;  1JOQ A;  5IGB A;  4ME5 A;  1STB A;  3HEJ A;  2F0O A;  5IGG A;  1STN A;  3MXP A;  2EYF A;  1JOK A;  5I6W A;  5CV5 A;  5I9O A;  3MHB A;  4S3S A;  4DFA A;  5EGT A;  5KYL A;  2KHS A;  1SNM A;  3E5S A;  4ZQ3 A;  5KGU A;  3EJI A;  5CV9 A;  4PMB A;  2EY2 A;  5HUR A;  4EVO A;  1EY5 A;  2EYP A;  1SYE A;  4MIU A;  1EYC A;  1EY8 A;  1EYA A;  2F0K A;  4K6D A;  4QMG A;  5CV4 A;  5JAV A;  2PZU A;  2RDF A;  3NXW A;  2F3W A;  2PQE A;  3T16 A;  4PMC A;  3VA5 A;  4E6I A;  1A3T A;  5HGT A;  2EYO A;  1F2Z A;  2PW7 A;  3QOL A;  4F7X A;  3TP5 A;  5IGE A;  4HMJ A;  3TP7 A;  4LAA A;  3TP8 A;  5C5M A;  2SNS A;  4EQO A;  1SND A;  3TME A;  5KYI A;  3PMF A; 
#chains in the Genus database with same CATH topology
 4EQP A;  1I4R A;  5BN3 A;  5JEA H;  4KK7 A;  3HOU B;  2YTX A;  1R4Q B;  1B4O A;  1NJI C;  2R7Z H;  4LNQ A;  3J80 c;  4LUO A;  3J81 L;  2D9U A;  1C8C A;  3VYR A;  1WFQ A;  2EDG A;  3EQL C;  2R93 B;  1E0B A;  3ZJY C;  1L2F A;  5KND A;  3HOU G;  1CFM A;  3L7Z C;  1IL2 A;  2GVB A;  3S1M H;  1EWC A;  1XTD A;  1AE2 A;  1Z6H A;  3MFY A;  1XPU A;  2ZTD A;  3L9A X;  5LL6 X;  1XX8 A;  1UAP A;  2D0P A;  1E2Z A;  2QDB A;  2R61 A;  3Q8D A;  3DEP A;  4BWG B;  4YCW A;  2BE5 D;  1HNZ L;  1JR0 D;  1T9H A;  3R93 A;  5C5L A;  1EIY B;  2F0U A;  3HOZ B;  1JB7 A;  5IE8 A;  1TII D;  4LF9 Q;  3K5M A;  1QVC A;  5K5P A;  1Y1V B;  1SRU A;  1PTO H;  1J8I A;  5F2D A;  1CUK A;  1MKH A;  3ITP A;  2MFI A;  4TKO B;  1QZG A;  2QF7 A;  3T56 B;  4DV3 Q;  1VQ4 A;  1ET9 A;  1SMX A;  5C4H A;  4DR4 L;  5J39 A;  3PO2 G;  3HOY B;  1EZ6 A;  1ML0 D;  3S2H B;  3MVV A;  4LF7 L;  4J15 A;  1IYJ B;  4HCE A;  1IBM L;  4DV1 Q;  3PO3 B;  1Q8I A;  4NKL A;  4NP5 A;  3SVM A;  4C3I G;  4HID A;  1SFO B;  3TBI B;  2PQA A;  3PQI A;  3M7N A;  3GTG B;  1AH9 A;  3NEM A;  2NN6 H;  4C3I B;  2B3G A;  1I4Q A;  4P75 A;  4CKC A;  1VQ6 A;  1Z47 A;  4A3M H;  4HED A;  1G8Z D;  1K8M A;  2KHS A;  3E5S A;  2MO0 A;  5DNF A;  1FGB D;  4ULL A;  3HGB A;  3CCV A;  1A6X A;  1EYC A;  2I5L X;  1D7Q A;  1QG7 A;  1TS5 A;  2OTJ A;  1EUJ A;  3RR5 A;  2JA5 H;  1L1O C;  3DM1 A;  3ERS X;  4R4O A;  3B6Y A;  1Q8K A;  4P74 A;  1TS2 A;  1QWY A;  4GLX A;  2EVB A;  4MTK A;  4A3G B;  2NWG A;  4DUZ L;  4K5W A;  1TQO A;  2SEB D;  2E8G A;  3A56 A;  5ELO A;  2EPB A;  2WIN B;  4BY1 H;  2F0I A;  3FPU B;  4DV5 Q;  2BH8 A;  3GQB A;  1XMQ L;  5EKK A;  2O5J C;  1HZB A;  1EIG A;  2XN9 C;  3HOX B;  1OO9 B;  3EN2 A;  2K5W A;  4IOA A;  1DOK A;  1QNU A;  3P7J A;  4LF6 Q;  2DNC A;  4A4I A;  2DY8 A;  2PMZ E;  2EJF C;  1QNK A;  3S1Q H;  4QCL A;  2BH2 A;  2UUC Q;  1OXT A;  1LAC A;  3GDE A;  1N32 Q;  1S40 A;  2F0E A;  4TRD A;  4A3J B;  3LWE A;  3IFD A;  3DWA A;  5GAH C;  4B3R L;  2K6A A;  4OON A;  1T5X D;  2PI2 A;  1A3U A;  4LFA Q;  4KHZ A;  5LMN L;  2RDG A;  5C44 B;  3P75 A;  3A7A B;  3KF8 A;  1TXY A;  3Q24 A;  1HH2 P;  4BY7 G;  2F0D A;  2R7F A;  1Y14 B;  3MTS A;  1S3O A;  3NEL A;  1U4M A;  4HSP A;  3OHX C;  3UDI A;  1AFP A;  5EKI A;  1H9S A;  3CXC A;  1AN8 A;  2JA8 B;  4GN3 B;  4DV2 L;  1D6E C;  1P16 A;  3OTO L;  2A6H C;  5IGC A;  3IRB A;  1QCB D;  1ZKO A;  1TWC B;  2UXC Q;  1L1O A;  1UUP A;  3U9S A;  1BXT A;  3U4Z A;  3S15 H;  1SE2 A;  1Q1B A;  3HOW G;  2B8G A;  4LF6 L;  4C1N K;  1IYU A;  1GUG A;  5IP7 G;  1A2U A;  3KDF A;  1QOH A;  2AKW B;  1D5Z C;  4X6A H;  1Y1V H;  4RH6 A;  2LY7 A;  3PV0 A;  4P71 A;  3W2D A;  2WV6 D;  2VS1 A;  4KI0 A;  2VW9 A;  1H9S B;  3VDY A;  1X54 A;  4R8I A;  1VQK A;  3MXP A;  5KGU A;  1RIP A;  1KRT A;  1H9J A;  3NBH B;  2EYP A;  2KOL A;  4NXM L;  2JK8 A;  3GTG H;  4PG3 A;  4AQY L;  1PH2 A;  2B2W C;  3T16 A;  2NYZ D;  2JA6 H;  1CHP D;  1PFN A;  1PTO F;  5DLQ E;  4F7X A;  5IYB H;  3TEH B;  4GOP B;  2E2J H;  1VQB A;  4LMQ D;  3WWV A;  1EY6 A;  1WD1 A;  5FO7 B;  1M4V A;  1PH5 A;  3J7Y W;  2UXC L;  1A2T A;  3D4W A;  4K8J A;  1SYF A;  4X3S A;  5DEH A;  1YI2 A;  2MQH A;  4DV4 Q;  3CCS A;  1PXU A;  2Z9H A;  4KD3 A;  1UEB A;  3GTQ H;  3HKS A;  2F3V A;  4HMI A;  4HJ8 A;  5D3I B;  4K5X A;  3UI2 A;  1EQQ A;  3K80 C;  4LF5 L;  3J7Z C;  4PZ6 A;  3H15 A;  1N8R C;  4A3L H;  1NBW A;  4QIW B;  2ZXP A;  4A3G H;  1I6H B;  1X56 A;  3R3O A;  2O4X A;  3K7U C;  4YY3 L;  1EZ8 A;  4KJO A;  3SGI A;  1EYD A;  4NMZ A;  4PQX A;  1MSH A;  4YWL A;  5JEA G;  2WB1 B;  2R7Z G;  1GUS A;  2K75 A;  4KY6 A;  4C2M H;  1GVP A;  3EA6 A;  3NE5 B;  3I4M G;  1S5E D;  1IBL L;  4O42 A;  3AB9 A;  3PUY A;  3GP7 A;  2YYZ A;  4L5R C;  4GNX A;  1DYQ A;  2WFW A;  2JJQ A;  4LJZ C;  4ZCK A;  2HT1 A;  4RCO A;  4GKK L;  4BS9 A;  4UP7 A;  1JCK B;  2UUA Q;  2GA4 B;  1I4P A;  5CV7 A;  3U9O A;  4DR1 Q;  3NWS A;  1YNX A;  3M4P A;  3FKI H;  3OIQ A;  1XMO Q;  1PRT F;  2EYL A;  2NVY H;  3S16 H;  4IZ8 A;  2A68 C;  1S5B D;  3GTO B;  1ASZ A;  5M5W H;  4PMW A;  2JA9 A;  3OYY A;  1F9R A;  4DAY A;  1HR0 L;  3I7F A;  4CDC C;  1O7L A;  4LFB L;  3I3C A;  2NN6 I;  2OT2 A;  1I4G A;  4ZK9 B;  1JOQ A;  3FPP A;  3ER0 A;  1B3Q A;  3BVZ A;  1G91 A;  4NPS A;  4DFA A;  1M1K C;  2UUB Q;  3EJI A;  1QUQ A;  2ZJR A;  3V96 A;  4LW1 A;  5GRO A;  5CV4 A;  1EYA A;  4KN4 C;  3TSS A;  2PZU A;  2K52 A;  1GD7 A;  4A3E B;  1GHJ A;  2PW7 A;  4FXG C;  1PVO A;  4HMJ A;  2TSS A;  1LTG D;  4EQO A;  1CZG A;  4IFD G;  4DXF A;  4DAY B;  3PO3 G;  3URY A;  5FLM H;  1O7Z A;  4F87 A;  5GAD C;  4GKJ Q;  4ODG A;  4LUZ A;  2X6L A;  1HUN A;  5E1F A;  4NDX A;  3CCJ A;  3HZX A;  1SNQ A;  2EY6 A;  2UXB Q;  4QB4 A;  1BCP F;  2OXP A;  2BE5 C;  2Z4I A;  1XMO L;  1LTT D;  4RMF A;  4GNX C;  1NY4 A;  5NUC A;  1Q1E A;  2B2T A;  2RSO A;  3EVQ A;  5JEA J;  2LXK A;  1HNW L;  2FMC A;  2D5D A;  1LM0 A;  1WYD A;  4JW0 A;  1Q82 C;  1F9P A;  2GVA A;  5JVG 3;  2KHI A;  4YIJ A;  2HQL A;  1Q90 A;  4LF9 L;  3TN2 A;  4ABN A;  1TY2 A;  1X3Q A;  2B2V C;  2F0P A;  4K5V A;  2JA7 B;  3K58 A;  3GTP B;  4V19 0;  4N8X 1;  5A2Q E;  2M9V A;  3ERQ A;  1MGS A;  1YNN D;  3HG9 A;  1ESR A;  2SOB A;  5C4J B;  1KIX A;  4CJ1 B;  4L5T A;  1G29 1;  1EWH A;  4FF3 A;  2A69 C;  2K01 A;  2IX3 A;  3KLR A;  1LO5 D;  1ENF A;  4Q5V A;  1K73 C;  1XNR Q;  4B3M L;  1KLU D;  1BO0 A;  1FNW A;  1I5F A;  1K3R A;  4A3K G;  1KDC A;  4BA2 I;  1S5D D;  2NVQ H;  3SK5 A;  3T1Y L;  2QIL A;  3CCL A;  1HNX L;  2E2D C;  5M3F H;  3V2T A;  4ZRZ A;  2HIX A;  2N55 A;  4U67 3;  5IOD A;  2R7D A;  3MXN A;  3AEV A;  2K50 A;  2R7Z B;  1NCV A;  1U0L A;  2EYF A;  1JOK A;  5CV5 A;  4F88 A;  5I9O A;  5BR8 L;  1FNV A;  4JCV E;  1I6V C;  5GAE C;  3W1G A;  3P20 A;  4IN3 A;  1SR3 A;  1XYI A;  3VA5 A;  1E3P A;  3I4N B;  5IGE A;  1GXD C;  4H02 A;  1J5E L;  1Y8O B;  3MAQ A;  2V4D A;  2A68 D;  1XNR L;  4M8A A;  4MHE A;  1WTW A;  3U50 C;  3KF6 B;  3NEN A;  1FR3 A;  1RKN A;  1HNX Q;  2B2U A;  3A55 A;  5KEE A;  1YJ9 A;  1K83 H;  1CKN B;  2OEO A;  1PTO D;  2HIV A;  2I07 B;  3OMC A;  4A3B G;  1N34 Q;  4Y7N B;  2UUC L;  1N32 L;  2R3Z A;  1WTP A;  1TT2 A;  3E3X A;  2NN6 G;  5IT9 c;  3M4Y A;  4FO2 A;  1EY0 A;  3J7A V;  1JC7 A;  1X6O A;  2FJ2 A;  2B2W A;  5LMN Q;  5IP9 H;  4LFA L;  4G7Z C;  1LLR D;  4DAP A;  1Y1V G;  4X66 L;  1HQM C;  2N49 A;  4HSV A;  5EPL A;  3S2D H;  1TU2 B;  3STB D;  4YCV A;  3I4O A;  4LFC L;  4A3F H;  4B9W A;  1F2M A;  1QIL A;  3M3Y H;  3RMH A;  5FJ8 G;  1XJV A;  1BCP B;  4QL5 A;  3LWU A;  3K57 A;  3SR1 A;  3G4S A;  2E2I H;  1G6Z A;  3HFZ B;  4C3I H;  3D6W A;  2K14 A;  5M5W B;  4K0K L;  2E76 C;  1PYB A;  4C1N I;  1MJE A;  1EIF A;  5FLX c;  1DJR D;  5I2X A;  2PZW A;  4WJ3 M;  5FOB B;  3H3V I;  1A63 A;  1N34 L;  4UY8 C;  3M4O B;  4A3K H;  1E22 A;  1NR2 A;  2YTY A;  5C4X B;  2AUK A;  3MC0 B;  4B3S Q;  4JI5 Q;  3MA2 B;  4A3D H;  2EYM A;  1Y1W B;  4P72 A;  2EXZ A;  5M5X H;  3L3O C;  2Z8L A;  2HDM A;  4K14 A;  3BS1 A;  4JI3 L;  1HUM A;  5CC4 A;  3GTJ B;  1H95 A;  4KLK A;  4G7O C;  2WB1 E;  4IJL A;  3EFX D;  3I73 A;  3QJY A;  4BY1 B;  4C3H B;  5D3D A;  1RTN A;  2F1M A;  3BDO A;  2HCI A;  4PMB A;  5LL6 S;  1G6P A;  3C2P A;  1BQQ T;  3D4R A;  5I4D A;  4I7A A;  4IPH A;  3TQY A;  5JAV A;  5I9P A;  5HGT A;  2NBF A;  1A3T A;  2PO4 A;  5FLX L;  4R9W A;  2XWB B;  3K0X A;  1SMY C;  4OL7 A;  5AJ3 L;  1G2S A;  3Q0A A;  3L0O A;  5IYC G;  2C9O A;  4JI8 L;  2EY5 A;  3DXJ C;  1OTC A;  1WTX A;  1JE4 A;  4KKS A;  3CCR A;  1LT4 D;  2RVL A;  2VB3 X;  3VYT A;  3CME A;  4B3S L;  3M3Y B;  1W6K A;  4OEM B;  1IZ6 A;  3KJP A;  1LTR D;  3OW7 A;  1I4H A;  1DOL A;  1Q12 A;  1CK1 A;  1CT1 D;  2D0O A;  1STH A;  1SNO A;  4DK6 C;  4DK0 A;  4K6L A;  4OWT B;  2NVQ B;  3E6Z X;  1VQC A;  1HRJ A;  4OWW B;  2AUJ D;  1HR0 W;  2L1B A;  1PLF A;  5CBE E;  4JI6 L;  4TQU S;  1VS0 A;  4KY5 A;  5FK9 C;  1SYD A;  3SK4 A;  2MNA A;  3ICE A;  1PTO C;  1BF4 A;  3CW2 C;  3CMA A;  2F0H A;  3UE1 A;  4GZY C;  1DON A;  1SBB B;  1ROD A;  4RG1 A;  4JI8 Q;  1A8V A;  2Z0S A;  1S4Z A;  2VL6 A;  3RUZ A;  2RQX A;  5C3X A;  4DR1 L;  4P73 A;  2ZT9 C;  3CCU A;  5E4X A;  5I2Y A;  4IFD J;  2JQO A;  1EWI A;  4DGZ A;  1C7Y A;  4L6T B;  3ND9 A;  1VDZ A;  2F0M A;  3J81 i;  4DV3 L;  4C3H G;  2CHB D;  3AU7 A;  4H44 C;  1TWF B;  4KKU A;  2F0Q A;  4IQZ A;  3BDL A;  3G6E A;  1EU4 A;  1MJC A;  4OO1 I;  2DUD A;  4IUT A;  3S1N H;  3E0J A;  5LMU L;  4GN4 B;  2NUC A;  1CQF A;  2Z6K C;  2R6G A;  2JA5 B;  1N33 L;  1D1I A;  4FP5 D;  2QEX A;  1SN8 A;  4A3C G;  4B3T L;  1TWG B;  4JYA Q;  1VQL A;  2A5H A;  1VQD A;  3S16 B;  2KA7 A;  2LXJ A;  4A3D B;  2WKC A;  2AWN A;  4QIW E;  2ATW A;  4EVO A;  2B2U C;  4JI7 Q;  2ZXR A;  1KTK A;  1Z7T A;  4RFB A;  1R4P B;  4HCS A;  1EEI D;  3TP5 A;  2RSN A;  1QJO A;  1ZYR D;  2CH4 W;  3M7G A;  1LTA D;  1T5E A;  5COY A;  2SNS A;  1O7Y A;  1SND A;  2PNH A;  4WRD A;  4IJH A;  2IJ0 A;  5JJI A;  2HDL A;  2ZM6 L;  4JI1 Q;  1NR4 A;  2OWO A;  4MNO A;  2XVS A;  4XT1 B;  1G2T A;  4YHH Q;  2PW5 A;  4KJN A;  4A93 B;  1A0I A;  1PZK D;  2ALY B;  3Q6S A;  5L37 A;  1PZI D;  1K8O A;  3H3V C;  1ET6 A;  1AEX A;  4O0A A;  1A3V A;  3KBG A;  1RTO A;  3DHQ A;  4DV0 Q;  2R92 B;  1N36 Q;  5C4X G;  1KL9 A;  1KNA A;  3VA7 A;  1EY9 A;  2RA4 A;  4CHT B;  5TSS A;  3JAM i;  3A54 A;  3HOU H;  1STY A;  5E3F A;  4DK1 A;  2JP1 A;  4OX9 Q;  1F9Q A;  3CC7 A;  3VR5 A;  3CPF A;  1D8L A;  3K8A A;  1EU3 A;  1Y8P B;  5M3M B;  1XPO A;  2NZ1 D;  2CH4 A;  1B1Z A;  3K7A H;  1BBX C;  2Q2H A;  4I65 A;  2Q8I B;  5FO9 B;  2JA8 G;  1EOT A;  4GS3 A;  1UNS A;  1VQ7 A;  1RF2 D;  3K6O A;  2CQA A;  2N88 A;  2AWO A;  3RD4 A;  2MJ8 A;  5ELD A;  5M9O A;  3TRZ A;  2CQO A;  4A3I H;  4X3T A;  3HRZ C;  3FVQ A;  3RLO A;  5EKL A;  5C0X I;  3MXG A;  2WAC A;  4EQN A;  1VQO A;  1JJG A;  2VQE Q;  4LF8 Q;  3KK7 A;  5JOB A;  1SJE D;  2GN5 A;  3M85 A;  5CV8 A;  3PCO B;  3R2I A;  3RLN A;  3QO2 A;  2H4O A;  4DV7 Q;  4JOI A;  5ISR A;  2K5V A;  3BDC A;  2KEC A;  2WP8 J;  3PGZ A;  3T51 B;  4UP9 A;  4DV0 L;  2LKV A;  4LWC A;  5BN4 A;  1N9W A;  5COR A;  3PO2 H;  3NTK A;  5GAG C;  3K59 A;  2K1B A;  1X65 A;  1ZEQ X;  1QVG A;  5KNC A;  3IFT A;  5LHY 1;  5KYL A;  2NVY B;  3S24 A;  1WCM G;  1WTO A;  2K04 A;  4BBR H;  5IT9 E;  4MIU A;  1SYE A;  2F0K A;  2OQK A;  4X3K A;  3S17 H;  4FF4 A;  4IPG A;  3JC6 6;  1WCM B;  1I50 H;  1YNN C;  5C5M A;  1FVI A;  4R4C A;  3K5N A;  3KBX A;  5FKA C;  5EAY A;  3GO5 A;  3MFG A;  4A75 A;  4AH6 A;  1NE3 A;  1VF7 A;  4LF8 L;  4DR3 L;  2JEB I;  4LF4 L;  1BVS A;  1DD2 A;  3SE0 A;  3TDQ A;  5H1S E;  3C3L A;  1HA6 A;  1C48 A;  2L11 A;  4ZKB B;  2NVX H;  4HN7 A;  1B8A A;  4X66 Q;  4DV4 L;  2B63 G;  2VUM H;  1G51 A;  4A3D G;  4P2C B;  5CBA E;  1VQF A;  4ZLT F;  1PTO B;  4HJA A;  2B2T C;  4Z9C B;  1Y8N B;  4JOI C;  4TVA B;  2EJG C;  2D2C C;  3HOV G;  1HHV A;  2XWJ B;  4RKB A;  4YY3 Q;  1FD7 D;  3CC2 A;  3OOC A;  3F1Z A;  2F0J A;  1VMP A;  1MIU A;  1LTL A;  1FNU A;  4H0L C;  4IAL A;  4DR6 L;  1E2V A;  4V0B A;  3WOE A;  1BDO A;  1R9T B;  3H3V H;  3VR3 A;  4DR3 Q;  1WI5 A;  3I91 A;  3S2D B;  2LSS A;  3CCE A;  4JI5 L;  2KUM A;  5IWA Q;  2IX1 A;  1TWG H;  1OXX K;  2WAQ B;  1NMF A;  1IYV A;  1U4R A;  1JB3 A;  1NMG A;  1STA A;  4A3M B;  4OHJ A;  4JI3 Q;  3OIP A;  1PYW D;  4DV6 Q;  1L1O B;  1SNP A;  4HAE A;  4IUN A;  5J1Z A;  4JPB W;  4UHV A;  2FIN B;  1YEZ A;  1K8G A;  1K0R A;  4RWS C;  3HOW H;  3GTL H;  2K5N A;  1LT5 D;  3RZD B;  2FHT A;  1HNZ Q;  3HOX H;  1YHB A;  1L0X B;  2DGY A;  4TSS A;  3HOY H;  1CZW A;  4DR7 Q;  5M3F B;  4ME3 A;  2EXD A;  2F3W A;  4DR6 Q;  4LAA A;  4DNT B;  3MEF A;  3QR8 A;  4JC0 A;  2K05 A;  4Y7N H;  1CQV A;  1SE4 A;  1TS4 A;  3ONA B;  1I3Q H;  2KED A;  1U9R A;  1PH9 A;  4LK1 C;  2F4I A;  1DM0 B;  1S5F D;  2QW7 A;  3GV3 A;  3SK6 A;  1PYS B;  3I4L A;  3N52 A;  3V05 A;  5IP9 G;  1LTB D;  4GKJ L;  4CBV A;  4Y52 H;  4R4T A;  5IYB G;  1KQS A;  1IW7 C;  4KY7 A;  2L12 A;  2IWH A;  1DXM A;  1QUQ B;  2RHQ B;  4FDB A;  3AYH B;  1KD1 C;  4UDU C;  4AYB E;  4LF7 Q;  3W5O A;  3Q23 A;  3J81 c;  4DV6 L;  1LTI D;  4DV1 L;  2JA7 H;  1F77 A;  3MWY W;  3HOV B;  5M3M H;  2F4V L;  3CP0 A;  1NSN S;  3CQZ H;  1XPR A;  2PPB C;  2OQ0 A;  1E2W A;  3R8B A;  1JE5 A;  4RHS A;  2CW0 C;  4KTA A;  1RL2 A;  1SDF A;  2DY7 A;  4DU9 A;  3PIO 3;  2HHH L;  2VUM G;  3NSW A;  2F52 A;  4YWM A;  2BCO A;  4DR7 L;  4HIO A;  4JBM A;  5IYD H;  3K5L A;  2ICI A;  4O1N A;  4FYD A;  3GTK H;  1IKM A;  2M2L A;  4FXK C;  3FRP B;  1IBK Q;  5JJK A;  1F2Y A;  4A3K B;  1LT3 D;  2Y0S G;  1K3B C;  3CKI B;  4QGU A;  2AQ2 B;  5I6Y A;  2Z4H A;  3BVM A;  4OWX B;  5M3F G;  2EYH A;  2MGS A;  1SMY D;  2K03 A;  1ASY A;  1EFI D;  3H0G B;  1FJG Q;  3I4M H;  2K4K A;  2EZV A;  2A6E C;  3H94 A;  1UE5 A;  5C44 H;  4DV5 L;  2R92 G;  2A74 C;  3DWQ A;  2K33 A;  4XYO A;  1HZC A;  2XGT A;  3A0J A;  3HP3 A;  4B3T Q;  1B50 A;  1EQV A;  4JYA L;  4KD4 A;  1WVL A;  4X64 Q;  3AMU A;  5JJL A;  3UDG A;  4BY7 B;  1SYG A;  2WB1 G;  4HJ5 A;  1ICF B;  1ICW A;  1KC8 C;  4DUY L;  1ZYR C;  3I72 A;  3DEO A;  5IGB A;  1PA6 A;  2E5L L;  2HHH Q;  1STB A;  2XRS D;  1DGS A;  5IGG A;  2KEN A;  3O13 A;  1J9O A;  5EGT A;  2OTL A;  2EY2 A;  4NXN L;  4K6D A;  5K36 G;  3NXW A;  3M4O H;  2PQE A;  2EYO A;  3BG3 A;  3PIP 3;  1K9M C;  3UDX A;  4QUC A;  4CJ2 C;  3BZD B;  3TME A;  4FXD A;  1TWH H;  2WAQ G;  3CPW A;  1STG A;  1B44 D;  2G9D A;  4K8I A;  3A5Z B;  4I7Z C;  2O5I C;  5CMD A;  4DR4 Q;  2B2Y A;  4A3B H;  4DV2 Q;  1LV9 A;  3UDF A;  4A3I G;  1JWU D;  3OTO Q;  1KDA A;  2K5H A;  3H6M A;  3CC4 A;  5IY0 A;  2VQF L;  5FLM G;  3BZC A;  4CKE A;  2CWP A;  5ELB A;  2VY3 A;  4A3C H;  1PRT C;  3ULL A;  2QA4 A;  1MBY A;  4JG2 A;  4UP8 A;  1BCP D;  4KV6 A;  3CU7 A;  5C3E H;  2DN8 A;  3T1H L;  3S1R B;  2QDL A;  4A93 H;  4X62 Q;  5IGD A;  4HJ9 A;  4JBK A;  1XXG A;  1CM9 A;  4PZ8 A;  1EOV A;  3JAM L;  1YJN A;  3H0G G;  2F0L A;  3HKZ G;  2NZH A;  2VB2 X;  1W3S A;  3G6J B;  3SDZ A;  3EIV A;  1SE3 A;  3OWE B;  1GHK A;  1EY7 A;  1JJ2 A;  3GTP H;  1HXY D;  2HD3 A;  4C56 C;  1I6H H;  4IUP A;  4DV7 L;  1BR9 A;  1Q81 C;  3T13 A;  3RZO B;  1BNZ A;  3TP6 A;  5IOC A;  2K5Q A;  4L63 B;  4R4I A;  1GUT A;  1GUN A;  1DCZ A;  4L8J A;  4JBJ A;  2VQF Q;  1M90 C;  4ZAI A;  4IUQ A;  3IAY A;  3GTK B;  1S5C D;  5JPN C;  2EIF A;  4KHP L;  2B2V A;  2KQ3 A;  1EFW A;  3T1H Q;  1VCI A;  3HOZ G;  4ME5 A;  2OCE A;  4OO1 H;  1V1P B;  5D65 A;  4GOP C;  1XWE A;  1STN A;  2ZJQ A;  4JV5 Q;  3TRE A;  1X55 A;  2AMC B;  1OXS C;  4NW2 A;  1PMR A;  1PH6 A;  2ES2 A;  4XIG S;  2AHO B;  1V43 A;  4LUV A;  4FVM A;  1PFM A;  2FFK B;  4POF A;  1F2Z A;  3M9B A;  4H13 C;  4A3L G;  5IYC H;  4WJ4 A;  1DZ1 A;  3N6R A;  4IPC A;  4ZYS A;  1VQE A;  1TWA H;  2BOS A;  2Z6K A;  1BOS A;  1WJJ A;  1PFB A;  1RJT A;  2Q2I A;  3TZU A;  1U4L A;  3I70 A;  2DJF C;  2E75 C;  1RHP A;  3FP9 A;  1PFS A;  5ELN A;  1WTQ A;  4B9X A;  3MXU A;  1KAA A;  2IHE A;  2XRQ D;  1WTV A;  3KF6 A;  4RGM A;  2F03 A;  4QJF A;  1JWS D;  2XIW A;  2L0C A;  1VMC A;  4DR5 Q;  3J80 L;  4JK1 C;  4A3E H;  1JT8 A;  3PIO A;  1TWH B;  3DUZ A;  2L15 A;  1IXR A;  1KHI A;  1E7Z A;  2G5D A;  2O2L D;  4C3J H;  2F0S A;  2F0G A;  2NTS A;  1PH4 A;  1HR0 Q;  3GTM B;  3T53 B;  4JI0 L;  5EPJ A;  4BBR G;  2KCM A;  3FKI G;  5EQ0 A;  1B53 A;  1D5M C;  2YTV A;  3OW2 A;  2XSC A;  3LX0 A;  4AQY Q;  1CKM A;  3BYY B;  5IIF A;  3PUX A;  2NB0 A;  3FEW X;  2UUB L;  3C1E A;  3OMG A;  1D5X C;  2DJG C;  1PH3 A;  1HFG A;  4JI6 Q;  2LS0 1;  2UXD L;  1LT6 D;  2KCN A;  5C3E B;  5KIX A;  1QE6 A;  3JAM E;  1H9K A;  1B9M A;  5M3M G;  3ND8 A;  4OEL B;  1GUO A;  1SAP A;  5A2Q L;  3NQI A;  4IUR A;  3EBE A;  2ZTC A;  1TR5 A;  4DAM A;  1X3E A;  3ZYY X;  4FNF A;  1QB5 D;  5FLX E;  3PF5 A;  4HIK A;  2KHJ A;  3NQT A;  3CRK C;  2JXM B;  5GQO A;  2I0Q A;  4R1J A;  2YU9 H;  1HNW Q;  3Q22 A;  3S17 B;  2WKD A;  4N8F A;  1VQI A;  1SE8 A;  2Q2T A;  4CKB A;  1B70 B;  2Y0S E;  4BA1 I;  2TMP A;  3KJO A;  1PH7 A;  2IPK D;  1EY5 A;  3LNN A;  1YNJ D;  3FMC A;  4DKA C;  4PMC A;  3A8K E;  1YJW A;  2UXD Q;  1NAP A;  4A76 A;  3PO2 B;  3DLL A;  3CAM A;  4JI7 L;  1Y1W H;  1TVX A;  5IGF A;  4GKK Q;  1BKB A;  2NTT A;  4WOR A;  3I56 A;  1SXT A;  2OF1 A;  1CKO A;  4B3M Q;  2IL8 A;  5KRU A;  4HTH A;  4A3F B;  3I4N G;  3KOJ A;  4C2M B;  1L0W A;  2FMM A;  4XQJ A;  1B9N A;  4BBR B;  2BDO A;  1PV4 A;  2A19 A;  2BDN A;  4F8M A;  4YHH L;  2WAQ E;  2RHS B;  1YIJ A;  3K7A B;  5ELC A;  5CGK A;  1I50 B;  4JI4 Q;  4M1U B;  2EYJ A;  1EIH A;  2BA0 A;  2ENB A;  4PV1 C;  4ZKC B;  2JA8 H;  1F2L A;  3VYU A;  5BR8 Q;  1IBK L;  1HZA A;  3K5O A;  1CKN A;  4OX9 L;  3LGJ A;  3ULJ A;  1B3A A;  1LAB A;  5T1I A;  3CQZ B;  3I8Z A;  5M5X B;  3RLF A;  3J7A F;  2Q8R E;  1K8A C;  2IX0 A;  2CW0 D;  2L9H A;  2LFN A;  3J80 i;  3L2P A;  1HPC A;  4DN4 M;  3WDN A;  3RZD H;  1YIT A;  1SYB A;  4DNI A;  2CVR A;  4GOP A;  1JIC A;  4L5Q A;  3U4V A;  3KUP A;  5C3W A;  1ESF A;  3PF4 A;  4MN3 A;  1IW7 D;  3HOY G;  2E5L Q;  1U5K A;  1O7I A;  1VQG A;  2E74 C;  4OXP A;  3TS0 A;  4AYB B;  1SEB D;  2MO1 A;  1WCM H;  3H0G H;  2B39 A;  3S2H H;  3HEJ A;  1GKH A;  3MHB A;  4S3S A;  3TS2 A;  1PH8 A;  1SNM A;  2E2H H;  4AYB G;  5CV9 A;  5HUR A;  5C3E G;  3S1M B;  3GV6 A;  1YHA A;  3FKI B;  1EEF D;  2ID0 A;  4OGQ C;  5C0X H;  2K32 A;  3HKZ E;  1TWF H;  4DUZ Q;  3VR4 A;  3K81 C;  2L4N A;  3QWN A;  3VR2 A;  3F8T A;  3WOF A;  2KVM A;  5T1G A;  3OPO A;  1VQ9 A;  3GTL B;  2N8N A;  5AFW A;  2JA7 G;  1JQY D;  1XMQ Q;  1CA5 A;  1XTC D;  4WJW A;  3BJU A;  1Q3L A;  2C35 B;  3MEH A;  1Y1W G;  4BBS H;  2CFM A;  3D3R A;  1STE A;  2SNM A;  4C3J B;  2K7V A;  2C5C A;  1H9R A;  2MHV A;  1E1T A;  5FO8 B;  4A3G G;  3NTI A;  5KNB A;  3CHB D;  4BY1 G;  3NPP A;  3KFU A;  1A62 A;  5C0X J;  2B63 H;  1I3Q B;  2I46 A;  2B2Y C;  4DAV A;  4HR7 B;  2A6E D;  1O78 A;  5IYD G;  4B3R Q;  1BBU A;  1ENC A;  2I5M X;  5JJZ A;  3I90 A;  4X65 L;  4JI2 L;  1CTM A;  1TY0 A;  4G57 A;  3D4D A;  3CD6 A;  3OWF A;  4KMU C;  3X3N A;  1YHQ A;  3F2U A;  4A3J G;  5CR3 A;  1PDQ A;  3UE0 A;  4GNX B;  1VQM A;  5J3B A;  1PRT D;  3S1Q B;  3GTO H;  3F2D A;  3QOJ A;  1J5E Q;  3E9H A;  2ICE C;  4J6H A;  5C6A A;  2UU9 Q;  1FGU A;  5C44 G;  2R92 H;  1D2B A;  2D62 A;  4ZUJ A;  1CI3 M;  3STB C;  1KAW A;  2QGQ A;  2VZA A;  5C4Z A;  3J81 E;  4NB3 A;  1UE1 A;  4Q0F A;  3ULP A;  1LTS D;  3DWP A;  1CSP A;  1II3 A;  2MP1 A;  5IT9 L;  4FF2 A;  4G4K A;  4IUV A;  4XDX A;  1H9M A;  2EY1 A;  1MSG A;  1WOC A;  1C4Q A;  3KLS X;  5IWA L;  2JN4 A;  2RDH A;  1JMC A;  4A3F G;  1M8A A;  2Z1C A;  1BUV T;  1SNC A;  2X6G A;  2G9H D;  5E7N A;  4XT3 B;  4X65 Q;  3J7A 5;  4A93 G;  5IP7 H;  1XNQ Q;  4GLA C;  1CSQ A;  4A3B B;  2H5X A;  4NXM Q;  2JYO A;  1SSO A;  4DR2 L;  5I6W A;  1HJP A;  3PO3 H;  4RHR A;  1Q86 C;  1K0S A;  2HCC A;  3A74 A;  3CCM A;  4U68 A;  2RDF A;  2KEE A;  2IW3 A;  4XYQ A;  1GOZ A;  4UPA A;  1IL8 A;  1EQT A;  1VQ5 A;  3C46 A;  4K0K Q;  5KYI A;  1KRS A;  3PMF A;  4QF4 A;  2HQE A;  2X69 A;  5BN5 A;  1X32 A;  5CYU A;  1Q46 A;  1RD9 D;  1PZJ D;  2PI2 E;  4RAU C;  1X9N A;  1ENA A;  1WTH A;  3A5U A;  4QQB X;  2JA5 G;  1J6Q A;  2E2H B;  2N78 A;  2AQ1 B;  2YV5 A;  4LF5 Q;  1GJX A;  3G7L A;  4CDE C;  1V8Q A;  4WFN 3;  4IFD I;  4IOC A;  4JI0 Q;  3HOZ H;  4OO1 G;  4A3I B;  1XNQ L;  2L5T A;  1VQ8 A;  1FYC A;  4JBW A;  1ZXT A;  4DNR B;  3QIA A;  1DOM A;  2B29 A;  2CKZ B;  2RKS A;  3R2T A;  5LMU Q;  1HA5 A;  4DR2 Q;  2J4X A;  1LYL A;  2P5Z X;  2ZXO A;  1N33 Q;  2H1E A;  1AP0 A;  4JVZ A;  2RCF A;  3FHW A;  3OSO A;  1IBL Q;  2KCT A;  3BVG A;  2Y0S B;  1Q7Y C;  2J7Z A;  2NZO A;  4FF1 A;  1RCV D;  5J22 A;  3W3A A;  4A3J H;  1KLG D;  1X3G A;  2L55 A;  4CDD C;  3S15 B;  3C1F A;  4OIJ A;  2LMC B;  3CF5 A;  3A8J E;  4EQ5 A;  2UUA L;  2AQ3 B;  4UAI A;  3SK8 A;  4R4Q A;  1GUW A;  4K2L A;  4DK3 C;  1GM5 A;  2B8F A;  5A35 A;  3PIP A;  4BY7 H;  3I2Z A;  1HTL D;  4JI1 L;  1KDB A;  5G3L D;  4POG A;  1VQN A;  3IKJ A;  4XTC S;  2Q2U A;  1O80 A;  1I4X A;  1EY4 A;  3HS0 C;  1MD2 D;  2BA1 A;  1FJG L;  3I4N H;  1LUZ A;  3E0E A;  1UEA B;  1YNJ C;  2Z6B A;  1C0A A;  1IBM Q;  1VQP A;  1KAB A;  4AIM A;  5DAU A;  1W6J A;  4H7B A;  2A1A A;  2VXW A;  3J80 E;  1YZ6 A;  3NBI A;  1E1O A;  1HFN A;  1N36 L;  2F0O A;  4X64 L;  3RN2 A;  1ILQ A;  3AQQ A;  4ZQ3 A;  4DUY Q;  1TWC H;  1L0Y B;  2JEA I;  1NNX A;  1EY8 A;  3NTH A;  4QMG A;  5EBD A;  4PZ7 A;  4KN7 C;  1MHW C;  5EBC A;  1VQH A;  4APV A;  5C4X H;  3QG1 A;  4GLV B;  4NXN Q;  3TP8 A;  1SRO A;  2UXB L;  1TS3 A;  4C3H H;  3H91 A;  2VUM B;  4O2D A;  3IL8 A;  3GTQ B;  4CGY B;  2KCC A;  3DMU A;  4A3E G;  1HQR D;  3GTJ H;  2MPM A;  1BBW A;  3AFP A;  3H09 A;  1FL0 A;  3P1H A;  2NVX B;  4GN5 A;  2EOT A;  3F2C A;  4IFD H;  1D1K A;  4YWK A;  2QKI C;  2JA6 G;  1V1O A;  2DNE A;  3T4A C;  5M5Y H;  3TZD A;  2F0F A;  3S1R H;  2PNR C;  3VR6 A;  2VQE L;  2NVT B;  4X3U A;  3NK9 A;  2E2J B;  2IY5 B;  1CHQ D;  3KLW A;  4JI4 L;  1JOO A;  3MZ5 A;  2E2I B;  2CWA A;  4EX5 A;  4CDF C;  3F2B A;  2A73 B;  4XQQ A;  2VNU D;  4QY7 A;  2V1C C;  1TWA B;  1HZ9 A;  1UE6 A;  1WTR A;  1AW7 A;  2F0N A;  4B08 A;  2Q8T A;  5DM6 3;  4IO9 A;  1R9T H;  3HKZ B;  2PCF B;  4BXX H;  4KHV A;  2KBN A;  3G48 A;  3X3M A;  2R93 H;  3PSI A;  4BBS G;  2ASB A;  4RCN A;  1UWV A;  4X62 L;  3RZO H;  4RGO S;  2N3S A;  4ZUI A;  3W1B A;  2HUG A;  4J1M A;  5E4W C;  4N9P A;  1E24 A;  1SYC A;  2CCZ A;  4J8Q A;  2JSO A;  3D6C A;  1IKL A;  1QVF A;  1NUC A;  5C0X G;  3T1Y Q;  5DM7 3;  2ZM6 Q;  3AFQ A;  3HOW B;  4DF7 A;  2YU9 B;  2MUY A;  2EQS A;  1F9S A;  1JOR A;  5CV6 A;  1AZP A;  2SDF A;  1P8L A;  5EPK A;  5C4J H;  2ZTE A;  4KKT A;  1VF5 C;  3GD7 A;  1HTP A;  4QUF A;  1SJH D;  2PYK A;  4IUU A;  1I94 L;  1EQR A;  3RN5 A;  1VQJ A;  3S14 B;  2F0T A;  2I5H A;  1KNE A;  3BZK A;  5ELF A;  5G3L F;  2QEJ C;  2JA6 B;  2A6H D;  1MI2 A;  4R8N A;  5EJW A;  3NP8 A;  1ILP A;  4IPD A;  1OXV A;  2K28 A;  4L5S A;  1CA6 A;  4ILW A;  2PMZ B;  2RF4 A;  4KHP Q;  1PRT B;  4XXE A;  3JAM c;  1SFO H;  3BU2 A;  2K5D A;  2XTI A;  1AZQ A;  1EL0 A;  3S1N B;  4DPG A;  2EE1 A;  4JV5 L;  1JWM D;  2FXQ A;  2PQA B;  3A7L A;  5D14 A;  4OIK A;  3M4Q A;  5HGQ A;  1AE3 A;  2PZT A;  1PHJ A;  3D0F A;  3HOV H;  4ALP A;  4HJ7 A;  2ZJP A;  4RGN A;  5K36 H;  1V1P A;  3GTM H;  4RA8 A;  3A8I E;  1I94 Q;  1YVC A;  3NBH A;  3ERO A;  1KXL A;  1EYG A;  4C3J G;  2RBM A;  3K0Y A;  4JI2 Q;  1A15 A;  1OXU A;  2M00 A;  3D8G A;  3RNU A;  4YCU A;  1ONL A;  1U4P A;  4DR5 L;  1IHZ A;  1K83 B;  3U58 A;  4LFC Q;  1W2B A;  1K28 A;  2JE6 I;  3CRL C;  3SHL A;  3I4M B;  2KJX A;  1B7Y B;  5LMN W;  4PNY A;  4EGV A;  2UU9 L;  3MXN B;  1V1Q A;  3NUC A;  2WII B;  2QCP X;  1Z9F A;  3S14 H;  1VQA A;  1C9O A;  3PUW A;  4BXX G;  4CJ0 B;  1HCZ A;  1SLJ A;  3SEB A;  3SXH A;  2R93 G;  1TKW B;  5ELE A;  3KF8 B;  1Y69 U;  1NTG A;  1JJC B;  2J0T D;  2F3I A;  1GO3 E;  2F0W A;  2RCN A;  5FJ8 H;  3HOX G;  3NWT A;  3FDT A;  4LF4 Q;  3S9W A;  3NHH A;  1S72 A;  4HIM A;  1X3P A;  1RDP D;  1UE7 A;  2F0V A;  4G7H C;  3DM3 A;  3J81 j;  1V9P A;  3D31 A;  4RKL A;  4K2K A;  5JVH 3;  1BCP C;  2IT1 A;  4DXG A;  4MZ9 A;  3PUV A;  3I55 A;  5HY6 A;  3VYS A;  4ID6 A;  4MTN A;  4N9T A;  2F4V Q;  4A3M G;  4RGT A;  3QB3 A;  4XQN A;  3CCQ A;  4BBS B;  4DA2 A;  3BYT B;  3E9I A;  3KDF B;  1WD0 A;  4LFB Q;  1QZH A;  1YBY A;  5M5Y B;  1X3F A;  1B2T A;  2XNA C;  2B63 B;  5JPM C;  2A69 D;  2EJM A;  3G71 A;  4E6I A;  5AJ3 Q;  3QOL A;  3KLS A;  3TP7 A;  2NVT H;  1PH1 A;  3PUZ A;  2A8V A;  3KYH C;  2IHF A; 
#chains in the Genus database with same CATH homology
 4EQP A;  1I4R A;  5BN3 A;  5JEA H;  4KK7 A;  3HOU B;  1R4Q B;  1B4O A;  3J81 L;  2D9U A;  1C8C A;  3VYR A;  3EQL C;  2EDG A;  2R93 B;  1E0B A;  5KND A;  1CFM A;  3L7Z C;  1EWC A;  1Z6H A;  3MFY A;  5LL6 X;  3L9A X;  1XX8 A;  1UAP A;  2QDB A;  1E2Z A;  2R61 A;  3DEP A;  4BWG B;  2BE5 D;  1JR0 D;  3R93 A;  5C5L A;  2F0U A;  3HOZ B;  1TII D;  3K5M A;  5K5P A;  1Y1V B;  1PTO H;  1J8I A;  5F2D A;  3ITP A;  4TKO B;  2QF7 A;  3T56 B;  1ET9 A;  5C4H A;  5J39 A;  3HOY B;  1EZ6 A;  1ML0 D;  3S2H B;  3MVV A;  4HCE A;  3PO3 B;  1Q8I A;  4NKL A;  4NP5 A;  3SVM A;  4C3I G;  1SFO B;  3TBI B;  3M7N A;  3GTG B;  2NN6 H;  4C3I B;  1I4Q A;  4CKC A;  1Z47 A;  4HED A;  1G8Z D;  1K8M A;  2KHS A;  3E5S A;  5DNF A;  1FGB D;  4ULL A;  3HGB A;  1A6X A;  1EYC A;  1QG7 A;  1TS5 A;  3DM1 A;  1TS2 A;  1QWY A;  2EVB A;  4A3G B;  2NWG A;  4K5W A;  1TQO A;  2SEB D;  3A56 A;  2EPB A;  2WIN B;  2F0I A;  3FPU B;  3GQB A;  5EKK A;  2O5J C;  1EIG A;  2XN9 C;  3HOX B;  1OO9 B;  2K5W A;  1DOK A;  1QNU A;  3P7J A;  2DNC A;  2DY8 A;  2EJF C;  1QNK A;  4QCL A;  1LAC A;  1OXT A;  2F0E A;  4TRD A;  4A3J B;  3LWE A;  3IFD A;  3DWA A;  2K6A A;  1T5X D;  1A3U A;  4KHZ A;  2RDG A;  5C44 B;  3P75 A;  3A7A B;  3KF8 A;  3Q24 A;  2F0D A;  3MTS A;  1U4M A;  4HSP A;  3OHX C;  1AFP A;  5EKI A;  1H9S A;  1AN8 A;  2JA8 B;  1D6E C;  2A6H C;  5IGC A;  1QCB D;  1ZKO A;  1TWC B;  1UUP A;  3U9S A;  1BXT A;  1SE2 A;  1Q1B A;  2B8G A;  4C1N K;  1IYU A;  1GUG A;  1A2U A;  1QOH A;  1D5Z C;  4RH6 A;  2LY7 A;  3PV0 A;  3W2D A;  2WV6 D;  4KI0 A;  1H9S B;  4R8I A;  3MXP A;  5KGU A;  1H9J A;  2EYP A;  2KOL A;  2B2W C;  3T16 A;  2NYZ D;  1CHP D;  1PFN A;  1PTO F;  4F7X A;  4LMQ D;  1EY6 A;  1WD1 A;  5FO7 B;  1M4V A;  3J7Y W;  1A2T A;  3D4W A;  4K8J A;  1SYF A;  4X3S A;  5DEH A;  1PXU A;  4KD3 A;  2F3V A;  4HMI A;  5D3I B;  4K5X A;  3UI2 A;  4QIW B;  2ZXP A;  1I6H B;  3R3O A;  2O4X A;  1EZ8 A;  4KJO A;  1EYD A;  4NMZ A;  4PQX A;  1MSH A;  5JEA G;  2WB1 B;  1GUS A;  4KY6 A;  3EA6 A;  3NE5 B;  1S5E D;  4O42 A;  3AB9 A;  3PUY A;  3GP7 A;  2YYZ A;  1DYQ A;  4LJZ C;  4RCO A;  4BS9 A;  1JCK B;  2GA4 B;  1I4P A;  5CV7 A;  3U9O A;  3NWS A;  3OIQ A;  1PRT F;  2EYL A;  4IZ8 A;  2A68 C;  1S5B D;  3GTO B;  4PMW A;  1F9R A;  4DAY A;  1O7L A;  3I3C A;  2NN6 I;  2OT2 A;  1I4G A;  4ZK9 B;  1JOQ A;  3FPP A;  3BVZ A;  1G91 A;  4DFA A;  3EJI A;  3V96 A;  5CV4 A;  1EYA A;  4KN4 C;  3TSS A;  2PZU A;  4A3E B;  1GHJ A;  2PW7 A;  4FXG C;  4HMJ A;  2TSS A;  1LTG D;  4EQO A;  1CZG A;  4IFD G;  4DXF A;  3URY A;  1O7Z A;  4F87 A;  4ODG A;  2X6L A;  1HUN A;  5E1F A;  4NDX A;  3HZX A;  1SNQ A;  2EY6 A;  4QB4 A;  1BCP F;  2OXP A;  2BE5 C;  2Z4I A;  1LTT D;  5NUC A;  1Q1E A;  2B2T A;  2RSO A;  3EVQ A;  5JEA J;  2FMC A;  2D5D A;  1F9P A;  5JVG 3;  4YIJ A;  1Q90 A;  3TN2 A;  4ABN A;  1TY2 A;  1X3Q A;  2B2V C;  2F0P A;  4K5V A;  2JA7 B;  3K58 A;  3GTP B;  4V19 0;  5A2Q E;  2M9V A;  3ERQ A;  1MGS A;  1YNN D;  3HG9 A;  1ESR A;  2SOB A;  5C4J B;  4CJ1 B;  1G29 1;  1EWH A;  4FF3 A;  2A69 C;  2K01 A;  2IX3 A;  3KLR A;  1LO5 D;  1ENF A;  4Q5V A;  1BO0 A;  1FNW A;  1KLU D;  1KDC A;  4BA2 I;  1S5D D;  3SK5 A;  2QIL A;  2E2D C;  3V2T A;  4ZRZ A;  2N55 A;  4U67 3;  5IOD A;  3MXN A;  2R7Z B;  1NCV A;  2EYF A;  1JOK A;  5CV5 A;  4F88 A;  5I9O A;  1FNV A;  1I6V C;  3P20 A;  4IN3 A;  1XYI A;  3VA5 A;  3I4N B;  5IGE A;  1GXD C;  1Y8O B;  3MAQ A;  2V4D A;  2A68 D;  4M8A A;  4MHE A;  1WTW A;  1FR3 A;  1RKN A;  2B2U A;  3A55 A;  5KEE A;  2OEO A;  1PTO D;  2I07 B;  3OMC A;  4Y7N B;  2R3Z A;  1WTP A;  1TT2 A;  2NN6 G;  3M4Y A;  4FO2 A;  1EY0 A;  3J7A V;  1JC7 A;  2FJ2 A;  2B2W A;  4G7Z C;  1LLR D;  4DAP A;  1HQM C;  4HSV A;  5EPL A;  1TU2 B;  4B9W A;  1F2M A;  1QIL A;  3RMH A;  1BCP B;  3LWU A;  3K57 A;  3SR1 A;  1G6Z A;  3D6W A;  5M5W B;  2E76 C;  4C1N I;  1DJR D;  5I2X A;  2PZW A;  5FOB B;  3M4O B;  1NR2 A;  5C4X B;  2AUK A;  3MC0 B;  3MA2 B;  2EYM A;  1Y1W B;  2EXZ A;  3L3O C;  2Z8L A;  2HDM A;  4K14 A;  3BS1 A;  5CC4 A;  1HUM A;  3GTJ B;  4G7O C;  3EFX D;  3I73 A;  3QJY A;  4BY1 B;  4C3H B;  5D3D A;  1RTN A;  2F1M A;  3BDO A;  2HCI A;  4PMB A;  5LL6 S;  3C2P A;  1BQQ T;  3D4R A;  5I4D A;  5JAV A;  5I9P A;  5HGT A;  2NBF A;  1A3T A;  2PO4 A;  5FLX L;  4R9W A;  2XWB B;  1SMY C;  4OL7 A;  1G2S A;  3Q0A A;  2C9O A;  2EY5 A;  3DXJ C;  1WTX A;  1JE4 A;  4KKS A;  1LT4 D;  2RVL A;  2VB3 X;  3VYT A;  3M3Y B;  1W6K A;  1LTR D;  3OW7 A;  1I4H A;  1DOL A;  1Q12 A;  1CK1 A;  1CT1 D;  1STH A;  1SNO A;  4DK0 A;  4K6L A;  2NVQ B;  3E6Z X;  1HRJ A;  2AUJ D;  2L1B A;  1PLF A;  5CBE E;  4TQU S;  4KY5 A;  5FK9 C;  1SYD A;  3SK4 A;  1PTO C;  1BF4 A;  2F0H A;  4GZY C;  1DON A;  1SBB B;  1ROD A;  1S4Z A;  3RUZ A;  2RQX A;  5C3X A;  2ZT9 C;  5E4X A;  5I2Y A;  4IFD J;  4DGZ A;  4L6T B;  3ND9 A;  1VDZ A;  2F0M A;  4C3H G;  2CHB D;  3AU7 A;  4H44 C;  1TWF B;  4KKU A;  2F0Q A;  4IQZ A;  3BDL A;  1EU4 A;  4OO1 I;  4IUT A;  3E0J A;  2NUC A;  1CQF A;  2JA5 B;  2R6G A;  1D1I A;  4FP5 D;  1TWG B;  2A5H A;  3S16 B;  2KA7 A;  4A3D B;  2WKC A;  2AWN A;  4EVO A;  2B2U C;  2ZXR A;  1KTK A;  1Z7T A;  4RFB A;  1R4P B;  4HCS A;  1EEI D;  3TP5 A;  2RSN A;  1QJO A;  1ZYR D;  3M7G A;  1LTA D;  1T5E A;  5COY A;  2SNS A;  1O7Y A;  1SND A;  4WRD A;  2IJ0 A;  2HDL A;  1NR4 A;  2XVS A;  4XT1 B;  1G2T A;  2PW5 A;  4KJN A;  4A93 B;  1PZK D;  3Q6S A;  1PZI D;  1K8O A;  3H3V C;  1ET6 A;  1AEX A;  1A3V A;  3KBG A;  1RTO A;  3DHQ A;  2R92 B;  1KNA A;  3VA7 A;  1EY9 A;  2RA4 A;  4CHT B;  5TSS A;  3A54 A;  1STY A;  5E3F A;  4DK1 A;  2JP1 A;  1F9Q A;  3VR5 A;  1EU3 A;  1Y8P B;  5M3M B;  2NZ1 D;  1B1Z A;  1BBX C;  2Q8I B;  4I65 A;  5FO9 B;  1EOT A;  1UNS A;  1RF2 D;  3K6O A;  2CQA A;  2N88 A;  2AWO A;  3RD4 A;  2MJ8 A;  5ELD A;  5M9O A;  4X3T A;  3HRZ C;  3FVQ A;  5EKL A;  5C0X I;  3MXG A;  2WAC A;  4EQN A;  3KK7 A;  5JOB A;  1SJE D;  3M85 A;  5CV8 A;  3R2I A;  3QO2 A;  2H4O A;  5ISR A;  3BDC A;  2KEC A;  2WP8 J;  3T51 B;  2LKV A;  5BN4 A;  5COR A;  3NTK A;  3K59 A;  2K1B A;  1ZEQ X;  5KNC A;  3IFT A;  5LHY 1;  5KYL A;  2NVY B;  1WTO A;  2K04 A;  5IT9 E;  4MIU A;  1SYE A;  2F0K A;  4X3K A;  4FF4 A;  1WCM B;  1YNN C;  5C5M A;  3K5N A;  3KBX A;  5FKA C;  3GO5 A;  3MFG A;  1VF7 A;  2JEB I;  1DD2 A;  3SE0 A;  3TDQ A;  3C3L A;  1HA6 A;  1C48 A;  2L11 A;  4ZKB B;  4HN7 A;  4P2C B;  5CBA E;  4ZLT F;  1PTO B;  2B2T C;  4Z9C B;  1Y8N B;  2EJG C;  2D2C C;  1HHV A;  2XWJ B;  4RKB A;  1FD7 D;  3OOC A;  2F0J A;  1VMP A;  1FNU A;  4H0L C;  4IAL A;  1E2V A;  4V0B A;  3WOE A;  1BDO A;  1R9T B;  3VR3 A;  3I91 A;  3S2D B;  2KUM A;  2IX1 A;  1OXX K;  2WAQ B;  1IYV A;  1U4R A;  1JB3 A;  1STA A;  4A3M B;  4OHJ A;  3OIP A;  1PYW D;  1SNP A;  4HAE A;  4IUN A;  5J1Z A;  2FIN B;  4RWS C;  1LT5 D;  3RZD B;  2FHT A;  1L0X B;  4TSS A;  1CZW A;  5M3F B;  2F3W A;  4LAA A;  4DNT B;  2K05 A;  1CQV A;  1SE4 A;  1TS4 A;  3ONA B;  2KED A;  1U9R A;  4LK1 C;  2F4I A;  1DM0 B;  1S5F D;  3GV3 A;  3SK6 A;  3V05 A;  3I4L A;  3N52 A;  1LTB D;  4CBV A;  1IW7 C;  4KY7 A;  2L12 A;  2IWH A;  1DXM A;  4UDU C;  3Q23 A;  1LTI D;  1F77 A;  3MWY W;  3HOV B;  1NSN S;  2PPB C;  1E2W A;  3R8B A;  4RHS A;  2CW0 C;  4KTA A;  1SDF A;  2DY7 A;  4DU9 A;  3PIO 3;  3NSW A;  2BCO A;  3K5L A;  2ICI A;  4O1N A;  4FYD A;  1IKM A;  2M2L A;  4FXK C;  3FRP B;  1F2Y A;  4A3K B;  1LT3 D;  3CKI B;  2AQ2 B;  5I6Y A;  2Z4H A;  3BVM A;  2EYH A;  2MGS A;  1SMY D;  2K03 A;  1EFI D;  3H0G B;  2EZV A;  2A6E C;  3H94 A;  2A74 C;  3DWQ A;  2K33 A;  4XYO A;  3HP3 A;  1B50 A;  1EQV A;  4KD4 A;  1WVL A;  3AMU A;  4BY7 B;  1SYG A;  1ICW A;  1ZYR C;  3I72 A;  3DEO A;  5IGB A;  1STB A;  2XRS D;  5IGG A;  3O13 A;  1J9O A;  5EGT A;  2EY2 A;  4K6D A;  5K36 G;  3NXW A;  2PQE A;  2EYO A;  3BG3 A;  3PIP 3;  4QUC A;  4CJ2 C;  3BZD B;  3TME A;  4FXD A;  1STG A;  1B44 D;  2G9D A;  2O5I C;  4I7Z C;  4K8I A;  5CMD A;  2B2Y A;  1LV9 A;  1JWU D;  1KDA A;  3H6M A;  4CKE A;  5ELB A;  1PRT C;  1MBY A;  1BCP D;  4KV6 A;  3CU7 A;  2DN8 A;  3S1R B;  5IGD A;  1XXG A;  1CM9 A;  3JAM L;  2F0L A;  2VB2 X;  3G6J B;  3SDZ A;  1SE3 A;  3OWE B;  1GHK A;  1EY7 A;  1HXY D;  4C56 C;  4IUP A;  1BR9 A;  3T13 A;  3RZO B;  1BNZ A;  3TP6 A;  5IOC A;  2K5Q A;  4L63 B;  1GUT A;  1GUN A;  1DCZ A;  4L8J A;  4ZAI A;  4IUQ A;  3IAY A;  3GTK B;  1S5C D;  5JPN C;  2B2V A;  2KQ3 A;  1VCI A;  4ME5 A;  4OO1 H;  1V1P B;  5D65 A;  1XWE A;  1STN A;  1OXS C;  4NW2 A;  1PMR A;  4XIG S;  1V43 A;  4FVM A;  1PFM A;  2FFK B;  1F2Z A;  4H13 C;  1DZ1 A;  3N6R A;  4ZYS A;  2BOS A;  1BOS A;  1PFB A;  1RJT A;  3TZU A;  1U4L A;  3I70 A;  2E75 C;  1RHP A;  1WTQ A;  4B9X A;  3MXU A;  1KAA A;  2XRQ D;  1WTV A;  4RGM A;  2F03 A;  1JWS D;  2XIW A;  2L0C A;  1VMC A;  3J80 L;  4JK1 C;  1TWH B;  3DUZ A;  2O2L D;  2F0S A;  2F0G A;  2NTS A;  3GTM B;  3T53 B;  5EPJ A;  5EQ0 A;  1B53 A;  1D5M C;  2XSC A;  3LX0 A;  3BYY B;  5IIF A;  3PUX A;  2NB0 A;  3FEW X;  3C1E A;  3OMG A;  1D5X C;  1HFG A;  2LS0 1;  1LT6 D;  2KCN A;  5C3E B;  5KIX A;  1QE6 A;  3JAM E;  1H9K A;  1B9M A;  3ND8 A;  1GUO A;  1SAP A;  5A2Q L;  3NQI A;  4IUR A;  1TR5 A;  3ZYY X;  4FNF A;  1QB5 D;  5FLX E;  3NQT A;  3CRK C;  2JXM B;  3Q22 A;  3S17 B;  2WKD A;  4CKB A;  4BA1 I;  2TMP A;  2IPK D;  1EY5 A;  3LNN A;  1YNJ D;  3FMC A;  4PMC A;  3A8K E;  1NAP A;  3PO2 B;  1TVX A;  5IGF A;  2NTT A;  4WOR A;  1SXT A;  2OF1 A;  2IL8 A;  5KRU A;  4HTH A;  4A3F B;  4C2M B;  2FMM A;  4XQJ A;  1B9N A;  4BBR B;  2BDO A;  2BDN A;  4F8M A;  3K7A B;  5ELC A;  5CGK A;  1I50 B;  4M1U B;  2EYJ A;  1EIH A;  2BA0 A;  2ENB A;  4PV1 C;  4ZKC B;  1F2L A;  3VYU A;  3K5O A;  1B3A A;  1LAB A;  5T1I A;  3CQZ B;  3I8Z A;  5M5X B;  3RLF A;  3J7A F;  2Q8R E;  2IX0 A;  2CW0 D;  2L9H A;  2LFN A;  1HPC A;  4DN4 M;  3WDN A;  1SYB A;  2CVR A;  1JIC A;  3KUP A;  5C3W A;  1ESF A;  4MN3 A;  1IW7 D;  2E74 C;  4AYB B;  1SEB D;  2B39 A;  3HEJ A;  3MHB A;  4S3S A;  1SNM A;  5CV9 A;  5HUR A;  3S1M B;  3GV6 A;  3FKI B;  1EEF D;  2ID0 A;  4OGQ C;  5C0X H;  2K32 A;  3VR4 A;  2L4N A;  3QWN A;  3VR2 A;  3WOF A;  2KVM A;  5T1G A;  3OPO A;  3GTL B;  5AFW A;  1JQY D;  1CA5 A;  1XTC D;  4WJW A;  1Q3L A;  3MEH A;  3D3R A;  1STE A;  2SNM A;  4C3J B;  2K7V A;  2C5C A;  1H9R A;  2MHV A;  5FO8 B;  3NTI A;  5KNB A;  3CHB D;  3NPP A;  5C0X J;  1I3Q B;  2I46 A;  2B2Y C;  4DAV A;  4HR7 B;  2A6E D;  1O78 A;  1ENC A;  5JJZ A;  3I90 A;  1CTM A;  1TY0 A;  4G57 A;  3D4D A;  3OWF A;  4KMU C;  3X3N A;  3F2U A;  5CR3 A;  1PDQ A;  3S1Q B;  1PRT D;  3QOJ A;  4J6H A;  2ICE C;  1D2B A;  5C6A A;  2D62 A;  4ZUJ A;  1CI3 M;  5C4Z A;  3J81 E;  4Q0F A;  1LTS D;  3DWP A;  1II3 A;  2MP1 A;  5IT9 L;  4FF2 A;  4G4K A;  4IUV A;  4XDX A;  1H9M A;  2EY1 A;  1MSG A;  1C4Q A;  3KLS X;  2RDH A;  1M8A A;  2Z1C A;  1BUV T;  1SNC A;  2X6G A;  2G9H D;  4XT3 B;  4A3B B;  2JYO A;  1SSO A;  5I6W A;  4RHR A;  2HCC A;  4U68 A;  2RDF A;  2KEE A;  2IW3 A;  4XYQ A;  1GOZ A;  1IL8 A;  1EQT A;  3C46 A;  5KYI A;  3PMF A;  4QF4 A;  2HQE A;  2X69 A;  5BN5 A;  1X32 A;  5CYU A;  1RD9 D;  1PZJ D;  4RAU C;  1ENA A;  2E2H B;  2AQ1 B;  1GJX A;  3G7L A;  1V8Q A;  4WFN 3;  4IFD I;  4OO1 G;  4A3I B;  2L5T A;  1FYC A;  4JBW A;  1ZXT A;  4DNR B;  3QIA A;  1DOM A;  2RKS A;  3R2T A;  1HA5 A;  2J4X A;  1AP0 A;  2ZXO A;  2H1E A;  3OSO A;  3BVG A;  2Y0S B;  2J7Z A;  4FF1 A;  1RCV D;  5J22 A;  3W3A A;  1KLG D;  2L55 A;  3S15 B;  3C1F A;  4OIJ A;  2LMC B;  3A8J E;  2AQ3 B;  4UAI A;  3SK8 A;  1GUW A;  4K2L A;  2B8F A;  5A35 A;  1HTL D;  1KDB A;  5G3L D;  3IKJ A;  4XTC S;  1O80 A;  1I4X A;  1EY4 A;  3HS0 C;  1MD2 D;  2BA1 A;  1UEA B;  1YNJ C;  1KAB A;  5DAU A;  1W6J A;  4H7B A;  2VXW A;  3J80 E;  3NBI A;  1HFN A;  2F0O A;  1ILQ A;  4ZQ3 A;  2JEA I;  1L0Y B;  1EY8 A;  3NTH A;  4QMG A;  5EBD A;  4KN7 C;  5EBC A;  3QG1 A;  3TP8 A;  1TS3 A;  3H91 A;  2VUM B;  3IL8 A;  3GTQ B;  4CGY B;  2KCC A;  3DMU A;  1HQR D;  2MPM A;  3H09 A;  2NVX B;  3P1H A;  2EOT A;  4IFD H;  1D1K A;  2QKI C;  1V1O A;  2DNE A;  3T4A C;  3TZD A;  2F0F A;  2PNR C;  3VR6 A;  2NVT B;  4X3U A;  3NK9 A;  2E2J B;  1CHQ D;  1JOO A;  3MZ5 A;  2E2I B;  2A73 B;  4XQQ A;  2VNU D;  1TWA B;  1WTR A;  1AW7 A;  2F0N A;  4B08 A;  2Q8T A;  5DM6 3;  3HKZ B;  2PCF B;  4KHV A;  3X3M A;  4RCN A;  4RGO S;  4ZUI A;  2HUG A;  4J1M A;  5E4W C;  4N9P A;  1SYC A;  4J8Q A;  2JSO A;  3D6C A;  1IKL A;  1NUC A;  5C0X G;  5DM7 3;  3HOW B;  4DF7 A;  2YU9 B;  2MUY A;  1F9S A;  1JOR A;  5CV6 A;  1AZP A;  2SDF A;  5EPK A;  4KKT A;  1VF5 C;  3GD7 A;  1HTP A;  4QUF A;  1SJH D;  2PYK A;  4IUU A;  3S14 B;  2F0T A;  1KNE A;  5ELF A;  5G3L F;  2QEJ C;  2JA6 B;  2A6H D;  1MI2 A;  4R8N A;  5EJW A;  3NP8 A;  1ILP A;  1OXV A;  2K28 A;  1CA6 A;  4ILW A;  2PMZ B;  1PRT B;  4XXE A;  2K5D A;  1AZQ A;  1EL0 A;  3S1N B;  2EE1 A;  1JWM D;  3A7L A;  5D14 A;  4OIK A;  2PZT A;  4RGN A;  5K36 H;  1V1P A;  4RA8 A;  3A8I E;  3NBH A;  3ERO A;  4C3J G;  2RBM A;  3K0Y A;  1A15 A;  1OXU A;  2M00 A;  3D8G A;  1ONL A;  1U4P A;  1IHZ A;  1K83 B;  3CRL C;  2JE6 I;  3SHL A;  3I4M B;  2KJX A;  4PNY A;  4EGV A;  3NUC A;  2WII B;  2QCP X;  3PUW A;  4CJ0 B;  1HCZ A;  3SEB A;  3SXH A;  1TKW B;  5ELE A;  1Y69 U;  2J0T D;  2F0W A;  3NWT A;  3FDT A;  3S9W A;  3NHH A;  1X3P A;  1RDP D;  2F0V A;  4G7H C;  3D31 A;  4RKL A;  4K2K A;  5JVH 3;  1BCP C;  2IT1 A;  4DXG A;  3PUV A;  3VYS A;  4ID6 A;  4N9T A;  4RGT A;  3QB3 A;  4XQN A;  4BBS B;  4DA2 A;  3BYT B;  1WD0 A;  5M5Y B;  1B2T A;  2XNA C;  2B63 B;  5JPM C;  2A69 D;  2EJM A;  4E6I A;  3QOL A;  3KLS A;  3TP7 A;  3PUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...