The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
264
|
structure length |
264
|
Chain Sequence |
SYMDVRIFEDERVDICQDLTATFISYREGPEMFRHSINLEQSSDIFRIEASGEVKHFPWMNVSELAQESAFFVEQERFVYEYIMNVFKAGRPVVFEYRCKFVPFECTVLQMMDGNTLTRYTVDKGVETLGSPPYSPDVSEDDIARYGQGSGISILRDNAALLQKRWTSFCRKIVAMDNPRHNEYSLYSNRGNGYVSCTMRTQVPLAYNISLANGVDIYKYMRMYSGGRLKVEAWLDLRDLNGSTDFAFVISSPTGWYATVKYSE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis of mouse cytomegalovirus m152/gp40 interaction with RAE1gamma reveals a paradigm for MHC/MHC interaction in immune evasion.
pubmed doi rcsb |
molecule tags |
Immune system
|
source organism |
Mus musculus
|
molecule keywords |
Retinoic acid early-inducible protein 1-gamma
|
total genus |
60
|
structure length |
264
|
sequence length |
264
|
chains with identical sequence |
D
|
ec nomenclature | |
pdb deposition date | 2012-07-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
C | PF11624 | M157 | MHC class I-like protein M157 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Alpha Beta | 2-Layer Sandwich | Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 | Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 |