4G5FA

Pantothenate synthetase in complex with racemate (2s)-2,3-dihydro-1,4-benzodioxine-2-carboxylic acid and (2r)-2,3-dihydro-1,4-benzodioxine-2-carboxylic acid
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
286
structure length
282
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 93
structure length 282
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4g5fA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4g5fA01
1JILA 4F4HA 4EFKA 1O0CA 1U0BB 4CT0A 1MB9A 3HL4A 5HUHA 4KPUB 1NYLA 4QBTA 2E18A 4KR7A 4ARIA 1VL2A 5DASA 1WJGA 4ZT3A 2R5WA 4NATA 4ND7A 2YY5A 2A86A 4WSOA 5J5AA 2QTNA 1H3EA 1H3FA 1WQ4A 1J70A 1WXHA 2O8VA 4JFAA 1IHOA 1MAWA 2PFSA 1N2EA 1MBZA 1OD6A 4H3SA 2GOYA 1K4KA 4P2BA 3CLSC 3AIIA 1JHDA 1PFYA 4PY2A 5HUJA 2JAXA 1N2IA 4U7JA 2A1UB 4EG7A 1QU2A 1OWMA 1EUQA 2X1LA 2DETA 1YIDA 1VBMA 1WQ3A 1X6VA 1G8GA 1O94D 1IVSA 4MUIA 3IMGA 1LI5A 3AFHA 1XJQA 3CLRD 1KAMA 1MC1A 3CVVA 2E21A 1P7PA 3FDXA 2J5BA 1GZUA 1XNJA 3A05A 1A8HA 4MULA 3H9BA 1G8FA 5K0TA 1Q19A 2XRYA 3UMVA 3G5AA 4KR6A 1ZH0A 1J09A 1GTSA 1O95D 1O96A 4XFJA 2V0CA 4MQ6A 1F7VA 3H05A 2HMAA 4ZCSA 3QTTA 1IQUA 3CA8A 1O0BA 2JA2A 1D2RA 1Q15A 1M1ZA 3JXEA 5BNZA 1F4LA 2CV2A 3D6UA 3OP1A 1OWLA 1KH3A 1Q77A 1JZSA 3RHSA 1PG2A 2CYBA 4MAFA 4YMIA 4CDNA 4K03A 4UZEA 1N2OA 2WB2A 1IH8A 1EXDA 4KR9A 2PZBA 4NAHA 4QREA 2PXHA 4NAUA 4DJAA 3ZIUA 4MWEA 5TS2A 4F3RA 3Q12A 1EFPA 4G6ZA 1M8FA 1OBHA 4X0EA 2H29A 1QTQA 3RFFA 4MUJA 3VGJA 3IMEA 1B6TA 4AQ7A 2D5BA 3N9IA 1MB2A 3U1VA 5F23A 5KWVA 3ZJVA 3DO8A 3SEQA 1N2HA 3INNA 4MVXA 1GPMA 2A4MA 4Q16A 1KH1A 3CLSD 4UZFA 2HZ7A 3IOEA 2BTEA 1CT9A 3IVXA 3HGMA 2DEUA 1O97C 4MWCA 1JIJA 3ZXIA 3FETA 3G59A 1IQ0A 5K0SA 3N8HA 4TS1A 4KKVA 3G6KA 4BWVA 4G5FA 2ZP1A 1YUMA 3LCJA 1QRUA 2ZUEA 4U8HA 3IMCA 1N2JA 3COWA 3FOCA 3RBAA 2RD2A 1S4MA 5H16A 2QTRA 3F3MA 2CSXA 4RUKA 5DEOA 3NV7A 3ISJA 3M5WA 4U63A 1KQNA 2X3FA 4DDHA 1G59A 1NUSA 1KP3A 1KQPA 1SURA 2D54A 2YWCA 4JZYA 4JYZA 4GU5A 4MUGA 2J4DA 3LOQA 4NDAA 3UC5A 1NUPA 3N2YA 3L93A 3S3TA 1MJHA 1KORA 3GMIA 2DPLA 1JEDA 5TEVA 4JXXA 1PFUA 1UFVA 1EJ2A 1NZJA 4OUDB 1ZUNA 4ZCTA 1N2GA 4YP7A 2VXOA 1N77A 2A84A 4HJRA 4FZJA 1EFVB 1YI8A 1QRSA 1NUUA 3Q4GA 1R6UA 1M83A 4WNYA 2A7XA 1Y42X 4HJXA 4MUKA 4DNXA 2OV4A 4ZT4A 5J58A 2QJOA 4ZT6A 4MWDA 3HMQA 5DB4A 3CVXA 1NURA 3ND6A 1MOPA 1J21A 5TGTA 1V47A 1EUYA 3C8ZA 3TZLA 1X8XA 4ARCA 2VTBB 1TQ8A 3QTBA 3K32A 1WXIA 2DR2A 3SYTA 1U7DA 3HZRA 5LM3A 2H2AA 4MW5A 2CYAA 2AG6A 1EE1A 2AKEA 3IUBA 2IELA 3IODA 2CT8A 3ZJTA 3UY4A 1H1TA 4ZCRA 2BYTA 2XRZA 1O97D 4PBSA 2A1TR 5IJXA 3IVCA 2QUKA 3TNJA 1M8GA 1ZJWA 1M8PA 4CDMA 5TEWA 3SZ3A 1KR2A 1U3DA 3X1MA 4KPUA 4R2LA 3H99A 1JEEA 5KHAA 3DPIA 4PBRA 1PG0A 3D6VA 2C5SA 1WXFA 4HPWA 4XFDA 3E27A 4YP6A 3QE4A 4EGAA 1J1UA 1YULA 4PBTA 3AG6A 1NUTA 4GRIA 3P0IA 1TYBE 5LFAA 4EF6A 3ILVA 4I6EA 3RJZA 4MW2A 4NZPA 4ZT7A 1COZA 4EG3A 2AZXA 3HV0A 5FO1A 1NI5A 3DLAA 4L2IB 1GLNA 1K92A 1M8JA 1FFYA 1KQOA 2J08A 3ND5A 2A1UA 3IVGA 3FG9A 1N78A 2ZUFA 3ZXSA 1OWPA 2EL7A 3P0JA 2A88A 5AHWA 3TZEA 1WZ2A 3H97A 1R6XA 2NZ2A 3COZA 2JANA 3IDFA 4MWBA 3X1KA 2E0IA 5IHXA 1J1ZA 5JBNA 4MW1A 1T9GS 2DXIA 1FYDA 1OBCA 4A91A 1N1DA 1WKBA 3CVYA 4CQNA 1WOYA 2WSIA 2V0GA 2NSYA 3A04A 1I6LA 4ZCQA 2O5RA 4ND6A 4OJMX 1NUQA 3PNYA 1TFUA 2X0KA 1OWNA 4YBRA 3FY4A 3MLAA 3A2KA 2J07A 1VBNA 1H3NA 2GM3A 1OWOA 3CLUC 3VU8A 1TYDE 4ZCPA 4J76A 4MW6A 2CYCA 5FNZA 4YP5A 1JIIA 3H9CA 4R0NA 2Z09A 4Q93A 1T6YA 3ZGZA 1KH2A 1LI7A 2HGZA 2IJGX 4I6GA 4J75A 3ZUGA 3Q10A 1TYCA 1N2BA 1O96B 3FIUA 4EG8A 2DERA 1R6TA 3LE8A 1KP2A 3I05A 4L2IA 2QTMA 4NX2A 1GAXA 3COVA 4I6JA 1T6ZA 1PFVA 1VLHA 4MW0A 4DLPA 3AG5A 3DV2A 4MW7A 2TS1A 5J59A 4ZT2A 3IH5A 4K0RA 3CLTC 1Q11A 1XNHA 3N05A 3FH0A 3SDBA 2QJTA 4MVYA 3KT3A 1NP7A 4EG1A 3NBKA 4EG5A 2EJCA 1EFPB 3FNRA 4ZT5A 1QQTA 3SZGA 3MLBA 3OTWA 3L92A 3UK2A 2CV1A 4MVWA 1YUNA 4HK4A 5LLTA 1IQRA 5HG0A 4G5YA 3HFJA 3IOCA 3GUZA 1V8FA 4QRDA 1T9GR 4JXZA 3PNVA 3NBAA 1U3CA 3AKZA 2RE8A 1WXEA 2CUZA 4S1OA 3TQIA 3SEZA 1VBKA 1RQGA 3MXTA 2J09A 5FO0A 3IOBA 1JZQA 2WQ6A 2D13A 1K97A 2IP1A 2QUJA 1PFWA 5DK4A 2X1MA 2PZ8A 1N75A 1JECA 1KKUA 1MAUA 5H7XA 1ZH6A 1O5TA 5KCMA 3FHJA 3KFLA 3CVWA 3PNBA 3CLUD 4MUNA 3X1JA 1KAQA 4OUDA 3RK0A 4RPIA 3AL0C 1TEZA 4E1AA 4EG6A 1I6KA 3FWKA 1EFVA 3P52A 1JGTA 1O6BA 3BL5A 3VRHA 3PRHA 4MVCA 1JMVA 3KT8A 3FI0A 2OQ2A 4XSVA 2G36A 4MW4A 4AS1A 3UOWA 1ILEA 1GTRA 2I1LA 1ULHA 2YWBA 3CVUA 3MMXA 1JIKA 1I2DA 1G8HA 1T6XA 3A4IA 3K9WA 3PXUA 2VTBA 1GN8A 3KT0A 2PG3A 1NSYA 4DDKA 1N3LA 1LW7A 1QJCA 1QNFA 4MUFA 2DUMA 2Z3VA 1O94C 4DDMA 2QJFA 3CLTD 3ELBA 1HYBA 4MUHA 4EG4A 3ZJUA 1BS2A 3CLRC 2Z08A 3TS1A 2PZAA 1M8KA 3CR8A 4MW9A 1F9AA 1WXGA 1J20A 3KT6A 3MUEA 2PIDA 1U7XA 4DE5A 2B7LA 3ND7A 1K4MA 2A1TS 1O95C 5EKDA 2E89A 1DNPA 1MRZA 1YIAA 1IRXA 4MUEA 2GKSA 1I6MA 3RK1A 3GLVA 1TYAE 2WQ7A 2CFOA 2QUIA 1QRTA 2QUHA 3P0HA 1IFXA 3SP1A 3COYA 2YXNA 4R2MA 1WY5A 2CV0A 3TQOA 4MLPA 1F7UA 3IUEA 1XNGA 1QU3A 2DLCX
chains in the Genus database with same CATH superfamily
4NTZA 4B6QA 1EB8A 3I1JA 1P4GA 4R9NA 3LLMA 5B64A 1R12A 4UDNA 4DQXA 4UVDA 3QLJA 4TPKA 5LQNA 2KSQA 3AILA 4OLAA 3GLSA 4A26A 4E2YA 2F2TA 3GFGA 4K46A 3T9FA 1E94E 4XB1A 3BE4A 4WCDA 5HKKA 3V4SA 3WDMA 1E98A 1WIWA 1H2FA 2EX4A 2KJQA 2QTTA 1UC9A 2YL2A 3CFIA 5ER6A 1GVNB 3LGSA 3Q8MA 5TMDA 4OHOA 3ETLA 3A1EA 3IJPA 4L5BA 3NTUA 1I2CA 4J0JA 2V5VA 2Q3HA 2XH8A 5EXEA 3EAFA 2X4LA 1D9XA 3LT0A 4NBVA 3D8NA 4P31A 4ENWA 5JPDA 3LTNC 5L53A 1YZKA 3HEAA 3B52X 4IHJF 5JS8A 4WZBA 5TF4A 1U3UA 3PLAE 1CZRA 1DCMA 1KEVA 2LTAA 2RGAA 5EIAA 2XUPA 3KJXA 4ZYZA 2HGSA 1E2JA 1JSXA 5FJIA 2MT9A 1QHXA 3GFOA 3NX4A 3KSAC 1V8ZA 2OV2A 1K88A 5JHHB 4N5DA 2WFLB 3UKJA 4GDMA 5HA5A 1YR6A 1IB0A 3R7AA 3PDJA 5E9QA 4Z2AA 4S2EA 3ENKA 5L51A 1DTWA 3F3KA 4YP0A 2W98A 3SYRA 2IEZA 1PEKE 1VJ0A 5KOJB 4COKA 5MN4A 4UW9A 3C8DA 3W79A 1OI7A 5THXA 4ILKA 4DC9A 1WLYA 1Z5OA 2PUJA 2XRYA 4LDJA 4NV0A 4LY9A 5TVKA 4O0LA 2OZKA 4KLAA 2P5TB 1VM6A 2IPNA 2B1IA 1VRWA 5AVTA 4JP5A 1GPJA 2GXSA 2Q2WA 2ZGVA 4ESEA 2JFNA 1STOA 1MENA 3JARA 5HMLA 6REQA 3HN7A 4X20A 1DC4A 1WTAA 4O4LB 1SBTA 2F67A 2IEAA 2BFWA 4DV7B 2P3QA 2BMJA 1NTOA 2JA2A 2PVSA 2D3WA 1HNXB 5C4IA 4G4IA 5BQ3A 3EULA 2DBZA 4JJKA 1P7YA 3D5QA 3I52A 4QG3A 1N8SA 2MCFA 3C5WP 3DAOA 1A5BB 4RGYA 4DYDA 3L4JA 1DIHA 4M38A 3SY8A 1U0OC 3K0FA 4E5VA 2YWFA 2HT6A 2ZRQA 1WR8A 3FFXA 2DWUA 3PVSA 5I5GA 1NQ5A 1V1RA 3ESCA 1PGOA 1FYEA 2GM9A 3C3CA 3KR0A 4RPCA 3ZQUA 3CFHL 4QREA 5JQWA 3THXA 4B4DA 1RKXA 3OFNA 4JSTA 2W6NA 2Q29A 1V25A 4MWEA 4EJSA 4B3TB 2PUVA 3IAEA 2FGJA 1CZHA 1I3OA 1SCNE 2HA2A 3GJ8A 4MV5A 2M6SA 4WOJA 5DGIA 5LIRA 1DWOA 3ZDDA 1Y7LA 4CM3A 2C99A 1ZX1A 1IHPA 3DOHA 4JHLA 4XIIA 3U7HB 5J5VA 3UIEA 4II7A 4G9BA 4C0QC 2Z30A 1BJKA 2XKAA 1AE1A 2ZW9A 2QP4A 3BMNA 4CI9A 1H42A 1N5DA 3QOYA 1J2TA 4OB8A 2CY0A 4RKYA 4RH1A 2BEWB 3ROQA 2Q8QA 2MDTA 2QZ4A 1EFHA 3EK2A 2N75A 4KK4A 2HV9A 5CW2A 4HGOA 5IJWA 4CHGA 3ADDA 1ZNWA 2BKXA 3PXGA 4IIBA 5I4BA 1CT9A 4LYFA 4HUJA 3THWB 1LBIA 5BYBA 3ISTA 2ES4A 1CUXA 1KDOA 4NG4A 4XJTA 3KAKA 1QAQA 4PICA 2BISA 1RKBA 1TYZA 3LUKA 1R9GA 3FGOA 5KNDD 1AN9A 1CDZA 3ZWAA 1EHIA 3FETA 3EEIA 4JGGA 1EFLA 1TMOA 3F7NA 1YI1A 1YKGA 4J2HA 5INTA 3GPBA 4NBNA 4EELA 5EPOA 5KQPA 4UE3S 3EFHA 1MDBA 1ZNXA 4AJIA 5JSUA 2BEUA 1FFEA 1TVMA 2FLWA 4ACBA 3O47A 4DJTA 4L5YA 1WB5A 2FFQA 3FOCA 2XGMA 3EMOA 1JRLA 3R6DA 4TV8B 5ALZA 3VC7A 2RBKA 2WUEA 4AMUA 5LP6C 2L42A 4RGQA 4L4YA 5GTDA 2F4VB 1JR6A 3CNBA 2ZATA 4R0VA 1OLSB 2CNDA 1M75A 1W0JD 1CQWA 5DGDA 5EWJB 3VPXA 1ONPA 4FSHA 3R0ZA 2DRIA 5FYDA 4IDGA 2O2ZA 3I4FA 3LC0A 2Q5EA 1XZQA 1KP3A 1XEWX 4NHOA 4R3NA 1G59A 3IGFA 1GL3A 4HH4A 4DQVA 4BMZA 3PDUA 3WWYA 3EAQA 5E6UA 4OV6B 1NUPA 2DT5A 1WHSB 1EDDA 1E9DA 1WZ2A 1PFUA 1G3QA 4XWKA 4HDNA 1TQ2A 4W1SA 3A4YA 3M2TA 2B1QA 1D7OA 2QQ5A 3I9V1 5TC4A 3ZQJA 1DL5A 4IIGA 4LHXA 4YQZA 2QLBA 1T2FA 4PNZA 2EZ4A 1DQNA 3VPFA 3VR2A 3F78A 3ZTTA 4Z1OA 3QUSA 2VA9A 3HNOA 3MFYA 4P7GA 1VJTA 1JMKC 5DX1A 4AS2A 2C4HA 4TTRA 1SUEA 5SZIA 4PRKA 4EX7A 3LHSA 2B7BA 5F4ZA 4LKOA 1PTJC 3WIDA 3NLLA 1Y9ZA 4LDRA 2Q28A 3O75A 3CVXA 2UVQA 1NI3A 4Q0MA 1KO5A 1BFKA 2CKDA 1E1DA 3BXEA 4RABA 3ND6A 5F9HA 2QUAA 1XYYA 4FGZA 1XOIA 3HG7A 4WK0B 1X1AA 3PQCA 5KOIA 4NDNE 1RFGE 3C8ZA 3S1AA 3TZLA 5L7TA 3CZAA 1JA0A 1J0DA 2G83A 4H7HA 5UKDA 4ZV4A 1IQPA 3QTBA 3HU3A 4ZU1X 1PJBA 2UDPA 2QZZA 1SHKA 2ZYVX 5FI3A 1U7DA 4ZKEA 3U80A 5EJ4A 5F2NA 2XW6A 1E2LA 3DOUA 1XCMA 2QJRA 3I76A 4G0WA 3P1JA 4EHKA 1S1MA 3AFIA 3CR7A 3L0PA 4UM9B 2CT8A 4LV5B 4D2IA 4YT4A 4WMLA 5KWSA 2QENA 3A6EA 1H1TA 3KM0A 1IWBB 4QOHA 2C9YA 4BNFA 4LHWA 3UB4A 3F6YA 1NLUA 1BYIA 2JI6A 3ZDFA 3CCFA 1TAUA 3BWBA 3GNSA 2WJYA 3QKWA 4OY3A 2JK1A 2R8RA 1SQ5A 3JVIA 3L05A 2BN4A 4CDMA 2Y67A 4KOAA 5JXJA 3HVRA 2WMNB 4TT3D 4QRIA 1Z62A 2MSKA 3TOVA 1TGVA 3LQ2A 3ZCUA 1WL8A 4EI9A 1A7JA 5JNUA 1ULTA 1FFAA 1VQ1A 2QSUA 4B7XA 1Q0TA 3GCZA 1ZU5A 3LPMA 3I2KA 1A9OA 2J0UB 3M6UA 3NCHA 4JI1B 4CEHA 1J1UA 3WNBA 2I7TA 1M6VA 3E3AA 3T3HA 3K96A 4QM7A 1FPQA 3F8WA 1JEQA 1VSVA 1O3YA 1R88A 1TYBE 4H3HB 3BD6A 3WL5A 3HKDA 2HPVA 4URWR 3FGNA 3I09A 3DEJA 2FN8A 4EIWA 1Q22A 4EMSA 1OXKB 1SJ9A 1YHYA 2GD0A 3BMCA 3QI2A 4K9KA 4NCKA 2IV2X 3U7QB 2DFKB 5TPWA 3UK1A 2ZUWA 2UUPA 3WMEA 2X86A 3CH4B 1EEHA 3DLAA 3GLIB 1RXSA 2B34A 1HDGO 5CEEA 1AXEA 1QUEA 3SVTA 3SIRA 5TRTA 3KB6A 3PTLA 4MSUA 1ZMXA 3GDOA 2OILA 4Y6GB 1I2ZA 1ZO8A 2PRZA 2WSMA 3GJ7A 2VUHB 3RI3A 4NR0A 3N76A 3O1HB 2NZ2A 3BG5A 3EXFA 2ZYIA 2JANA 4YBZA 2E0IA 2ZI6A 3O0DA 4AD8A 2WNHA 5F2EA 1D0IA 1Q83A 1EWQA 2WAYA 4P8RA 1BTOA 2WF6A 4LBVA 4MW1A 2PRKA 1LTQA 4YNBA 2OYCA 3LKBA 5I01A 4IF6A 3AESA 3H8VA 3F7OA 3V7WA 1JVNA 1U8TA 3CT4A 3TZ6A 1EGAA 4NS4A 3OLXA 5EHXA 4M8LA 2W2QA 2W58A 2NUAB 3OQIB 1CZKA 7MHTA 1TFUA 5EMNA 3EDYA 1JUDA 1OHHD 1ZRHA 2PBZA 2H7CA 1LDMA 1YBFA 2CDAA 2E4YA 2J07A 2VF4X 3BXXA 4N8EA 4C2AA 4HV4A 3CG4A 1LFDB 2VLBA 3R3HA 4DDWA 3NIWA 4E5NA 1JIXA 1NBME 4D8UA 1NC3A 3TYXA 5HJ7A 4LOIA 1UWVA 1CVLA 2C5HA 3JR7A 4TMKA 3M1AA 3KQKA 4WXYB 1YZYA 3QSYA 3GVIA 1KK2A 3WRYA 5LLDA 4AKIA 4DV0B 3WGLA 3DVAB 3RUIA 1J2UA 4DADA 4EWLA 4JUAA 1L4LA 2OB2A 3F46A 3W6PA 4AJPA 1L4KA 4B8WA 4V1CB 3GG9A 5IWCA 4FMDB 1U0GA 5SY4A 3L0OA 2UUOA 3FGPA 1AD2A 1NJGA 1OIXA 1QVZA 2Z95A 3MJVA 2UYQA 3TTSA 1Y6GA 3LWZA 1IJKA 3U49A 1B3BA 2RGNA 3W05A 4BFYA 1S2NA 2PM8A 2HADA 5CM9C 1U2EA 5JSFA 4R1PA 3IBYA 4EGJA 3IHLA 4PIVA 4JI6B 2O8EB 1YKFA 4QECA 3WQBA 5KTMA 1SUWA 3HJUA 4X6LA 3KYDB 1G66A 1UMKA 4AECA 3T1NA 4UEOA 2GSDA 3I04A 5TIIA 3PE4A 4KFTA 4P58A 2HNBA 5DHSA 2AEMA 4HB4A 3RRZA 2A58A 4YQFA 1MG0A 2WJ6A 3SSAA 4D3DA 4PTLA 1F8XA 4BB9A 2RH4A 4YMUA 2VFAA 1SBQA 2OBNA 2GK6A 4MVYA 2X23A 1E1LA 3OWHA 1B76A 3WGMA 5FQNA 4UC0A 3QFTA 2CMKA 2RB4A 1UP4A 2J45A 3TF5A 1ES9A 1MJ5A 2QTZA 3UK2A 3CF6R 2P11A 4I2NA 4BNWA 1ELOA 4R16A 1II9A 1KYQA 1ZVQA 2I7VA 3PRJA 4PC7A 3UJ6A 3ZWBA 2J6IA 4ZTZB 2NP7A 1CUUA 3UOGA 4TROA 5AW8A 2YWXA 1QE0A 3LHIA 1SQ6A 4GWLA 1LQTA 3GEDA 2C7PA 3FBGA 3NBAA 4AJJA 1P2SA 1SHLA 4JK3A 2FETA 1B6GA 3BERA 2Y6VA 3JZAA 3OEYA 4Y1RB 4MV4A 2IZZA 5HE8A 2PQ6A 1HNWB 4CMEC 2F43A 2KPOA 1KDZA 5DBHX 2XGSA 5CYPA 2W90A 1IY1A 4AKHA 4Y6QA 1V43A 4UUBA 5KQSA 4K40A 1GL9B 5LZ9A 4H3VA 1KBZA 4KWIA 3DLBA 2PZ8A 1N5LA 3LUHA 3UWOA 2CLEB 4DLUA 4OMFG 2BMEA 1KKUA 3ECAA 4ZMRA 1JAZA 4KLNA 1K5DA 3QVMA 3M9WA 4RTRA 2VP2A 3NV9A 5ALFA 1M0WA 2J8ZA 3CLUD 3PNBA 3M4XA 4Y9RA 2YTZA 3A0RB 4V03A 1XPUA 3WIBA 1FMFA 2YXPX 1F14A 1ND5A 2NYUA 3CVJA 4HSGA 1GRNA 4W63A 5CRIA 4TS3A 2BHNA 1JN0A 3EZLA 3F4KA 4UDXX 3V9AA 2YINC 3O5AA 2ZYDA 4ZCMA 1GZ5A 5CX1B 5CJPA 1UWCA 4MVCA 5IHPA 3A1SA 5KVVA 5CCBA 3EOZA 1MJNA 1SVUA 4ZOBA 4Q1VA 4HLCA 1DAIA 5AFSA 2G6TA 3UA3A 3LQKA 2ZKLA 3K1AA 4XWAA 4XH9B 3V4LA 1ZIOA 2OG2A 2ZS8A 3U6KA 3PFIA 4NBKA 1AKYA 2EIXA 4HB2A 2FPMA 2AG5A 1GTRA 4R5MA 4TTTS 2LCQA 3O82A 2WWIA 3WKBA 2YWBA 1F4VA 4XJXA 1OA1A 5HQ3B 3HL6A 3NT5A 3S40A 1PGNA 2I22A 5LKRA 1I30A 2Q07A 1BMTA 2HA4A 4AZ0A 2UUAB 2OENG 1E2IA 2BLNA 3P2YA 2VPZA 4UATA 5T6MA 2APJA 3DWIA 2G3DA 4EGCB 1S96A 1P9LA 2AZDA 4L07A 1KYVA 4PR0A 5D01A 1R8QA 3NM4A 2YZGA 1QRRA 2QVYX 3EXIB 4CETA 4X63A 4Y0NA 3KPWA 2D74A 1QWSA 1OILA 4Q7LA 4FOTA 3VVCA 1HETA 2CK3D 3O38A 121PA 1ICEA 4NDZA 2TSYB 3Q3JB 4EJ2A 5IFLA 1TM3E 1L7VC 1UXIA 2R84A 1XZHA 4PC6A 3OAAA 3SFTA 3FTEA 3TUIC 8OHMA 1CWUA 2QLTA 3GN2A 5K9ZA 1QOQB 3ZDXB 3R3UA 2FWAA 3BQMB 1C1DA 2G8NA 4KREA 2YYAA 2IYPA 1NKTA 5DBOA 4M7WA 4TVKA 1ODLA 3ND7A 4RA9A 5AOBA 1QCCA 5LL6P 2F00A 2FXVA 3PNKA 1CYDA 3VZRA 4PZAA 4DQLA 1DTWB 3BIJA 4ESHA 3U4DA 2BC9A 3O4HA 2AR9A 1IRXA 3DYVA 1E5DA 3IE0A 1S8FA 3KR2A 2PA3A 1WUTA 4BVBA 3BD7A 1ZW6A 4B73A 2WQ7A 2Q2VA 1UPFA 1DKOA 2QUHA 3D3QA 3KQOA 1ZWLA 2VN8A 2QEQA 4I4TA 5FBQB 3FR8A 4K6KA 1Y4DE 5AT1A 1LGYA 3JARB 5K3EA 4RKWA 4GKBA 2ZWVA 4WVFA 2NUTA 1NF9A 3DKKA 6REQB 1VMDA 5KDDA 1AKEA 3CUVA 4F4HA 1QGED 1O0CA 2VSFA 2XNJA 4C0BA 1NOJA 2I2BA 4XZ3A 2PXAA 1NAIA 2OBYA 3FZNA 3IOMA 4L1KA 4MI3A 3I8XA 3K3PA 2V6BA 4MUXA 3DBLB 5EJFA 5IN5A 2XZOA 4QUJA 2EWWA 3DFMA 3IT0A 3ZQ6A 2HYIC 5ITZA 1JJBA 1WJGA 5B1YA 4ER5A 1E2HA 5K09A 1DIRA 3T3OA 4MR8B 1N1EA 1YDFA 1ZJJA 3K0FB 4E5YA 2J9GA 1PV1A 2A7QA 1V71A 2J9YB 3CZQA 1NBHA 2AXEA 3DR3A 4QNRA 2IHVA 4JLMA 3ZE6A 5ED4A 4WN3A 1V5GA 1N0WA 5EQJB 1T0BA 5TQJA 3RF7A 3ZDZB 4BLUA 2AGVA 3A2LA 3DE3X 4OREX 5T4BA 5JMOA 1J70A 1VECA 4IIYA 4R8LA 2PMFA 3KEOA 2JFFA 3GJTA 4O1MA 2IHNA 4EJSB 1Z2AA 1FYVA 1UZAA 3J7AC 3TL2A 4F46A 2AR0A 1YUBA 3LKDA 1TX4B 1ECJA 1KMCA 3HYNA 3PIRA 4YWJA 3AF5A 2CE7A 2YZ7A 4U7JA 3WLEA 4J4BA 2I2CA 1OBVA 4HZUB 1OLOA 3IVMA 2QL9A 3EXG2 4JA0A 2GN0A 3EH1A 5IVIA 2ODPA 4UXIA 1L4HA 4BQIA 2J9RA 3OF3A 3VYTB 1KC3A 1WQ3A 1DIAA 3FZGA 2YZ2A 1G8KA 5AKGA 6AT1A 5HRAA 1G2QA 3N58A 1YR7A 1ULBA 2IEBA 3QW2A 4FYYA 1MV5A 3CLRD 3KPUA 3B6MA 3EWSA 2Q3FA 5GV8A 4D0LB 3UQYS 5CDFA 2QTFA 3IBSA 2IHYA 2J5RA 2W6ID 3IIMA 2VSYA 3IMKA 1F38A 3S5JA 3GC6A 1QZXA 5BSFA 2IIVA 2CVHA 1U0LA 1XVAA 3WGOA 3TIXB 1ZMBA 1HNNA 4BVKA 2A3NA 2CLMB 3MSCA 4DMFA 3J80A 4WH0A 1M2VA 1YZLA 2VNIA 4A5SA 2BEUB 2GZRA 2CFRA 2EJWA 4OYHA 2WOOA 1GUBA 4DT1A 4Q6BA 3EF1A 4HGRA 4P4NA 4PW0A 4L3WA 5KS2A 3OTHA 4OKNA 1E7SA 3SMVA 5JIBA 4UOEA 3GRCA 4RD4A 1LBTA 3P9XA 2VJLA 4PO1A 1MN6A 5E4TA 1NASA 3UW1A 1NMXA 2C4KA 3FCAA 3L1HA 3LGAA 4WE3A 4ZAWA 4EA7A 5BN5B 5BRNA 4G01B 3MHPA 4NCXA 3RHSA 2FTKE 3LO8A 1PGQA 3TSCA 2B6HA 4AF6A 4MQ4A 4IXDA 2JFXA 3KE8A 5E6UB 4GVXA 4XD7A 5PNTA 3SGLA 3AP1A 4DS3A 4DTIA 5K03A 2LMEA 4OM7A 5KUTA 1XVUA 1VPDA 3K8QA 3ZH9B 3PUXA 3RJ5A 3KE9A 3U7RA 1EFPA 1TVKB 3FTNA 1MV8A 1ZGHA 5B3LA 5HS6A 3I2FA 1CZLA 4GP9A 4KNVA 2VNHA 1PS9A 1SKQA 2H2DA 3RFFA 4QOFA 1ZPDA 1QHHA 1B6TA 1OGYA 2DR3A 4NXMB 2PZJA 1OCEA 3IR5A 1P4RA 1ATZA 2FZWA 3N9IA 3O21A 4FP9A 5KWVA 5BWOA 2ZCJA 3NXSA 3DO8A 2XVXA 2GT1A 2F8TA 1C0PA 4ZEOA 3AB7A 4LV6A 1N2HA 1A7KA 1V1JA 3SEQA 2OZEA 2HJRA 1FP4A 4C5BA 2IEDA 1CVRA 5ESDA 3FNHA 3G68A 3WHKA 2FN9A 3UF0A 8MHTA 2I2XB 2Z83A 4Q16A 4OP1A 2H31A 5LR6A 3T95A 2QP3A 4C21A 3K35A 1GLGA 3CJQA 3AVYA 3PUWA 3WDKA 3P0FA 4QBHA 3IPXA 4DCJA 1JKXA 2G07A 2ZYWX 3S1AB 3MLEA 3NIDB 4BZQA 4DRYA 4W5OA 4B2LA 3IILA 2JFVA 3O93A 3TI9A 3PK0A 3LDGA 4Y2SA 2FVYA 3ZXIA 1AKRA 2EG5A 1GKUB 3KWFA 3ZDQA 5AHXA 4IJQA 1X14A 1Y4AE 2I71A 1YFJA 1R0KA 1YUMA 2ZUEA 3OH8A 1T1GA 1P9WA 4HDCA 4IV5A 2CMHA 1NW9B 4LS3A 4EPYA 1IZ7A 5ELLA 1W87A 5LSAA 3PJEA 1RS0A 2OD7A 2HSGA 4L9RA 2GBFA 4ZICA 1G42A 2VHWA 3F3MA 3ODPA 1DC8A 1P1JA 5B1EA 3K9FC 4JJIA 2QRVA 4RUKA 5ERGB 3HR7A 2CB0A 3EVBA 4GBJA 4HG2A 3IAAA 5HOEA 1UOQA 2YH2A 2B8TA 1H9BA 4JIGA 1JSRA 4JZYA 3MAAC 4Y2GA 4MUGA 2B99A 3IQEA 4XUGB 1VIVA 1HZZA 3AEXA 3DMRA 1USKA 4BC0A 3M6LA 4X84A 1SZPA 4L27A 2G72A 1M6VB 1M2FA 2GN6A 4TLLB 1J25A 4ZHSA 3OHMA 5FBZA 3WFZA 2QXYA 2W2LA 3KK0A 1REQA 2X4DA 3JQBC 3D9QX 5HF8A 4BNVA 2GLUA 2PMCA 3DCIA 1FX0A 4M87A 2WZQA 3HKCA 3DO5A 1DRKA 2P6PA 2AK2A 3L7CA 4TL8A 1WMDA 3L8HA 4EFMA 4O4JA 2QN7A 1E8DA 1RPJA 4GOLD 5AWFC 2P90A 4A7PA 1MX1A 3VH4A 4E30A 4QUHA 3T5PA 4BNZA 4C7OB 5J58A 1NU6A 3M4NA 4Z3OA 3Q9NA 4PZ0A 2C78A 2X14A 1G9XA 3RRXA 4WASA 4I4CA 3RVOA 1FTNA 3A1NA 4EITA 1HT3A 3UG7A 1H6BA 3KB2A 1Z4KA 4LISA 4M1WA 2VXYA 1JG6A 2ZPTX 2RC6A 4KV7A 4AVYA 1D5WA 1YQEA 2DH5A 3LLVA 5TDHA 3GT3A 2ZJ6A 3EXFB 4XUDA 4LECA 4PGAA 3I0MA 1QIKA 1XHLA 3OX1A 1Z4NA 2Q3JA 3WRVA 2B8JA 1EVZA 1ZZEA 3IDOA 4QO7A 3W1WA 3GL9A 1QPGA 2I8LA 1QFXA 5E9AA 4R2JA 3W6UA 1UJ4A 5CK5A 3QPAA 3ZJTA 1YR3A 2HDNB 1QG2A 1BJRE 4FX5A 3W1VA 1CV2A 1UCFA 1KVUA 5C2JB 1OAAA 3QPUA 3QPVA 2I8AA 1TLLA 2A1TR 3O7MA 4W8OA 3TDMA 4ZK6A 4YV7A 3IAHA 2RHMA 5EZ6B 3V8EA 3G2NA 3MUFA 2D2IA 1PK7A 3S8YA 4DV3B 2PRYA 1BD4A 2C0QA 1I32A 2WP8J 1DBQA 3T4PA 4ZHQA 1X2EA 1K66A 4YI3A 3UMJA 3A9TA 1B0PA 3HFGA 3DKIA 4N41A 1MW8X 1LPOA 4AFNA 1E7YA 1X1BA 3SR0A 2C5SA 4FWTA 3ZWNA 5AKLA 2R1VB 3THYA 2JLWA 2CDCA 5AOVA 1C30A 2YDXA 2H48A 4OD0A 2ODTX 1VFPA 3GVXA 2R87A 2B4QA 3AI2A 4PC3A 3SYMA 1B14A 3CRZA 3QEOA 5L7YA 5K6AC 2C5AA 2XX3A 3QG5A 4UXJA 1LPBB 1EK5A 3GRYA 4NQZA 3AERB 1CKEA 4I6EA 1H8HA 5DTQA 3R9WA 4P3PA 5SZJA 1TECE 3DVQX 3JSAA 1ORDA 1T3ZA 2RGDA 2FFHA 3O4GA 3T1OA 3TNYA 5LXTA 3WAGA 2P41A 3H1AA 1GFZA 1X38A 1Y9DA 1UMBB 1QQ6A 2A9KA 2OY0A 2ZYAA 3GLGA 4PXSA 3CKMA 2QZJA 4AULA 5EE5B 5BRAA 1MIOA 1HKHA 1N78A 1FYXA 3SM9A 1ESMA 2REBA 1P9NA 4KNWA 2EXXA 4M9ZA 4F6RA 3GHYA 4OP3A 2AC2A 3FYUA 2VAMA 1OT3A 5IDVA 1R6XA 1ZKDA 2I65A 1LPAB 2MSDB 3I9FA 4HLUC 4IX9A 2BKLA 4F1WA 5KJFA 1RC1A 2XNHA 5JSYA 3X1KA 1WVIA 3C24A 2JFQA 4I0WB 5GJWC 3R7SA 1L4GA 2C9ZA 3CINA 4IMRA 4WKNA 1Z88A 5AUQA 3KPVA 4DMHA 1DMRA 2JGFA 4RV5A 3RKUA 2CL0X 4ZYUA 1NN5A 4G0VA 4HDOB 1O9HA 3F5DA 4UVEA 3HSKA 4BLPA 1QQ5A 4ZK2A 2XB9A 1HLPA 4IVPA 3R3XA 2X0RA 2G28A 2VT3A 3B5IA 3AVUA 1EEXB 1TAGA 1TA4A 4Z54A 1UZMA 2ZTVA 1V8BA 1D2CA 1Z6QA 3KD3A 3MLAA 4EKIA 1NVVR 4NMXB 4NJMA 3I5AA 2ZAGA 4BTLA 1BSVA 2GM3A 1ENPA 2IDKA 3V8NA 3CIFA 2F43B 4KQ6A 1A8SA 3KOOA 5EGNA 1DX4A 4AG6A 3NALA 1DKLA 1AZSC 2ZWIA 1B7GO 1T4CA 2ZUSA 3QWIA 4NARA 4YP5A 5D1NA 3VYUB 4AMBA 2PH3A 1FU8A 1O95A 3C3MA 3OKAA 4XGKA 2B4TO 4R2HA 2R1ZA 2VDVE 3F2IA 2ACKA 3I6IA 5HK9A 3OZCA 4GPZA 3RODA 2ABWA 4FMPA 3IIIA 4CIWA 3FAZA 4XGRA 3GUCA 3U3DA 4DN6A 1G0OA 2AOVA 5JDCA 3TLJA 1Z33A 1J7JA 2HCBA 3NU1A 4ZXPA 2VDKB 1X77A 4ZEWA 3EISA 1R4ZA 4CWAA 5F3RA 2C3OA 3BMXA 1KY2A 3UENA 1LK5A 1O87A 1H1DA 3HB5X 3RS2A 4Z7JA 1QZ3A 4ROSA 3AG5A 2J1LA 1E5LA 4BMYA 2X8BA 2QNIA 3LOPA 2TS1A 2YFHA 2Z8ZA 5IDQA 4OI2A 4G25A 2CUKA 1RLIA 4TWAA 3T3EA 3AM3A 1ABEA 3NRBA 3IH5A 1PNRA 5CG1A 3RT7A 4JOQA 5J23A 2JFYA 4PRLA 3B6ZA 4GX5A 5D5HA 4NOMA 2VWGA 3B5EA 3QVOA 4B9EA 4G4GA 5AVZA 1OPXA 1L5HA 4UVIA 3WYNA 5CVTA 1DSSG 1L8XA 2CLIB 3CUKA 1YH3A 1FS4A 3R3WA 4IUYA 4KXNA 3VC1A 3ZR4B 3IR7A 1U2ZA 2CV1A 1L5FA 3BULA 1J24A 3ESDA 1KO4A 3S2GA 1XVLA 1WMFA 2EATA 1VKJA 3TCXB 3LZ6A 1XZJA 3ZPXA 2HA3A 3QXXA 2A14A 1ZN9A 2EFYA 5D6NA 1K98A 1T9GR 3Q3VA 3QKUA 5KNCH 1LBHA 5JMTA 2HTEA 3NHJA 2IH2A 1N6OA 3FKSA 5IBQA 5BSGA 1IY2A 1K63A 1I4EB 1UH5A 2GVNA 3ACBA 3BSWA 1DRVA 1HH4A 3M6XA 4HMOA 1M73E 3O8OB 4RVUA 4LQCA 1KSGA 2QUJA 3TRJA 2IQ5A 2GJ8A 3A9CA 4LUCA 3F1LA 4ZI7F 3CRVA 1SELA 3EXAA 1TJ3A 1MAUA 4BO0A 1O5TA 2R8PA 1A8UA 1N5KA 1XN1A 5H82A 2NPIA 3KFLA 3LNCA 2BFBA 1ZP6A 3BL8A 4R8RA 1KDYA 3ZCTA 4AM8A 1D7AA 1UDBA 1QH8B 4EJSC 1UJMA 4Q48A 2H1RA 2WKRA 3Q0EA 2IHZA 3PNOA 3MINB 3E5MA 4LRWA 4WOBA 1Z6TA 3MT7A 3TGLA 3CEAA 3ICPA 3QXJA 1SULA 2GN8A 5CT4A 3RFCA 4RFVA 5JTTA 5CBPB 1F20A 1XQ9A 2ZVDA 4J0DA 4RSHA 4DMUB 5IJ0B 2YYYA 1SUBA 3IERA 5F12A 3EPPA 4LDQA 1E1RD 1P1RA 3PHBE 4URHA 4WEQA 3WGYA 3CRW1 4ALKA 4W1RA 3ZW9A 5B58C 4FFDA 3KDPA 5DM60 2C8KA 5ERXA 4DA8A 4WI1A 5F3WB 4FFBB 4C6RA 1JHPA 4AG3A 4LY6A 3PP8A 5KYGA 1CUBA 1JIKA 1I2DA 3R9XA 2NM0A 1J39A 3MCZA 4YI5A 3M89A 5M2QA 3SZMA 3C7TA 3UJDA 1VKZA 1D07A 1ID1A 1SKUA 1US8B 4GM0A 5JAQA 4FBLA 1V4BA 4F8JA 2G1AA 4I1PA 3V1NA 5ED0A 1G291 1LW7A 1MJGA 3LCRA 3OBIA 4RBNA 1QNFA 3S2YA 1GM5A 4FKZA 3EPRA 3WWEA 5LJIA 2JDIA 1HYBA 4HNVA 4FB4A 4V2IA 2B5OA 5IEJA 3NNDA 4KOEC 3G9TA 4PAWA 4M76B 4RSGA 5C18A 1HDOA 3OIWA 1BE1A 3STWA 4B82A 3OPNA 1BXKA 2YQ5A 3UAWA 3O9MA 4HMQA 4PN7A 2LBPA 4X54A 5TE9A 3KZ1E 2PIDA 3WK9A 3TXXA 3WRXA 3FMIA 4EKEA 5HGXA 4JQOA 4MUAA 1IZ0A 4AN0A 4BN4A 4Y6SA 2NUPA 1G17A 2L82A 4NFLA 2GYUA 3PI7A 2XA1A 2DFTA 2IQIA 4CM5A 4WERA 1YIAA 3NS7A 1N5MA 1IATA 3U3RA 1IWPB 4BNGA 3ECSA 2HIAA 4PX3A 3GPIA 2F8MA 3K0CC 1Z73A 4D0GA 4BE4A 1ZI6A 2Q3MA 5GONA 1IPHA 1A5TA 4RU1A 3DFZA 1L5QA 1QFYA 2Z9BA 3JQDA 1I2MA 2ZYGA 3CSDA 2HDHA 2IYQA 1T3LA 4FEGA 4Q24A 2IS6A 1EK6A 1WO8A 3PUJA 1QBKC 1JILA 4Z3KA 4DT1B 1NOIA 3DW3X 1OVGA 1PIWA 3T8YA 5DSXA 3LFUA 4LJSA 3NDRA 1NZFA 1GHTA 1EVEA 3LZCA 4DMKA 3Q40A 5L4SA 3DGFC 3NHPA 3A1VA 4YAUA 5L3QA 5HUHA 2C04A 3A11A 3NI2A 4O8ZA 2I4LA 4P33A 3B70A 4YCBA 4I1SA 5FFNA 3OE5A 3U4HA 2BR5A 1L0BA 3EWNA 2IU0A 3PD1A 2EZ8A 1GILA 3R0IA 3WQRA 5F35A 1ZSVA 4JENA 3E84A 2BONA 4MV0A 4E5DA 1BXGB 3OQPA 1X1SA 1E2KA 4LHZA 3BWDD 4MI1A 5DM4A 5C5IA 2VQDA 4WNAA 3ABIA 4UM8B 3CO5A 4EHHA 1CF9A 3TXYA 1QVRA 4OHYA 3AF1A 3H17A 4W7IA 5SZKB 1VLJA 2WWHA 3G1TA 1R15A 2UVPB 4WK4B 5E1BA 4KFRA 5K3DA 2FF5A 3V1LA 4DBZA 3DOIA 3H5AA 3C4JA 3VPAA 1DV2A 2PL5A 4BGIA 4F12A 4AL4A 4ZPXA 2RONA 5DXJA 1VSQA 4MKHA 5A1TA 4TSRA 1E3DA 2PLNA 3FNBA 1TTHA 4IDOA 3TRDA 4F9EA 1DWUA 5CEFA 1FP4B 4U2KA 1NV9A 3GVCA 5LDHA 1NLMA 3WYEA 4LDPA 2G2SA 1XAIA 2G3YA 2YJZA 5AK4A 4ZQEA 3RHTA 5BRJA 3MRTA 4MPPA 4NYMQ 5EXTA 4MITA 1X2BA 3H2SA 1QKIA 3FDXA 2GKGA 2NYRA 4P6VF 5DV9A 5TMPA 1NVUQ 4G67A 3W77A 3PXBA 3M9LA 3E58A 1IY8A 4FDVA 4I1YA 1DIBA 3QVGA 4DLRA 4D8TA 2XE6A 4Y6LA 5CCEA 2BOVA 1Z26A 2KI5A 4MR9A 1BDJA 2JHGA 3ZKWB 4BQQA 1YGPA 3KZNA 1QR6A 2Q8NA 4IIHA 1GTSA 2P2GA 3OG9A 3VUFA 4K9RA 2WZCA 3IURA 1W49A 4A23A 1PUJA 3GOQA 4BEWA 1KXJA 1UPBA 2GH1A 3LBHA 1PNQA 5DGTA 4RK5A 3OMXA 4G5QA 2F9FA 2ZI9A 4KW7A 4G8JA 4YQEA 3D6MA 1UJNA 2LIVA 3C98A 3F6EX 5EIXA 5IVDA 2OOKA 1VP9A 2BMWA 4YMSA 1I3KA 2FFAA 5JDIA 2Y71A 1V7PC 3Q2KA 4M8NE 2P2LA 2NYAA 2ZRAA 1JIVA 2PK3A 4K05A 4TGLA 4L72A 3ZU6A 5C31A 4NE7A 2QG6A 4TTIA 3VR6D 1JYFA 2C58A 4BHRA 1NW7A 1F2VA 2PZBA 1KNQA 2PXHA 5DWVA 1LBEA 1REQB 1Z8HA 9MHTA 3VTAA 5EJ6A 1GNSA 4K9SA 3PFKA 3WOVA 3G8CA 2F8LA 3LZDA 3HKCB 5K3FA 4YO8A 1SZDA 1C80A 2Y93A 1QTQA 2JKYA 3F9IA 5DCLA 4Z0NA 1SO8A 1N3YA 4JBYA 2BDUA 3TIIA 2BGLA 3OT5A 1A4UA 4YS6A 4BBJA 1ZONA 2GZDA 3IL2A 3C8MA 1KOLA 1G21E 2DTEA 2P1ZA 4PLWA 4RY9A 3TK1A 5JD4A 4N5LA 1C7IA 1JR3E 1IUNA 1RYNA 1VFNA 4BO6A 3OTQA 5DULA 4I5IA 5JPCA 1FPMA 3HCAA 1Q6ZA 3NGLA 2QMYA 2AWOA 4YJGA 1RFLA 3ELYA 2C57A 3ZHXA 3Q7TA 1IG3A 1T6NA 3I9V6 1X80A 3U5TA 4BBAA 5BSVA 3AHGA 2M32A 1JBQA 1AS0A 2D1TA 4CIAA 3CW9A 3OSUA 1D4ZA 3TECE 3U4IA 4JGBA 3TLEA 1ODJA 2CXTA 4NZMA 1IQ0A 2FQXA 1II8A 2JHFA 4M6WA 5IJ9A 4PONA 1QGUA 3CUSA 4REMA 2QN8A 1FVHA 1QRUA 5BN3A 3VI3B 1N9GA 1SWVA 1XVTA 1N2JA 1Z2DA 3RRYA 5CU7A 4A0SA 1F2TA 1NQTA 2REQA 1G21B 4LXYA 3OI7A 1P75A 1LLCA 3R75A 3DNMA 1OX5A 4B76A 1FRFS 2X58A 3U19A 5DWQA 3E03A 3NMUF 3EC7A 2I1VB 2BHSA 1LS1A 5BN4B 4ZHQB 1JEJA 2GMWA 3RH0A 2RGEA 3OOHA 4FFNA 4TS4A 4BASA 2NTVA 4XD2A 4QATA 1S2DA 2D00A 2GDJA 2PUHA 3ZLBA 5A6VA 5DN6D 4IFTA 4EY6A 1CIVA 1U80A 3GFTA 1R18A 1AC5A 1U2QA 3PUIA 3KXPA 3KZOA 3S3TA 5KVCA 5ALPA 3EQ8A 5DXAA 1PGPA 1JEDA 2JFBA 4EEZA 2H8GA 1UFVA 3N2IA 3GK3A 3GUYA 2PAAA 4QQNA 6ABPA 2ONZA 3X1YA 5F9MA 4R6XA 4N7RA 3TM4A 4QTXA 1GNQA 1T3TA 5TMBA 5KYYA 4YPOA 1TM4E 2NV2B 3LUFA 2MYNA 3DF7A 2ZANA 2GPWA 3V2IA 1VKHA 5HRCA 2G5CA 1GRQA 1FLAA 1WLSA 1Z34A 4IZ6A 2A7XA 2W48A 2ZJ8A 4EAQA 4HYEA 5LXTB 2XXAA 5K2MA 1V95A 3KTAA 4H7EA 1J8YF 4C14A 3CSSA 4Q1FA 1JQDA 5SY6A 3EIXA 2COKA 3CLKA 1G5QA 3KVRA 3VKVA 3ZN2A 3KQNA 1KO1A 3LG2A 4DCVA 5ECWA 3DUFB 1WCV1 2YRFA 1QANA 1GG5A 1MAAA 1L8AA 2EF1A 4EB6A 5B3KA 1RAIA 3ZW8A 5BN3B 1KI9A 3M6AA 3UT5B 4KGXA 4YDQA 4EJFA 4GNKA 4FHEA 1Q7RA 4F3TA 4ZVRA 5JNLA 3WA7A 3ND9A 3K32A 3V4OA 5IS2A 1XD8A 4BNIA 1KKMA 2G8LA 2I4OA 1J0AA 1OC4A 5LYYA 2HSZA 4MMYB 4RD2A 5NLLA 2ECOA 4NE9A 3WQSB 4F86A 5CFQA 2V54A 4XM2A 1LLDA 2B2CA 2AFIE 4BMOB 1MGOA 2RGWA 5B7NA 4ZCRA 3WR5A 1R0BA 2XYHA 1HYQA 2QXTA 2QHXA 2QVCA 5BWMA 1G3RA 2QGZA 4W9MC 1CZNA 3IV6A 2BKVA 1C3JA 1H93A 1SXQA 2GUWA 4QAQA 4QFCA 3SQOA 1CY7A 4H7FA 2OO7A 3WBKA 1A1VA 1BE0A 5IBPA 4AI6A 3MMPA 2CJXA 2QMOA 1K68A 2XMRA 3I42A 3M1IA 4NJMB 4WLUA 1CJUC 4ZOLB 3B1WA 5EPUA 4EABA 1N33B 5JALA 3ASYA 2QG9A 4C6SA 3PQ2A 2QMHA 4G4JA 3EEYA 2LP4Y 1ZHOA 1XVVA 4WKCA 2IRWA 1NVMB 1QIGA 3OIFA 4JEHA 3LT1A 1T4CB 1WXFA 4WFIA 4HB0A 1SIOA 4OHKA 4YHHB 2XYQA 1RNLA 2MMGA 4KIWA 2JFGA 3IPCA 4LZJA 2FUNB 3FYCA 3O2SB 1YQUA 3WYAA 5DCUA 1ZY2A 3INYA 2QRJA 1TM1E 3QOWA 1EGQA 4OQQA 3EVAA 4BIIA 2WIJA 1NW5A 2WG0A 4D9BA 4DR1B 4YRSA 2DY0A 4K6FA 3H2YA 3RS3A 4B7CA 3BGVA 5KNCA 5MF6A 3DAHA 1NJFA 16PKA 3CRMA 3ZE1B 4ZDKA 4P0QB 5BP7A 4X8LA 2OSBA 3HZZA 4QTUB 3MS2A 1K7XB 1TC1A 2WU0A 1B73A 3LBAA 1R4AA 3NVMB 3GAZA 4RFSA 5GAJA 1XJCA 1NW8A 2F4NA 3GJ0A 3NBZC 5SYNA 2H16A 2FWMX 3A32A 5AI6A 1U1GA 5H9WA 2ZITA 1EPUA 4LPKA 1P62B 1PF7E 4UNRA 1V3UA 3CWZA 2CZCA 2QRLA 3ETDA 3IUJA 4OHMA 4UNNA 2XAAA 4HPXB 1W5SA 1E79A 2C5BA 1U02A 2RARA 2Q9CA 1RZUA 1QYCA 2DECA 4QM6A 1E9AA 1Y48E 3GP5A 5JVDF 1GQQA 1L5HB 4IHAA 1T2UA 5JYDA 4IO0A 4JEMA 3ZHYA 1DUSA 1FVFA 2E5WA 1O89A 3FMOB 3Q7PA 1PQPA 2AMLA 1R6BX 4GYYA 5EAIA 1I6LA 2VWQA 3EQZA 4IWYA 2TMDA 1MAVA 1O94A 5G1NA 5A06A 4OHRA 1WBBA 3PNYA 2V1UA 3FIJA 3GFVA 3NETA 2KBFA 1OI3A 3NPAA 3JQEA 3E3LA 1JI3A 1IB6A 3MWDA 4BVAA 2XVAA 4LYHA 3HCEA 1U9YA 4FNGA 2KB0A 3ZWPA 5EZ5A 1TYDE 1NJ8A 2YV1A 4O4IF 4PX2A 3SC2B 2CGEA 2OGUA 2JGAA 4NCNA 3ZTWA 3SQNA 2ZTSA 4ZYVA 5LQJA 4QD3A 4GG1A 4AJKA 1FS6A 2DUWA 2I0FA 4X24A 5EIOA 5BMOA 2VPXA 1CR4A 1UMDB 1DIOB 2HHJA 3H5IA 2JIPA 1EWYA 4JKYA 1PT7A 3P20A 4PHFA 3HRIA 4PYIA 4D9JA 2XPCA 4MK4A 2Y77A 3MM4A 4ABTA 1VCOA 1DOAA 2IDJA 4RA6A 4B8ZA 4BBPA 5DYYA 5EVCA 3X43A 1N2BA 2JFZA 3CX4A 5KHOC 2XYRA 4RLQA 1I8TA 2ZS7A 5C0OE 1M1NB 3FDFA 5CURA 3LPCA 3SLKA 2WHEA 1TPYA 4NOLA 5BUZA 3T41A 3KXKA 2D5CA 4IL5A 4WK2B 5K3AA 3GV0A 4FNAA 3ZBUA 1BG6A 3TW6A 3PXCX 1S6YA 3BH7A 4R1NA 5KVQA 2YZKA 4DMGA 4NCHA 2D0IA 4Z8YA 1KPGA 3EXEA 5JCXA 3VDQA 1V4NA 4A0HA 2GERA 1B6RA 5BV7A 3V2UA 4Z7QB 2DQYA 2FEWB 4B45A 4KN6A 3ESXA 3LI2A 4LZNA 4PLZA 1ZAYA 3W4IA 3H8WA 1R37A 4C76A 3RFTA 2PH5A 2E6KA 4CHTA 2H7XA 1II0A 1DOHA 1U1IA 1U0NA 1VCHA 2ODEA 1XYVA 2SKEA 5TT1A 1H5QA 3B3FA 4OAPA 2BM9A 1G60A 4X60A 5BURA 2EBFX 3LDUA 4DNOA 1UJ5A 4Y9SA 3UGKA 3D8HA 1F2DA 4GW3A 3U3MA 2HY7A 1XTRA 3A25A 1IQRA 5HG0A 4G5YA 4UMDA 5LLTA 4CEIA 4X97A 3Q6IA 3LY8A 3FSRA 4PAQA 2W2TA 3GUZA 4XGQA 1VL8A 1V8FA 2IY7A 2REXB 3EVZA 2O2CA 3JWJA 3BD9A 1Z0AA 4BQSA 1O54A 4R2XA 5M5BA 3AKZA 3GLGE 2RE8A 3PCRB 4S1OA 3B82A 2WUDA 4YVFA 3SEZA 1BWRA 2AJLI 1QB7A 2ZIAA 3OFKA 3PSAA 1VLMA 5LCXA 4D74A 4F4DA 4JLVA 2PUDA 3IOBA 1DEAA 2NW6A 4G0PA 1A9PA 2O5VA 3RSHA 5LPNA 2O2SA 5JQGA 2P40A 2C2BA 4G97A 2NUPB 1LSOA 4RF5A 1XDWA 3IKJA 4UAGA 1HTBA 2EFJA 1UXKA 4FFMA 3CNOA 2GPAA 4X7BA 3CVWA 2D62A 1W96A 2C9CA 4JVOA 3WLNA 1LRLA 2FK7A 5FYQA 2G4VA 4W5JA 4CNQA 3AL0C 1R50A 3H2KA 2N0SA 5HJ2A 5BOSA 3HKEB 2AD5A 5DTIA 4KDEA 3P52A 5L3RA 1QGYA 1QP4A 4YRCA 1GGMA 3VRHA 1SHZA 3PRHA 2WI8A 2UU9B 1MC4A 1NMYA 1R0RE 3AJEA 1D5CA 3DWGA 3RTGA 621PA 4LF9B 3MT9A 4BMSA 3MQ4A 5FKJA 2KM1A 3JW8A 4LTDA 4RE5A 1F8YA 1XEWY 4MNTA 4B2PA 4B6OA 3RJTA 1AGNA 3A10A 3AF0A 4KQ9A 5G0UA 4EA8A 5L3QB 4PVDA 2QSZA 4R3WA 1ML4A 2R1TA 4YONB 4JT8A 2H17A 3VNQA 2I1LA 5CD9A 3IJ5A 1KSHA 1Y5IA 2NIPA 2QY9A 4FQ7A 5CYFA 4BLVA 1XV5A 1P2DA 1JG2A 2IDZA 4Q6WA 1G8HA 2Y1XA 4I5GA 5B3JA 3A8TA 4IS2A 5FPHA 3UWKA 4DV5B 4C0XA 4WNAB 2B61A 3PT9A 2P7HA 4WW0A 8LDHA 4FT2A 3ORSA 4NWIA 5SYMA 3PWKA 1N2ZA 4U7HA 1PJ4A 1R8JA 4R1QA 4TM7A 2FW9A 3CS3A 1QPZA 4B3CA 4BZZA 4NZNA 2JIDA 4FZVA 1C7EA 2PXXA 1UBGA 3ENQA 1M6NA 3C3XA 3JQFC 3L7LA 4CQLA 1R3DA 3PPXA 4BFSA 1HM5A 3G2HA 2H57A 3F7TA 5CW1A 5AVWA 4CM9A 1M54A 4BFXA 4EO9A 1RP7A 2RHDA 1HQDA 5J4YA 4KDRA 4V3CA 2B7LA 4FUTA 5KU1A 2IOFA 4L8FA 1OMOA 1YAJA 2WIFA 3QJYA 1HZZC 1IPEA 5I7HA 2OO5C 2ZBUA 3BS4A 1ZH2A 4M99A 4NBUA 2ZIUB 3DOCA 1Q1AA 3ANMA 2PBFA 3QVGB 2DE0X 2L2QA 1GN9A 3DKVA 2IVFA 4OQPA 1DRWA 4MR9B 4X1IB 4Z4CA 3EVFA 4A15A 1QRTA 5EXDA 1AKWA 5CFPA 1M10A 3VTKA 1O6GA 1P5JA 2AE1A 2ZROA 5FL7D 1HE4A 4HNSA 1QYWA 5HX7A 4CT5A 3FTCA 4BLRA 3KL2A 5NULA 1KY3A 3HO1A 4BXOB 2CXRA 4GO1A 5JBQA 2ZOSA 3VU3A 1N0IA 2Q6KA 3EMKA 1N9ZA 3AEZA 4HLDA 1Z3CA 4KE6A 3HLYA 4LZPA 4FDAA 4Q02A 2WMOB 1GZVA 4G23A 2CLDX 3G85A 1X0VA 2J7PA 2BE9A 4Q4DA 3DEFA 2I3ZA 3DMYA 1KETA 3H5WA 4QBTA 4ARIA 1PI3A 3VC2A 3NC0C 4M0MA 4DM4A 1CQXA 1OF1A 2R9VA 4C0LA 4NZYA 1WEKA 2P0EA 2BF4A 4RL6A 3DMHA 1Z9BA 3ZZ1A 1HT2E 1M67A 4ZO9A 1H3EA 1CLEA 1H3FA 2BH2A 2DLDA 3HLKA 2BP7A 1IEXA 2GPNA 2WAOA 4RF4A 1XEXA 4RGVA 1AGPA 1MBZA 1UOOA 4JOBA 3J81A 4HAOA 1XMPA 5K3FB 3Q3CA 4OHZA 1YC2A 2XMQA 2CFIA 2FQYA 3PXXA 4R9SA 5AJYA 3BTOA 7MDHA 1KGDA 2E85A 2CF6A 2HPAA 3ICVA 1N2IA 3R5JA 2JKZA 3C3WA 4K8RB 4CCWA 1E1MA 1N4DA 4WBXC 3HA2A 4PANA 4CU2A 3Q0IA 3RYCA 4UUQA 3N2KA 1GPBA 1U0TA 1TUIA 3S7ZA 3VDMA 3IUYA 4OQYA 3V97A 2OHXA 5JY6A 2VDUE 1X39A 3HXKA 4S1NA 4NOJA 2DPYA 4ZMSA 3NUQA 3O2NA 3OOSA 4OQNA 4UMVA 1QPBA 4LJKA 1P7PA 1WU7A 1X80B 4JYMA 4EJMA 4EPXA 3B6IA 5B7QA 4ZARA 4O0MA 1VGRA 2YHUA 4MULA 1BQEA 2JS7A 2XECA 3I37X 3AMVA 2Y0PA 1R16A 2W2NA 3EEBA 1KMNA 2QZPA 4R1UA 4UD2A 1GZ7A 2EDCA 4M6WB 3V48A 5IH3A 5G1OA 1QGUB 1YASA 1V41E 3OQ1A 2NU8B 1A2QA 4CGYA 2P3LA 2ACEA 2FFBA 4G0QA 4G0OA 4NQRA 1Y82A 2V0CA 1N9GB 2V4ZA 1ZS9A 3HR8A 3PQ4A 3PQ5A 2ZRPA 3E2PA 1F2TB 4UPDA 4MRRA 4EOGA 4EFLA 3PNPA 2OHHA 4XTRA 2VT7A 3CA8A 5DP1A 4XUEA 5KNBD 2VOJA 2PO5A 2QL7A 2OCYC 1QNLA 5ITWA 1CZOA 3D6UA 3PJRA 3K73O 4DR5B 1L1RA 4KACA 3PB3A 4A9AA 2Z5VA 2JLZA 4EEXA 4PO3X 1JJVA 3IQDB 4RELA 3RT9A 1KZ7B 4XM1A 2XI4A 1B6SA 1SKMA 3R5XA 4GC9A 4JP3A 1S3FA 3IP6A 2IUSA 4LZWA 4ML3A 3GR6A 4LSZA 5ICFA 5JAOA 4U2FA 3L0CA 3F5QA 3PD0A 4IICA 4MV1A 3OTGA 3GY0A 1WMBA 4L15A 3UUWA 2HWKA 5JV5A 4TWJA 5KYYB 4JU8A 1HE5A 3A6GA 3K2QA 4HXYA 3HCBA 3KSMA 1R5BA 4EUFA 1ZD2P 1ODTC 1XZCA 3ND8A 1R0ZA 2OQIA 2C88A 3D81A 1LBSA 4OOEA 5CEJA 3TPFA 5F77A 4HTFB 3KTAB 2GEFA 4XWOA 4BDSA 2AG0A 3BZWA 3GW8A 4E3ZA 1KJ8A 1NVBA 1NFRA 4MRPA 2FMFA 2X40A 4MVXA 4PQYA 4UTOA 4ALJA 4MHTA 1XTIA 4WHMA 4HO1X 2IS1A 2F3PA 4NYJQ 1EA7A 3O9ZA 4EVRA 4JR0A 2RDMA 3I2HA 4XPIA 3G3EA 3O84A 3BTVA 4BQOA 5FUWA 4U5QA 3PPYA 1KK3A 2D1SA 1XMOB 1WUIS 2ORIA 1VE9A 2DULA 2PR2A 2OLJA 1Y4ZA 3SC6A 3WMRA 3LHKA 3PHHA 4JWTA 1Y6FA 4MAAA 1TTQB 2FWIA 2R79A 3EFBA 2O6LA 4TS1A 3DLHA 3K9QO 2ZU0C 1Z68A 1ETHA 4OFXA 3ZI4A 1Z8FA 5KWJA 4XFKA 3NTLA 4HNTA 3HP4A 4W9RA 1COWA 4U02A 2IOFK 3TZHA 2VRCD 1G19A 4E5UA 2QTLA 4IUDS 5JS2A 5D3KA 2CSXA 5EN4A 2Q2OA 4OTZA 4FJ0A 1KMMA 2HKIA 4MCAA 4ZJYA 4RD6A 5CB4A 5JAZA 4WZ6A 2GTPA 4DDHA 1RPAA 1Z2NX 2D54A 3FNFA 3H0EA 2O2IA 1FSSA 1VL0A 2P9FA 3LOQA 3NPMA 4NE2A 1MJHA 2BGNA 5TEVA 2FK8A 4RJJA 1QKJA 1EJ2A 2QV0A 3GNTA 1I13A 1YZVA 2NGRA 3IP9A 5KAPA 1YV9A 4DWVA 4C20A 1MXFA 2WJ3A 3ZWYA 2HSJA 1P81A 4I7EA 4MZXA 4O5OA 3GXBA 1Z5PA 1BVRA 4JBHA 5BSTA 4O1IA 2IP2A 2PUFA 4YCJA 3WGHA 1BFDA 3M3PA 3ROEA 1WXXA 3FZEA 5AM3A 5KC9A 3OZRA 1W6RA 3GCXA 4KN9S 1QVWA 3S6JA 2V8OA 4IIUA 2DWQA 1Y1RA 4R8KA 5BPFA 2IODA 4HGNA 1VLLA 5B5SA 2PZMA 1DBWA 4WY5A 3DJYA 2JHPA 3L0DA 3NB0A 2WLSA 4JWKA 3H83A 5ANRB 2CLOB 5EHGA 2OC9A 3IT2A 1FFCA 1YRYE 1X7GA 2G16A 5FD8A 4KMOA 4OB6A 5HBGA 5F3DA 1E0DA 3LAWA 4EKYA 1QMPA 4ASUD 3HI6A 3SZUA 3L7NA 1KY4A 3QVLA 3CZMA 1J5XA 3ILHA 4UKDA 3ZBPA 3W5DA 3CZ9A 3CJRA 2Y1DA 2WILA 4FVTA 4ZV9A 3BWCA 3IE2A 5TVGA 4DF3A 5GQSA 3Q3IA 4HKTA 1OR8A 4D82A 3LJKA 3AY6A 3WOHA 1V4VA 5DNYB 3CE9A 4E08A 2PKQO 3G8DA 4PRYA 4GKKB 5AYVA 4B71A 5TARA 1PJCA 2W8BA 2F90A 4DLWA 2GBPA 1GXSB 4Q47A 4AQYB 1M5RA 2BKAA 1AS2A 1WZEA 3AI7A 1YS7A 4X9XA 5HIAA 2JAPA 5ITVA 2AN3A 3DYBA 4YQYA 1QP8A 3ER9A 1ENOA 1UFQA 2I6TA 1HNZB 2IUYA 3MWDB 4NKRA 4O2LA 4UNPA 1M2EA 4BO1A 2NO6A 4HEJA 4EDFA 2YYSA 3HDQA 3GLHE 5FBLB 2BFFB 3TDNA 2QNRA 1S9HA 2WD7A 2WJHA 3KSDO 5ALXA 3ZJ5A 4J8PA 4AK9A 1Z7EA 4LRTB 3UEOA 4N5IX 3SQXA 1BVYF 3OJ0A 3CVOA 3IDQA 3E27A 3GJ5A 2OT3B 4HPWA 4OG2A 4EGAA 1A9QA 1THGA 2PZLA 3OLWA 3EZ6A 2IXAA 2P67A 4GD3Q 1IHYA 4DXAA 2Z6QA 1AS3A 5HKLA 3H42B 2HCFA 1LC0A 4GGPA 3WQHA 2WDPA 3TLXA 1XDSA 3LW8A 1SBHA 4UAVA 4UJ3A 4XB2A 2BGTA 2DKFA 4UAUA 2V6IA 1LWNA 3IQWA 1FSPA 5ITSA 1LJUA 2QMEA 2WM3A 4YV2A 3U1TA 4GVLA 4PYOA 2YHAA 2HHCA 2XUDA 3BL6A 2DSTA 1E6EA 3QGMA 2AE2A 3MMZA 4FLFA 2A1UA 3IVGA 1E3SA 3GLHB 2ZM6B 2QPLA 3PJDA 2VHCA 4EZBA 3EXEB 2QB5A 3H16A 3HH8A 1USWA 2ODQA 1A7UA 4PFJA 4GXTA 3F67A 4Z5XA 1SCBA 1C7RA 3GQBA 3ESAA 4YRAA 3G9QA 3L4SO 1NP6A 3ZXXA 3BMQB 4TXLA 4URYR 2WE8A 2WBLC 4BNDB 1Z8NA 5H83A 4PWYA 2ZWAA 1RYMA 3I4LA 4MYSA 3ICEA 1NR5A 1RCUA 2PS0A 2V1XA 2WKQA 2FF7A 4DYHA 4OXNA 1OLXB 3H7AA 1KFJB 3KZMA 1G8JA 4K3UA 4Q3BA 4RH0A 4Y8VA 4D26A 2VP5A 2Z2KA 1GAJA 3BAZA 3CZCA 4ER7A 4CEIB 4PGHA 4J7UA 4F92B 2GM4A 5KSWB 1NJ1A 4ZZ2A 1F6BA 4YJ3F 3SQDA 2JZCA 1SUPA 2GJ4A 4H7PA 4TMFA 4E7OA 2O2EA 4JBXA 2I99A 3L6CA 3AI1A 4LJ7A 5BSWA 1UC5B 5KYVA 2NXEA 5BYJA 1ZJYA 4PSDA 1W8IA 2F9LA 5L4LA 1P61B 1J49A 2YR0A 3FRHA 3OZFA 4MQFB 5HBRA 5AQ1A 1TKBA 1N32B 4KO2S 2ZEJA 2LCFA 4WK6A 1E1YA 5HTKA 2PS3A 4LA4A 2H4ZA 3ITEA 3HDHA 2Q3BA 1S5PA 4NFYA 5J2UB 1C4KA 1V11B 3HXMA 3GPDG 1XDZA 2JG3A 1MQ9A 2E7ZA 2C7OA 4ERXA 2HOQA 1JE0A 3ETHA 3WGJA 2N1BA 4CJXA 2JCXA 3SPXA 2HAEA 2WD9A 5H4HA 3VDNB 2C1ZA 5BOSB 2DERA 4PYLA 1UDAA 2EJVA 1N2CA 3FLEA 4FSDA 1W93A 4FXPA 4MJLA 4OH7A 3JYNA 3D8RA 3QU5A 3REQA 2HBQA 2WIGA 1FLNA 1TFRA 3MJHA 4EKGA 1H2HA 1PYGA 3VBCA 3V9PA 4TYNA 4MW7A 2RIRA 4FFRA 2ZE6A 3MRSA 5LBTA 5KC8A 3OCCA 3QWFA 5FFFA 3FBWA 4HDSB 3T5CA 5L6MB 1AQIA 1D4FA 4U3JB 1ZRSA 3QRWA 4N82A 4R2WA 4Y2XA 1MFPA 1JHUA 2FX2A 1G1AA 1O5OA 2O3UA 3CIOA 3K6RA 4FLMA 2QJTA 5DPMA 2XLBA 3C1TA 5JCOA 4CG2A 3T4XA 5CDTA 2HHAA 1GTL1 3OX4A 4DQKA 1J5EB 3MZ0A 3LX4A 4GI7A 4HZIA 2QSJA 2WHYA 3H3JA 4BNJA 1P1KA 3R9IA 3L92A 4RVGA 9GPBA 1WV0A 4OLFA 4PX9A 3H75A 4DDUA 4CTNA 4DUZB 1SRQA 3N3BC 1OREA 3HFJA 4EGSA 3UAVA 5EJMA 1WPGA 3QLUA 1DEXA 4C22A 2FW7A 1FXUA 3NHFA 3QKRA 1XSEA 3BIFA 4CQLB 1P17A 1ZCAA 5GOTA 4RVNA 3UMFA 2CUZA 5JXWA 2UZ0A 3B38A 4J3FA 4Q4AA 3T0IA 2MYUA 3LCUA 5BY2A 3KQUA 3DZJA 4KIUA 2YWDA 4Q1CA 5EYPB 3V8PA 1K97A 2IP1A 3R3SA 4LI0A 4NBRA 1ZOOA 1XZKA 3GJRA 5FTMA 3QYFA 3BREA 2X1VA 1H2XA 5L8VA 1DT5A 3BXFA 5ADWA 4PRZA 4OXXA 2QMUA 4P92A 1X1TA 4ER0A 4V0MA 3FHJA 3E5NA 3D1VA 2XE7A 4PC1A 1OX4B 3IP7A 2NAFA 1MTOA 3KXDA 3VPSA 1JWLA 4MVJP 1W0JA 1Y6QA 4ES6A 1LPMA 3L41A 4RK1A 5KMGA 5FLXA 4MV3A 3G2IA 4CKEA 1MRNA 2X4IA 3TCNA 3HA5A 2WTUA 2GB4A 1BMQA 3VAYA 5L3VA 1DWQA 3CR3C 4DDTA 3KU4A 2M98A 2KQUA 2XUAA 3ITNA 3QENA 3FPEA 4XXHA 5JASA 1AJEA 5EMHA 5TV2A 2EHDA 2VIIA 1KRWA 4A6PA 3ZVMA 1TVCA 2WHPB 1W8DA 4CTMA 2WYVA 5CB6A 1PBTA 4MPTA 4I55F 4RESA 4IXJA 3A4IA 2B6NA 4GUAA 1NF3A 3LS2A 2HM7A 2WIDA 1YT5A 3Q88A 4QEZA 5TMEA 4M9RA 4PLGA 3ZHRA 4F04A 4EGFA 1PW5A 4MKRA 3IXLA 2BP7B 3D7NA 3HADA 5FOVA 4DDKA 1PV4A 2ESRA 4TYQA 3OCXA 1XEXB 4MIEA 2QOEA 4HX5A 1LNQA 3VJMA 5LQCA 5JSHA 5JTUA 2HO5A 4Q03A 3R3JA 2Z08A 3P9NA 4FEEA 2I6UA 2WWFA 3QX9A 3UJ7A 4MO9A 1ZGAA 1L4EA 2K2QB 1D2NA 2NO0A 1BVUA 2AOXA 3CW8X 3OA0A 2Q1YA 3TUZC 2YQZA 3SJCA 1BA3A 3K9BA 3K0AA 3ZD9A 1UT5A 1JG4A 1ZNQO 3D4PA 4YREA 4JLOA 1DG9A 1QAOA 3MCUA 4NZOA 3SX2A 2ZIGA 1ZK4A 3X0DA 4DIEA 5A04A 5BR1A 5I7RA 5E7JA 4DSAA 3WK4A 3PHGA 1G20A 2CVOA 4I5DA 2WJJA 4U7FA 3C3DA 2CLFB 4FPXA 4DY6A 3PC6A 3WMWA 3RS4A 5HJEA 1N6KA 1CR6A 4MWSA 2GKSA 1S8AA 4JI3B 3I04M 4X62B 1SCIA 4LF6B 1UPXA 3I2JA 2OEPA 1XLTA 4RPKA 4TSFA 3ADKA 3IYLW 1H1LB 3CRRA 2NU6B 4C30A 1WY5A 1G6KA 1KI8A 1NMEA 3OLQA 4UJ5A 4TT3A 3EMBA 1I7PA 2YBDA 4II3A 1SOAA 2PWBA 1E60A 1JL3A 2H3EA 3ICCA 4MVJF 5CT5A 5EJEA 1UXHA 5MFZA 1TU0A 2VJBA 4WN9B 1Q21A 1MB9A 1U8FO 1L7AA 3F98A 2AX4A 4KH0A 2GYWA 1AG9A 4TYMA 5FBKA 3PJFA 4KQ1A 4X8HA 5C1DA 2Z9CA 2XA9A 5A5VA 4KPUB 3KUCA 4HGPA 2QVXX 3D2BA 3HC7A 3NHLA 4V0NA 2HMUA 1NONA 2WF9A 1HE1C 1QHGA 1FRVA 4NATA 4MVJD 1LW6E 1LFAA 4W5WA 1DAPA 5DK6A 3N0VA 5DSTA 5J5AA 2CFTA 3GYGA 1P72A 1WOMA 1HPLA 4AJEA 3L7YA 1JAYA 3TLGA 1XMXA 2F3UA 4EUHA 5L4NA 3L49A 4B35A 1FZTA 3A70A 4KVAA 4TUYF 1WXHA 1Z6XA 2ERYA 5DBFA 4DV4B 1JB1A 4ER6A 2C82A 2F1RA 4H9GA 4ADSG 4O02B 4GZLA 1JFSA 1FFXB 1K4KA 1YCDA 3PEEA 2R8OA 3FDZA 3R44A 2WWXA 4HNHA 4M0KA 4QJ4A 4IGEA 4WT7A 4XARA 2OM2A 4ME6A 2WU8A 5B1SA 2GHTA 3UVEA 4D9HA 1RW4A 3A6DA 2Q4BA 3FKJA 1LLFA 2CXXA 3OVMA 5I8WA 5IPFA 1CF2O 1UT6A 5A6SA 3WIOA 4BGVA 1Q16A 3W5HA 3AETA 4KHZA 3OEED 1YIDA 3IX7A 3Q98A 1E3IA 1QV9A 1UKCA 1T36A 3R8XA 2NNWB 4W4TA 3SX4A 5KCZA 3IMGA 2BZ1A 4RETA 4CDRA 3GEMA 2Q2NA 3F9CA 3ZVRA 1BO6A 1QKKA 1KAMA 3GRFA 1Y7HA 3FCEA 4ENTA 2J5BA 2VAXA 5HDBB 4LWOA 3TAUA 4JR2A 3HJNA 1AZTA 1PL7A 2YOGA 2D5IA 4MR7B 1PHRA 2A8YA 1H23A 3EGDA 3MIIA 3OQBA 4HB3A 1OHHA 4OUKX 5U1PA 1GP2A 2P0YA 3T7IA 3UMVA 3G5AA 1OU0A 2AI3A 5ALVA 3JQAD 1VZ2A 1L5NA 2PYIA 4AUMA 3W6OA 1PEYA 3DZBA 2QLMA 2XWQA 4NIMA 1YQGA 1ZNYA 4DEVA 2O7NA 1DKQA 3SIXA 4OP2A 2BE7A 4U6NA 3T7SA 3AYZB 1WF6A 2J9FA 4POAA 3KJIA 3PF9A 1BH2A 1SVWA 2WT9A 3LVFO 4TTSA 1MO4A 5EKTA 1D2RA 5JLJA 2GA8A 4GSLA 1P4HA 1H2ZA 2G67A 1U5AA 1XRQA 4BCBA 1ORVA 1RI5A 2ZJ3A 1NX9A 4EFDA 5CB4B 4A6EA 4DJEC 1A9XA 4MWOA 1QXSA 2ECQA 2JGEA 2W37A 3V4VB 3DV0B 2RAVA 1Q77A 2P9HA 5CVDA 3UKOA 1GO2A 4CM8B 2HSEA 3NOOA 4DCUA 2VRWA 5DM70 2AB0A 2VDWA 4QEDA 1Q0PA 4MQLA 3FRIA 1UL1X 4K03A 1IM2A 3WLQA 2P91A 4PGGA 1JXQA 3WNQA 4P2GA 2ZXUA 4OGKA 3SF8B 1J22A 5AW3A 1JKJA 1UJ2A 1YZFA 2GILA 4CQNA 3CG0A 1H0HA 5ARBA 1WB9A 1AQ6A 4K3VA 4L08A 5IU6A 1Z17A 3L4BA 5K20A 3THOA 1E32A 2RI1A 3A6JA 2BR3A 2ETVA 3D8TA 1O4VA 3PX3A 3WAJA 1XRNA 2X2OA 3Q5GA 1EDEA 5CLIA 4FR5A 4YAKA 5FUVA 3WSVA 3SSNA 5DM0A 4D9GA 1RYDA 4KE7A 5F23A 1FW8A 3ETCA 1CJBA 4ETIA 2C2GA 4J6EA 4JL5A 4PLYA 1VJGA 2W70A 1HEUA 1XQ6A 2G5PA 2X9QA 4NENA 4UOQA 4ENPA 3DE2X 3HDJA 1XAGA 4JVMA 3ZLUA 1OZHA 1VHQA 3BGOS 5IAOA 2HU5A 2VYVD 3QSGA 3NFYA 5IAKA 1T4BA 1H8ED 3MGGA 1Q7EA 3DGEC 2EW2A 4HWSA 4LGVA 2FEOA 1K7EB 3RC1A 3ZK7A 4ZU6X 4HS4A 2C95A 2CXNA 3PLRA 1P5ZB 5DNDA 5CH5A 3DDSA 3STUA 2G88A 5E4FA 1RQXA 5IAAA 2DCUA 1MB3A 5U9CA 4XCVA 4D3YA 2G5ZA 1KIMA 2GA9A 2YV5A 4I4LA 3T61A 4IS3A 4B6SA 4YCMA 2UUBB 4U9HS 5GIPE 2PRIA 3H5NA 1E1CA 2ZJ7A 3PNMA 2AI2A 1S4MA 1TZJA 1Y3DE 2WWTA 3BIOA 3AVPA 3QHPA 3RIMA 2VT6A 1DX6A 3KUUA 3VH1A 4E6PA 4X6UA 4AZSA 1VOTA 1RXEA 1IONA 4U63A 4GBED 4OBXA 1RI4A 2WD7B 3T5GA 5FWNA 1J8QA 1KQPA 1G2OA 1IMOA 4LOJA 4RZHA 4M1EA 4I50F 4JSYA 3AUSA 4Q9AA 4P4SB 3S68A 5EMJA 4QPJC 4RWEA 1ABFA 1DXOA 2DPLA 5IJZA 5FTJA 4BFVA 3DZKA 1ZGCA 3AV3A 1JTVA 3JWHA 2ZRKA 2TMGA 3TVTA 1HDIA 3M6VA 3GCGA 3B36A 4H1VA 2AXQA 5T4FA 3RGWS 1IUKA 4TX1A 3MT8A 3QUQA 1SXGA 4XWYA 2C9OA 3WGZA 5KPDA 2YN4A 2B9EA 4F5DA 2HRCA 1SU8A 2G06A 2I4IA 2PS1A 4I8XA 3CLVA 3BIWA 3L8GA 5CXSA 4HJXA 4NAVA 3GGJA 4JODA 2HC9A 4CG1A 5E2BA 1Z63A 4F84A 1V9LA 3IUNA 2DCMA 4ZT6A 1GDHA 5IKPA 1JBKA 1RJDA 3HMQA 4CLXA 1NQXA 4L51A 2CB9A 3A9SA 1ARZA 1U8ZA 4NNJA 3RREA 3VQTA 1G8PA 2ZAOA 1UZLA 4ZO8A 3FOEC 2PT5A 3QTLA 3G2LA 3W8RA 5JH7A 1PQ4A 1EG7A 3AC0A 3G79A 2P6RA 3HBAA 5SYAA 1X8JA 4J1TC 2AIRA 1ADBA 2HBRA 5JG7A 4CKZA 2FQQA 1FNNA 1KR5A 1NR7A 2CK3A 4KTVE 4DB2A 1WCYA 2Y92A 2YV4A 4L50A 2H4JA 5C34B 4RQUA 3TTVA 4IIFA 4TZKA 4TSKA 2IELA 1P4JA 1X7HA 2DFPA 4F72A 2WJWA 4LN1A 3RRJA 3UJAA 4ZVOA 4ZIRB 2BYTA 3QIVA 3VPBA 1L5OA 5IAGA 1EFTA 2W6PA 4LWPA 5IJXA 3ENZA 5AQEA 4KPFC 5KYKA 1JZTA 1E66A 1NT4A 1U7OA 4CKCB 1H9CA 2QUKA 4NNPA 4MGKR 2QRPA 5LP6F 2YHIA 3LFTA 1GKIA 2P9YA 5I9IA 5I7WA 2VJKA 3PQDA 5LDDC 3O8CA 2XE4A 3RIGA 1LDYA 1WTCA 2NVWA 1IVYA 2XBLA 3OTOB 2XDQA 3BF7A 3JZFA 4I36A 3WYGA 4OK6A 4R2LA 1KHTA 5KHAA 1DLJA 3S55A 2PH1A 3PXEA 2FPSA 4C7MA 1JEYA 3U44A 4N76A 3ZZ0A 3OHPA 3A6KA 3FSJX 3IC5A 2V65A 1E1KA 4N01A 5G3ZA 3V1UA 3AG6A 3M70A 3UJNA 3GDFA 1KYZA 1MX5A 4KKXB 5I45A 3VSCA 4CMGA 5B4VA 4RK6A 1J0CA 5IF9A 3ILVA 1PR5A 4TMXA 4Z7OB 5IYZB 4D8VA 2QG4A 5AP9A 4GQBA 4V24A 1ZH4A 3E3OA 4RTNA 4H1WA 3GJZA 3L8MA 3UC9A 4I4NA 3FOBA 3REQB 1QWOA 4DBLE 4ZAFA 3DMFA 3MVEA 5LIPA 5ES3A 3UQZA 3ZE0B 2VEDA 3V55A 3SN6A 3JYHA 5BSHA 1FJXA 4GMDA 3HCDA 1A9ZA 1NJ6A 1XDUA 3OZAA 3QFCA 5I6DA 1EX1A 2GS9A 4UTPA 2P4UA 3HY6A 1JIUA 2PL1A 1XTSA 3IQIX 1C4OA 1RWVA 3I3SR 2NO1A 5E3IA 3KUKA 4U7PB 3SS8A 4BKMA 1WUJS 2G17A 1EDOA 1DXYA 2WFZA 4KYUA 1LV7A 4MWBA 3H0KA 1E58A 3UPDA 1XEFA 3F3YA 3PR3A 2HCRA 2R6HA 1T25A 2AYZA 5JNSA 1Z35A 5AOAA 5DHFA 1NW6A 3HDYA 2R2AA 3RUEA 1MOZA 1T3GA 4Q37A 2ZRBA 4GX2A 1BXZA 3P9IA 3R24A 4KI7A 4M3NA 2FUKA 3I2YX 5H3HA 1NX6A 3GEIA 2IWRA 2DTXA 1FP6A 4CFYA 5JFGA 2GPJA 2B36A 3GCDA 2I2WA 3GWGA 3P5SA 2DT8A 1GZ3A 4MDHA 4GPIB 3AEQA 1Q7CA 5LQSA 5C35A 3GRVA 1FNDA 2NZXA 2WICA 5KKAA 1BCRA 3G5MA 3DMNA 4F9FA 4U7TB 2EFEB 3L1UA 5ALRA 1XXLA 4QNNA 2MOKA 5BSKA 1IZZA 3RARA 2BY4A 1FDTA 3UGQA 1Y6RA 2W6IA 1ZN8A 3OKFA 4BKUA 1Y4SA 2JGDA 3AV0B 1RJ9A 1AMOA 4ZCPA 2AS0A 4FQ8A 3ROKA 3DA8A 4EKNB 1T24A 2IIQA 3EZ7A 1QLWA 4CL2A 1ZH8A 4R0NA 1Z2OX 4OJTA 5EIFA 1KDPA 4Q93A 5T8KC 4BRSA 4QUDA 4ESOA 3BSSA 4OI0A 4NH0A 3R6TA 2GR7A 4BBZA 5EFZA 2I67A 2IJGX 5ICSA 3H5VA 2Z2ZA 2C29D 3E22A 1BMDA 3L4KA 2FJPA 4UARA 3S2FA 5CLQA 4TN5A 2Q50A 1ORHA 3SS7X 2JJ1D 1F17A 1MAHA 3M1YA 4PLTA 3ABRB 2DWCA 3JQ7B 1CY0A 4UCXA 3G89A 5FCDA 3SKYA 5DXFA 4QT4A 2R11A 1NVAA 2VAVA 4I08A 3LE8A 1NYRA 1XF9A 3TJRA 2Q4OA 1AXRA 3L7KA 3KZCA 3KCQA 3L40A 3K8OE 4PPGA 4Q9IA 2X3UA 5AUPB 2XGJA 1T9KA 2O8DA 1FDVA 1EDZA 4LJ5A 2FDRA 2ZZMA 4E88A 3HK2A 2E3JA 1KIAA 3DC7A 3KQTA 2ZETA 1FQOA 4C0HA 5C81A 3V33A 4Q7JB 5IX8A 1XTPA 1KF0A 1MEJA 2CEAA 1B2LA 5E2AA 2GZ3A 4P36A 5H9VA 1B26A 3HL0A 4W8GA 4LQLA