4G5YA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase in a ternary complex with atp and n,n-dimethylthiophene-3-sulfonamide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
286
structure length
286
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 94
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4g5yA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4g5yA01
1PFWA 1G8FA 4EG6A 2QUIA 3RHSA 1VBMA 4JXZA 3N9IA 2H2AA 1VBNA 2AG6A 2QUKA 4AQ7A 4KR7A 1IQ0A 3LE8A 2YWBA 4JXXA 3CLUD 4X0EA 1JMVA 4MWEA 1MJHA 5FO0A 2QUHA 3K9WA 1I6LA 1T9GS 1FFYA 3L92A 1RQGA 3SZGA 2EJCA 4QREA 3H9CA 1O0CA 2QTNA 2AKEA 3ZXSA 5K0SA 3RK1A 1T6ZA 2X0KA 1NUUA 2A7XA 3NBAA 4MW9A 4KKVA 3P0HA 3Q12A 1KAQA 2XRYA 1N2OA 4MW7A 3RBAA 4S1OA 2A1TR 2CV1A 1J70A 3FY4A 1V8FA 1TYDE 3MMXA 3AKZA 1TEZA 4YBRA 5HG0A 2HZ7A 3P0IA 1VL2A 1QRTA 1GAXA 1VBKA 4WSOA 1O5TA 1ZH6A 4DDKA 1KAMA 3A4IA 2GKSA 4MW0A 4HPWA 2D13A 1U0BB 4ND6A 4XFDA 4I6EA 4MW6A 3QE4A 2CFOA 1F7UA 3G6KA 3K32A 2EL7A 3OP1A 2BTEA 1GPMA 3AFHA 3SYTA 5EKDA 4MWBA 2E21A 2BYTA 1JIIA 1NSYA 1PG0A 1YUNA 4AS1A 4DDHA 3P0JA 4ZT4A 3DPIA 2C5SA 1KQNA 3CLSC 2J08A 4MW5A 1WOYA 3PRHA 1OBHA 4PY2A 1QQTA 3GMIA 4MVWA 1N2GA 1O95D 1O6BA 5FNZA 2H29A 1EFVB 2GM3A 1GN8A 1N2IA 1K92A 1MAUA 4XFJA 4NDAA 4JFAA 4ARCA 3ZJVA 1QTQA 1JECA 5KWVA 1IFXA 1T6XA 3FHJA 4NZPA 3HGMA 5DASA 4ZT2A 1OD6A 1O97C 4PBTA 4ZT7A 1JIKA 1O94D 3ELBA 1O0BA 1CT9A 4MUNA 2ZUEA 3UOWA 2GOYA 2VTBA 3IMCA 1LW7A 3MUEA 3JXEA 3CVVA 2PXHA 1YULA 1Q19A 5K0TA 1EUYA 2CSXA 1K4KA 4L2IA 4R0NA 4MAFA 1G8GA 2Z09A 2A1UB 1MRZA 2CYCA 2G36A 1J09A 3I05A 4JZYA 1N75A 2WB2A 4G5YA 4JYZA 5H16A 4MUGA 1M8JA 3CVUA 1JGTA 2E89A 4EG1A 2XRZA 3MLAA 1TFUA 1COZA 2OQ2A 4CDNA 5JBNA 2CYAA 1LI7A 2PZBA 1H3FA 4YP7A 2IP1A 1WQ3A 1M8GA 3CVYA 1TQ8A 1EJ2A 1N2EA 1U7XA 4QBTA 1PFUA 4U63A 3RK0A 4Q16A 1O96B 2QJOA 4ZCSA 2PZAA 3ND6A 3IVXA 4XSVA 1ZH0A 2O5RA 2WQ6A 4E1AA 1ZUNA 1K97A 1FYDA 1PG2A 3H9BA 1OWOA 1GZUA 1PFYA 1N1DA 2IJGX 3F3MA 4ZCQA 1I6KA 1YIAA 4R2LA 2DETA 4KPUA 4MUFA 5LFAA 3CLRD 1SURA 1I6MA 2A1TS 4NATA 3BL5A 3COZA 1MC1A 4P2BA 1X6VA 4EG7A 1B6TA 4J75A 3FH0A 3ND5A 3TNJA 1J1UA 3C8ZA 2X1MA 3FWKA 1WXGA 4F3RA 1QRSA 2E18A 4HJRA 3CLTD 3DV2A 5TS2A 3TQIA 3ZUGA 1UFVA 3VU8A 1JILA 3IVGA 3COWA 2RD2A 1EXDA 3ZGZA 3TZEA 5TEWA 3FNRA 2YXNA 4NAUA 1MAWA 3L93A 2A86A 2WSIA 3SZ3A 1QJCA 3INNA 1QRUA 5LM3A 1LI5A 1QU2A 1VLHA 4PBRA 1XNJA 1OBCA 3HZRA 3PNBA 2YY5A 1JZSA 3M5WA 4WNYA 4Q93A 3H99A 3AG5A 4MUIA 3A2KA 1U3CA 1TYCA 2OV4A 1Q15A 3GLVA 1T6YA 4MLPA 2D54A 1WZ2A 3ZJTA 1XNGA 1KKUA 5J58A 4MWCA 1R6TA 3QTTA 1M8PA 1NZJA 3AL0C 2A88A 4EG5A 3N05A 3FOCA 2B7LA 3ZXIA 4ZT3A 3FETA 4ZCPA 3CVWA 1U7DA 1MOPA 4EF6A 3CLSD 2J09A 4G5FA 1V47A 1JZQA 4BWVA 3RFFA 1WXHA 3HV0A 1Q11A 1WXIA 4MUHA 1NUSA 4OUDA 4EFKA 3IOBA 5J59A 3A04A 4MW2A 1JIJA 1R6XA 1KR2A 3KT8A 4MW1A 2JA2A 4EG8A 2VTBB 2Z08A 1NURA 5IHXA 2A4MA 2HGZA 3X1JA 1BS2A 1J20A 4NX2A 3AG6A 1OWLA 2A84A 2J4DA 4DDMA 2QJFA 4I6GA 1ZJWA 1EUQA 1KP3A 3UK2A 1EFPA 1NUPA 3ZJUA 1ILEA 4MVXA 3IODA 5DEOA 1MBZA 5FO1A 1F9AA 4L2IB 2DR2A 3HMQA 3PNVA 1WJGA 2O8VA 2X3FA 3P52A 1Y42X 3FG9A 1WY5A 4YP6A 3RJZA 3FDXA 1NUTA 5IJXA 1Q77A 4ND7A 4EGAA 1EFPB 1KP2A 3S3TA 2CUZA 2X1LA 3LOQA 4MWDA 3UMVA 2RE8A 1JEEA 4KR6A 5KCMA 4UZEA 3U1VA 2DPLA 1N3LA 2QJTA 4G6ZA 1IQRA 4H3SA 4YMIA 1N77A 1DNPA 4ZCTA 1QNFA 3IMEA 3COYA 1H3EA 4RUKA 4EG4A 1WXEA 2NSYA 3Q4GA 4U8HA 3H97A 4R2MA 5H7XA 3VGJA 3KFLA 4MVCA 3CLUC 1G8HA 3IMGA 2VXOA 4MUJA 1IHOA 4MUEA 1WKBA 4TS1A 4F4HA 5KHAA 1NP7A 3CLRC 2PG3A 5LLTA 1MB9A 1XJQA 2TS1A 3IH5A 2DEUA 3DO8A 1K4MA 4PBSA 3CR8A 2WQ7A 1R6UA 4KPUB 1XNHA 2JANA 2HMAA 1S4MA 4RPIA 2QTMA 1QU3A 3H05A 4CT0A 4QRDA 2DLCX 2D5BA 1GTSA 3CLTC 1YIDA 3TS1A 1N78A 3DLAA 3SEZA 4NAHA 2QUJA 1H3NA 3G5AA 2CV0A 4MQ6A 2ZUFA 3ND7A 3PXUA 1JEDA 1T9GR 3AIIA 1J21A 3A05A 5HUHA 4ZT5A 4MUKA 2ZP1A 1N2HA 1IVSA 2AZXA 5AHWA 4HK4A 3X1MA 4DLPA 5TEVA 3MXTA 1NI5A 2I1LA 5DB4A 3IVCA 4ZCRA 3OTWA 3TQOA 4YP5A 3ISJA 4UZFA 1YI8A 1N2BA 3NBKA 4ZT6A 4K0RA 2DUMA 3IUEA 1IRXA 3CA8A 5DK4A 3VRHA 3KT3A 2J5BA 1M1ZA 2PIDA 2NZ2A 4KR9A 1YUMA 3FI0A 3N8HA 1HYBA 1O95C 2R5WA 2IELA 4OJMX 1N2JA 1F4LA 2QTRA 1EFVA 1F7VA 1P7PA 1NYLA 1J1ZA 4CQNA 5BNZA 4FZJA 2Z3VA 4MW4A 1M8KA 3G59A 4MVYA 1KQOA 3HFJA 3KT6A 1OWPA 3D6UA 2CV2A 3ILVA 4K03A 1O94C 4CDMA 2YWCA 1IH8A 1A8HA 3IOEA 1KH3A 4DNXA 3ZIUA 3SP1A 1G59A 2PFSA 1WQ4A 1O97D 1WXFA 1PFVA 3KT0A 1NUQA 3D6VA 3TZLA 3CVXA 3GUZA 3LCJA 4OUDB 1GLNA 1X8XA 3X1KA 4ARIA 3NV7A 3IUBA 2A1UA 2DERA 4DJAA 4GU5A 3UY4A 1KORA 5HUJA 2JAXA 2PZ8A 1TYAE 2CYBA 1D2RA 3PNYA 2DXIA 2CT8A 5J5AA 1EE1A 1JHDA 3UC5A 1M8FA 4I6JA 1OWNA 3IOCA 3FIUA 3HL4A 4J76A 4MULA 2V0GA 1MB2A 3IDFA 1GTRA 1OWMA 4A91A 2J07A 3COVA 3E27A 4GRIA 1O96A 3Q10A 5F23A 2V0CA 4EG3A 1KH1A 1KQPA 3SDBA 1TYBE 3QTBA 1KH2A 1U3DA 2E0IA 4HJXA 1I2DA 4DE5A 4U7JA 3SEQA 1M83A 1ULHA 1H1TA 1IQUA 3N2YA 5TGTA 3MLBA
chains in the Genus database with same CATH superfamily
3RYHA 1JSZA 1RTTA 4OV6B 1KGSA 4BHTA 3KK0A 3AM4A 4BFLA 3N76A 3G9QA 2O2YA 3HYLA 5FTKA 1GNQA 2IHBA 1SU6A 3F5MA 1RZRA 3O90A 4D6XA 1CTQA 1DUIA 2PGAA 2JLZA 1MVNA 1VBNA 1V7PC 3NEYA 2QJRA 3ELDA 1V2GA 2V3VA 3LE8A 3IO3A 3VDRA 4X7PA 3TBFA 1E1RD 2BZSA 1N2ZA 2NNLD 1HZZC 2ZDQA 2GB4A 2EFGA 4KMSA 3SXJA 4CM3A 3U56A 1U2QA 4RNCA 2ZE8A 1UXKA 5K0CA 2IPMA 1P2DA 3O1HB 1L5HB 3ICPA 3KJEA 3VU9A 4KN5A 4AO7A 1AGPA 4W1SA 4F5YA 3ZWAA 1G21E 4GRDA 2AFHA 1A9XB 1X7ZB 4PAGA 4BNKA 4L9AA 2ZKLA 3ZZ1A 3VDMA 4GI5A 3LWBA 3OEEA 2AUMA 2ATIA 2ZRGA 4I9GA 3PWZA 3WGGA 1Z63A 4C5CA 2I4RA 2B2NA 1D6JA 1LPMA 1V8ZA 4TQ9A 4Y1RA 1Q95A 2C2XA 1AXGA 1Y3AA 1T6NA 3AETB 2C5LA 3CWZA 2CHQA 3RFXA 3E82A 1N7HA 1K8QA 4FGJA 3ORFA 4ZU6X 5C8ZA 4YH1A 3GL9A 4ZCMA 4G0OA 1SRRA 2O8DA 2AOVA 2QKYA 1RRFA 3K15A 3M4YA 1S96A 5HK9A 1OH6A 2GEJA 1VKOA 4LCEA 1CZKA 4BQIA 2QU7A 2V7QA 1FDIA 3R0XA 3Q8XB 2J31A 5E6UB 3F8WA 2G71A 5IH3A 3R8CA 3RARA 4D7AA 1KAMA 2ENUA 1QZXA 2E4AA 4JAVC 3VHLB 1LJUA 2JJMA 3DA8A 2PYZA 3R6LA 4INOA 3DFFA 2H17A 4LTDA 4XRGA 1RKQA 1YO6A 4LGMA 4P7KA 4HLNA 5BUQA 1C30A 3FRHA 4LVCA 4E4RA 3LKZA 3EXIA 1NRWA 3ET4A 3ABSB 4FKMA 3AEUB 1SUDA 4Y9SA 1UPCA 3BWYA 3DEFA 3KQYA 4XIJA 4RIFA 4RIGA 5IN5A 4A36A 3IHWA 3PHGA 1HSZA 1PG0A 2ONYA 4GM4A 1KFCB 3L0IB 1H2EA 4PX5A 5AO9A 4COOA 4GQAA 4CIWA 2OSBA 2G4CA 4MWGA 2NZ8A 3B3JA 2ZXUA 3EVGA 1IZ0A 3DE3X 4RE5A 3K16A 1KYWA 4AL4A 2EL9A 3BX1A 5EGNA 2P1ZA 3RD5A 2XZPA 1CVRA 1VCOA 4MV8A 3BXHA 1QQTA 2VPQA 2IZOA 2P40A 1YR6A 4A0GA 4IDOA 1EU1A 1T9HA 3GR6A 1RQNA 3MWKA 2YVUA 3Q3HA 1W4LA 4NJEA 4C3VA 5CAEA 5TDHA 5JMPA 4MYDA 5H1YA 4Q1EA 1M2KA 4JFAA 1TM7E 2JIBA 3ER8A 1JECA 5CEFA 2QLLA 4L02A 1OV6A 5JCXA 2GZMA 5LMZA 3W5BA 4NTZA 4EMUA 1RPJA 1CQXA 3FHLA 4DIEA 1R16A 4F8JA 4GYYA 2B99A 1DWPA 4AMYA 4P6VF 1AMNA 1IOVA 2HIMA 3RFVA 2I6GA 1CB7A 3UOWA 1V8OA 1BHQ1 1DDOA 1JWAB 4QVKA 3O8RA 1XBTA 3C87A 4HQOA 5I9LA 4R54A 1MA3A 1V3VA 3GJ3A 4Q18A 5JHHB 2OZLB 3I04M 2HL6A 4OATA 4E5MA 4GKJB 2ZJ2A 1Z2PX 2W43A 3DMRA 4G1FA 4GOJA 2YHUA 1Y5MA 1FUKA 1W46A 1FCJA 1ZO8A 3DEZA 3UKOA 3MS7A 4BCDA 4IPTA 5GADl 1UDAA 4WOCA 4CHGA 1ZVVA 1GT91 4K9KA 2A1UB 4JMLA 3ODGA 4CYMA 1QDEA 1KBZA 1BXKA 4GDMA 1Q1QA 4O08A 4RCVA 2J32A 1HEIA 2ZATA 3PFKA 2BFOA 2NTYC 4FLEA 4OVKA 4F92B 3NHAA 4E2XA 4MUGA 1SOVA 1ULAA 3GZTB 3F3YA 3AXTA 1Y4DE 3LQKA 4H1TA 4JLVA 3V55A 3CNQS 3JPWA 5ED0A 2A3NA 4NSNA 4ENTA 4CF7A 3B1FA 4YJ3F 2BI4A 2YC2C 3I73A 3UOAB 3UWSA 3AFIA 4CQMD 1QVWA 1WQ3A 2Q2OA 1HQDA 4MKRA 1RMYA 3E9EA 2IX9A 3VX3A 4DABA 4LZPA 4X62B 5FI3A 4O1MA 1IM8A 1KOGA 3EGOA 1L8AA 5AUNB 5A5GA 2N0SA 3RRXA 2J3MA 4XZ3A 1SK8A 3ABZA 4XLLA 1AF7A 5CJ2A 4CTNA 3H8WA 2A8YA 4EB8A 1I14A 1TU3A 5K0ZA 3LUKA 1ULUA 3TECE 4PZAA 1EVEA 2Q5QA 3S81A 2GN0A 1SRQA 1MGOA 1D1PA 2F6RA 2FLKA 1CZUA 1KJZA 1ZXBA 3IIMA 5FPQA 5TMBA 3H1BA 4AP9A 1T1IA 3U61B 2I6UA 3S1SA 1ZAKA 1ZSYA 2RHCA 4NR0A 1AUQA 3LIIA 1CUEA 2WTAA 2Z98A 4R2LA 3QMPA 4XDHA 5LFAA 5IM4A 5ECWA 2CBZA 1FFDA 1GKLA 2QR3A 1ZIDA 3CRMA 4HTAA 2O2CA 4EM6A 3PKIA 4LX8A 3AILA 4ME6A 1J8DA 1Y5LA 3I42A 3SM9A 1CY7A 3NTRA 2K4MA 1IEVA 4P2BA 3HSKA 1CYEA 2RBGA 2GF2A 3RTGA 1ZKMA 4J75A 3JZFA 3L8EA 3R3UA 3MTGA 3KXIA 4NBUA 4PG4A 4QARA 3KEQA 2WM2A 3ZCPA 3FWKA 4UD2A 4F3RA 2YMLA 1OLUB 3NIBA 1SCDA 1UOOA 3GGCA 4ZOCA 1U9ZA 3GLHB 5CVDA 3I76A 4YY3B 3WWYA 2QMHA 1WU7A 4IXJA 1XZQA 1EK6A 1YRAA 1KJQA 2A6PA 4L51A 2Y1CA 4HPXB 3FCUB 2P30A 2R79A 4NAUA 3LU1A 5KTSA 1K0UA 1MAWA 5A9RA 1GWNA 2PYIA 1FX0B 4K6FA 3D8NA 5ES3A 3JQ7A 4IJQA 4HLUC 2J67A 3RV3A 1JXAA 1UMKA 1V5EA 5T3YA 2AQ8A 1A7JA 4M1EA 3RTEA 1LLUA 1ZZGA 3HPQA 3RAEC 1WW8A 1MO3A 1U9JA 4ZFNA 2UZ3A 4OGWA 1L7VC 3FIJA 3G6WA 5AJXA 1NBAA 2KBEA 5TX7A 3T5PA 4G26A 4CMBA 1ORRA 1BOOA 3U6BA 5BSMA 3EY9A 3HYNA 3M5WA 3OQVA 5KU1A 1CS0A 1DZIA 4I4TB 4RHUA 3WRXA 5JYBA 2VTEA 2Q5OA 3T0FA 1M5TA 2Y4NA 1QCCA 3PQ4A 2AOUB 4M38A 4PC1A 4ZO4A 4BS9A 3B9QA 3VNRA 3K2QA 2VDUE 1IG3A 1RYMA 3FPCA 4O0MA 1DG3A 5L51A 2V74B 1VSUA 1P9NA 1APBA 1U7UA 3L0DA 2ZWIA 3OE4A 3OPNA 4B71A 1NBEA 2R4UA 5EJ8A 1ADFA 4QRHA 1VIDA 2PT7A 4UCWA 5IEBA 5CK5A 3UANA 2I55A 1N36B 4CQMA 4EG5A 3G88A 5CLQA 4I1PA 1I0LA 2C9MA 2ZJZA 1AZTA 5EWMA 5HF8A 3KQNA 4BMVA 4F9TA 1WABA 1Y8AA 3QOWA 4J4TA 5EIOA 5GM2A 1A4IA 1ZOLA 4C78A 1G1MA 4YHHB 1YGYA 2P4EA 2BKUA 2R6HA 3FBWA 2BE9A 3JD2A 3KVNA 5JZSA 1F14A 4D3SA 1NFFA 4EPWA 4IUDS 4BV9A 4ZDJA 5DBHX 4K05A 2DY1A 1PU2A 2W5UA 1YKSA 3OZEA 4OXKA 4GX0A 2O0HA 4OA8A 3CF4A 3CR3C 1JI3A 1P0IA 2JBWA 2R8OA 3OA2A 2FMFA 3H75A 4RLQA 4HNGA 3V8VA 4XPIA 3RS0A 1KQGA 3HY6A 1XEXA 2E85A 2C8KA 1A98A 4FBGA 4Y9RA 3AYXB 2Y0BA 1YBMA 1I2CA 2JA2A 3E81A 4TTAA 1V48A 2I4OA 5CB4B 5JZVA 2R2GA 1YDFA 2J5RA 5GQSA 1IJBA 1NX6A 4JDPA 4A0FA 4CBVA 3PDWA 2NUPB 3D59A 1HOTA 4C88A 1DJOA 1HG1A 3SJBA 3VZRA 3IUQA 3V4ZA 3RSFA 1HNWB 3KKPA 1U8XX 1NYQA 1AHIA 2EX0A 3T5AA 4OJYA 2ST1A 4IIJA 1WMFA 1HO3A 4KLRA 4X1YA 1SBCA 3F1KA 3FI9A 3IP1A 4KLZA 5FBZA 2WM3A 2AV6A 4YLGA 3TDKA 2CY0A 4F5ZA 2VA9A 1BMFA 4MWTA 4Y2PA 2DFNA 4IOKA 4O4JB 5KQRA 4GPBA 1PD0A 2NVBA 1HYEA 3W9YA 4HDAA 2G83A 3TVDA 4IHAA 3W5SA 4BQPA 2PNFA 4LYJA 3E4CA 3HB9A 3ZCQA 5FCDA 4DYHA 4XDGA 4NK4A 5TVGA 5JVDB 2QRNA 2HHCA 3GPDG 1EFPB 3HP7A 1MA0A 3F6YA 5C37A 3BMNB 1N3IA 6PFKA 4DQUA 2UYGA 3MWDA 1AU9A 1V0JA 2ZSEA 4CMKA 4EO4A 2WLTA 3NFRA 5AKZA 3LX5A 5JXIA 5LXTF 4INZA 3RF7A 3U1VA 2WUGA 4YFYA 2BBWA 2AH5A 4N8SA 1G3MA 2Q4BA 3HWSA 1U5BA 3JALB 1C8VB 1EFRD 4NBWA 5IDQA 4EKYA 1EZ1A 2B8JA 2WVHA 1ORWA 4RUKA 5JE8A 1F12A 2R8YA 3TCNA 2W2TA 3BGWA 3VGJA 4HS9A 2FOLA 1GUAA 2RHJA 3CLUC 5ITZA 4RVFA 3DE2X 3R24A 2VXOA 4V0NA 3ZZTA 1K7YA 1WKBA 3WOHA 4C89A 3CE6A 3HA5A 4JVMA 2G82A 1KR5A 3NIFB 5IKOA 5NLLA 2OAQ1 4DEVA 3GAMA 5J5VA 4IFEA 4FYYA 2QEQA 1N8SA 2EKZA 1XJQA 3QXGA 3C4VA 4GYWA 1K4MA 2I0FA 1FSZA 1M2OA 2J3KA 1W0JA 5CYGA 3HDQA 4MP3A 2Q6IA 3CF0A 3LP6A 4M9SA 3E6AA 4PW0A 4U39A 3KD2A 4ITUA 1E61A 1YC2A 4FHDA 4QRDA 5KC9A 4F4IA 3CFFL 2QTZA 1R9NA 2XY4A 5DBEX 1KS2A 3W2IA 1LSUA 3DBOB 2DBYA 4ZTBA 2X8LA 4B85A 3QLUA 1SZDA 1QH8B 4QSMA 3IL2A 1PBNA 4BU1A 3QKIA 3IP7A 4AUMA 4AWXA 2DUUA 1W76A 2R68A 3KZCA 1MX3A 1KY2A 3PXUA 4HZUA 2TYSB 2IFTA 4NP6A 4ZCLA 4HT3B 5K8UA 4Q01A 1B8VA 5ETJA 2DFLA 5GP1A 2I9PA 4F2GA 2CF5A 2XQGA 3B52X 2B1RA 3ESZA 4LOIA 1EX6A 2EZUA 1RXWA 1TZKA 1VJCA 2VKQA 4K2AA 3GLFB 2Q27A 4DKXA 4DQDA 1CDEA 4C03A 4P4TA 4YP5A 1TCVA 4JSYA 4BNIA 3KVVA 4DLRA 2FSHA 1WHTB 3LLCA 5JBIA 3WLTA 2EQBA 3SC6A 5F5NA 3EGCA 1PZMA 4OHWA 3KOZA 4HNQA 1YZQA 3VRHA 1RVV1 1CJUC 5C5IA 4CR8A 4LIPD 4D0RA 1TEVA 1TMOA 2CSUA 4MRSA 3SSNA 2PJZA 3EEIA 4ZI7B 1KDZA 2GDZA 1YUMA 3EBPA 3U2QA 2J3JA 4ZJYA 5FWDA 2ZCJA 4UDXX 2CXNA 1JFSA 5FI5A 4LV6A 2NYAA 3LF2A 3E9NA 4TKZA 5I4CA 5LMUB 1P3JA 3AX6A 5EY5B 5T41A 2YTZA 4INPA 2D4AA 2FPPB 1WOMA 2C5FA 2G67A 1IIBA 3WKDA 4GGOA 1W29A 2DB3A 1CJCA 1HGXA 1X7WB 2IYLD 3PG5A 1ENPA 2XRFA 1KVTA 3UJ6A 5JXGA 3ESYA 3OQJA 3AW8A 3R3HA 3ZKWB 3VXKA 3ESCA 3IQWA 3ILVA 1PDOA 1G3IA 1TUEA 1L8OA 1F2VA 3CINA 1RKXA 1EFRA 3JRNA 1EM6A 1XD9A 4KXYA 1DCFA 1D03A 3FGNA 1N6KA 4UEOA 1O4VA 2Q2VA 2VK8A 4IUCS 5AXAA 3ZHXA 4DJTA 5B1YA 2R1TA 3IP9A 2PH7A 3OOEA 1LDEA 4HWGA 1W1IA 4R2JA 5FL7D 1AOXA 3KQSA 3A70A 3EIWA 3G1TA 2HU7A 4HDKA 4RQUA 4WNAB 4YAJA 5DH9A 2LD4A 5C4MA 1CERA 2VNIA 1O1YA 1R50A 1R5OA 1TK3A 2HJSA 3TRHA 1XMJA 2RGCA 3UWKA 2AXNA 2CXUA 4M9QA 3BD6A 1VYVA 3PSAA 4PQYA 3MJCA 4MLZA 4N8EA 3VH2A 8AT1A 1TYAE 1BMQA 4CKBA 4II3A 2OKGA 2ZROA 2QL5A 4KR0A 3GLUA 5CX1A 5CM2Z 3H5AA 1J99A 4FXPA 1CJSA 3H7AA 4G37A 4X61A 1U7HA 3ZGOA 3HL4A 1J5PA 4EITA 3OZTA 5ALEA 1BCRB 2ZLBA 2JBAB 5CXQA 1ZM4A 4M87A 1GTRA 2O1EA 1DE0A 2O2SA 3F2IA 4NULA 3WV5A 3V4LA 4RABA 2J3LA 3COVA 1TUBA 2FGKA 1QE3A 1WV0A 1SPXA 1ISFA 4RWZA 3ROZA 1KJ9A 3K73O 2Y92A 3QTBA 4ZYLA 1ZESA 2FLVA 4XW2A 4ZHQA 1AS3A 5T8KA 2P65A 3D6FA 4G3XA 5C8YA 4BTEA 3EXHA 5K4HA 1UM9A 5CYFA 3VBEA 4RHFA 3LCUA 4RF2A 4AJEA 4DNFA 1RKUA 5CT4A 3L7MA 1XSEA 4GZ3A 4KHZA 1I2DA 2PSJA 3R3SA 4TV9B 4BJ5A 4R69A 3B20A 5A4JA 1H2WA 1M83A 3CBGA 3IAHA 5B2ZA 3DMTC 3N2YA 4BWYA 3L06A 4WXYB 4RD4A 1M34A 1YZHA 1P2FA 5K6AA 5K7SA 4MQMA 1CZRA 2NQ8A 3U4QB 4DCMA 1FDUA 2Q4RA 2QUIA 1DEXA 4K8RB 4TQUS 1JWLA 1FFBA 1O2DA 5B57C 1WB6A 4DLLA 3QFTA 1VL5A 1Y81A 3JQFA 1RP1A 4CKEB 4BB9A 2A9RA 3K6KA 2I99A 1PIWA 2YWBA 2NZXA 3H5LA 3UA0A 4IDGA 3RYFB 3UHOA 1W4AA 3DQQA 1RJEA 3EPPA 3WLQA 1PDWA 3VR5H 3NGLA 4OK5A 1FW8A 1FDTA 3ICOA 4OQZA 2VHYA 1GZ4A 4C2BA 3EEBA 2HEGA 2FZLA 2XOEA 1XEAA 4MXDA 1RS0A 1XCBA 3HFRA 3ZVRA 1WF3A 2YXEA 4GPIB 2L2QA 1YVRA 3MMSA 4MPRA 1QQ6A 1H0KA 1NNI1 2J9RA 5LJLA 2IYYA 1DC3A 2H4FA 4M7WA 3AL3A 4B2IA 1VJTA 4M0FA 2AZ4A 4LFCB 3P0HA 4B7ZA 2VAPA 1N2OA 1ML4A 2CWDA 3M33A 1RWMA 4HC4A 3ZYCA 3LQRA 3NJRA 1J70A 2E5FA 1PTJA 1TM2A 3FY4A 3MMXA 2NZVG 2Z58A 5AW6A 4HNAA 2JARA 2O54A 3BMCA 4C3ZA 3QOFA 4RZIA 1TEZA 4H1WA 4XEUA 1PGJA 1UM8A 5CLHA 5FL7A 3EQ8A 5DHSA 4YRBA 4RK5A 5E1BA 4CRWB 1JSXA 2BELA 4Y6SA 3WO0A 1GAXA 3D8BA 2ZJOA 1E6KA 1WXWA 1O5TA 1X38A 2ZUWA 3DKVA 3KB1A 4N7RA 3I6BA 1PL7A 1JAIA 2PS3A 2E4UA 2BFBB 4FOPA 4F12A 1U0BB 3PUVA 3PVZA 3PRYA 4LDQA 2NYUA 1DKMA 3GX1A 3IAM6 1Q2XA 2ORWA 1BVUA 2DWQA 4C1BA 4B7XA 2APJA 2VK1A 4KCGA 1MXHA 3GD7A 3ST7A 3WJAA 1IK6A 3L7KA 3U09A 1E99A 4YRPA 3D0RA 1II8B 3L0SA 2H1CA 1AF4A 1NLYA 2CCGA 5EXPA 1ZD4A 5HS4A 3U6KA 1RHQA 2OVBA 2Q1YA 3I23A 3JASA 3KB6A 3EHDA 3HUUA 1PJ8A 4NEGA 1SBHA 1Z8HA 5FIUA 3IQFA 2GK3A 1V9SA 1Q20A 1T8UA 2VDRB 1STOA 1XD2A 2JGRA 1UMBB 5IRCD 4MW5A 1WOYA 3KEFA 2HMWA 3G79A 2OGUA 4MUAA 3E5RA 3C39A 3LYAA 3QKRB 4IH1A 4OA5A 2RCNA 4PONA 4PX3A 2VATA 3MGBA 1IIRA 2FN7A 2GM3A 1K92A 1MAUA 4QGBA 3SX2A 5JQGF 5L6LB 2PN1A 2REXB 2G3DA 3NXSA 3IXMA 2QRZA 2W70A 2D5LA 3HBLA 1RLTA 2BTQA 3O83A 1Z5OA 1JSRA 2BGKA 1UWLA 3HGMA 1GQSA 1ZM3A 4L28A 1Y4SA 4EHBA 3UYLA 4L5BA 3K2EA 2YV2A 4BN0A 4TMXA 4UBMA 1A5ZA 2BEVB 3D54D 4LZJA 2BH2A 2ZUEA 2XNKA 3N86A 3OQ1A 3IKTA 1J0CA 4OBXA 3RPEA 3MFQA 1WCWA 4A8JA 4H77A 3ZCUA 4N5DA 3LDHA 4DFDA 5JISA 2IKSA 4DB4A 4GMHA 5JW6A 4BLVA 3RJMA 1YR8A 2HO5A 1VE9A 2J46A 4OFZA 3DHEA 1PAUA 1TPYA 1Y1TA 4G0PA 2CJFA 2XTMA 3LVQE 4NECA 1FMJA 1K4KA 4R0NA 3GDGA 5IS2A 3JAMA 3ICVA 4OQPA 3KDPA 3KEOA 4Z7OB 2Q46A 2FCAA 2XLBA 3A31A 1Q74A 4ZVTA 4M99A 2IU0A 1CQIA 4O3MA 1N9GB 1UWVA 4J0CA 2D2FA 4JZYA 4Y0NA 2IXAA 1CR1A 5F3RA 9ABPA 1DEHA 3Q40A 4U9IS 2WHQA 5CLFA 3NHMA 1NSTA 1I30A 3WDKA 4XIIA 3HVJA 1CEQA 4FFOA 4M36A 1F48A 5H68A 5DP1A 1YT5A 1G21B 2XXAA 2JFBA 2YIVX 1U2SA 5ELLA 1TTHA 1EGHA 5CDUA 1GGNA 2Q5CA 4HGRA 3M4ZA 3RAPR 5CNIA 3I01A 3BWXA 3FWPA 1QB8A 3RK0A 3V2IA 1NP6A 3KPVA 4OAQA 2AG1A 5HKBA 2PVPA 1KOJA 1Q91A 5IK2A 4XH9B 4K81B 2VDPB 3GNSA 1HDGO 3O74A 3DHVA 4WD3A 4GGPA 1DAFA 1J6UA 1R9JA 1SVLA 2Q3MA 5LDGA 3CGGA 3ZQ4A 1I8TA 1ZH0A 2HAEA 3ESXA 3GJ5A 1I3CA 3LO8A 3ZV7A 5KHOC 3F4BA 3CRVA 3DV0B 3S0JA 3TTWA 4RGYA 3P26A 5AW1A 1PG2A 4LRQA 3H9BA 2RJOA 1BXGA 4REQB 2VJLA 3GUVA 3EZ9A 3HG7A 4KNVA 5EFOA 4M8KA 3Q8LA 2QAGC 4JJZA 1SCJA 2IJGX 2XNCA 4CETA 3PL5A 2EAUA 4E46A 1SVKA 3L1UA 5TMEA 3NBZC 2XMZA 2FFHA 4NFHA 1ODLA 1ZMBA 4EG0A 4TS4A 3I9KA 3D1JA 2AW5A 4MDHA 4OHMA 2QLFA 4ZOAA 3COZA 3HZHA 4URHA 2CCKA 2WAOA 3F5SA 3DAPA 1B6TA 1OI4A 4BJ3A 1NMZA 3DEAA 5EZYF 1UBNA 4M7OA 3O91A 2NO7A 4P32A 4KW7A 3HBMA 2F2TA 2X15A 1XZFA 1JU4A 2BZ0A 4X1KB 1NG9A 1BYUA 3U3OA 3K9GA 3CURA 4Y2UA 3V1LA 4BRWA 4CMEA 1DFHA 3LX8A 4YTEA 1CQZA 2OV1A 2AZDA 3BIFA 3L7NA 1O58A 3OURA 1JILA 1FTYA 2RD2A 1UZUA 1XLUA 1T4MA 4NJMA 3QUAA 1VMKA 2F64A 3AVWA 3D5TA 1YRBA 3KS9A 1GQ2A 3TZEA 4KGZA 5IVDA 4S04A 4K6GA 1H4TA 3KCQA 4MWOA 5DM1A 5DFAA 3WYGA 3V1KA 4OHVA 3I1IA 1Z6QA 1QQAA 1BH2A 2C4WA 2OBNA 1NQAO 1E7RA 3AEYA 3QWFA 4UM9D 3H2ZA 2R5NA 2R751 1DAGA 3VO9A 3CW8X 1PV2A 4JVOA 3TQQA 1ZWLA 4MRNA 3V8MA 2OFXA 2CJWB 2FDCA 2I4MA 2OPHA 4ZTUB 5CW1A 1LEHA 2NU7A 3G9ZA 2OCIA 2OD7A 3KZOA 3QMMA 3PDHA 1ZXXA 4M53A 4BQQA 1V8PA 2VUUA 5ISMA 2VZ8A 3KVRA 2VWHA 1EUDB 4GKBA 4WX2B 3FZNA 3HEMA 3T9DA 2WF6A 3UICA 4D3ZA 3C16C 5B2FA 4EAAA 1U7WA 1T6YA 2KYRA 3WLFA 1Q0TA 3UCXA 1L6RA 3FLEA 4M4SA 4ARZB 4JU9A 4XXHA 5HMMA 1QHEA 2ZEJA 4PZDA 1EWYA 2JGNA 4B35A 5BR7A 1O6ZA 5ENVA 4RSHA 4AICA 1DBWA 5BW4A 1YZTA 4AKSA 3CH7A 1QAMA 2O0KA 5FP0A 3PC6A 1OPXA 3DUWA 2W6ID 2XD4A 2GQ0A 3D7KA 1UP7A 5LYJF 3VX4A 1ZN9A 2IOQA 4WLVA 3HCWA 1C8BA 3IB3A 4FT2A 5BRJA 1FDRA 3E3NA 1N34B 4RXMA 1ODTC 1UPFA 5DCUA 5FBVB 2XUFA 1BNCA 4RA6A 4JJ7A 5KQSA 5BUZA 4LYYA 1VL1A 4ZXPA 3W5HA 3ZE2B 3RC8A 1PVDA 1PR2A 1B1AA 4WJKB 4IMIB 4ENVA 3T9BA 5A4IS 1ZN2A 3PI7A 1QFSA 4Y2QA 3U44B 1NXSA 3PGKA 3PC8C 2E5LB 3ELWA 4D4GA 2X8WA 3R0VA 4A1FA 4LEIA 3OICA 4DXAA 1DAOA 2DFKB 4ANFA 3UW3A 4WCFC 3TTSA 2VTBB 3WSVA 4P33A 2UXBB 1VMAA 4A2QA 4GVXA 4O4HB 3UXHA 1NVAA 2QAGB 2Q5LA 4ZZ2A 3SE7A 4R98A 3KYDB 3WK5A 4QAJA 3GHYA 2O2IA 3A3KA 1RRMA 3BORA 1FU4A 3FDZB 3IT2A 4NOKA 1KP3A 1VJGA 2DQKA 4UD6A 3QZUA 3IE2A 3GVHA 3UMMA 1FXSA 2PWBA 5FR1A 1M1YE 3Q3GE 1PZFA 4ATNA 1G6OA 3R6WA 5AWFC 4KEAA 2C99A 1SD5A 4QASA 1JDNA 2DR2A 2JLVA 5IBRA 2GR7A 1PT8A 4WZBE 3NMUF 2A9OA 4ZVKA 4LISA 1INLA 1OIXA 2PGIA 3N0WA 1WXDA 1ZQ1A 2QN1A 2SKCA 1J0XO 3JSAA 1UXGA 3NYWA 3Q1KA 2Q4OA 1RHKA 1P2TA 2FPWA 3EDYA 1WW3A 2RGWA 4OHUA 2OG1A 4X45A 1L7BA 3SOPA 5I7FA 4GZ5A 4NU6A 4Q5IA 1KP2A 3ASYA 2CUZA 4R2WA 3LOQA 5T7BA 3QMWA 3H5VA 4NCIA 4LRXA 1JEEA 5AM2A 5FWYA 5JR3A 2Y67A 2PQ6A 4HX5A 1QHIA 1VGVA 5B30A 3IUSA 3M6WA 2V6FA 3PJRA 5HRCA 1PW5A 2XIQA 4JJ6A 3KQWA 4CI9A 4WBNA 1U0HC 2Z0MA 1L8QA 1QG4A 5CA0A 2JGJA 2RAFA 1IOZA 2GM4A 3H97A 4HOYA 4OQFA 4R2MA 5H7XA 1Z5WA 4YQEA 1FMLA 2OAP1 4V1CB 1F2DA 1G8HA 1YV9A 2UUPA 1E9RA 2JIMA 3ER6A 1F2UA 4B9EA 4Z1OA 3KR2A 2QN6A 2E3JA 1NP7A 3ZIDA 2CVQA 3I53A 3DMGA 3OSUA 4KVAA 3LVBA 3KDAA 4LOAA 4QULA 4L72A 1HDIA 3T9FA 4JQCA 1PWHA 3V7NA 5CD9A 1K6JA 5EIAA 2EBUA 2O06A 5JD5A 2OHFA 4K7JA 5I7HA 5BMVA 3SLKA 2WLSA 1U28A 1XA3A 3VC3A 2BT4A 1ZVMA 2PRSA 1YTUA 3I2YX 4RADA 1GZ6A 2JANA 5JJKA 1S4MA 2B0JA 4IV5A 2RKBA 2W6IA 3DOFA 4CV2A 5AVWA 3FXAA 2DBZA 5DRYA 1MHTA 4FMPA 2DLCX 1EHCA 3C6BA 5JNWA 5D1HA 4RH0A 3L84A 3GVXA 1BVHA 1BA2A 1GDDA 3BTSA 1F7UA 4KN8A 5JNSA 3QYFA 4JC4A 4CU2A 1QNLA 1JKMA 2XUHA 2VT2A 4ZGWA 2ZUFA 3WB1A 1T9GR 3BFPA 5KPDA 2JW5A 2BFFA 2ZI9A 1A95A 2R87A 1NJ2A 1JJAA 4JLSA 1VRVA 5D2CA 1N2HA 4B3DA 4CKYA 1YRHA 2FAXA 2Q7OE 3QVXA 5IW8A 3MAJA 4HBZA 4EGCB 3DW1X 3KG2A 5F4BA 5GGXA 3W2TA 1GNLA 3ZGYA 3RQIA 5KWSA 1JXQA 1ES9A 2UVDA 1A2OA 3LUFA 3SZOA 1JG2A 2I6FA 2GO7A 3SX0A 4IOLA 2W71A 3CX3A 3G89A 1FYWA 4P7BA 4JUDX 4D6YA 3WP1B 3KKNA 3L7JA 1IG0A 1MENA 1KIFA 1VFNA 4YT5A 2X42A 3DS8A 1D2GA 2QE7D 5HM8A 2FUNB 4ZMRA 3TKYA 1KZ6A 4UULA 4WCFB 4KR9A 3WBKA 1BFKA 2W2OA 4QFMA 2RAPA 2WWXA 2OLKA 2PSDA 4LV5B 4M8IA 2J0UB 4NFLA 1O5IA 4R4JA 5LDDC 4BNJA 2AYXA 2I2XB 2W2KB 1XL1A 3DXFA 2TMGA 4KWCA 4BGEA 3EPHA 5AKKA 1SN7A 1UXHA 3QEKA 3T1QA 5I3CA 3HVHA 1SUEA 2JZNA 2BY4A 1QH0A 1RW4A 1Y0BA 2V5AA 4P81A 3WL6A 5BWLA 4DZZA 5BYAA 1NLMA 2PBZA 3AEZA 4GMKA 4JOSA 4J16A 4J0IA 3GQBA 1WULS 3FSRA 2O2GA 2OEPA 2XMGA 5EOVA 1QAQA 3F5QA 3WYEA 721PA 5EJ9A 1QDUA 1R5NA 2YCBA 4C4SA 4N7BA 2KM1A 4G89A 4URZR 4BQOA 3C4QA 2NU6A 2H1LA 2HXSA 1W4RA 2C54A 4Q1VA 3W9BA 4GE0A 4DCUA 1MOQA 4ODIA 2XHEA 4ENWA 3OC0A 2WAXA 1KH3A 3QJYA 4IVPA 5FHRA 3WJ2A 4QDXA 1M2GA 3ENVA 3R0ZA 3ZDAA 3A1WA 4OFWA 1I3MA 2D74A 1PFVA 1Z6AA 4MCHA 1ZUD1 5IDXA 1YCGA 2AOXA 3WV4A 3FZQA 3HGTA 3L8CA 3GUZA 3LQ2A 3PPYA 1IQPA 2GBLA 3LCJA 4YA6A 1DRWA 4G4SP 5DYWA 3DP7A 3BF7A 4Q1BA 3IUBA 1SIOA 1TJPB 5HRAA 2J9GA 3QLTA 3L1JA 4WBXC 1PK9A 5B3KA 2OORC 2QRLA 4P3KA 1YAJA 2JD1A 3EDRA 1J9EA 4ALIA 4YEDA 1PEKE 1P61B 2JCXA 2O9JA 4CL8A 4FGWA 2A78A 4FWTA 2WAYA 3GW8A 5DLDA 1FS5A 3TR5A 4B2LA 2P6OA 5JJ5A 4RTSA 5EIXA 2VJOA 4KMOA 2IWRA 1CVLA 2ZTHA 4HFNA 4QG7A 3ANMA 3OX4A 3TSAA 3KWMA 2IYPA 1LWOA 1GVNB 3DHNA 1G19A 4K9NA 2PS1A 2WHYA 3WLPA 3K0BA 4RJTA 1E69A 1EIZA 1IXKA 3F7TA 5REQB 4IH9A 3R75A 1C9YA 2V0CA 3H2HA 4W5NA 2P68A 4IL5A 2HT6A 5J2UF 5AW7A 1U7ZA 5BY2A 4GP9A 2NUAA 1SNYA 1QGUA 1VE1A 3IJPA 4H7EA 4LSZA 1NNLA 2YFHA 4G67A 4G56A 4LJSA 3TAHA 1LUAA 4PZ9A 2BGJA 1KMCA 3M83A 4ASUD 1UPUA 1K9VF 3EVAA 2O3UA 4A26A 2VOEA 5G4KA 3GT4A 5DSZA 1W5AA 5C8XA 5KWEA 3S2SA 5I4BA 2RC6A 3CZPA 2ZYAA 3L3BA 2HYDA 5E6SB 5K0FA 1JEQB 2MMCA 2V58A 2QE7A 1NU8A 4KVZA 3UK6A 3DXXA 2B92A 2V7EA 1K6IA 2BPOA 1NVVQ 1W48A 4LBYA 4RVCA 4YJHB 4IRUB 3RAJA 5B5SA 3AVPA 2OQRA 4RS3A 1OI2A 2JB9A 2WKSA 5LB4A 3RGWS 3HYRA 4HMQA 1JJIA 2Q2NA 4G0UA 2SNIE 3OG9A 5LQUA 3F8SA 2HA7A 7MDHA 2HNAA 1OA0A 1MJHA 2VQ3A 2Y6UA 5DNDA 1VIYA 4D9EA 3KKQA 1HNZB 3SZGA 4Q9IA 4X00A 3JQQA 2NWQA 2M6KA 4ZV4A 5KNDH 1O0CA 1GSAA 2QTNA 5C1PA 4WFQA 2HJRA 2DSTA 5B55A 3PHIA 5JC8A 2E6KA 2WYHA 2V7GA 4HXFB 4B80A 3B1JA 1V45E 5B53A 4S0XA 1P77A 5K3BA 1W85A 2QX7A 3N2EA 5I5GA 4DY4A 5KYXA 4MGIR 3KHUA 2YWFA 2H7CA 1MABB 5JFGA 4I50F 1JG1A 2UVQA 1R3DA 3EGDA 2BMEA 1GUFA 4M46A 4RY2A 3EOZA 4RZSA 4S0ZA 2P9EA 1A2BA 5JSZB 4I4LA 2PBFA 4BEBA 4J1TC 3V2HA 2ZT5A 5DM70 1V41E 3F74A 4ZZIA 2FQQA 1U8CB 2OENG 4I2VA 3FYUA 5IXYA 5JUWA 4RPGA 2ZJ4A 4O02B 3EUFA 4ZMSA 4TXHA 1SBQA 3VR5A 3IQZA 2PLNA 2W00A 3GEMA 4CM8B 1L4UA 4YRGA 2WKWA 1Z5GA 5BPFA 4Q4AB 3LPNA 4B9AA 3DJYA 2PZJA 2OAEA 4HPWA 4XX0B 2AJ8A 2VUHB 1P1KA 1NDHA 3SHTA 4U2KA 1EFUA 3G6KA 1PLKA 1IN1A 1QTRA 4DSOA 4BQRA 3V5NA 2OCYC 4NU8X 3NCTA 3H8JA 4DLSA 2W42A 3G8DA 3O92A 1Y80A 1MB0A 1UKYA 2OHOA 3QUSA 3OX2A 2HLDD 1JIIA 4IW3B 4PC7A 2BI8A 3P1JA 2J9ZB 4RH3A 3WGNA 1R3UA 4N0QA 4Q3NA 3RU3A 4I3FA 1DXHA 3GVPA 3FZEA 1EM8A 4GYJA 4J2HA 1E1MA 2EWMA 1O6GA 2DP4E 3OZWA 4A23A 3EFOA 3KFXA 2V5UA 1JPUA 1QIIA 4L4SA 1W4ZA 2MSCB 1J2UA 3BZUA 4BQSA 2QZPA 2AE1A 3MMZA 5IDVA 4ROTA 4GXNA 1WKCA 4NCNA 2DM6A 3BKXA 1Z6XA 3CLKA 3HV2A 4AO8A 4ASUA 1NIJA 2ABWA 1G5PA 4Q00A 3W1VA 2H4XA 4BE7B 2CFIA 2IEAA 5LU8A 3LAWA 3R5FA 2SKEA 2EKQA 2CXXA 4M8LA 3E1KA 4ZT2A 4CU5A 5JSUA 1WBJB 3I1JA 1JTFA 5KWIA 3Q0EA 3OC6A 2CMFA 1Z6GA 3IT3A 3QPDA 2VYFA 2PMCA 4MUNA 1E3WA 1NXPA 1ZFNA 4QYIA 4BBJA 4DC9A 1LW7A 3LX6A 1VPTA 1YB5A 2YZGA 3PEFA 3WKCA 4B8ZA 5ADWA 2IBSA 4JLPA 3L8YA 1YULA 3OEWA 4BTLA 2GZHA 3EC1A 3FSEA 4MV0A 3EIQA 4QXMA 1RYNA 3L8GA 3NBXX 3SJAA 4BATA 5K0TA 5AT1A 4JJ8A 5TY0A 1NUHA 3DE1X 4MKXA 4PNPA 3S29A 4BRSA 3HYCA 2J7PD 4P84A 3MN1A 1TIPA 3FNQA 2FR0A 3EW7A 3M6VA 5U4XA 3U4IA 1B41A 5G0TA 1IXZA 5K01A 1C3EA 4JYZA 4UBNA 3BS4A 2IOFA 1A04A 1G6KA 2WOOA 3ELYA 1G2OA 1JMKC 1HXHA 3GJQA 4G0ZA 1IWPB 2IYEA 4H59A 2CYAA 1TZCA 3BCSA 3DW3X 4MKHA 5L4NA 3H19A 4CUKA 3W7VA 3PUIA 2BDEA 3LBNA 3CRRA 2P4QA 4OU5A 5CH5A 3RKRA 1NXVA 2QM0A 1MB4A 1P4SA 1V25A 1N2EA 2IXGA 3IAS6 3OZGA 4WKNA 3MRXA 1K75A 4A8TA 5DLQC 2XNDD 5GJCA 4RMNA 2HCJB 5HKKD 4Q4HA 2W6CX 1A69A 2EFCB 3LG2A 4TTTS 16PKA 3UM9A 3U81A 1AA6A 4QPJC 1PZEA 1I10A 1ZRSA 4U1RA 4UUMA 3VR0A 5E7MA 2X58A 4Q1AA 3SR4A 3S2FA 3TSYA 4EARA 2R6CA 1CQJA 5LXTA 1IWOA 2NIPA 3KUKA 2WUEA 3UENA 4AX4A 5A2GA 1LK7A 1C4OA 2ZTSA 3L6OO 1NATA 1EX1A 2NSLA 1ONPA 2WJJA 4DILA 1RXUA 4JD5A 1B4DA 1UEIA 3FFTA 3SR0A 2QYOA 1CFJA 1UBHS 3G2HA 5HIJA 4F06A 1SBNE 1NDQA 2Q1SA 3JRXA 5EL0A 2JFXA 1SURA 4R8VA 3R23A 4R6WA 3JVEA 3FBGA 3RB8A 5HXAA 1J9GA 5T4EA 2FXVA 2RHTA 3HCDA 1SCBA 3OECA 2JEZA 3AHIA 4P92A 3BWDD 3KSRA 3RFTA 2QI9C 5EMKA 1WDWB 2FQYA 1E2NA 3DBHA 3FOWA 3KL2A 3W90A 4YRFA 4M60A 1DOZA 4BQNA 3KAQA 4MITA 4TUYA 3IAUA 3VO8A 4QUBA 4UM5A 2BFCA 3QUBA 1LQTA 3BRWD 3TOZA 1UT8A 5AJYA 4DM3A 3U9LA 3PRKE 1LDNA 4US2R 2AFVA 5K2MA 3ZUGA 1YR3A 2RKOA 3A10A 1QO9A 3H2SA 1QZTA 4LJ5A 1H66A 4MVJI 4YDRA 1DC8A 3VU8A 4BO1A 1RXCA 3SBEA 3WNCA 4X5OA 1L5OA 6AT1A 4JI4B 2VHXA 1E5TA 1CYDA 3ZXUB 3O21A 5DCWA 3FCYA 3UGQA 1HE1C 1EJ6A 4P93A 4LVUA 4Z86A 2QVBA 3E48A 1P2BA 3FVTA 4CV3A 1Q1ZA 4LBVA 1GPWB 1KPIA 4M89A 1PSZA 3BMOB 4RM3A 4LE1A 2GASA 1QJCA 5LN1A 2OHVA 1Z8NA 2PSEA 4KXXA 4ALLA 3EARA 1UK7A 1E2JA 4WZAB 3GCGA 5LM3A 2P79A 2WFZA 2E4YA 2UZ1B 4OOEA 1IL0A 3DT8A 1TVEA 4W99A 2FW1A 4GOXA 5KTPA 4KPGA 2PRZA 3PGA1 6YASA 1Y9AA 1LVHA 2J7PA 4TLMB 1FNSA 3VO2A 1V5FA 4RDCA 1NYRA 1XZHA 1RD4A 1NFRA 1U3CA 1WBDA 2ZDGA 1UZMA 3FNGA 3HJNA 2RHWA 3S8YA 3D64A 3WYDA 2XTNA 2VJPA 3A6DA 2AOTB 3IVRA 3PQ3A 3V34A 1L1QA 5JS6A 1UC4B 2GZAA 2IQIA 3OCUA 1A8IA 1XZJA 4LZAA 3RAFC 1J2TA 1NL3A 1T8PA 3QG5A 3REQB 5DYYA 4JWTA 2GX6A 4C08A 1MO5A 4OEHA 2H7VA 3M34A 4P3XA 2VSYA 5DHUA 3PR3A 2N3ZA 1L5WA 1DKNA 1KWKA 2CL0X 2FSGA 1JLRA 3IBGA 3M3DA 1MOPA 2CE2X 4L4UA 4B17A 7YASA 1YI1A 1K27A 2XNDA 3H1GA 1LSJA 1R10A 1USWA 4ZAFA 4CF3A 5HKKA 3B89A 3E1SA 1SXPA 1CZOA 2WYOA 3Q3VA 3LYHA 5KDLA 4R40A 1Y82A 4MRVA 1L4NA 2P4SA 5EP2A 2EFDB 1CQPA 5IJ0A 1L1EA 1EG7A 1V3UA 3EQ9A 2P2ZA 1ENOA 3B6MA 3WGJA 4EHNA 5MDHA 4G0WA 3UYKA 4HFMA 3U49A 4QT0A 5BSGA 2BH9A 4D74A 4R83A 5LB2A 1CLEA 2HRBA 3L46A 3PFHA 1VDMA 3UJPA 3ZY4A 1ESNA 1PQWA 2WF7A 4MW2A 4TZKA 3JWHA 5F2NA 2DR0A 1KR2A 1S3GA 2NV6A 2RI1A 3CH4B 2F48A 2A4MA 2HGZA 5IHXA 4U6QA 4YRTA 2PXAA 2FPGA 4ZK6A 3HSSA 2A84A 1B73A 2AIRA 4ZRDA 4LQ4A 5H3HA 3DOJA 3VZPA 4RBNA 1P5HA 5DMXA 4BJ1A 4EW2A 4YXWD 3A6EA 1TM3E 3WLOA 4G81A 1HZZA 1H23A 4UU7A 3C14C 3OJEA 5FO1A 1QTIA 1NJ6A 1YJAA 2F43B 1RAIA 2ZFUA 3B2NA 3BRWA 2XMRA 1JHOA 4QE3A 4TTIA 4WA7A 3VOAA 1MDFA 4KFCA 4QM7A 5EHQA 2OC4A 2PVCA 3NUQA 2I91A 3OJFA 1NBIA 4KK4A 1L7AA 1FRNA 3E9ZA 4PYIA 4D9GA 4P80A 1RHRA 4M88A 1FP2A 2ZPAA 3QITA 1KZ4A 4QKQA 1IHUA 1NPDA 4FI3F 1W6RA 2P3LA 2XCQA 3A9CA 2CXRA 2FN4A 5AKHA 1WO8A 2EJTA 1SVUA 3HCFA 3MWEA 2FWNA 4YCNA 4IDFA 3GAAA 2IVFA 3PP8A 3RKSA 3M81A 3OJCA 3P5SA 3JD0A 3RS5A 3T61A 4P8RA 4DPLA 1THMA 4E1BA 4GECA 1Y7PA 3Q7RA 4XB6B 3OLXA 2L19A 5JT1A 4NBVA 4OYHA 1QVAA 3NM4A 1U6JA 2AMLA 4UHFA 3ZD6A 5I9MA 3S27A 2B94A 4I2NA 2JCVA 3EVCA 3O8QA 1C9KA 1PJBA 2ODBA 5CA1F 1P8JA 3TE6A 1YL6A 1SKQA 4E2YA 4ZYZA 4D9IA 2RK6A 2FWMX 1MHPA 4PS1A 1ZK2A 2B1IA 4KE7A 2R6ZA 2WSSD 3CZ5A 4Z0HO 4JP8A 3T06B 3QW2A 3B5IA 4JN6B 3ZWMA 4K9LA 3TX2A 2QG9A 2QLBA 1FVFA 2EC5A 3E9RA 3AR3A 4XCXA 5CJJA 1V9CA 3T3MB 1ADBA 1Z6TA 5ICFA 3OBIA 2I4TA 2A94A 1DX9A 3BBLA 1G8JA 2Q5FA 4L3WA 4TS9A 5LR6A 3GOQA 3RBVA 3GGGA 4NFSA 2ZSKA 1O54A 3TS1A 5KB3A 3LY9A 5CDGA 3OWOA 1VC2A 5J1TB 1GO2A 3MTEA 1QC5A 1XTZA 3KETA 1KSFX 3DOCA 1NN1A 1AIPA 3VNUA 1UBKS 3WRYA 4RCZA 2JGFA 2XBMA 1U2GC 3TSZA 4X9XA 1BEZA 2YIMA 3S6JA 2WFLA 5B6IA 1RABA 1IHDA 4X44A 3H2IA 5PNTA 4LHEA 5HUHA 4RTRA 4ZT5A 1G5QA 2KPOA 3SNHA 4IEEA 1H0HA 1NM5C 4KQJA 1ZNWA 3WLRA 3LLMA 4DG8A 3I8XA 3RTCA 2P6NA 3D4PA 4GI7A 5CGQB 3ZE7A 1KEEA 2PV0A 2VXCA 5KOJA 3UQZA 4HADA 5JH7B 3CJTA 1LFAA 4FS3A 3GRPA 3P9IA 4B3FX 4BAZA 2YRWA 3D2AA 3DDSA 1IY8A 4F3CA 3MRTA 4KQHA 1JV2B 2W90A 1PWYE 3CA8A 4JLUA 2YBEA 2X40A 1DWQA 4YXWA 2GNAA 4Q3CA 4DRXB 1MORA 2NZ2A 2W93A 3EMBA 3LWDA 3P0RA 5AM1A 3W0LB 2G16A 1X74A 3SLRA 1G4UR 3U1BA 2NZUG 3RHZA 1Z34A 2H1WA 1SZCA 3EVFA 3I2HA 3LFHA 3MELA 4GL4A 5I9SA 4DRZA 1E2MA 3SX4A 3COSA 1R0LA 4U00A 5ALDA 3O1LA 4MGKR 1F7VA 1E6EA 3FVRA 3LY5A 4C4YA 3JVIA 1Y5NA 1XI2A 2X3YA 3HDVA 2FPSA 1J1ZA 5BQFA 3AHFA 1M1YB 4MV7A 1HFJA 3BICA 4DM7A 3ESRA 4KI0A 4FZJA 2YJ3A 2ZIXB 1WMAA 3BRQA 2RGNC 2XOXA 5K4GA 2Z5GA 4AAYA 1ABBA 5FADA 3D6UA 1ESEA 4NBRA 4N39A 1XNQB 4P35A 4RX1A 4ZP1A 4IJKA 1HOXA 2YX1A 2QMOA 4A2CA 5B6PA 2B20A 2IHKA 1UDWA 1YR1A 3C4JA 1VPLA 3LTEA 2JFOA 4WK4B 3OI7A 3V4VB 1H1LA 1Z4PX 3TQRA 2JLAA 1R8YA 4JLOA 4IHJF 4TWIA 4V0LA 1WNFA 4JQSA 1X1EA 4L74A 4QFCA 1KDOA 4QNMA 3RF6A 3RJ9A 3UUWA 1R0RE 5JQGA 1KOLA 2C2HA 1O97D 3CSSA 4FLMA 4BXOB 1HPLA 2EATA 2WJWA 5D87A 1VI5A 1KMNA 5F2EA 5SY6A 3WIVA 4BNHA 4C0QC 4C22A 2Z56A 4KI7A 2ZZMA 3WGVA 1LDYA 1E4OA 3OHMA 2WSSA 4EEZA 1O5OA 2BGGA 4C9BA 3UWDA 5J3JA 5G0UA 1LNSA 1PRYA 1VRCA 4X6LA 1J8FA 2PZ8A 3AR4A 3EWIA 4LI3X 3RSOA 5LZ9A 3HXMA 4Z4GA 4W5WA 1REQA 1Z7GA 2X2OA 2QK4A 3AUAA 4JBGA 2DPGA 5J43A 2BGRA 3T1HB 1R12A 4CNBA 4ZAWA 3DZBA 1ULZA 4BIMA 2ZS8A 3UC5A 3DLHA 1JYFA 2QUZA 4FHEA 4I6JA 4M1QA 4V0KA 4IGEA 4JT2A 3TIGA 4H6PA 5IEJA 5AVQA 1OFUA 3OZDA 1P1IA 4C05A 1VJ5A 5JU6A 2C97A 4F46A 1BU5A 1EK1A 1IJKA 1HE5A 1NR1A 1NVFA 2BF4A 4J6EA 1LBEA 1OWMA 4P86A 4JVNA 4R01A 5ALUA 4EPXA 2RBKA 1D7AA 4BKQA 1YL5A 4II2A 5IASA 1O96A 3HJHA 1VYUA 3B1YA 4NS4A 4QUHA 2CL7X 3SDBA 1QG0A 1MQAA 2H1SA 1T4CA 1L4EA 1DQNA 4CEJB 5EWLA 3I83A 1ECJA 2HQ1A 1SHUX 1DO0A 1G3QA 4A5SA 1E3LA 1KQFA 3E2PA 2AJBA 3I5UA 1I94B 3HBFA 4PC2A 1C7EA 1LQ2A 1OYOA 1WX1A 2ACEA 1PFWA 2ZAIA 3L0BA 1C1DA 4MX8A 4TL6A 4XYBA 2IF2A 4HAWA 4EY6A 1TT5A 2XWQA 4YC7A 4WESB 5CP8A 2VHCA 2FEKA 2X3UA 2XNHA 1KYQA 1ZBQA 3DZIA 3DXYA 4K5QA 1MG0A 4MOWA 4XDZA 1BX0A 3SYLA 1CJVC 4KZPA 5A71A 1XB2A 4D0LB 3RG2A 3FX2A 5H3CA 4CE6A 3RC1A 4DV6B 3CLUD 2XE8A 4CF6A 1QGAA 4NKRA 4EHFA 1HY3A 2ID8A 4OGGA 5DSTA 5G1PA 2O59A 3R9XB 4IYJA 3TRFA 1KVUA 4FNMA 3TSCA 3D8UA 2EJCA 1R8SA 1PT5A 1XL0A 2OK8A 3KEMA 3NKFA 3O4RA 2WMDA 5K45A 2O8BA 2EF1A 2QTBA 1WS6A 2I62A 2QLNA 2WJ4A 1ZQ9A 3MGCA 2BEUA 3R77A 3RVOA 4WFJA 3RSSA 3W77A 3UC9A 3I4FA 1ZVKA 1P31A 3AEKA 2JVIA 3H6HA 3S8MA 3NBAA 3EXG2 4LHVA 1TLTA 3A6KA 5EZYA 1L5NA 4HL6A 3H8VA 1GFIA 4JYCA 3WL7A 1WXXA 1Z06A 3QOYA 4W9MC 2I4LA 5FRDA 2PUCA 2W2NA 3DT6A 2QN3A 4HXEB 3ZWYA 2FWBA 4YBRA 1DIBA 4HNUA 4R8MA 5CUQA 3ONFA 4DPKA 3OFSA 4I5FA 2QBYA 1Z7BA 5DOVA 1OR8A 2BEWB 3MWJA 5JTUA 2DE0X 3RS8A 4GP6A 5I8PA 4OKSA 1ZH6A 1GZVA 1PR0A 1TU4A 4DDKA 2Q7XA 4PLCA 1ZXLA 4LNUA 4MW0A 4V3BA 4W5JA 2C82A 5HGJA 2D13A 3WL4A 3O8OB 3GI1A 4UHEA 1N0WA 3MF4A 5DHAA 5KNDA 1P3DA 2JRLA 1SA0A 1NNUA 4Q47A 3MSXA 3PXBA 5AVZA 3WL3A 1H9CA 4FK8A 2YYZA 3DB2A 5G02A 2BTEA 4LCBA 2A57A 3W8DA 1DO2A 5IMSA 3R3ZA 3GJ6A 4RVOA 2BHRA 3JQ9C 3GUYA 5JC1A 3PC4A 3GJTA 1GG9A 3ROGA 5CITA 1NAHA 4IY1A 3KC2A 4JJIA 3T7IA 1NSYA 1OBOA 1YUNA 3PKJA 3V7UA 1Z5ZA 2E1PA 3MJDA 1KA9H 3QY0A 4GBJA 4GX2A 5BYKA 1J8VA 1WPXA 2HU8A 5J40A 2EZ9A 4C6TA 5DNWA 3NAZA 5E6RA 1XA0A 1JA1A 1Y6RA 4AJOA 3BE8A 1OOEA 4RD3A 4M1WA 4W8GA 5CM9C 5EWJA 2HJ9A 4BQFA 4DQ0A 1AO0A 5FPKA 1J2EA 3RWOA 2VAXA 4MVWA 3STUA 2UYOA 1GKKA 4TKUB 1K0FA 4WCDA 3FJYA 3QOXA 3SU8A 4ZYVA 2AEMA 5JI2E 1SKUA 2N1BA 1O3YA 3OQOA 4TRJA 4JQZA 2P6PA 4H0NA 2HHLA 3RC3A 1DDIA 4NS1A 4HDQB 4BV8A 4LNAA 4S1PA 5L53A 1WBBA 1UFOA 3OZXA 4UUPA 3DTTA 5LP1A 3ZGNA 3ILSA 5LYJA 4BB0A 3BXXA 1JIKA 3H18A 4BKOA 1UK8A 1CT9A 1XAJA 5L7YA 3DFUA 1U8UA 4RJ2A 2REOA 1DFGA 2WZQA 5TQ2A 5BV1A 1N5LA 5KTOA 3ZD8A 4OQXA 1VG1A 4YRMA 1JQJC 3CEJA 3SG0A 3WKAA 3AIMA 4LWZA 1YHNA 1OREA 2ZYUX 1H5UA 2JFGA 4A5OA 4GXTA 1GUDA 1R4NA 4NIMA 4RGVA 4ZEVA 5IULC 5HKLA 3H9QA 1KAGA 3PZBA 1HLPA 4N49A 3PQ6A 4HGPA 5EJMA 2ZAOA 4J0EA 4PC6A 1PE0A 4R5HA 1MRZA 1JHUA 3UAWA 4NXMB 3OTIA 4UXIA 2GEUA 1IHYA 4ZQIA 5K6TA 1XR3A 3LQYA 3HLTA 5CBPA 5IYZF 2X0FA 5I7AA 5IJZA 1JL3A 1ODIA 3M6MD 5HDQA 3TL2A 2QF7A 3VH3A 1MZVA 4AYTA 4FQ8A 3VZQA 3HL0A 2OOSA 1KMMA 9MHTA 1WP4A 4KBFA 4JJ4A 2Z57A 2HOQA 4Z7QB 4J8PA 3CFAL 1RNLA 2OQ2A 4Q7JB 3FVVA 3RVSA 3GFRA 4DIKA 3HKBB 4GC9A 5JS1A 1GXSA 3AKCA 3FUCA 1PWEA 3L0CA 4YJGA 4C4AA 1CEEA 2YOGA 4ON9A 1FUEA 3K0FB 4IDBA 1Q84A 3CMMA 3U7QB 5JASA 5A1TA 4M86A 3VYSB 3W5VA 4Z4EA 2RARA 1KI6B 3EISA 4Q16A 4XUEA 2H1HA 2VH5R 3C7KA 5KS2A 1PZGA 3ND6A 2V8OA 2OXTA 3G0DA 1CDDA 5JXJA 4MYRA 2WWYA 4X1IB 1YACA 1VHLA 3GFFA 1PL6A 1ZGHA 2HM7A 4WW0A 5EKXA 1R5BA 3H9UA 4H3VA 2XUKA 3FRIA 5DXAA 5KKCA 2FW7A 4IDHA 3Q7QA 5G40A 3E2MA 3UAXA 3ADCA 3RT1A 4B3MB 3W4KA 3CWQA 4DANA 2C8VA 3CEPB 5KQPA 121PA 2FZKA 3UG7A 2MINA 4MUFA 3IESA 4PTZA 4A2WA 3ZWKA 2GESA 1VKHA 3EIFA 4Y6OA 1QVZA 4BP3A 4FKZA 4XQGA 3O73A 1YU6A 1T2EA 1O03A 2LDXA 1PZXA 9ATCA 2A1TS 4QX6A 3YASA 3N2KA 1LPPA 4Y2GA 3SDZA 5FUQA 1QM5A 3L9WA 2V8BA 2XUJA 3FH0A 4CMAA 4K1LA 4OY3A 3FPKA 5DWVA 2HFJA 2P2GA 3DHYA 3UJ9A 1KL7A 1Z4OA 2EP5A 4E31A 2JC3A 3E23A 2IC5A 2W2QA 4M0UA 3T35A 4ZI3A 1ZGJA 2XX3A 3RYIB 3S7TA 3AI7A 4B48A 3TEJA 3HB1A 1XNRB 2NPOA 1J7KA 3QEOA 4H15A 4LHWA 1BDJA 2XKBA 3MT7A 3TKAA 5IF3A 3VTFA 1DXYA 3HK2A 2UYCA 1SKYE 4AC9A 5CGZA 2XMCA 1E6MA 2I67A 5DLPA 3U4HA 1D6NA 3HCRA 2WFMA 3KZNA 4DCJA 2XMQA 1WZEA 2H5LA 1JA0A 1A9ZA 4PF1A 4UFPA 5A9SB 4MB2A 3QFSA 3HU5A 3ANYB 10MHA 2O6HA 2OKCA 1ECPA 2HV8A 3K9BA 3T7SA 1MW9X 2XQJA 4UUQA 3EZXA 4BO2A 5ITSA 3PNMA 1OGYA 5KIAA 4ETNA 1MVOA 1HDOA 1WSWA 3EC2A 3HKDB 4C7MA 2PGOA 4UOEA 4X66B 4HGYA 4B6QA 2Z5VA 1Z22A 1E96A 1YK1A 2F4NA 2ZB7A 2GZSA 3VR3D 1E79D 4LJ9A 5JRJA 3OFJA 1M10A 3OT5A 3AP3A 4Z9XA 1YDHA 2JJ1D 1LQUA 4O1HA 1ZK4A 3EMKA 4AECA 1M5RA 2XGGA 1U3UA 3ZNQA 5J58A 5WRFA 2WVGA 4FEYA 3NRJA 1Y3IA 2C0PA 3O03A 1W19A 2AXEA 4B4OA 2QTGA 3JWPA 1DU4A 3K1YA 3VR4H 5JADA 3CX7A 2GEVA 3FKSD 4ZKEA 5AXCA 1USVA 3RRZA 3UV7A 4BO6A 4MGEA 1XZMA 1KAOA 1KNQA 1CG6A 4KPYA 4G5FA 1S9DA 3DF7A 1KIAA 3T52A 4WFKA 5K51A 1UADA 5IM5A 2GXQA 1ABEA 4UDYX 3A1SA 5A7FA 2PCJA 5TB5A 2IIPA 1E2BA 4V0RA 1WXIA 2FEAA 2Z43A 3D0KA 2O3TA 3DCJA 3Q6IA 1Q7CA 1SD2A 3P9ZA 4PCVA 3N8IA 4RHXA 4UNSA 5DSXA 3WKBA 4Q19A 3IOBA 3DCNA 4MYTA 1KMQA 1FFAA 3C48A 1NC3A 5G2FA 1N9ZA 2VSNA 3RYCA 3C41J 4CLOA 4BY9E 2FFJA 2AWNA 4RK1A 4Z49A 3NT5A 4QVIA 3OZIA 4EJFA 3AHCA 4EHAA 4E6PA 3IEKA 3W8FA 1GTG1 1T9KA 4B6OA 1J20A 4HAOA 4CQJA 3ZDCA 1HDYA 2J6IA 5JROA 4I55B 1O8CA 1OZ0A 2P27A 4G9EA 3CKMA 4LI0A 2YRFA 4YDHB 1KK0A 5DW3A 4WKOA 2PSSA 2XZOA 3AP1A 5KYWB 4LQDA 4QJBA 3DDNA 4I1YA 1NWCA 3Q0IA 3HCAA 3ZHOA 1WF6A 5B4VA 3HMQA 4MV1A 5CDFE 2H5JA 2KQUA 1M67A 2C5HA 3GLTA 3FWHA 3AYZB 2YL2A 2M32A 3UQYS 4A3SA 3LLSA 1N2CB 4YP6A 3ZJYA 1M2EA 1OLOA 4EGAA 3E9QA 4O2BF 3L18A 3RAGA 4BNUA 5EJFA 3L7OA 4RVUA 4XX1A 2BMAA 4DMCA 1VDZA 5JY6A 2R8BA 2DHDA 2X1LA 3N2GB 2G77B 3PPXA 1AKYA 4ZI5A 1K3FA 1FMFA 4H1UA 2E5WA 1FLNA 1B15A 1JPJA 3NHUA 3CMCO 2ZU0C 2AJDA 4G6ZA 5BSKA 5DM2A 1TO1E 4YJFA 5DCLA 5C7LO 2R8PA 2WJ6A 5IXSA 5LQNA 2ZT6A 1A8SA 3NDRA 4FFBA 4LK2A 1L8LA 2PLFA 1UCFA 4EG4A 5J2UA 4JASB 1P18A 3PGLA 1QRAA 4I46A 5EMNA 3OPYI 2KLHA 4MQEA 2I65A 3LBHA 4LJ7A 1HZJA 4W1RA 4OBEA 4FX5A 1W88B 2XYGA 5KSPA 5TPWA 3MTBA 1WHSA 1WG8A 1YF3A 2P2DA 3ONNA 1TCBA 1R5JA 5DBFA 2EWVA 1GADO 5TR9A 1TW2A 1JE0A 2JJ1A 3EDQA 2TS1A 3KPUA 1WZUA 4LYAA 1QV7A 3VDXA 4KL8S 3Q1LA 1N1EA 3CH6A 4IIFA 2WQ7A 2D7DA 1PNTA 2UUBB 5JNTA 4F72A 4LXUA 4EKGA 4RPIA 1R74A 3KUUA 4JDUA 4HG2A 1D04A 3E9YA 3FKSA 1F1JA 1RRCA 3BJIC 5B1HA 1LPBB 3L6EA 1MFPA 5BN3B 5F7XA 3DMDA 1XX6A 5I7UA 1OROA 3M6XA 2OCLA 3TJRA 4HXYA 1TMYA 1U04A 5A5EA 1D1SA 1JLKA 4CKWA 1FTSA 1AUOA 4E5VA 2Q49A 1OYWA 3F4LA 2QTFA 4FMDB 3CH5A 4PLFA 3HO1A 1X19A 1XTRA 3D3WA 3BH6A 1ECGA 3OTHA 4LOKA 4UFNA 1F17A 1JAXA 3DQPA 5DTEA 4RTLA 2RGBA 3X1MA 4YRNA 3P9RA 2XQKA 3HRHA 4JYPA 1OJLA 5HF6A 4EQ6B 3OTWA 2H4HA 2A54A 2PAAA 1JJBA 5TJ9A 6NULA 5BRAA 2R8ZA 2GKOA 5EC8A 2DUMA 5EP4A 2YN0A 3FTNA 1RDFA 1ETHA 3ODPA 1OA1A 4NBKA 2O8EA 3FHTA 3UN1A 3IBFA 4GPEA 2J5BA 4P2GA 4W1PA 4X94A 2PIDA 5FYDA 5KTMA 4TXNA 4P5PA 4LF8B 1P5RA 4BU0A 3CEAA 3NOXA 3UMRA 3TVTA 3FI0A 1Q0PA 4OQ4A 2QZ4A 3C15C 3UJHA 4X6YA 3UW1A 1TO6A 2HXYA 1WEKA 3R8XA 1F4LA 2ISSD 4WI1A 3DMFA 5IWAB 4YJKA 4D96A 1BVRA 4EHIA 3ZNNA 4D99A 2IGTA 1NYLA 1RLMA 1G8MA 1U4NA 2JHPA 2QN7A 4KH0A 4WHMA 3WYNA 1HORA 1WCIA 2EKDA 1QPBA 5ITVA 4NBNA 1QFMA 2J3QA 4BUCA 3ZK9A 1V39A 2JNWA 4M1MA 5E0KB 3ID6C 4YMLA 1W36C 1DLJA 5TT0A 3AHHA 4QO7A 4F7DA 1ZD3A 5J5CA 2HUPA 1Y7IA 1TIBA 4MV3A 4EFLA 4X71A 1YXMA 2I1WA 1U8TA 1YBHA 3AM1A 3EE6A 4IS2A 2QY9A 1Y4ZA 2QUAA 2WZCA 4YVFA 3T4XA 2GJ8A 3CFYA 3W05A 2BTOA 4CFSA 5LUAA 3EZNA 4AP5A 2PD6A 4TQGA 4EEKA 4L9SA 4EECA 3EF1A 2AN3A 4GKAA 3I5AA 4JLDA 4OJKA 1G60A 2JFPA 4FHGA 2Q8QA 1V1RB 1TKBA 2V1XA 1K8XB 5BWBA 1GP2A 5M7EA 4LYHA 4S12A 3TLGA 1L5GB 4BC1A 1SBZA 2XAUA 4H0FA 4Y9DA 2WYVA 3PUHA 4DJAA 4JJKA 1Q3HA 5IKXA 3UMYA 1IBRA 1H4QA 1PVVA 4HQ6A 2RDMA 3MMPA 1R2QA 1VCMA 3A3OA 2YN2A 5IT4A 5EEGA 4EDHA 2B3TA 3LPDA 2GCGA 3R2JA 4L0MA 1ZDMA 4IM7A 1WCYA 5YASA 4W5OA 2H0RA 3CI0I 3IOCA 1KVSA 1SCAA 3I4CA 4GW3A 5TQ0B 3OZVA 2O7VA 2VK2A 3K9FC 3KUXA 1SMKA 4IILA 1PL8A 1PWZA 4BPBA 1D2HA 4AZ3B 1I7QB 4QGHA 4Q9JA 2J07A 4PSUA 4UBKA 4US0R 2MSEB 4NG5A 1KH1A 3T4EA 2HQBA 1QOPB 2R7AA 3A1NA 1V9LA 3IE0A 4DLNA 1G38A 1ZIOA 1C1YA 2H4YA 2HQRA 2J9FB 1LB1B 1MNAA 1GR0A 4FZVA 3KSBC 1RJGA 4NZMA 1TDJA 2P67A 5SY4A 2FXIA 3UFXB 4KO3S 3HO8A 1BCSA 2GZDA 4DBZA 2Q8PA 3EN0A 2W9XA 3KO8A 4TZTA 3ZY2A 1ZC4A 1LS6A 3VZDA 1OI7A 2LCIA 2PWYA 3OX1A 1YCHA 4Q05A 2WT8A 2XIJA 3BQNB 3STVA 2R6JA 3JZMA 5EI5A 1ELOA 5C31A 2QGFA 1PK8A 3DD5A 5KINB 5TF4A 1ST3A 2RGGA 1FVOA 4PLVA 5I5EA 4G25A 2BFMA 1UQRA 4AQ7A 4N7JA 4PYNA 4QECA 2GJ4A 2P9TA 3QVUA 1MAVA 3BGIA 4QDZA 4R1OA 4OOFA 2N42A 2ZETA 4N7MA 3WWPA 4EUNA 3IUMA 5LZ8A 1OTHA 2M6SA 3VZBA 3E7WA 1IONA 2NZWA 3V6MA 4IXMA 5HHTA 3Q2KA 2EXXA 5K2OA 1CB0A 2PY6A 4QREA 3HCOA 1XRPA 5BR1A 3T7CA 1JKJB 2IEGA 3GN2A 1XPJA 1WDTA 5JYDA 1Z0FA 1QP0A 3C3YA 4JV5B 5FOVA 1TUGA 2ADFA 4R1TA 2ZT7A 4NVRA 2IT1A 3ITEA 4OLHA 4BEWA 3CEMA 4F3YA 4ZI7F 1VIVA 3DZGA 3H5WA 2GPYA 5A5VA 1HFWA 1EDEA 1KFKB 1NHGA 3BZWA 3L1IA 2A0YA 4RO0A 4UHDA 3T3PB 3OY7A 4EGSA 4F2WA 1W36B 5DJ5A 3EPJA 5JAZA 1AGRA 1XDZA 5DX8A 3CUSA 1YFJA 2QXYA 3PENA 4UMDA 3VVLA 1VJ0A 2ASVA 1XJ5A 1KFJB 3K0KA 2HZ7A 2XA2A 3MIIA 4MQFA 3Q85A 2A0XA 4IG9A 4PVCA 1T0UA 2AEFA 2FK8A 2PT6A 5ERXA 3GHHA 1PGNA 1ADGA 2PA0A 1M1UA 1GNPA 3RU7A 4KIFA 1M34E 2VAWA 3BHIA 1C80A 4PQEA 2PJUA 4EA7A 2O20A 3BD8A 3E8XA 4MW6A 4JR1A 2CFOA 4CN9A 3CI0K 1FJHA 4KQCA 1YA4A 2H65A 2HA4A 1CIJA 3IQHX 3PC8A 4M0PA 3S68A 4C76A 2JL1A 2IXEA 4O5OA 4Z5XA 1PVOA 1RLJA 1RI5A 3AIKA 4MPPA 4NQZA 3ZLBA 5FH9A 4FXOA 1RP7A 3SYTA 5F3WB 1TMKA 3QVMA 4W6QA 5B12A 2OBBA 5E8RA 1W5EA 2WG2A 4TLLB 1EUCB 5BVHB 2ZJBA 1Z17A 1LBQA 3KJXA 1U2DA 2VPYA 2DBQA 1ESZA 3S2YA 3CLSC 1UZLA 2N1MA 3CKLA 3W2EA 1XZPA 1Z4QA 2X0IA 4RVDA 2IW1A 1UKCA 4AI6A 3NVAA 3Q3JB 2P9BA 4Q7LA 4NDAA 4BECA 2I9KA 4ZGGA 3A2MA 3LF4A 3EXEA 3LDGA 4OAPA 4QAQA 1G9TA 3CEHA 5DZSA 5JAMA 2P6RA 2HPAA 3A8TA 2WYUA 3VSAA 3U62A 4HQ0A 2XE4A 3THXB 2HK6A 4NZPA 4B46A 3CJQA 1KFEB 2FE4A 1KYYA 3MINB 1J1IA 3NORA 2WUDA 4F2PA 2P9ZA 3IP5A 1W59A 3R9KA 1OHHA 2XUDA 5G0VA 3CC8A 2GTIA 3N2NA 1U0RA 3GWZA 4PR3A 2QGZA 3O4IA 4K86A 5ER6A 3MUEA 2VJCA 1ZSNA 3N0XA 1FNNA 4KFUA 4PNHA 2QR2A 4REOA 4GWLA 5BW8A 1GTZA 1X1DA 1Y1KE 1LZKA 4L75A 4F8EA 2WV9A 3M6FA 4LKRA 3V4RA 4C6RA 2WNSA 4ARAA 1TMGE 3LWZA 1SULA 1XD8A 3DYIA 1XAHA 2KWIA 2FUEA 4RD6A 2Z09A 2AKAB 2V6IA 4TV9F 1A27A 2XE7A 3K6JA 2E4ZA 1SXJB 1DTWB 3IA2A 3MPUA 3MS4A 4WOJA 4YMSA 3ZC3A 4AWBA 4KPEC 1XWFA 1ZMOA 4J0HA 4BCBA 2VL7A 4HLCA 2VNSA 4N6OA 1UDXA 4CPDA 3ZCTA 2IYAA 2BFDB 3DBRB 5D86A 3ZHZA 4YCMA 3ML1A 4I5DA 4JOCA 5JZBA 1L5QA 2O23A 1H6CA 1KJ8A 1RXSA 1PKEA 2QYSA 3ILYA 1U6KA 4J3NA 4IF6A 5ARCA 4TLBA 2IDKA 1W87A 2YWHA 1C7ZA 5CFMA 4YCBA 3AU8A 2VZ9A 4JUAA 4EL0A 4W82A 1TQ8A 3OLYA 4OYYA 5L4SA 2JHAA 3JAWA 2VP0A 1UBSB 4E2FA 1EESA 4BV3A 1JEYB 3OOYA 1KXJA 3QU9A 3VGPA 3IS3A 3MQ2A 1P0QA 4L4RA 5CVJA 5CXXA 3FYCA 2JAWA 3A06A 1W94A 5EXSA 1NBHA 4G0XA 3UKDA 4JLMA 4E1AA 5C52B 3Q2OA 1K97A 3GFBA 4UE3S 5TGZA 2BMVA 3AQ4A 3KYCB 1XCJA 4L5YA 4QYMA 3ZJ5A 4B40A 3BFXA 3DZ8A 3EBLA 4Y98A 4U3JA 1YQGA 2P5YA 4ND1A 2BONA 5K3FA 3V8BA 3VA7A 2DMRA 4EZBA 1IOLA 3O93A 2HA3A 4GX5A 5T4HA 4C0BA 3EB9A 2V5VA 1X7XA 2JVKA 2I3GA 2R8RA 3RYHB 4E2ZA 1NVVR 1TUIA 1FLVA 2G1JA 4BFTA 2SBTA 5AW5A 3O0TA 3U40A 3OLWA 1QHSA 2WF5A 1K7EB 3NIWA 4MV5A 2F59A 5H3LA 3UV3A 1TZMA 3VR4D 2NUBA 3L05A 4FS8A 4BC0A 3JD4A 1G7SA 5CA1A 1LX6A 1RWQA 5J1SB 1YZUA 1SEVA 2A7QA 4Y0AA 3B1VA 4Y6LA 3RRJA 3V9PA 3VAYA 1I4EB 2XLCA 4P36A 3UNXA 4KGVA 2B34A 4XD2A 1Q7EA 4EFDA 4EQZA 3TBHA 1JKIA 4I0WB 1XRLA 2C20A 1MRSA 2E18A 5JFOA 1CETA 2MCFA 2RH9B 1UZAA 4Q02A 2AFHB 2GXUA 4G85A 3LC0A 3IVGA 4TT8A 4GGMX 2Q6LA 4QU9A 5KJCA 5HX7A 3NWPA 5KUTA 5TEWA 4OQLA 5KJ1A 3IDAA 3WQRA 4YLEA 2OYCA 1HBJA 1MAAA 4Y1RB 2A5LA 3L8DA 3O7WA 5KTRA 2QTHA 1II9A 2V9PA 2CVOA 5HVNA 3DYVA 4G8BA 1ZW6A 2O8DB 5HFNA 1NE7A 3DQZA 3TAXA 2M9MA 3QXXA 4LF6B 1C4KA 4DJEC 4JODA 1Z0IA 2BGTA 2XMSA 2ET6A 2GLUA 3M5CA 5C8VA 3GCXA 4ER6A 3ZEAA 1CR4A 3IRUA 1Z0AA 2P6MA 4JEMA 3JV7A 4G8DA 3WAJA 4U2DA 3SQOA 1I7SB 2F8SA 4OM7A 1OXKB 1T5TA 1DJMA 3CR7A 3MD0A 1QOQB 3BREA 3BIXA 3PEVA 3UMJA 3ES9A 4EI2A 2IDZA 3JZAA 4QC2A 3GLVA 4QDOA 1IB0A 1C30B 2CL6X 1JSLA 2H57A 4B7AA 2EBHX 3EXIB 2NYRA 4QBGB 1O9GA 4MEJA 2CDRA 2H2WA 4PAWA 4V0QA 3VPXA 4Z51A 4ZZ3A 4E03A 1M2HA 2RG1A 5J23A 2XYVA 3BIWA 1M8PA 4M8NE 4EVSA 4W5RA 4RZ2A 4EGJA 2X0JA 3K4QA 1A5TA 4DZTA 3DHWC 4GIBA 1HT1E 1GFSA 1U7DA 2QRHA 4WLOA 3AJ8A 4J3JA 2VPZA 4XLTA 4EL5A 3H13A 4LRUA 1EHYA 3KWJA 5M3BA 4D4MA 5KTKA 4QYSA 3SFVA 5CEJA 4NJEB 1BGXT 4EUKA 1QZZA 3GGOA 3IAEA 5CAEB 4TWRA 3VVCA 4ZOLF 2WHEA 1NI3A 4NWIA 1TXGA 1XA4A 1JG7A 4TWAA 2P9YA 1H42A 1FB5A 4EFKA 4DZRA 1MAHA 2UV8A 4H1HA 4URXR 3ZOKA 1H8HD 4Z54A 5KO2A 1MOZA 1L7PA 1Q3TA 3RIXA 2GJKA 4KIWA 4OU4A 1NWHA 2OP0A 2AYZA 2LCQA 1JIJA 2QU8A 5IAGA 2CLCX 2WHXA 1M72A 4X1OA 3WLSA 4Z3KA 1JXMA 2O2HA 3L1VA 3RVDA 3GLIB 1A1SA 3FVWA 3VR4A 3AG6A 2J4DA 3WNBA 1T5HX