4G68A

Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
392
structure length
392
Chain Sequence
ITLTFWNLFTGEPAKTKVKEIIDQWNKENPNVQIVESVTENDAYKTKIKAAIAANEAPDIFQTWAGGFSQPFVEAGKVLQLDSYLNDGTKDQLLPGSFDNVTYNGKIYGIPFDQQASVLYINKELFDKYNVKVPTTFSELIDAIKTFKSKGVTPFALGEKDEWPGMWYYDMIALREGGVQLTRDALNGKASFDNQAFTDAAQKLQDMVNAGAFDSGFMGLTRDEATAEFNQGKAAMYFGGNFDAAAFVSDPSSLVKGKIEAVRFPTIEGGKGDPTEYIGGTVGALMVSANSKYKDEAVRAAKYLAKQLSDMDYLIATGLPAWKYDNIDQSKVDPLEIQIMNNIVANAKGSVPAWDIYLSGDAAQTHKDLVAQLFAKQITPEEYSKQMQQKIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter
publication title Biochemical and Structural Insights into Xylan Utilization by the Thermophilic Bacterium Caldanaerobius polysaccharolyticus.
pubmed doi rcsb
source organism Caldanaerobius
molecule tags Transport protein
total genus 137
structure length 392
sequence length 392
ec nomenclature
pdb deposition date 2012-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g68A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4g68A02
1B6HA 4PQJA 1D9YA 2X26A 4BLAA 4G8NA 4GOTA 1JEVA 5IKBA 2P0SA 1RKMA 2XX8A 2UVIA 1H76A 1LLSA 4DLDA 3OENA 2H25A 2V93A 3C4MA 4FORA 3OMBA 1PB8A 4C1TA 3LR1A 2XXXA 3B7DA 2Y7IA 3VV5A 3U93A 5KZTA 3QXMA 3VVEA 1ANFA 1FQBA 3ZKLA 4DZ1A 2O69A 4GXSB 4GWOA 3MP8A 2XXWA 4TOZA 4OFJA 5FHNA 3KN3A 1ELJA 2H99A 4R6YA 3TCHA 2ZYMA 4OHNA 1PB7A 4F39A 2V3UA 3K1PA 4WEDA 3N6TA 1B5IA 1FTKA 2F36A 4Q0CA 2OLBA 2OK2A 3H3GA 4MBPA 1MPDA 5H8NA 5K2YA 5I59B 3VVFA 1Y4TA 1SYHA 1POY1 1N3WA 1MM6A 5AE4A 2O51A 5AA4B 5DVJA 3FUZA 4NTLA 3RTWB 4QF9A 1MY1A 3PUVE 4RK2A 3FJGA 2F78A 4ESWA 3UGWA 1Z7ME 1NL5A 4EXLA 2Y7RA 1TFAA 2F7CA 2REJA 3ECRA 4Z0IA 3IB1A 2NXOA 4ELRA 3O6HA 1DOTA 3B6QA 3U1OA 3OEKA 3VXBA 2DYXA 4IO3A 3IAZA 3Q27A 3S9NC 3IR1A 1OMPA 4JSOA 4NF4B 4RK9A 1SDXA 1P1OA 1BKAA 3HSTA 1TFDA 3MZBA 4U2RA 4OESA 4ZEBA 3CFLA 5CMCA 3N5LA 4OENA 3IX1A 1IUDA 1ZIUA 4FE8A 5DVIA 2VOZA 4JB7A 1M5CA 3QSLA 3W9WA 4IO4A 4NWDA 4RXLA 5ISUA 3A3CA 2A5TB 5B7DA 1VR5A 1QUKA 2Y7WA 1FQDA 1Y3NA 5FTIA 3FVNA 2G29A 2UVJA 4QFPA 3FJ7A 4ZECA 5I84A 5H8HB 5CRYA 3TAJA 2I49A 4PFYA 2VGQA 3KBRA 3PD8A 3IORA 1JW1A 2DQVA 5DVFA 1JW4A 4KD5A 1SI1A 3PPNA 1PBQA 5M2VA 4KCCA 2XD2A 1B2HA 1H45A 1M5DA 1GV8A 4EDPA 4KYEA 4XIGQ 1XHYA 3N6UA 4H5FA 3IB0A 4H67A 1QUIA 3IJXB 5I2KA 2OWSA 5L9MA 3VFJA 2DSFA 5CI5A 2PYYA 4POWA 1Q1KA 3K4UA 2F6PA 1GTKA 4OTEA 3MPLA 2I0BA 2DP8A 3MUQA 3RT6B 1LCFA 2H9BA 1B3HA 3L6HA 4PFTA 2DXYA 1SW1A 2QS2A 4GVOA 4R9FA 2HXWA 4G4PA 2FA7A 1MY0A 3PMVA 4YU0A 3T93B 4YKJA 1FW0A 3I6VA 4IGRA 2QSXA 2AL5A 2OBGA 1IEJA 1DSNA 1MXZA 3UA8A 4HW8A 5K2XA 3TELA 5AA3A 4KQPA 2GHAA 4GF8A 3IB2A 2CZLA 1POTA 3KN8A 3I5OA 3GBAA 1URSA 1I6AA 4N13A 3RTFB 1HSEA 4R2BA 1N76A 2ANJA 1PBPA 3M3LA 3PUZE 2QPQA 3JZJA 1P1NA 3CR9A 1B52A 3DLNA 4PETA 2AL4A 2DWAA 4Z7EA 4E0WA 2Y7KA 1XOCA 3C35A 2OZZA 1OQHA 3C32A 3CFXA 1FQAA 1B5HA 3MJNA 3HHFA 2HCAA 4RY1A 5AA2A 4OERA 3OXNA 2KLFA 4F22A 4R75A 3H6VA 1YCJA 4ND9A 5IAIA 4EXKA 4JWYA 3T9HB 5A5XA 3M3FA 1I6QA 1IIWA 1LFIA 2OJTA 3E13X 3H06B 1B1XA 1B4ZA 3K6UA 2F7BA 4POXA 2HFBA 4KYSA 4OYVA 3MZ1A 3KSJA 5JK4A 1XS5A 5CM6A 4DDDA 2UVGA 1UTBB 4F19A 4DXBA 3CIJA 1ZKBA 1MM7A 1LAXA 2R9JA 4HS7A 3SESA 1SW4A 2P2AA 1IXHA 1R6ZA 2CMOA 4IY5A 4ZDMA 1R9QA 4NE4A 5H8FB 5F7VA 1SW2A 4FECA 5TP9A 2RC7A 2GFEA 4F31B 2O6AA 1ZU0A 3VE1B 4LUBA 3PPQA 4G2ZA 4ZEIA 4IB2A 4BDQA 5DTBA 1FQCA 1PC3A 1OVBA 2UXAA 4MLVA 2Q9TA 1GR2A 1WDNA 4ZE9A 5AA2D 2AIXA 4HCYA 1S7YA 1D4NA 2I58A 4F18A 2PT1A 2D3IA 3JV9A 4R6HA 3S9EA 1JETA 3HO7A 3RQTA 4JSDA 1XVYA 3TCFA 3UORA 3IO4A 3VXCA 1P99A 2RCBA 4O3CA 1EZ9A 5FHOA 4JWXA 4F1YA 2ZYKA 5I58B 3H03A 2XXQA 4I8CA 4YZZA 5DT6A 2R71A 4ELOA 4YKKA 3SKPA 4NF5B 4X1DA 3BFTA 2RC9A 1JW5A 5DEXA 1B7UA 2OCUA 3S9LC 1URGA 1OQGA 2XXIA 2F8DA 4QSDA 3MQ9A 2XX7A 1Y9UA 1CE2A 2YPNA 3TFLA 2P1SA 1A8FA 3T66A 2B3BA 1IITA 4QFNA 4OFOA 4NF6A 3GZGA 2GHBA 3OSRA 3VVDA 1CB6A 2O1LA 4LQ5A 5HBCA 2X7QA 4GLIA 4NF8B 4R72A 1M5BA 3VLUA 4FATA 1B3GA 4IO7A 1DTZA 2VHAA 1AOVA 1QKBA 3OELA 5DYHA 3BFUA 4GL0A 3I3VA 3G3HA 3TTKA 5JTYA 1OLCA 1B3EA 1B32A 3EHSA 5L8DA 1B3FA 3SEXA 3H7MA 1Z7NE 3H4ZA 2R6GE 1J1NA 5I56A 3U92A 5CMMA 5CMBA 5KDTA 1XC1A 2GH9A 4LZ7A 3C36A 1URDA 2QS3A 5H8QA 1RYOA 1NNFA 3DP4A 4YKPA 3GBBA 3MC2A 1HSJA 4Q30B 1LAFE 4U1OA 4DIGA 4G68A 5BUUA 4LA9A 1N7WA 4F3GA 5HM4B 1KWHA 4X1BA 2PVUA 1B7ZA 2DS9A 2QS4A 2Y7PA 4U1ZA 4ELPA 1N84A 1AH5A 3DM0A 4XKPA 2O7UA 2V3QA 4IO5A 2XXVA 4EQBA 4EF1A 3KEIA 3V5AA 2NWJA 1A99A 5TPAA 1MY4A 1LB9A 2ZXTA 1IQ7A 1MDQA 4QFKA 4LONB 1N04A 3H6TA 4GRKA 1R9LA 3AXFA 4OMBA 4ELQA 2PBWA 2UYFA 3HHGA 3USDA 2NOOA 1MXWA 4DE8A 2DVZA 2ZMBA 1T0KA 2XXHA 2NUVA 4ESXA 3Q29A 1MXXA 1ZJLA 4JDFA 4RYAA 4R2FA 4ECFA 5I57A 4XXUA 1A40A 4BDOA 1JVXA 3PPRA 2Q8JA 1XVXA 3O29A 1A54A 4IO6A 1BIYA 1NMUA 4K3FA 3SDFA 3DELB 1JQFA 2PMSA 2ONRA 2O68A 5EHSA 4H65A 1IXCA 2F7AA 3K02A 1MS7A 3UK4A 1M5FA 1B05A 3C33A 2DWJA 1TT1A 3SEWA 2HAUA 4EQ9A 1AL3A 2XX9A 3K1MA 1D9VA 2XXRA 3PV0E 4KHZE 1FCKA 4KR5A 3OSQA 3PMXA 4GD5A 2Q2AA 4IGTA 4NMYA 3FD3A 4G8HA 3O66A 3FXQA 5CC2A 3CG1A 3OOAA 1M5EA 1DPEA 3Q28A 3GXAA 2XXTA 3IOUA 3KSXA 3E3KA 3TZAA 5ICTA 4NEDA 1SQYA 2ZYNA 1D3KA 1AMFA 2O84X 3FVKA 4MH5A 1I6BA 3BBRA 4F3BA 4RNSA 1B5JA 2IA4A 1PB9A 1PDAA 5L9OA 3CSBA 5AA1A 1QUJA 4HTGA 4YAHX 1DMBA 1SI0A 3P7IA 3B6WA 5B70A 3ILTB 3MVZA 1MPCA 2UVHA 3G3FA 3EHUA 1P1QA 2V3TA 1B46A 1ZBMA 4THIA 2F35A 1ATGA 5LOMA 2DVCA 2I4BA 3THIA 5H8SA 4WEPA 3PU5A 2I3WA 1MXUA 3V89B 4XTCQ 1VE4A 1DPPA 2ALUA 3K1NA 1ZLQA 3RT8A 1UTHA 3S4UA 1Q35A 1Y3PA 1B58A 3K01A 2Q2CA 2YJPA 1IXIA 2A5SA 1MQGA 1GVCA 4DXCA 3WAEA 1UIVA 3MVXA 1LB8A 3MP6A 1A8EA 3G3JA 1UTBA 2UYEA 1QJMA 2F97A 1QULA 1SBPA 2H4IA 1RYXA 1B7HA 1XT8A 4OWDA 4X9TA 4ZEFA 3L6GA 3TTMA 4U22A 1A55A 3CG3A 3LSLA 3SERA 4LVQA 1USYE 3IJOB 3VLVA 1P1UA 1USYH 1VFDA 4OQOA 2I6EA 4H8IA 4F1UA 3DP8A 3FVGA 1B40A 1MXVA 4LZ8A 5AA2B 4QSCA 3WAFA 1LAGE 4YB5A 3K00A 2I48A 1UQWA 3W9VA 1JEUA 5A5XB 2Y84A 2LAOA 3RUMA 1ZMGA 1UIUA 4MFIA 4BDMA 1SW5A 2RC8A 5KCJA 5BWJA 3VDFA 3IL1B 3TKDA 3KG2A 2O1MA 4PE5B 3T96B 4IO2A 4P11A 3K6WA 1MPBA 3G3KA 3T9XB 5I2NB 1TWYA 2ESNA 3TTLA 1NNTA 4L17A 3MW0A 4C0RA 3CFZA 4NF5A 3IO6A 4GIZA 2O7IA 4I62A 4BDNA 1PEBA 1B4HA 3A09A 4TQUQ 3U94A 3N94A 1Y3QA 2DOJA 5TP9B 2X7PA 5F1QA 4WXJA 2H98A 2VD3A 4U23A 4PFWA 2RKMA 4KYDA 4U4SA 4JXIA 1NNPA 3O28A 4X48A 2OWTA 4C1UA 1MQDA 1L5TA 4ZZEA 3PD9A 5ELVA 1NNKA 2Z8EA 3ODBA 2B3FA 4KFQA 1O64A 3VLWA 2V25A 1WVJA 3M3KA 3C34A 5TU0A 3FV2A 3RGYA 3HN0A 1BP5A 1JVYA 2F5XA 3D4CA 4ZZAA 3UP9A 3KJ7A 1F9BA 1FTJA 1MY3A 2ONSA 3MZ9A 2XD3A 4F1VA 1LBCA 3FATA 1LAHE 3GLBA 4ZEDA 3ZKKA 4H6DA 4FIMA 1NFTA 4RPNA 4U4XA 3G3GA 3G7WA 5I59A 1EU8A 5FTHA 3LUYA 3HPIA 4BDRA 3A3UA 5DEXB 2M8CA 2XXYA 4TLMB 5HPQA 4N07A 3RY3A 3OO6A 4EUOA 5AA4A 3RN8A 3EN3A 3FXUA 1N7XA 3B6TA 3O9PA 2HEUA 3V83A 1B0LA 3KOTA 4RA1A 3TDJA 2ZNTA 4QFOA 2IEEA 4Q8RA 4NWCA 2NVUB 4YICA 4YB7A 4NF6B 1IXGA 4R74A 1MQIA 4GQOA 1MRPA 3OO7A 2I4CA 2Z22A 1VSOA 1Y1MA 2RF1A 4NF4A 4F29A 2ONKE 2YLNA 2I0CA 3KGCA 3UN6A 1B1HA 5JTYB 3QUFA 2HZKA 3KFMA 3EF7A 3QAXA 1IZ1A 3ONMA 3O6GA 1MXYA 3FZVA 3JYRA 5I56B 1US4A 1FTOA 4MF3A 5H8NB 3TUSA 2FYIA 2A5TA 4ONYA 1Y4CA 3PMWA 2QS1A 2RCAA 1LCTA 2WKYA 3MWBA 3MVWA 2D21A 5KDTB 4LP2B 4KPTA 1AIVA 3Q26A 3G3IA 3TQLA 2AYSA 1P1WA 4WKMA 5H8HA 5H8QB 1EZPA 4QSEA 4PP0A 2F6GA 4R6KA 1QKAA 3LSWA 5CBSA 4P0GA 3T9VA 4G68B 2ZNUA 3LSXA 3V8XB 1BLFA 3MAMA 1I69A 5CMKA 3TTRA 4G77A 3SEUA 4AB6A 2ZYOA 1MH4A 4O3AA 1MY2A 4IY6A 3QK6A 1LSTA 3CI8A 2DE4A 1Y1ZA 4F3PA 1O7TA 1YTVA 1EH3A 3TCGA 3KN7A 4EQ7A 1YAEA 4F3SA 3IK6B 1B51A 3OD7A 4QFLA 1N3XA 3UIFA 4UACA 3ILUB 5TPAB 1QW0A 4OZ9A 3C9HA 2DWIA 2QMXA 4OVJA 3CRBA 4YB6A 4FEBA 3EPEA 1WODA 1LFHA 4OEVA 3HCQA 2PT2A 1FTLA 4XKQA 3OO9A 4OETA 2Z8FA 4G68C 4KI0E 3TYHA 2HZLA 1S9TA 3H6UA 4R9GA 1GGGA 1DTGA 1Y20A 4XKNA 4DCYA 1SYIA 4OXVA 3TEPA 3U8QA 3CSGA 5I57B 1LGBC 4GXAA 4KCDA 3OO8A 1OLAA 2V84A 3LBSA 5JEIA 4I1DA 3TMGA 1A7LA 4FJPA 3E4RA 3K6VA 4H8JA 3TODA 4OEUA 4JBZA 2VP1A 4HCWA 1HSLA 5I2KB 5CBRA 2E1SA 2DE2A 4ISUA 3RLFE 4AQ4A 1B0HA 3C31A 2GRVA 3TQWA 3IOTA 2THIA 4H1XA 3RPWA 3MVYA 1N0TA 1MQJA 3R7XA 2Q89A 4M1VA 4PFUA 4RPOA 3SEYA 3H6WA 2XHDA 3T22A 1MH3A 2HQ0A 3FXRA 2E0SA 1US5A 4FAJA 5J1DA 4O3BA 3FASA 5ICQA 2F34A 4GFRA 3IOWA 3K6XA 1S50A 1FQFA 4H5GA 3O6IA 1SVXB 3QIMA 3PPOA 1B3LA 2ABHA 3FGSA 1R1NA 2VD2A 3EHTA 3O2AA 2ZNSA 4I9DA 3TPAA 4ZE8A 3M8UA 1QVSA 3SEVA 1EZOA 4TLLB 4H0WA 2QJEA 4U21A 3KOSA 4ZEKA 2D5WA 1FTMA 3F11A 3MP1A 4YKIA 1H43A 5ITOA 2Z8DA 4YMBA 1VFEA 3RNNA 2REGA 1B9JA 3PUYE 3HV1A 2PX1A 3QUJA 5EHMA 4AB5A 4R73A 4FEDA 2RINA 1ZTYA 3E9XA 3R6UA 4ZS9A 4BDLA 4LZ5A 4Q5TA 4GL8A 3R26A 3FV1A 1LFGA 3IOVA 1H44A 1O63A 5H8FA 4JWOA 1UTHB 3D4GA 4P0IA 3PGFA 3OEMA 1FQEA 1JNFA 5L9SA 3FIRA 4YMAA 3KZGA 2Q88A 3KJTA 5ITPA 5I2NA 2B65A 2XXUA 4MLQA 4DXUA 2QRYA 1MQHA 2BJJX 4EF2A 2QMWA 1NH7A 1NH8A 4DCXA 1II5A 5FHMA 3S9MC 4M4GA 3U72A 2XXPA 2H5YA 2HAVA 3PUWE 1MDP1 4N6PA 4LATA 3CVGA 4UA8A 5I58A 1H3DA 1YPNA 3TTNA 1BTJA 1OVTA 3T9UA 1OIBA 3MPKA 1SD3A 3N26A 4QRZA 3FJMA 4QHQA 3S2VA 4RJZA 2DWHA 5KCJB 3EQ1A 4OFLA 2Z23A 4F2OA 3PPPA 5EYFA 3SETA 1LBBA 3O97A 3Q25A 2I3VA 3K2DA 2DE3A 1NKXA 4G8MA 3DP6A 3BKIB 3QYTA 4XKRA 2DXRA 4NF8A 2FNCA 1TXFA 1MG1A 3ZSFA 3LSFB 3PUXE 4E0XA 3K0VA 3MBPA 4F2QA 3ZS6A 3FVOA 2W7YA 3W15C 3LC8A 4LQ2A 2G93A 2QL3A
chains in the Genus database with same CATH superfamily
1B6HA 4PQJA 1D9YA 1NV3A 2X26A 4BLAA 2XWKA 4G8NA 4GOTA 1JEVA 1DCUA 1FJ9A 5IKBA 2P0SA 1RKMA 2XX8A 2UVIA 1H76A 1LLSA 4DLDA 2WBDA 3OENA 2H25A 2V93A 3C4MA 4FORA 3OMBA 1PB8A 4C1TA 3LR1A 2XXXA 3B7DA 2Y7IA 3VV5A 3U93A 5KZTA 2HXRA 3QXMA 3VVEA 1ANFA 1FQBA 3ZKLA 4DZ1A 2O69A 4GXSB 4GWOA 2XWIA 3MP8A 4HE2A 2XXWA 4TOZA 4OFJA 5FHNA 3KN3A 5EQ9A 1ELJA 2H99A 4R6YA 3TCHA 4N8GA 2ZYMA 4OHNA 1PB7A 4F39A 2V3UA 3K1PA 4WEDA 1NV6A 3N6TA 1B5IA 1FTKA 2QVRA 2F36A 4Q0CA 2OLBA 4O94A 2OK2A 3H3GA 4MBPA 1MPDA 5H8NA 5A5LA 5K2YA 5I59B 3VVFA 1Y4TA 1SYHA 1POY1 1N3WA 2KR0A 2P3VA 1MM6A 5AE4A 2O51A 5AA4B 5DVJA 4O7MA 3FUZA 4NTLA 3RTWB 4QF9A 2PCRA 1MY1A 3PUVE 4RK2A 3FJGA 2F78A 4ESWA 3UGWA 1Z7ME 1NL5A 4EXLA 2Y5LA 2Y7RA 1TFAA 2F7CA 2REJA 3ECRA 4Z0IA 2ZZXA 3IB1A 2NXOA 2WYKA 4ELRA 3O6HA 3U65A 1DOTA 3B6QA 3U1OA 3OEKA 3VXBA 4XEQA 2DYXA 4IO3A 3IAZA 3Q27A 3S9NC 3IR1A 1OMPA 3SZPA 4JSOA 4NF4B 1JP4A 4RK9A 1SDXA 1P1OA 1FBGA 1BKAA 4LN5A 3HSTA 1TFDA 3MZBA 4U2RA 4OESA 4ZEBA 3CFLA 5CMCA 3N5LA 4OENA 3IX1A 1IUDA 1ZIUA 4FE8A 5DVIA 2VOZA 4JB7A 1M5CA 3QSLA 3W9WA 4IO4A 4NWDA 4RXLA 5ISUA 3A3CA 2A5TB 5B7DA 1VR5A 1QUKA 3KC1A 2Y7WA 1FQDA 1Y3NA 2CEXA 5FTIA 3FVNA 2G29A 2UVJA 4PF8A 4QFPA 3FJ7A 4ZECA 5I84A 5H8HB 5CRYA 3TAJA 2I49A 4PFYA 2VGQA 3KBRA 3PTYA 3PD8A 3IORA 1Q9DA 1JW1A 1NV1A 2DQVA 5DVFA 1JW4A 2V4CA 4KD5A 1SI1A 3PPNA 1PBQA 5M2VA 4KCCA 2XD2A 1B2HA 1H45A 1M5DA 5EQ8A 1GV8A 4EDPA 4KYEA 3BIHA 4XIGQ 1XHYA 3N6UA 4H5FA 3QMFA 2WX9A 3IB0A 4H67A 1QUIA 3IJXB 2VT5A 1LEVA 5I2KA 1G0IA 2OWSA 5L9MA 3VFJA 2DSFA 3IFCA 5CI5A 2PYYA 4POWA 1Q1KA 1LBVA 3K4UA 2F6PA 1GTKA 4OTEA 3MPLA 2I0BA 2DP8A 3MUQA 3RT6B 1LCFA 1LBZA 1B3HA 2H9BA 3L6HA 4PFTA 5EYHA 1FTAA 2DXYA 5ESYA 1SW1A 1RDZA 2QS2A 4GVOA 4R9FA 2HXWA 4G4PA 2FA7A 1MY0A 3PMVA 4YU0A 3T93B 4YKJA 1FW0A 3I6VA 4IGRA 2QSXA 2AL5A 2OBGA 4P47A 1IEJA 1DSNA 1MXZA 1FBCA 3UA8A 4HW8A 4I3YA 5K2XA 4I3EA 1FRPA 3TELA 5AA3A 4KQPA 2GHAA 4GF8A 3IB2A 2CZLA 1POTA 4PC9A 3KN8A 3I5OA 3GBAA 4HE1A 1URSA 1I6AA 4N13A 5IZ3B 3RTFB 1HSEA 4R2BA 4QBAA 1N76A 2ANJA 1PBPA 3M3LA 3PUZE 4OVPA 2QPQA 4GWYA 3JZJA 4QXDA 1P1NA 3CR9A 1B52A 1FBEA 2BJIA 3DLNA 4NF0A 3MYUA 2CZHA 4PETA 2AL4A 2DWAA 4Z7EA 4E0WA 2Y7KA 1XOCA 3C35A 2OZZA 1FBFA 1OQHA 2HPGA 3C32A 3CFXA 1FQAA 1B5HA 3MJNA 3HHFA 2HCAA 4RY1A 5AA2A 1IMCA 4OERA 3OXNA 2KLFA 4F22A 4R75A 3H6VA 1YCJA 4ND9A 5IAIA 4EXKA 4JWYA 3T9HB 5A5XA 5ET5A 3M3FA 1I6QA 1IIWA 1LFIA 2OJTA 3E13X 1FPLA 3H06B 1B1XA 1B4ZA 3K6UA 2F7BA 4POXA 2HFBA 4N81A 1FBDA 4KYSA 4OYVA 3MZ1A 1LBWA 3KSJA 5JK4A 1XS5A 4OVQA 5CM6A 4DDDA 2UVGA 1UTBB 4F19A 4DXBA 3CIJA 1ZKBA 1MM7A 2WBBA 1LAXA 2R9JA 4HS7A 2ZZWA 3SESA 1SW4A 4PGPA 2P2AA 1IXHA 4IR8A 4OA4A 5ET8A 1R6ZA 2CMOA 4IY5A 4ZDMA 1R9QA 4NE4A 5H8FB 5F7VA 1SW2A 2CEYA 4FECA 5TP9A 2RC7A 2GFEA 4F31B 2O6AA 1ZU0A 4PDHA 3VE1B 4LUBA 3PPQA 4G2ZA 4ZEIA 4IB2A 4BDQA 5DTBA 1FQCA 1PC3A 1OVBA 2UXAA 4MLVA 2Q9TA 1GR2A 1WDNA 4ZE9A 5AA2D 1BK4A 2AIXA 4HCYA 3ISPA 1S7YA 1D4NA 2I58A 4F18A 2PT1A 4XFEA 2DDKA 4NAPA 2D3IA 3JV9A 1NV4A 4N91A 4R6HA 3S9EA 5DW8A 1JETA 3HO7A 3RQTA 4JSDA 1XVYA 3TCFA 1IMDA 3UORA 3IO4A 4NGUA 3VXCA 1P99A 2RCBA 4O3CA 1EZ9A 5FHOA 4JWXA 4F1YA 2ZYKA 5I58B 3H03A 2XXQA 4I8CA 4YZZA 5DT6A 2R71A 4ELOA 2WEFA 4YKKA 3SKPA 1D9QA 4NF5B 4X1DA 3BFTA 2RC9A 4NQ8A 1JW5A 5DEXA 1B7UA 2OCUA 3S9LC 1URGA 1OQGA 2XXIA 2F8DA 4QSDA 4H46A 3MQ9A 2XX7A 3E79A 1Y9UA 5IGAA 1CE2A 2YPNA 3TFLA 2P1SA 1A8FA 3T66A 2B3BA 1IITA 4QFNA 4OFOA 3B8BA 4NF6A 3GZGA 2GHBA 3OSRA 3VVDA 1CB6A 2O1LA 4LQ5A 5HBCA 2X7QA 4GLIA 4NF8B 4R72A 1M5BA 3VLUA 4FATA 1B3GA 3FXBA 2FIXA 1DTZA 4IO7A 1FPKA 2VHAA 1AOVA 1QKBA 3OELA 5DYHA 3BFUA 4GL0A 3I3VA 3G3HA 3TTKA 4P9KA 5JTYA 1OLCA 1B3EA 1B32A 3EHSA 5L8DA 1B3FA 3SEXA 3H7MA 3T1BA 1FPDA 1Z7NE 3H4ZA 2R6GE 1J1NA 5I56A 5I3SA 3U92A 5CMMA 4PFRA 2QFLA 5CMBA 5KDTA 1XC1A 2GH9A 1RDYA 4LZ7A 4GX6A 2FBPA 3C36A 2XWVA 4MNIA 1URDA 2QS3A 5H8QA 1RYOA 1NNFA 3DP4A 4YKPA 3GBBA 4MX6A 5LDZA 3MC2A 1HSJA 4Q30B 1LAFE 4U1OA 4DIGA 4G68A 1FBHA 1XI6A 5BUUA 4JVIA 4N15A 2B4MA 4LA9A 1N7WA 4F3GA 5HM4B 4PE3A 1KWHA 4X1BA 2PVUA 5EYGA 1B7ZA 2HHMA 4O8MA 2DS9A 2QVUA 2QS4A 2Y7PA 4U1ZA 4ELPA 4NG7A 1N84A 1AH5A 3DM0A 4XKPA 2O7UA 2V3QA 4IO5A 2XXVA 4EQBA 4EF1A 4N6KA 3KEIA 3V5AA 5I7IA 2NWJA 1A99A 5TPAA 1MY4A 1LB9A 2ZXTA 1IQ7A 1MDQA 4QFKA 4LONB 1N04A 3H6TA 4GRKA 1R9LA 3AXFA 4OMBA 4ELQA 2PBWA 5EQAA 2UYFA 3HHGA 3USDA 2NOOA 1MXWA 4DE8A 2DVZA 2ZMBA 1T0KA 2XXHA 2FHYA 4G61A 2NUVA 4ESXA 3Q29A 1MXXA 1ZJLA 1IMBA 4JDFA 4RYAA 5EQ7A 4R2FA 2Y5KA 4ECFA 5I57A 4XXUA 1A40A 4BDOA 4PFBA 1JVXA 3PPRA 2Q8JA 4P3LA 1XVXA 3O29A 1A54A 4IO6A 1BIYA 1NMUA 4K3FA 3SDFA 3DELB 1JQFA 2PMSA 1SPIA 2ONRA 2O68A 1FBPA 5EHSA 4H65A 1IXCA 2F7AA 3K02A 1MS7A 1EYJA 3UK4A 1M5FA 1B05A 1FJ6A 3C33A 2DWJA 4P1EA 1TT1A 3SEWA 2HAUA 4EQ9A 1AL3A 4GWSA 2XX9A 3K1MA 1D9VA 2XXRA 3PV0E 4KHZE 1FCKA 4KR5A 3OSQA 3PMXA 1FPJA 1NV7A 2OWZA 4GD5A 2Q2AA 4IGTA 4NMYA 3FD3A 4G8HA 3O66A 3FXQA 5CC2A 3CG1A 3OOAA 1M5EA 1DPEA 3Q28A 3GXAA 2XXTA 3IOUA 3KSXA 3E3KA 3TZAA 5ICTA 4NEDA 1KA0A 1SQYA 2ZYNA 1D3KA 1FPGA 1LBXA 5FBPA 1AMFA 2O84X 3CHGA 3FVKA 4MH5A 1I6BA 3BBRA 4F3BA 4N17A 3LV0A 4RNSA 1B5JA 2IA4A 5ET6A 1PB9A 1PDAA 4MMPA 5L9OA 3CSBA 1IMAA 2VPNA 5AA1A 1QUJA 4HTGA 4YAHX 1DMBA 1INPA 1SI0A 2XA5A 3P7IA 3B6WA 1YXIA 4GBWA 5B70A 3ILTB 3B50A 3MVZA 1MPCA 2UVHA 3RPLA 3G3FA 2FVZA 3EHUA 1P1QA 2V3TA 1B46A 1ZBMA 4NHBA 4THIA 2PFYA 2F35A 1ATGA 5LOMA 2DVCA 2I4BA 3THIA 5H8SA 4WEPA 3PU5A 2I3WA 4N8YA 1MXUA 3V89B 4XTCQ 1VE4A 1DPPA 2ALUA 3K1NA 1ZLQA 3RT8A 1RDXA 1UTHA 3S4UA 1Q35A 4X04A 1Y3PA 1B58A 3K01A 2Q2CA 2YJPA 3KC0A 1IXIA 2A5SA 1MQGA 1GVCA 4DXCA 3WAEA 1UIVA 3MVXA 2P3NA 1LB8A 3MP6A 1A8EA 3G3JA 1UTBA 2UYEA 1QJMA 2F97A 2GQ1A 1QULA 1SBPA 3BIGA 2B4LA 2H4IA 4UABA 1RYXA 1B7HA 1XT8A 4OWDA 4X9TA 4PAKA 4ZEFA 3L6GA 4XF5A 3TTMA 4U22A 1A55A 3CG3A 2XWOA 3LSLA 3SERA 4LVQA 1USYE 3IJOB 3VLVA 1P1UA 1USYH 1VFDA 4OQOA 2I6EA 2R8TA 4H8IA 4F1UA 3DP8A 3FVGA 1B40A 1MXVA 4LZ8A 5AA2B 4QSCA 3WAFA 1LAGE 2KQZA 4YB5A 2F3DA 3K00A 2I48A 2OX3A 1NV0A 1UQWA 3W9VA 1JEUA 5A5XB 2Y84A 2LAOA 4NN3A 3RUMA 1ZMGA 1UIUA 4MFIA 4BDMA 1SW5A 2RC8A 4GWZA 4OVSA 5KCJA 5BWJA 3VDFA 3IL1B 3TKDA 3KG2A 2O1MA 4PE5B 3T96B 4IO2A 2L5VA 1KA1A 4P11A 3K6WA 1MPBA 3G3KA 3T9XB 4PDDA 5I2NB 1TWYA 2ESNA 3TTLA 4HE0A 2Q74A 5LTCA 1NNTA 4L17A 3MW0A 4C0RA 3CFZA 4NF5A 3IO6A 4GIZA 2O7IA 4I62A 4BDNA 1PEBA 1B4HA 3A09A 1FPFA 4TQUQ 3U94A 3N94A 1Y3QA 2DOJA 5TP9B 1EYKA 2X7PA 5F1QA 4WXJA 2H98A 2VD3A 5ET7A 4U23A 4PFWA 2RKMA 4HXVA 4KYDA 4U4SA 4JXIA 1NNPA 3O28A 4DI4B 4X48A 2OWTA 2ZZVA 4I40A 4C1UA 1MQDA 1L5TA 4ZZEA 3PD9A 5ELVA 1NUZA 1NNKA 4MHFA 2Z8EA 3ODBA 2B3FA 4KFQA 1O64A 3VLWA 2V25A 1WVJA 3M3KA 3C34A 5TU0A 3FV2A 3RGYA 3HN0A 1BP5A 1JVYA 2F5XA 1KZ8A 3D4CA 4PGNA 4ZZAA 3UP9A 3KJ7A 1F9BA 1FTJA 1MY3A 4N6DA 2ONSA 1VDWA 3MZ9A 2XD3A 4F1VA 1LBCA 3FATA 1LAHE 3GLBA 4ZEDA 3ZKKA 4H6DA 4FIMA 1NFTA 4JVDA 4RPNA 4U4XA 4MEVA 3G3GA 3G7WA 5I59A 1EU8A 4PTKA 3LUYA 3HPIA 4PF6A 5FTHA 3A3UA 4BDRA 5DEXB 2M8CA 2XXYA 4TLMB 5HPQA 4N07A 3D1RA 3RY3A 3OO6A 4EUOA 5AA4A 2WYPA 3RN8A 3EN3A 3FXUA 1N7XA 1AWBA 3B6TA 3O9PA 2HEUA 3V83A 1B0LA 4RA1A 3KOTA 3TDJA 2ZNTA 4QFOA 4P8BA 2IEEA 4Q8RA 4NWCA 2NVUB 4YICA 4YB7A 4NF6B 1IXGA 4R74A 1MQIA 4GQOA 1MRPA 3ROJA 3OO7A 2I4CA 1FSAA 2Z22A 1VSOA 1Y1MA 2RF1A 4NF4A 4F29A 4MIJA 2ONKE 2YLNA 1FPIA 2I0CA 3KGCA 3UN6A 1B1HA 5JTYB 3QUFA 2HZKA 3KFMA 4GWWA 3EF7A 3QAXA 1IZ1A 3ONMA 3O6GA 1MXYA 3FZVA 3JYRA 5I56B 1US4A 1FTOA 4MF3A 5H8NB 3TUSA 2FYIA 4MNCA 2A5TA 4ONYA 1Y4CA 5IZZA 3PMWA 2QS1A 2RCAA 1LCTA 2WKYA 3MWBA 3MVWA 2D21A 5KDTB 4LP2B 4KPTA 1AIVA 1G0HA 4O7IA 3Q26A 3G3IA 3TQLA 2AYSA 1P1WA 4WKMA 2MKZA 5H8HA 5H8QB 1EYIA 2XXKA 1EZPA 4QSEA 4PP0A 2F6GA 3A29A 4R6KA 2F3BA 1QKAA 3LSWA 5CBSA 4P0GA 3T9VA 4G68B 2ZNUA 3LSXA 4PBHA 3V8XB 4GWXA 1BLFA 3MAMA 1I69A 5J16A 5CMKA 3TTRA 4G77A 3SEUA 1CNQA 4AB6A 2ZYOA 4KXPA 1MH4A 4O3AA 1MY2A 4IY6A 3QK6A 4JVCA 1LSTA 3CI8A 3HFUA 2DE4A 1Y1ZA 4F3PA 1O7TA 1YTVA 1EH3A 3TCGA 3KN7A 5I5PA 4EQ7A 1YAEA 4F3SA 3IK6B 1B51A 3OD7A 4QFLA 1N3XA 3UIFA 4UACA 3ILUB 5TPAB 4MAGA 1QW0A 4OZ9A 3C9HA 2DWIA 2QMXA 4OVJA 3CRBA 4YB6A 4FEBA 4P1LA 3EPEA 3KBZA 1WODA 1LFHA 2PFZA 4OEVA 3HCQA 2PT2A 1FTLA 4XKQA 3FBPA 3OO9A 4OETA 2Z8FA 4G68C 4KI0E 3TYHA 2HZLA 1S9TA 3H6UA 4R9GA 1GGGA 1DTGA 1Y20A 4XKNA 4DCYA 1SYIA 4OXVA 3TEPA 3U8QA 3CSGA 5I57B 1LGBC 5T3JA 4N4UA 4GXAA 4KCDA 3OO8A 5IZ1A 1OLAA 2V84A 3LBSA 5JEIA 1NUWA 4I1DA 3TMGA 1A7LA 4FJPA 5IZ3A 4H45A 2JJKA 3T0JA 3E4RA 3K6VA 4H8JA 3TODA 4OEUA 4JBZA 2CZIA 2VP1A 3GYYA 4HCWA 2Q8MA 1HSLA 5I2KB 4AS5A 1DK4A 5CBRA 2E1SA 2DE2A 4ISUA 3RLFE 4AQ4A 1B0HA 3C31A 2GRVA 3TQWA 3IOTA 2THIA 4H1XA 3RPWA 3MVYA 4PBQA 3EKIA 1N0TA 1MQJA 3R7XA 2Q89A 4M1VA 4PFUA 4RPOA 3SEYA 3H6WA 2XHDA 3T22A 1MH3A 1NUXA 2HQ0A 3FXRA 2E0SA 1US5A 4FAJA 4P56A 5J1DA 4O3BA 3FASA 3MSTA 5ICQA 2F34A 3RYDA 4GFRA 3IOWA 3K6XA 1S50A 4H5GA 1FQFA 3O6IA 1SVXB 3QIMA 3PPOA 1B3LA 2ABHA 3FGSA 1R1NA 2VD2A 2CZKA 3EHTA 3O2AA 2ZNSA 4I9DA 3TPAA 4ZE8A 3M8UA 1QVSA 3SEVA 1EZOA 4TLLB 4H0WA 1YYZA 2QJEA 4U21A 3KOSA 4ZEKA 2D5WA 1FTMA 3F11A 3MP1A 2FIEA 4YKIA 1NV2A 1H43A 5ITOA 2Z8DA 4YMBA 1FPBA 1VFEA 3RNNA 1YZ0A 1B9JA 2REGA 3PUYE 3HV1A 3RPLB 2PX1A 2VPOA 3QUJA 5EHMA 4AB5A 4R73A 4FEDA 1IMEA 2RINA 1ZTYA 3E9XA 3R6UA 4ZS9A 4BDLA 4LZ5A 2QVVA 4Q5TA 4GL8A 3R26A 3FV1A 1LFGA 3IOVA 1H44A 1O63A 5H8FA 4PAIA 4JWOA 1UTHB 3D4GA 4P0IA 5IM2A 3PGFA 3OEMA 1FQEA 5F24A 4OANA 1JNFA 5L9SA 4GBVA 3FIRA 1K9ZA 4YMAA 3KZGA 3E78A 2Q88A 3KJTA 5ITPA 5I2NA 2B65A 2XXUA 4GWUA 4DI3D 4MLQA 4DXUA 2QRYA 1MQHA 2BJJX 4MJOA 3NOHA 4GX3A 4EF2A 2QMWA 1NH7A 1NH8A 1K9YA 1QGXA 4DCXA 1II5A 5FHMA 3S9MC 4M4GA 3U72A 2XXPA 3IFAA 2H5YA 2HAVA 3PUWE 1MDP1 1NV5A 4N6PA 4LATA 3CVGA 4UA8A 5I58A 1H3DA 1YPNA 4OVRA 4PFIA 3TTNA 1BTJA 1OVTA 3T9UA 1OIBA 3MPKA 4PCDA 1SD3A 4X8RA 3N26A 4GX4A 4QRZA 1NUYA 4FBPA 3FJMA 4QHQA 3S2VA 4RJZA 4NX1A 2DWHA 5KCJB 3EQ1A 4OFLA 2Z23A 4MCOA 1DBZA 4F2OA 3PPPA 5EYFA 4MNPA 3SETA 1LBBA 3O97A 1FPEA 1NI9A 3Q25A 1LBYA 2I3VA 3K2DA 2DE3A 1NKXA 4AS4A 4G8MA 3DP6A 3BKIB 3QYTA 4OVTA 4XKRA 2DXRA 4NF8A 1IMFA 2FNCA 1TXFA 1MG1A 3ZSFA 3LSFB 3PUXE 4E0XA 4PAFA 3K0VA 3MBPA 4F2QA 3ZS6A 3FVOA 2W7YA 3W15C 3LC8A 4LQ2A 2G93A 2QL3A 3LUZA
chains in the Genus database with same CATH topology
1B6HA 4PQJA 1D9YA 2X26A 4BLAA 4G8NA 4GOTA 1JEVA 5IKBA 2P0SA 1RKMA 2XX8A 2UVIA 1H76A 1LLSA 4DLDA 3OENA 2H25A 2V93A 3C4MA 4FORA 3OMBA 1PB8A 4C1TA 3LR1A 2XXXA 3B7DA 2Y7IA 3VV5A 3U93A 5KZTA 3QXMA 3VVEA 1ANFA 1FQBA 3ZKLA 4DZ1A 2O69A 4GXSB 4GWOA 3MP8A 2XXWA 4TOZA 4OFJA 5FHNA 3KN3A 1ELJA 2H99A 4R6YA 3TCHA 2ZYMA 4OHNA 1PB7A 4F39A 2V3UA 3K1PA 4WEDA 3N6TA 1B5IA 1FTKA 2F36A 4Q0CA 2OLBA 2OK2A 3H3GA 4MBPA 1MPDA 5H8NA 5K2YA 5I59B 3VVFA 1Y4TA 1SYHA 1POY1 1N3WA 1MM6A 5AE4A 2O51A 5AA4B 5DVJA 3FUZA 4NTLA 3RTWB 4QF9A 1MY1A 3PUVE 4RK2A 3FJGA 2F78A 4ESWA 3UGWA 1Z7ME 1NL5A 4EXLA 2Y7RA 1TFAA 2F7CA 2REJA 3ECRA 4Z0IA 3IB1A 2NXOA 4ELRA 3O6HA 1DOTA 3B6QA 3U1OA 3OEKA 3VXBA 2DYXA 4IO3A 3IAZA 3Q27A 3S9NC 3IR1A 1OMPA 4JSOA 4NF4B 4RK9A 1SDXA 1P1OA 1BKAA 3HSTA 1TFDA 3MZBA 4U2RA 4OESA 4ZEBA 3CFLA 5CMCA 3N5LA 4OENA 3IX1A 1IUDA 1ZIUA 4FE8A 5DVIA 2VOZA 4JB7A 1M5CA 3QSLA 3W9WA 4IO4A 4NWDA 4RXLA 5ISUA 3A3CA 2A5TB 5B7DA 1VR5A 1QUKA 2Y7WA 1FQDA 1Y3NA 5FTIA 3FVNA 2G29A 2UVJA 4QFPA 3FJ7A 4ZECA 5I84A 5H8HB 5CRYA 3TAJA 2I49A 4PFYA 2VGQA 3KBRA 3PD8A 3IORA 1JW1A 2DQVA 5DVFA 1JW4A 4KD5A 1SI1A 3PPNA 1PBQA 5M2VA 4KCCA 2XD2A 1B2HA 1H45A 1M5DA 1GV8A 4EDPA 4KYEA 4XIGQ 1XHYA 3N6UA 4H5FA 3IB0A 4H67A 1QUIA 3IJXB 5I2KA 2OWSA 5L9MA 3VFJA 2DSFA 5CI5A 2PYYA 4POWA 1Q1KA 3K4UA 2F6PA 1GTKA 4OTEA 3MPLA 2I0BA 2DP8A 3MUQA 3RT6B 1LCFA 2H9BA 1B3HA 3L6HA 4PFTA 2DXYA 1SW1A 2QS2A 4GVOA 4R9FA 2HXWA 4G4PA 2FA7A 1MY0A 3PMVA 4YU0A 3T93B 4YKJA 1FW0A 3I6VA 4IGRA 2QSXA 2AL5A 2OBGA 1IEJA 1DSNA 1MXZA 3UA8A 4HW8A 5K2XA 3TELA 5AA3A 4KQPA 2GHAA 4GF8A 3IB2A 2CZLA 1POTA 3KN8A 3I5OA 3GBAA 1URSA 1I6AA 4N13A 3RTFB 1HSEA 4R2BA 1N76A 2ANJA 1PBPA 3M3LA 3PUZE 2QPQA 3JZJA 1P1NA 3CR9A 1B52A 3DLNA 4PETA 2AL4A 2DWAA 4Z7EA 4E0WA 2Y7KA 1XOCA 3C35A 2OZZA 1OQHA 3C32A 3CFXA 1FQAA 1B5HA 3MJNA 3HHFA 2HCAA 4RY1A 5AA2A 4OERA 3OXNA 2KLFA 4F22A 4R75A 3H6VA 1YCJA 4ND9A 5IAIA 4EXKA 4JWYA 3T9HB 5A5XA 3M3FA 1I6QA 1IIWA 1LFIA 2OJTA 3E13X 3H06B 1B1XA 1B4ZA 3K6UA 2F7BA 4POXA 2HFBA 4KYSA 4OYVA 3MZ1A 3KSJA 5JK4A 1XS5A 5CM6A 4DDDA 2UVGA 1UTBB 4F19A 4DXBA 3CIJA 1ZKBA 1MM7A 1LAXA 2R9JA 4HS7A 3SESA 1SW4A 2P2AA 1IXHA 1R6ZA 2CMOA 4IY5A 4ZDMA 1R9QA 4NE4A 5H8FB 5F7VA 1SW2A 4FECA 5TP9A 2RC7A 2GFEA 4F31B 2O6AA 1ZU0A 3VE1B 4LUBA 3PPQA 4G2ZA 4ZEIA 4IB2A 4BDQA 5DTBA 1FQCA 1PC3A 1OVBA 2UXAA 4MLVA 2Q9TA 1GR2A 1WDNA 4ZE9A 5AA2D 2AIXA 4HCYA 1S7YA 1D4NA 2I58A 4F18A 2PT1A 2D3IA 3JV9A 4R6HA 3S9EA 1JETA 3HO7A 3RQTA 4JSDA 1XVYA 3TCFA 3UORA 3IO4A 3VXCA 1P99A 2RCBA 4O3CA 1EZ9A 5FHOA 4JWXA 4F1YA 2ZYKA 5I58B 3H03A 2XXQA 4I8CA 4YZZA 5DT6A 2R71A 4ELOA 4YKKA 3SKPA 4NF5B 4X1DA 3BFTA 2RC9A 1JW5A 5DEXA 1B7UA 2OCUA 3S9LC 1URGA 1OQGA 2XXIA 2F8DA 4QSDA 3MQ9A 2XX7A 1Y9UA 1CE2A 2YPNA 3TFLA 2P1SA 1A8FA 3T66A 2B3BA 1IITA 4QFNA 4OFOA 4NF6A 3GZGA 2GHBA 3OSRA 3VVDA 1CB6A 2O1LA 4LQ5A 5HBCA 2X7QA 4GLIA 4NF8B 4R72A 1M5BA 3VLUA 4FATA 1B3GA 4IO7A 1DTZA 2VHAA 1AOVA 1QKBA 3OELA 5DYHA 3BFUA 4GL0A 3I3VA 3G3HA 3TTKA 5JTYA 1OLCA 1B3EA 1B32A 3EHSA 5L8DA 1B3FA 3SEXA 3H7MA 1Z7NE 3H4ZA 2R6GE 1J1NA 5I56A 3U92A 5CMMA 5CMBA 5KDTA 1XC1A 2GH9A 4LZ7A 3C36A 1URDA 2QS3A 5H8QA 1RYOA 1NNFA 3DP4A 4YKPA 3GBBA 3MC2A 1HSJA 4Q30B 1LAFE 4U1OA 4DIGA 4G68A 5BUUA 4LA9A 1N7WA 4F3GA 5HM4B 1KWHA 4X1BA 2PVUA 1B7ZA 2DS9A 2QS4A 2Y7PA 4U1ZA 4ELPA 1N84A 1AH5A 3DM0A 4XKPA 2O7UA 2V3QA 4IO5A 2XXVA 4EQBA 4EF1A 3KEIA 3V5AA 2NWJA 1A99A 5TPAA 1MY4A 1LB9A 2ZXTA 1IQ7A 1MDQA 4QFKA 4LONB 1N04A 3H6TA 4GRKA 1R9LA 3AXFA 4OMBA 4ELQA 2PBWA 2UYFA 3HHGA 3USDA 2NOOA 1MXWA 4DE8A 2DVZA 2ZMBA 1T0KA 2XXHA 2NUVA 4ESXA 3Q29A 1MXXA 1ZJLA 4JDFA 4RYAA 4R2FA 4ECFA 5I57A 4XXUA 1A40A 4BDOA 1JVXA 3PPRA 2Q8JA 1XVXA 3O29A 1A54A 4IO6A 1BIYA 1NMUA 4K3FA 3SDFA 3DELB 1JQFA 2PMSA 2ONRA 2O68A 5EHSA 4H65A 1IXCA 2F7AA 3K02A 1MS7A 3UK4A 1M5FA 1B05A 3C33A 2DWJA 1TT1A 3SEWA 2HAUA 4EQ9A 1AL3A 2XX9A 3K1MA 1D9VA 2XXRA 3PV0E 4KHZE 1FCKA 4KR5A 3OSQA 3PMXA 4GD5A 2Q2AA 4IGTA 4NMYA 3FD3A 4G8HA 3O66A 3FXQA 5CC2A 3CG1A 3OOAA 1M5EA 1DPEA 3Q28A 3GXAA 2XXTA 3IOUA 3KSXA 3E3KA 3TZAA 5ICTA 4NEDA 1SQYA 2ZYNA 1D3KA 1AMFA 2O84X 3FVKA 4MH5A 1I6BA 3BBRA 4F3BA 4RNSA 1B5JA 2IA4A 1PB9A 1PDAA 5L9OA 3CSBA 5AA1A 1QUJA 4HTGA 4YAHX 1DMBA 1SI0A 3P7IA 3B6WA 5B70A 3ILTB 3MVZA 1MPCA 2UVHA 3G3FA 3EHUA 1P1QA 2V3TA 1B46A 1ZBMA 4THIA 2F35A 1ATGA 5LOMA 2DVCA 2I4BA 3THIA 5H8SA 4WEPA 3PU5A 2I3WA 1MXUA 3V89B 4XTCQ 1VE4A 1DPPA 2ALUA 3K1NA 1ZLQA 3RT8A 1UTHA 3S4UA 1Q35A 1Y3PA 1B58A 3K01A 2Q2CA 2YJPA 1IXIA 2A5SA 1MQGA 1GVCA 4DXCA 3WAEA 1UIVA 3MVXA 1LB8A 3MP6A 1A8EA 3G3JA 1UTBA 2UYEA 1QJMA 2F97A 1QULA 1SBPA 2H4IA 1RYXA 1B7HA 1XT8A 4OWDA 4X9TA 4ZEFA 3L6GA 3TTMA 4U22A 1A55A 3CG3A 3LSLA 3SERA 4LVQA 1USYE 3IJOB 3VLVA 1P1UA 1USYH 1VFDA 4OQOA 2I6EA 4H8IA 4F1UA 3DP8A 3FVGA 1B40A 1MXVA 4LZ8A 5AA2B 4QSCA 3WAFA 1LAGE 4YB5A 3K00A 2I48A 1UQWA 3W9VA 1JEUA 5A5XB 2Y84A 2LAOA 3RUMA 1ZMGA 1UIUA 4MFIA 4BDMA 1SW5A 2RC8A 5KCJA 5BWJA 3VDFA 3IL1B 3TKDA 3KG2A 2O1MA 4PE5B 3T96B 4IO2A 4P11A 3K6WA 1MPBA 3G3KA 3T9XB 5I2NB 1TWYA 2ESNA 3TTLA 1NNTA 4L17A 3MW0A 4C0RA 3CFZA 4NF5A 3IO6A 4GIZA 2O7IA 4I62A 4BDNA 1PEBA 1B4HA 3A09A 4TQUQ 3U94A 3N94A 1Y3QA 2DOJA 5TP9B 2X7PA 5F1QA 4WXJA 2H98A 2VD3A 4U23A 4PFWA 2RKMA 4KYDA 4U4SA 4JXIA 1NNPA 3O28A 4X48A 2OWTA 4C1UA 1MQDA 1L5TA 4ZZEA 3PD9A 5ELVA 1NNKA 2Z8EA 3ODBA 2B3FA 4KFQA 1O64A 3VLWA 2V25A 1WVJA 3M3KA 3C34A 5TU0A 3FV2A 3RGYA 3HN0A 1BP5A 1JVYA 2F5XA 3D4CA 4ZZAA 3UP9A 3KJ7A 1F9BA 1FTJA 1MY3A 2ONSA 3MZ9A 2XD3A 4F1VA 1LBCA 3FATA 1LAHE 3GLBA 4ZEDA 3ZKKA 4H6DA 4FIMA 1NFTA 4RPNA 4U4XA 3G3GA 3G7WA 5I59A 1EU8A 5FTHA 3LUYA 3HPIA 4BDRA 3A3UA 5DEXB 2M8CA 2XXYA 4TLMB 5HPQA 4N07A 3RY3A 3OO6A 4EUOA 5AA4A 3RN8A 3EN3A 3FXUA 1N7XA 3B6TA 3O9PA 2HEUA 3V83A 1B0LA 3KOTA 4RA1A 3TDJA 2ZNTA 4QFOA 2IEEA 4Q8RA 4NWCA 2NVUB 4YICA 4YB7A 4NF6B 1IXGA 4R74A 1MQIA 4GQOA 1MRPA 3OO7A 2I4CA 2Z22A 1VSOA 1Y1MA 2RF1A 4NF4A 4F29A 2ONKE 2YLNA 2I0CA 3KGCA 3UN6A 1B1HA 5JTYB 3QUFA 2HZKA 3KFMA 3EF7A 3QAXA 1IZ1A 3ONMA 3O6GA 1MXYA 3FZVA 3JYRA 5I56B 1US4A 1FTOA 4MF3A 5H8NB 3TUSA 2FYIA 2A5TA 4ONYA 1Y4CA 3PMWA 2QS1A 2RCAA 1LCTA 2WKYA 3MWBA 3MVWA 2D21A 5KDTB 4LP2B 4KPTA 1AIVA 3Q26A 3G3IA 3TQLA 2AYSA 1P1WA 4WKMA 5H8HA 5H8QB 1EZPA 4QSEA 4PP0A 2F6GA 4R6KA 1QKAA 3LSWA 5CBSA 4P0GA 3T9VA 4G68B 2ZNUA 3LSXA 3V8XB 1BLFA 3MAMA 1I69A 5CMKA 3TTRA 4G77A 3SEUA 4AB6A 2ZYOA 1MH4A 4O3AA 1MY2A 4IY6A 3QK6A 1LSTA 3CI8A 2DE4A 1Y1ZA 4F3PA 1O7TA 1YTVA 1EH3A 3TCGA 3KN7A 4EQ7A 1YAEA 4F3SA 3IK6B 1B51A 3OD7A 4QFLA 1N3XA 3UIFA 4UACA 3ILUB 5TPAB 1QW0A 4OZ9A 3C9HA 2DWIA 2QMXA 4OVJA 3CRBA 4YB6A 4FEBA 3EPEA 1WODA 1LFHA 4OEVA 3HCQA 2PT2A 1FTLA 4XKQA 3OO9A 4OETA 2Z8FA 4G68C 4KI0E 3TYHA 2HZLA 1S9TA 3H6UA 4R9GA 1GGGA 1DTGA 1Y20A 4XKNA 4DCYA 1SYIA 4OXVA 3TEPA 3U8QA 3CSGA 5I57B 1LGBC 4GXAA 4KCDA 3OO8A 1OLAA 2V84A 3LBSA 5JEIA 4I1DA 3TMGA 1A7LA 4FJPA 3E4RA 3K6VA 4H8JA 3TODA 4OEUA 4JBZA 2VP1A 4HCWA 1HSLA 5I2KB 5CBRA 2E1SA 2DE2A 4ISUA 3RLFE 4AQ4A 1B0HA 3C31A 2GRVA 3TQWA 3IOTA 2THIA 4H1XA 3RPWA 3MVYA 1N0TA 1MQJA 3R7XA 2Q89A 4M1VA 4PFUA 4RPOA 3SEYA 3H6WA 2XHDA 3T22A 1MH3A 2HQ0A 3FXRA 2E0SA 1US5A 4FAJA 5J1DA 4O3BA 3FASA 5ICQA 2F34A 4GFRA 3IOWA 3K6XA 1S50A 1FQFA 4H5GA 3O6IA 1SVXB 3QIMA 3PPOA 1B3LA 2ABHA 3FGSA 1R1NA 2VD2A 3EHTA 3O2AA 2ZNSA 4I9DA 3TPAA 4ZE8A 3M8UA 1QVSA 3SEVA 1EZOA 4TLLB 4H0WA 2QJEA 4U21A 3KOSA 4ZEKA 2D5WA 1FTMA 3F11A 3MP1A 4YKIA 1H43A 5ITOA 2Z8DA 4YMBA 1VFEA 3RNNA 2REGA 1B9JA 3PUYE 3HV1A 2PX1A 3QUJA 5EHMA 4AB5A 4R73A 4FEDA 2RINA 1ZTYA 3E9XA 3R6UA 4ZS9A 4BDLA 4LZ5A 4Q5TA 4GL8A 3R26A 3FV1A 1LFGA 3IOVA 1H44A 1O63A 5H8FA 4JWOA 1UTHB 3D4GA 4P0IA 3PGFA 3OEMA 1FQEA 1JNFA 5L9SA 3FIRA 4YMAA 3KZGA 2Q88A 3KJTA 5ITPA 5I2NA 2B65A 2XXUA 4MLQA 4DXUA 2QRYA 1MQHA 2BJJX 4EF2A 2QMWA 1NH7A 1NH8A 4DCXA 1II5A 5FHMA 3S9MC 4M4GA 3U72A 2XXPA 2H5YA 2HAVA 3PUWE 1MDP1 4N6PA 4LATA 3CVGA 4UA8A 5I58A 1H3DA 1YPNA 3TTNA 1BTJA 1OVTA 3T9UA 1OIBA 3MPKA 1SD3A 3N26A 4QRZA 3FJMA 4QHQA 3S2VA 4RJZA 2DWHA 5KCJB 3EQ1A 4OFLA 2Z23A 4F2OA 3PPPA 5EYFA 3SETA 1LBBA 3O97A 3Q25A 2I3VA 3K2DA 2DE3A 1NKXA 4G8MA 3DP6A 3BKIB 3QYTA 4XKRA 2DXRA 4NF8A 2FNCA 1TXFA 1MG1A 3ZSFA 3LSFB 3PUXE 4E0XA 3K0VA 3MBPA 4F2QA 3ZS6A 3FVOA 2W7YA 3W15C 3LC8A 4LQ2A 2G93A 2QL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6H A;  4PQJ A;  1D9Y A;  2X26 A;  4BLA A;  4G8N A;  4GOT A;  1JEV A;  5IKB A;  2P0S A;  1RKM A;  2XX8 A;  2UVI A;  1H76 A;  1LLS A;  4DLD A;  3OEN A;  2H25 A;  2V93 A;  3C4M A;  4FOR A;  3OMB A;  1PB8 A;  4C1T A;  3LR1 A;  2XXX A;  3B7D A;  2Y7I A;  3VV5 A;  3U93 A;  5KZT A;  3QXM A;  3VVE A;  1ANF A;  1FQB A;  3ZKL A;  4DZ1 A;  2O69 A;  4GXS B;  4GWO A;  3MP8 A;  2XXW A;  4TOZ A;  4OFJ A;  5FHN A;  3KN3 A;  1ELJ A;  2H99 A;  4R6Y A;  3TCH A;  2ZYM A;  4OHN A;  1PB7 A;  4F39 A;  2V3U A;  3K1P A;  4WED A;  3N6T A;  1B5I A;  1FTK A;  2F36 A;  4Q0C A;  2OLB A;  2OK2 A;  3H3G A;  4MBP A;  1MPD A;  5H8N A;  5K2Y A;  5I59 B;  3VVF A;  1Y4T A;  1SYH A;  1POY 1;  1N3W A;  1MM6 A;  5AE4 A;  2O51 A;  5AA4 B;  5DVJ A;  3FUZ A;  4NTL A;  3RTW B;  4QF9 A;  1MY1 A;  3PUV E;  4RK2 A;  3FJG A;  2F78 A;  4ESW A;  3UGW A;  1Z7M E;  1NL5 A;  4EXL A;  2Y7R A;  1TFA A;  2F7C A;  2REJ A;  3ECR A;  4Z0I A;  3IB1 A;  2NXO A;  4ELR A;  3O6H A;  1DOT A;  3B6Q A;  3U1O A;  3OEK A;  3VXB A;  2DYX A;  4IO3 A;  3IAZ A;  3Q27 A;  3S9N C;  3IR1 A;  1OMP A;  4JSO A;  4NF4 B;  4RK9 A;  1SDX A;  1P1O A;  1BKA A;  3HST A;  1TFD A;  3MZB A;  4U2R A;  4OES A;  4ZEB A;  3CFL A;  5CMC A;  3N5L A;  4OEN A;  3IX1 A;  1IUD A;  1ZIU A;  4FE8 A;  5DVI A;  2VOZ A;  4JB7 A;  1M5C A;  3QSL A;  3W9W A;  4IO4 A;  4NWD A;  4RXL A;  5ISU A;  3A3C A;  2A5T B;  5B7D A;  1VR5 A;  1QUK A;  2Y7W A;  1FQD A;  1Y3N A;  5FTI A;  3FVN A;  2G29 A;  2UVJ A;  4QFP A;  3FJ7 A;  4ZEC A;  5I84 A;  5H8H B;  5CRY A;  3TAJ A;  2I49 A;  4PFY A;  2VGQ A;  3KBR A;  3PD8 A;  3IOR A;  1JW1 A;  2DQV A;  5DVF A;  1JW4 A;  4KD5 A;  1SI1 A;  3PPN A;  1PBQ A;  5M2V A;  4KCC A;  2XD2 A;  1B2H A;  1H45 A;  1M5D A;  1GV8 A;  4EDP A;  4KYE A;  4XIG Q;  1XHY A;  3N6U A;  4H5F A;  3IB0 A;  4H67 A;  1QUI A;  3IJX B;  5I2K A;  2OWS A;  5L9M A;  3VFJ A;  2DSF A;  5CI5 A;  2PYY A;  4POW A;  1Q1K A;  3K4U A;  2F6P A;  1GTK A;  4OTE A;  3MPL A;  2I0B A;  2DP8 A;  3MUQ A;  3RT6 B;  1LCF A;  2H9B A;  1B3H A;  3L6H A;  4PFT A;  2DXY A;  1SW1 A;  2QS2 A;  4GVO A;  4R9F A;  2HXW A;  4G4P A;  2FA7 A;  1MY0 A;  3PMV A;  4YU0 A;  3T93 B;  4YKJ A;  1FW0 A;  3I6V A;  4IGR A;  2QSX A;  2AL5 A;  2OBG A;  1IEJ A;  1DSN A;  1MXZ A;  3UA8 A;  4HW8 A;  5K2X A;  3TEL A;  5AA3 A;  4KQP A;  2GHA A;  4GF8 A;  3IB2 A;  2CZL A;  1POT A;  3KN8 A;  3I5O A;  3GBA A;  1URS A;  1I6A A;  4N13 A;  3RTF B;  1HSE A;  4R2B A;  1N76 A;  2ANJ A;  1PBP A;  3M3L A;  3PUZ E;  2QPQ A;  3JZJ A;  1P1N A;  3CR9 A;  1B52 A;  3DLN A;  4PET A;  2AL4 A;  2DWA A;  4Z7E A;  4E0W A;  2Y7K A;  1XOC A;  3C35 A;  2OZZ A;  1OQH A;  3C32 A;  3CFX A;  1FQA A;  1B5H A;  3MJN A;  3HHF A;  2HCA A;  4RY1 A;  5AA2 A;  4OER A;  3OXN A;  2KLF A;  4F22 A;  4R75 A;  3H6V A;  1YCJ A;  4ND9 A;  5IAI A;  4EXK A;  4JWY A;  3T9H B;  5A5X A;  3M3F A;  1I6Q A;  1IIW A;  1LFI A;  2OJT A;  3E13 X;  3H06 B;  1B1X A;  1B4Z A;  3K6U A;  2F7B A;  4POX A;  2HFB A;  4KYS A;  4OYV A;  3MZ1 A;  3KSJ A;  5JK4 A;  1XS5 A;  5CM6 A;  4DDD A;  2UVG A;  1UTB B;  4F19 A;  4DXB A;  3CIJ A;  1ZKB A;  1MM7 A;  1LAX A;  2R9J A;  4HS7 A;  3SES A;  1SW4 A;  2P2A A;  1IXH A;  1R6Z A;  2CMO A;  4IY5 A;  4ZDM A;  1R9Q A;  4NE4 A;  5H8F B;  5F7V A;  1SW2 A;  4FEC A;  5TP9 A;  2RC7 A;  2GFE A;  4F31 B;  2O6A A;  1ZU0 A;  3VE1 B;  4LUB A;  3PPQ A;  4G2Z A;  4ZEI A;  4IB2 A;  4BDQ A;  5DTB A;  1FQC A;  1PC3 A;  1OVB A;  2UXA A;  4MLV A;  2Q9T A;  1GR2 A;  1WDN A;  4ZE9 A;  5AA2 D;  2AIX A;  4HCY A;  1S7Y A;  1D4N A;  2I58 A;  4F18 A;  2PT1 A;  2D3I A;  3JV9 A;  4R6H A;  3S9E A;  1JET A;  3HO7 A;  3RQT A;  4JSD A;  1XVY A;  3TCF A;  3UOR A;  3IO4 A;  3VXC A;  1P99 A;  2RCB A;  4O3C A;  1EZ9 A;  5FHO A;  4JWX A;  4F1Y A;  2ZYK A;  5I58 B;  3H03 A;  2XXQ A;  4I8C A;  4YZZ A;  5DT6 A;  2R71 A;  4ELO A;  4YKK A;  3SKP A;  4NF5 B;  4X1D A;  3BFT A;  2RC9 A;  1JW5 A;  5DEX A;  1B7U A;  2OCU A;  3S9L C;  1URG A;  1OQG A;  2XXI A;  2F8D A;  4QSD A;  3MQ9 A;  2XX7 A;  1Y9U A;  1CE2 A;  2YPN A;  3TFL A;  2P1S A;  1A8F A;  3T66 A;  2B3B A;  1IIT A;  4QFN A;  4OFO A;  4NF6 A;  3GZG A;  2GHB A;  3OSR A;  3VVD A;  1CB6 A;  2O1L A;  4LQ5 A;  5HBC A;  2X7Q A;  4GLI A;  4NF8 B;  4R72 A;  1M5B A;  3VLU A;  4FAT A;  1B3G A;  4IO7 A;  1DTZ A;  2VHA A;  1AOV A;  1QKB A;  3OEL A;  5DYH A;  3BFU A;  4GL0 A;  3I3V A;  3G3H A;  3TTK A;  5JTY A;  1OLC A;  1B3E A;  1B32 A;  3EHS A;  5L8D A;  1B3F A;  3SEX A;  3H7M A;  1Z7N E;  3H4Z A;  2R6G E;  1J1N A;  5I56 A;  3U92 A;  5CMM A;  5CMB A;  5KDT A;  1XC1 A;  2GH9 A;  4LZ7 A;  3C36 A;  1URD A;  2QS3 A;  5H8Q A;  1RYO A;  1NNF A;  3DP4 A;  4YKP A;  3GBB A;  3MC2 A;  1HSJ A;  4Q30 B;  1LAF E;  4U1O A;  4DIG A;  4G68 A;  5BUU A;  4LA9 A;  1N7W A;  4F3G A;  5HM4 B;  1KWH A;  4X1B A;  2PVU A;  1B7Z A;  2DS9 A;  2QS4 A;  2Y7P A;  4U1Z A;  4ELP A;  1N84 A;  1AH5 A;  3DM0 A;  4XKP A;  2O7U A;  2V3Q A;  4IO5 A;  2XXV A;  4EQB A;  4EF1 A;  3KEI A;  3V5A A;  2NWJ A;  1A99 A;  5TPA A;  1MY4 A;  1LB9 A;  2ZXT A;  1IQ7 A;  1MDQ A;  4QFK A;  4LON B;  1N04 A;  3H6T A;  4GRK A;  1R9L A;  3AXF A;  4OMB A;  4ELQ A;  2PBW A;  2UYF A;  3HHG A;  3USD A;  2NOO A;  1MXW A;  4DE8 A;  2DVZ A;  2ZMB A;  1T0K A;  2XXH A;  2NUV A;  4ESX A;  3Q29 A;  1MXX A;  1ZJL A;  4JDF A;  4RYA A;  4R2F A;  4ECF A;  5I57 A;  4XXU A;  1A40 A;  4BDO A;  1JVX A;  3PPR A;  2Q8J A;  1XVX A;  3O29 A;  1A54 A;  4IO6 A;  1BIY A;  1NMU A;  4K3F A;  3SDF A;  3DEL B;  1JQF A;  2PMS A;  2ONR A;  2O68 A;  5EHS A;  4H65 A;  1IXC A;  2F7A A;  3K02 A;  1MS7 A;  3UK4 A;  1M5F A;  1B05 A;  3C33 A;  2DWJ A;  1TT1 A;  3SEW A;  2HAU A;  4EQ9 A;  1AL3 A;  2XX9 A;  3K1M A;  1D9V A;  2XXR A;  3PV0 E;  4KHZ E;  1FCK A;  4KR5 A;  3OSQ A;  3PMX A;  4GD5 A;  2Q2A A;  4IGT A;  4NMY A;  3FD3 A;  4G8H A;  3O66 A;  3FXQ A;  5CC2 A;  3CG1 A;  3OOA A;  1M5E A;  1DPE A;  3Q28 A;  3GXA A;  2XXT A;  3IOU A;  3KSX A;  3E3K A;  3TZA A;  5ICT A;  4NED A;  1SQY A;  2ZYN A;  1D3K A;  1AMF A;  2O84 X;  3FVK A;  4MH5 A;  1I6B A;  3BBR A;  4F3B A;  4RNS A;  1B5J A;  2IA4 A;  1PB9 A;  1PDA A;  5L9O A;  3CSB A;  5AA1 A;  1QUJ A;  4HTG A;  4YAH X;  1DMB A;  1SI0 A;  3P7I A;  3B6W A;  5B70 A;  3ILT B;  3MVZ A;  1MPC A;  2UVH A;  3G3F A;  3EHU A;  1P1Q A;  2V3T A;  1B46 A;  1ZBM A;  4THI A;  2F35 A;  1ATG A;  5LOM A;  2DVC A;  2I4B A;  3THI A;  5H8S A;  4WEP A;  3PU5 A;  2I3W A;  1MXU A;  3V89 B;  4XTC Q;  1VE4 A;  1DPP A;  2ALU A;  3K1N A;  1ZLQ A;  3RT8 A;  1UTH A;  3S4U A;  1Q35 A;  1Y3P A;  1B58 A;  3K01 A;  2Q2C A;  2YJP A;  1IXI A;  2A5S A;  1MQG A;  1GVC A;  4DXC A;  3WAE A;  1UIV A;  3MVX A;  1LB8 A;  3MP6 A;  1A8E A;  3G3J A;  1UTB A;  2UYE A;  1QJM A;  2F97 A;  1QUL A;  1SBP A;  2H4I A;  1RYX A;  1B7H A;  1XT8 A;  4OWD A;  4X9T A;  4ZEF A;  3L6G A;  3TTM A;  4U22 A;  1A55 A;  3CG3 A;  3LSL A;  3SER A;  4LVQ A;  1USY E;  3IJO B;  3VLV A;  1P1U A;  1USY H;  1VFD A;  4OQO A;  2I6E A;  4H8I A;  4F1U A;  3DP8 A;  3FVG A;  1B40 A;  1MXV A;  4LZ8 A;  5AA2 B;  4QSC A;  3WAF A;  1LAG E;  4YB5 A;  3K00 A;  2I48 A;  1UQW A;  3W9V A;  1JEU A;  5A5X B;  2Y84 A;  2LAO A;  3RUM A;  1ZMG A;  1UIU A;  4MFI A;  4BDM A;  1SW5 A;  2RC8 A;  5KCJ A;  5BWJ A;  3VDF A;  3IL1 B;  3TKD A;  3KG2 A;  2O1M A;  4PE5 B;  3T96 B;  4IO2 A;  4P11 A;  3K6W A;  1MPB A;  3G3K A;  3T9X B;  5I2N B;  1TWY A;  2ESN A;  3TTL A;  1NNT A;  4L17 A;  3MW0 A;  4C0R A;  3CFZ A;  4NF5 A;  3IO6 A;  4GIZ A;  2O7I A;  4I62 A;  4BDN A;  1PEB A;  1B4H A;  3A09 A;  4TQU Q;  3U94 A;  3N94 A;  1Y3Q A;  2DOJ A;  5TP9 B;  2X7P A;  5F1Q A;  4WXJ A;  2H98 A;  2VD3 A;  4U23 A;  4PFW A;  2RKM A;  4KYD A;  4U4S A;  4JXI A;  1NNP A;  3O28 A;  4X48 A;  2OWT A;  4C1U A;  1MQD A;  1L5T A;  4ZZE A;  3PD9 A;  5ELV A;  1NNK A;  2Z8E A;  3ODB A;  2B3F A;  4KFQ A;  1O64 A;  3VLW A;  2V25 A;  1WVJ A;  3M3K A;  3C34 A;  5TU0 A;  3FV2 A;  3RGY A;  3HN0 A;  1BP5 A;  1JVY A;  2F5X A;  3D4C A;  4ZZA A;  3UP9 A;  3KJ7 A;  1F9B A;  1FTJ A;  1MY3 A;  2ONS A;  3MZ9 A;  2XD3 A;  4F1V A;  1LBC A;  3FAT A;  1LAH E;  3GLB A;  4ZED A;  3ZKK A;  4H6D A;  4FIM A;  1NFT A;  4RPN A;  4U4X A;  3G3G A;  3G7W A;  5I59 A;  1EU8 A;  5FTH A;  3LUY A;  3HPI A;  4BDR A;  3A3U A;  5DEX B;  2M8C A;  2XXY A;  4TLM B;  5HPQ A;  4N07 A;  3RY3 A;  3OO6 A;  4EUO A;  5AA4 A;  3RN8 A;  3EN3 A;  3FXU A;  1N7X A;  3B6T A;  3O9P A;  2HEU A;  3V83 A;  1B0L A;  3KOT A;  4RA1 A;  3TDJ A;  2ZNT A;  4QFO A;  2IEE A;  4Q8R A;  4NWC A;  2NVU B;  4YIC A;  4YB7 A;  4NF6 B;  1IXG A;  4R74 A;  1MQI A;  4GQO A;  1MRP A;  3OO7 A;  2I4C A;  2Z22 A;  1VSO A;  1Y1M A;  2RF1 A;  4NF4 A;  4F29 A;  2ONK E;  2YLN A;  2I0C A;  3KGC A;  3UN6 A;  1B1H A;  5JTY B;  3QUF A;  2HZK A;  3KFM A;  3EF7 A;  3QAX A;  1IZ1 A;  3ONM A;  3O6G A;  1MXY A;  3FZV A;  3JYR A;  5I56 B;  1US4 A;  1FTO A;  4MF3 A;  5H8N B;  3TUS A;  2FYI A;  2A5T A;  4ONY A;  1Y4C A;  3PMW A;  2QS1 A;  2RCA A;  1LCT A;  2WKY A;  3MWB A;  3MVW A;  2D21 A;  5KDT B;  4LP2 B;  4KPT A;  1AIV A;  3Q26 A;  3G3I A;  3TQL A;  2AYS A;  1P1W A;  4WKM A;  5H8H A;  5H8Q B;  1EZP A;  4QSE A;  4PP0 A;  2F6G A;  4R6K A;  1QKA A;  3LSW A;  5CBS A;  4P0G A;  3T9V A;  4G68 B;  2ZNU A;  3LSX A;  3V8X B;  1BLF A;  3MAM A;  1I69 A;  5CMK A;  3TTR A;  4G77 A;  3SEU A;  4AB6 A;  2ZYO A;  1MH4 A;  4O3A A;  1MY2 A;  4IY6 A;  3QK6 A;  1LST A;  3CI8 A;  2DE4 A;  1Y1Z A;  4F3P A;  1O7T A;  1YTV A;  1EH3 A;  3TCG A;  3KN7 A;  4EQ7 A;  1YAE A;  4F3S A;  3IK6 B;  1B51 A;  3OD7 A;  4QFL A;  1N3X A;  3UIF A;  4UAC A;  3ILU B;  5TPA B;  1QW0 A;  4OZ9 A;  3C9H A;  2DWI A;  2QMX A;  4OVJ A;  3CRB A;  4YB6 A;  4FEB A;  3EPE A;  1WOD A;  1LFH A;  4OEV A;  3HCQ A;  2PT2 A;  1FTL A;  4XKQ A;  3OO9 A;  4OET A;  2Z8F A;  4G68 C;  4KI0 E;  3TYH A;  2HZL A;  1S9T A;  3H6U A;  4R9G A;  1GGG A;  1DTG A;  1Y20 A;  4XKN A;  4DCY A;  1SYI A;  4OXV A;  3TEP A;  3U8Q A;  3CSG A;  5I57 B;  1LGB C;  4GXA A;  4KCD A;  3OO8 A;  1OLA A;  2V84 A;  3LBS A;  5JEI A;  4I1D A;  3TMG A;  1A7L A;  4FJP A;  3E4R A;  3K6V A;  4H8J A;  3TOD A;  4OEU A;  4JBZ A;  2VP1 A;  4HCW A;  1HSL A;  5I2K B;  5CBR A;  2E1S A;  2DE2 A;  4ISU A;  3RLF E;  4AQ4 A;  1B0H A;  3C31 A;  2GRV A;  3TQW A;  3IOT A;  2THI A;  4H1X A;  3RPW A;  3MVY A;  1N0T A;  1MQJ A;  3R7X A;  2Q89 A;  4M1V A;  4PFU A;  4RPO A;  3SEY A;  3H6W A;  2XHD A;  3T22 A;  1MH3 A;  2HQ0 A;  3FXR A;  2E0S A;  1US5 A;  4FAJ A;  5J1D A;  4O3B A;  3FAS A;  5ICQ A;  2F34 A;  4GFR A;  3IOW A;  3K6X A;  1S50 A;  1FQF A;  4H5G A;  3O6I A;  1SVX B;  3QIM A;  3PPO A;  1B3L A;  2ABH A;  3FGS A;  1R1N A;  2VD2 A;  3EHT A;  3O2A A;  2ZNS A;  4I9D A;  3TPA A;  4ZE8 A;  3M8U A;  1QVS A;  3SEV A;  1EZO A;  4TLL B;  4H0W A;  2QJE A;  4U21 A;  3KOS A;  4ZEK A;  2D5W A;  1FTM A;  3F11 A;  3MP1 A;  4YKI A;  1H43 A;  5ITO A;  2Z8D A;  4YMB A;  1VFE A;  3RNN A;  2REG A;  1B9J A;  3PUY E;  3HV1 A;  2PX1 A;  3QUJ A;  5EHM A;  4AB5 A;  4R73 A;  4FED A;  2RIN A;  1ZTY A;  3E9X A;  3R6U A;  4ZS9 A;  4BDL A;  4LZ5 A;  4Q5T A;  4GL8 A;  3R26 A;  3FV1 A;  1LFG A;  3IOV A;  1H44 A;  1O63 A;  5H8F A;  4JWO A;  1UTH B;  3D4G A;  4P0I A;  3PGF A;  3OEM A;  1FQE A;  1JNF A;  5L9S A;  3FIR A;  4YMA A;  3KZG A;  2Q88 A;  3KJT A;  5ITP A;  5I2N A;  2B65 A;  2XXU A;  4MLQ A;  4DXU A;  2QRY A;  1MQH A;  2BJJ X;  4EF2 A;  2QMW A;  1NH7 A;  1NH8 A;  4DCX A;  1II5 A;  5FHM A;  3S9M C;  4M4G A;  3U72 A;  2XXP A;  2H5Y A;  2HAV A;  3PUW E;  1MDP 1;  4N6P A;  4LAT A;  3CVG A;  4UA8 A;  5I58 A;  1H3D A;  1YPN A;  3TTN A;  1BTJ A;  1OVT A;  3T9U A;  1OIB A;  3MPK A;  1SD3 A;  3N26 A;  4QRZ A;  3FJM A;  4QHQ A;  3S2V A;  4RJZ A;  2DWH A;  5KCJ B;  3EQ1 A;  4OFL A;  2Z23 A;  4F2O A;  3PPP A;  5EYF A;  3SET A;  1LBB A;  3O97 A;  3Q25 A;  2I3V A;  3K2D A;  2DE3 A;  1NKX A;  4G8M A;  3DP6 A;  3BKI B;  3QYT A;  4XKR A;  2DXR A;  4NF8 A;  2FNC A;  1TXF A;  1MG1 A;  3ZSF A;  3LSF B;  3PUX E;  4E0X A;  3K0V A;  3MBP A;  4F2Q A;  3ZS6 A;  3FVO A;  2W7Y A;  3W15 C;  3LC8 A;  4LQ2 A;  2G93 A;  2QL3 A; 
#chains in the Genus database with same CATH topology
 1B6H A;  4PQJ A;  1D9Y A;  1NV3 A;  2X26 A;  4BLA A;  2XWK A;  4G8N A;  4GOT A;  1JEV A;  1DCU A;  1FJ9 A;  5IKB A;  2P0S A;  1RKM A;  2XX8 A;  2UVI A;  1H76 A;  1LLS A;  4DLD A;  2WBD A;  3OEN A;  2H25 A;  2V93 A;  3C4M A;  4FOR A;  3OMB A;  1PB8 A;  4C1T A;  3LR1 A;  2XXX A;  3B7D A;  2Y7I A;  3VV5 A;  3U93 A;  5KZT A;  2HXR A;  3QXM A;  3VVE A;  1ANF A;  1FQB A;  3ZKL A;  4DZ1 A;  2O69 A;  4GXS B;  4GWO A;  2XWI A;  3MP8 A;  4HE2 A;  2XXW A;  4TOZ A;  4OFJ A;  5FHN A;  3KN3 A;  5EQ9 A;  1ELJ A;  2H99 A;  4R6Y A;  3TCH A;  4N8G A;  2ZYM A;  4OHN A;  1PB7 A;  4F39 A;  2V3U A;  3K1P A;  4WED A;  1NV6 A;  3N6T A;  1B5I A;  1FTK A;  2QVR A;  2F36 A;  4Q0C A;  2OLB A;  4O94 A;  2OK2 A;  3H3G A;  4MBP A;  1MPD A;  5H8N A;  5A5L A;  5K2Y A;  5I59 B;  3VVF A;  1Y4T A;  1SYH A;  1POY 1;  1N3W A;  2KR0 A;  2P3V A;  1MM6 A;  5AE4 A;  2O51 A;  5AA4 B;  5DVJ A;  4O7M A;  3FUZ A;  4NTL A;  3RTW B;  4QF9 A;  2PCR A;  1MY1 A;  3PUV E;  4RK2 A;  3FJG A;  2F78 A;  4ESW A;  3UGW A;  1Z7M E;  1NL5 A;  4EXL A;  2Y5L A;  2Y7R A;  1TFA A;  2F7C A;  2REJ A;  3ECR A;  4Z0I A;  2ZZX A;  3IB1 A;  2NXO A;  2WYK A;  4ELR A;  3O6H A;  3U65 A;  1DOT A;  3B6Q A;  3U1O A;  3OEK A;  3VXB A;  4XEQ A;  2DYX A;  4IO3 A;  3IAZ A;  3Q27 A;  3S9N C;  3IR1 A;  1OMP A;  3SZP A;  4JSO A;  4NF4 B;  1JP4 A;  4RK9 A;  1SDX A;  1P1O A;  1FBG A;  1BKA A;  4LN5 A;  3HST A;  1TFD A;  3MZB A;  4U2R A;  4OES A;  4ZEB A;  3CFL A;  5CMC A;  3N5L A;  4OEN A;  3IX1 A;  1IUD A;  1ZIU A;  4FE8 A;  5DVI A;  2VOZ A;  4JB7 A;  1M5C A;  3QSL A;  3W9W A;  4IO4 A;  4NWD A;  4RXL A;  5ISU A;  3A3C A;  2A5T B;  5B7D A;  1VR5 A;  1QUK A;  3KC1 A;  2Y7W A;  1FQD A;  1Y3N A;  2CEX A;  5FTI A;  3FVN A;  2G29 A;  2UVJ A;  4PF8 A;  4QFP A;  3FJ7 A;  4ZEC A;  5I84 A;  5H8H B;  5CRY A;  3TAJ A;  2I49 A;  4PFY A;  2VGQ A;  3KBR A;  3PTY A;  3PD8 A;  3IOR A;  1Q9D A;  1JW1 A;  1NV1 A;  2DQV A;  5DVF A;  1JW4 A;  2V4C A;  4KD5 A;  1SI1 A;  3PPN A;  1PBQ A;  5M2V A;  4KCC A;  2XD2 A;  1B2H A;  1H45 A;  1M5D A;  5EQ8 A;  1GV8 A;  4EDP A;  4KYE A;  3BIH A;  4XIG Q;  1XHY A;  3N6U A;  4H5F A;  3QMF A;  2WX9 A;  3IB0 A;  4H67 A;  1QUI A;  3IJX B;  2VT5 A;  1LEV A;  5I2K A;  1G0I A;  2OWS A;  5L9M A;  3VFJ A;  2DSF A;  3IFC A;  5CI5 A;  2PYY A;  4POW A;  1Q1K A;  1LBV A;  3K4U A;  2F6P A;  1GTK A;  4OTE A;  3MPL A;  2I0B A;  2DP8 A;  3MUQ A;  3RT6 B;  1LCF A;  1LBZ A;  1B3H A;  2H9B A;  3L6H A;  4PFT A;  5EYH A;  1FTA A;  2DXY A;  5ESY A;  1SW1 A;  1RDZ A;  2QS2 A;  4GVO A;  4R9F A;  2HXW A;  4G4P A;  2FA7 A;  1MY0 A;  3PMV A;  4YU0 A;  3T93 B;  4YKJ A;  1FW0 A;  3I6V A;  4IGR A;  2QSX A;  2AL5 A;  2OBG A;  4P47 A;  1IEJ A;  1DSN A;  1MXZ A;  1FBC A;  3UA8 A;  4HW8 A;  4I3Y A;  5K2X A;  4I3E A;  1FRP A;  3TEL A;  5AA3 A;  4KQP A;  2GHA A;  4GF8 A;  3IB2 A;  2CZL A;  1POT A;  4PC9 A;  3KN8 A;  3I5O A;  3GBA A;  4HE1 A;  1URS A;  1I6A A;  4N13 A;  5IZ3 B;  3RTF B;  1HSE A;  4R2B A;  4QBA A;  1N76 A;  2ANJ A;  1PBP A;  3M3L A;  3PUZ E;  4OVP A;  2QPQ A;  4GWY A;  3JZJ A;  4QXD A;  1P1N A;  3CR9 A;  1B52 A;  1FBE A;  2BJI A;  3DLN A;  4NF0 A;  3MYU A;  2CZH A;  4PET A;  2AL4 A;  2DWA A;  4Z7E A;  4E0W A;  2Y7K A;  1XOC A;  3C35 A;  2OZZ A;  1FBF A;  1OQH A;  2HPG A;  3C32 A;  3CFX A;  1FQA A;  1B5H A;  3MJN A;  3HHF A;  2HCA A;  4RY1 A;  5AA2 A;  1IMC A;  4OER A;  3OXN A;  2KLF A;  4F22 A;  4R75 A;  3H6V A;  1YCJ A;  4ND9 A;  5IAI A;  4EXK A;  4JWY A;  3T9H B;  5A5X A;  5ET5 A;  3M3F A;  1I6Q A;  1IIW A;  1LFI A;  2OJT A;  3E13 X;  1FPL A;  3H06 B;  1B1X A;  1B4Z A;  3K6U A;  2F7B A;  4POX A;  2HFB A;  4N81 A;  1FBD A;  4KYS A;  4OYV A;  3MZ1 A;  1LBW A;  3KSJ A;  5JK4 A;  1XS5 A;  4OVQ A;  5CM6 A;  4DDD A;  2UVG A;  1UTB B;  4F19 A;  4DXB A;  3CIJ A;  1ZKB A;  1MM7 A;  2WBB A;  1LAX A;  2R9J A;  4HS7 A;  2ZZW A;  3SES A;  1SW4 A;  4PGP A;  2P2A A;  1IXH A;  4IR8 A;  4OA4 A;  5ET8 A;  1R6Z A;  2CMO A;  4IY5 A;  4ZDM A;  1R9Q A;  4NE4 A;  5H8F B;  5F7V A;  1SW2 A;  2CEY A;  4FEC A;  5TP9 A;  2RC7 A;  2GFE A;  4F31 B;  2O6A A;  1ZU0 A;  4PDH A;  3VE1 B;  4LUB A;  3PPQ A;  4G2Z A;  4ZEI A;  4IB2 A;  4BDQ A;  5DTB A;  1FQC A;  1PC3 A;  1OVB A;  2UXA A;  4MLV A;  2Q9T A;  1GR2 A;  1WDN A;  4ZE9 A;  5AA2 D;  1BK4 A;  2AIX A;  4HCY A;  3ISP A;  1S7Y A;  1D4N A;  2I58 A;  4F18 A;  2PT1 A;  4XFE A;  2DDK A;  4NAP A;  2D3I A;  3JV9 A;  1NV4 A;  4N91 A;  4R6H A;  3S9E A;  5DW8 A;  1JET A;  3HO7 A;  3RQT A;  4JSD A;  1XVY A;  3TCF A;  1IMD A;  3UOR A;  3IO4 A;  4NGU A;  3VXC A;  1P99 A;  2RCB A;  4O3C A;  1EZ9 A;  5FHO A;  4JWX A;  4F1Y A;  2ZYK A;  5I58 B;  3H03 A;  2XXQ A;  4I8C A;  4YZZ A;  5DT6 A;  2R71 A;  4ELO A;  2WEF A;  4YKK A;  3SKP A;  1D9Q A;  4NF5 B;  4X1D A;  3BFT A;  2RC9 A;  4NQ8 A;  1JW5 A;  5DEX A;  1B7U A;  2OCU A;  3S9L C;  1URG A;  1OQG A;  2XXI A;  2F8D A;  4QSD A;  4H46 A;  3MQ9 A;  2XX7 A;  3E79 A;  1Y9U A;  5IGA A;  1CE2 A;  2YPN A;  3TFL A;  2P1S A;  1A8F A;  3T66 A;  2B3B A;  1IIT A;  4QFN A;  4OFO A;  3B8B A;  4NF6 A;  3GZG A;  2GHB A;  3OSR A;  3VVD A;  1CB6 A;  2O1L A;  4LQ5 A;  5HBC A;  2X7Q A;  4GLI A;  4NF8 B;  4R72 A;  1M5B A;  3VLU A;  4FAT A;  1B3G A;  3FXB A;  2FIX A;  1DTZ A;  4IO7 A;  1FPK A;  2VHA A;  1AOV A;  1QKB A;  3OEL A;  5DYH A;  3BFU A;  4GL0 A;  3I3V A;  3G3H A;  3TTK A;  4P9K A;  5JTY A;  1OLC A;  1B3E A;  1B32 A;  3EHS A;  5L8D A;  1B3F A;  3SEX A;  3H7M A;  3T1B A;  1FPD A;  1Z7N E;  3H4Z A;  2R6G E;  1J1N A;  5I56 A;  5I3S A;  3U92 A;  5CMM A;  4PFR A;  2QFL A;  5CMB A;  5KDT A;  1XC1 A;  2GH9 A;  1RDY A;  4LZ7 A;  4GX6 A;  2FBP A;  3C36 A;  2XWV A;  4MNI A;  1URD A;  2QS3 A;  5H8Q A;  1RYO A;  1NNF A;  3DP4 A;  4YKP A;  3GBB A;  4MX6 A;  5LDZ A;  3MC2 A;  1HSJ A;  4Q30 B;  1LAF E;  4U1O A;  4DIG A;  4G68 A;  1FBH A;  1XI6 A;  5BUU A;  4JVI A;  4N15 A;  2B4M A;  4LA9 A;  1N7W A;  4F3G A;  5HM4 B;  4PE3 A;  1KWH A;  4X1B A;  2PVU A;  5EYG A;  1B7Z A;  2HHM A;  4O8M A;  2DS9 A;  2QVU A;  2QS4 A;  2Y7P A;  4U1Z A;  4ELP A;  4NG7 A;  1N84 A;  1AH5 A;  3DM0 A;  4XKP A;  2O7U A;  2V3Q A;  4IO5 A;  2XXV A;  4EQB A;  4EF1 A;  4N6K A;  3KEI A;  3V5A A;  5I7I A;  2NWJ A;  1A99 A;  5TPA A;  1MY4 A;  1LB9 A;  2ZXT A;  1IQ7 A;  1MDQ A;  4QFK A;  4LON B;  1N04 A;  3H6T A;  4GRK A;  1R9L A;  3AXF A;  4OMB A;  4ELQ A;  2PBW A;  5EQA A;  2UYF A;  3HHG A;  3USD A;  2NOO A;  1MXW A;  4DE8 A;  2DVZ A;  2ZMB A;  1T0K A;  2XXH A;  2FHY A;  4G61 A;  2NUV A;  4ESX A;  3Q29 A;  1MXX A;  1ZJL A;  1IMB A;  4JDF A;  4RYA A;  5EQ7 A;  4R2F A;  2Y5K A;  4ECF A;  5I57 A;  4XXU A;  1A40 A;  4BDO A;  4PFB A;  1JVX A;  3PPR A;  2Q8J A;  4P3L A;  1XVX A;  3O29 A;  1A54 A;  4IO6 A;  1BIY A;  1NMU A;  4K3F A;  3SDF A;  3DEL B;  1JQF A;  2PMS A;  1SPI A;  2ONR A;  2O68 A;  1FBP A;  5EHS A;  4H65 A;  1IXC A;  2F7A A;  3K02 A;  1MS7 A;  1EYJ A;  3UK4 A;  1M5F A;  1B05 A;  1FJ6 A;  3C33 A;  2DWJ A;  4P1E A;  1TT1 A;  3SEW A;  2HAU A;  4EQ9 A;  1AL3 A;  4GWS A;  2XX9 A;  3K1M A;  1D9V A;  2XXR A;  3PV0 E;  4KHZ E;  1FCK A;  4KR5 A;  3OSQ A;  3PMX A;  1FPJ A;  1NV7 A;  2OWZ A;  4GD5 A;  2Q2A A;  4IGT A;  4NMY A;  3FD3 A;  4G8H A;  3O66 A;  3FXQ A;  5CC2 A;  3CG1 A;  3OOA A;  1M5E A;  1DPE A;  3Q28 A;  3GXA A;  2XXT A;  3IOU A;  3KSX A;  3E3K A;  3TZA A;  5ICT A;  4NED A;  1KA0 A;  1SQY A;  2ZYN A;  1D3K A;  1FPG A;  1LBX A;  5FBP A;  1AMF A;  2O84 X;  3CHG A;  3FVK A;  4MH5 A;  1I6B A;  3BBR A;  4F3B A;  4N17 A;  3LV0 A;  4RNS A;  1B5J A;  2IA4 A;  5ET6 A;  1PB9 A;  1PDA A;  4MMP A;  5L9O A;  3CSB A;  1IMA A;  2VPN A;  5AA1 A;  1QUJ A;  4HTG A;  4YAH X;  1DMB A;  1INP A;  1SI0 A;  2XA5 A;  3P7I A;  3B6W A;  1YXI A;  4GBW A;  5B70 A;  3ILT B;  3B50 A;  3MVZ A;  1MPC A;  2UVH A;  3RPL A;  3G3F A;  2FVZ A;  3EHU A;  1P1Q A;  2V3T A;  1B46 A;  1ZBM A;  4NHB A;  4THI A;  2PFY A;  2F35 A;  1ATG A;  5LOM A;  2DVC A;  2I4B A;  3THI A;  5H8S A;  4WEP A;  3PU5 A;  2I3W A;  4N8Y A;  1MXU A;  3V89 B;  4XTC Q;  1VE4 A;  1DPP A;  2ALU A;  3K1N A;  1ZLQ A;  3RT8 A;  1RDX A;  1UTH A;  3S4U A;  1Q35 A;  4X04 A;  1Y3P A;  1B58 A;  3K01 A;  2Q2C A;  2YJP A;  3KC0 A;  1IXI A;  2A5S A;  1MQG A;  1GVC A;  4DXC A;  3WAE A;  1UIV A;  3MVX A;  2P3N A;  1LB8 A;  3MP6 A;  1A8E A;  3G3J A;  1UTB A;  2UYE A;  1QJM A;  2F97 A;  2GQ1 A;  1QUL A;  1SBP A;  3BIG A;  2B4L A;  2H4I A;  4UAB A;  1RYX A;  1B7H A;  1XT8 A;  4OWD A;  4X9T A;  4PAK A;  4ZEF A;  3L6G A;  4XF5 A;  3TTM A;  4U22 A;  1A55 A;  3CG3 A;  2XWO A;  3LSL A;  3SER A;  4LVQ A;  1USY E;  3IJO B;  3VLV A;  1P1U A;  1USY H;  1VFD A;  4OQO A;  2I6E A;  2R8T A;  4H8I A;  4F1U A;  3DP8 A;  3FVG A;  1B40 A;  1MXV A;  4LZ8 A;  5AA2 B;  4QSC A;  3WAF A;  1LAG E;  2KQZ A;  4YB5 A;  2F3D A;  3K00 A;  2I48 A;  2OX3 A;  1NV0 A;  1UQW A;  3W9V A;  1JEU A;  5A5X B;  2Y84 A;  2LAO A;  4NN3 A;  3RUM A;  1ZMG A;  1UIU A;  4MFI A;  4BDM A;  1SW5 A;  2RC8 A;  4GWZ A;  4OVS A;  5KCJ A;  5BWJ A;  3VDF A;  3IL1 B;  3TKD A;  3KG2 A;  2O1M A;  4PE5 B;  3T96 B;  4IO2 A;  2L5V A;  1KA1 A;  4P11 A;  3K6W A;  1MPB A;  3G3K A;  3T9X B;  4PDD A;  5I2N B;  1TWY A;  2ESN A;  3TTL A;  4HE0 A;  2Q74 A;  5LTC A;  1NNT A;  4L17 A;  3MW0 A;  4C0R A;  3CFZ A;  4NF5 A;  3IO6 A;  4GIZ A;  2O7I A;  4I62 A;  4BDN A;  1PEB A;  1B4H A;  3A09 A;  1FPF A;  4TQU Q;  3U94 A;  3N94 A;  1Y3Q A;  2DOJ A;  5TP9 B;  1EYK A;  2X7P A;  5F1Q A;  4WXJ A;  2H98 A;  2VD3 A;  5ET7 A;  4U23 A;  4PFW A;  2RKM A;  4HXV A;  4KYD A;  4U4S A;  4JXI A;  1NNP A;  3O28 A;  4DI4 B;  4X48 A;  2OWT A;  2ZZV A;  4I40 A;  4C1U A;  1MQD A;  1L5T A;  4ZZE A;  3PD9 A;  5ELV A;  1NUZ A;  1NNK A;  4MHF A;  2Z8E A;  3ODB A;  2B3F A;  4KFQ A;  1O64 A;  3VLW A;  2V25 A;  1WVJ A;  3M3K A;  3C34 A;  5TU0 A;  3FV2 A;  3RGY A;  3HN0 A;  1BP5 A;  1JVY A;  2F5X A;  1KZ8 A;  3D4C A;  4PGN A;  4ZZA A;  3UP9 A;  3KJ7 A;  1F9B A;  1FTJ A;  1MY3 A;  4N6D A;  2ONS A;  1VDW A;  3MZ9 A;  2XD3 A;  4F1V A;  1LBC A;  3FAT A;  1LAH E;  3GLB A;  4ZED A;  3ZKK A;  4H6D A;  4FIM A;  1NFT A;  4JVD A;  4RPN A;  4U4X A;  4MEV A;  3G3G A;  3G7W A;  5I59 A;  1EU8 A;  4PTK A;  3LUY A;  3HPI A;  4PF6 A;  5FTH A;  3A3U A;  4BDR A;  5DEX B;  2M8C A;  2XXY A;  4TLM B;  5HPQ A;  4N07 A;  3D1R A;  3RY3 A;  3OO6 A;  4EUO A;  5AA4 A;  2WYP A;  3RN8 A;  3EN3 A;  3FXU A;  1N7X A;  1AWB A;  3B6T A;  3O9P A;  2HEU A;  3V83 A;  1B0L A;  4RA1 A;  3KOT A;  3TDJ A;  2ZNT A;  4QFO A;  4P8B A;  2IEE A;  4Q8R A;  4NWC A;  2NVU B;  4YIC A;  4YB7 A;  4NF6 B;  1IXG A;  4R74 A;  1MQI A;  4GQO A;  1MRP A;  3ROJ A;  3OO7 A;  2I4C A;  1FSA A;  2Z22 A;  1VSO A;  1Y1M A;  2RF1 A;  4NF4 A;  4F29 A;  4MIJ A;  2ONK E;  2YLN A;  1FPI A;  2I0C A;  3KGC A;  3UN6 A;  1B1H A;  5JTY B;  3QUF A;  2HZK A;  3KFM A;  4GWW A;  3EF7 A;  3QAX A;  1IZ1 A;  3ONM A;  3O6G A;  1MXY A;  3FZV A;  3JYR A;  5I56 B;  1US4 A;  1FTO A;  4MF3 A;  5H8N B;  3TUS A;  2FYI A;  4MNC A;  2A5T A;  4ONY A;  1Y4C A;  5IZZ A;  3PMW A;  2QS1 A;  2RCA A;  1LCT A;  2WKY A;  3MWB A;  3MVW A;  2D21 A;  5KDT B;  4LP2 B;  4KPT A;  1AIV A;  1G0H A;  4O7I A;  3Q26 A;  3G3I A;  3TQL A;  2AYS A;  1P1W A;  4WKM A;  2MKZ A;  5H8H A;  5H8Q B;  1EYI A;  2XXK A;  1EZP A;  4QSE A;  4PP0 A;  2F6G A;  3A29 A;  4R6K A;  2F3B A;  1QKA A;  3LSW A;  5CBS A;  4P0G A;  3T9V A;  4G68 B;  2ZNU A;  3LSX A;  4PBH A;  3V8X B;  4GWX A;  1BLF A;  3MAM A;  1I69 A;  5J16 A;  5CMK A;  3TTR A;  4G77 A;  3SEU A;  1CNQ A;  4AB6 A;  2ZYO A;  4KXP A;  1MH4 A;  4O3A A;  1MY2 A;  4IY6 A;  3QK6 A;  4JVC A;  1LST A;  3CI8 A;  3HFU A;  2DE4 A;  1Y1Z A;  4F3P A;  1O7T A;  1YTV A;  1EH3 A;  3TCG A;  3KN7 A;  5I5P A;  4EQ7 A;  1YAE A;  4F3S A;  3IK6 B;  1B51 A;  3OD7 A;  4QFL A;  1N3X A;  3UIF A;  4UAC A;  3ILU B;  5TPA B;  4MAG A;  1QW0 A;  4OZ9 A;  3C9H A;  2DWI A;  2QMX A;  4OVJ A;  3CRB A;  4YB6 A;  4FEB A;  4P1L A;  3EPE A;  3KBZ A;  1WOD A;  1LFH A;  2PFZ A;  4OEV A;  3HCQ A;  2PT2 A;  1FTL A;  4XKQ A;  3FBP A;  3OO9 A;  4OET A;  2Z8F A;  4G68 C;  4KI0 E;  3TYH A;  2HZL A;  1S9T A;  3H6U A;  4R9G A;  1GGG A;  1DTG A;  1Y20 A;  4XKN A;  4DCY A;  1SYI A;  4OXV A;  3TEP A;  3U8Q A;  3CSG A;  5I57 B;  1LGB C;  5T3J A;  4N4U A;  4GXA A;  4KCD A;  3OO8 A;  5IZ1 A;  1OLA A;  2V84 A;  3LBS A;  5JEI A;  1NUW A;  4I1D A;  3TMG A;  1A7L A;  4FJP A;  5IZ3 A;  4H45 A;  2JJK A;  3T0J A;  3E4R A;  3K6V A;  4H8J A;  3TOD A;  4OEU A;  4JBZ A;  2CZI A;  2VP1 A;  3GYY A;  4HCW A;  2Q8M A;  1HSL A;  5I2K B;  4AS5 A;  1DK4 A;  5CBR A;  2E1S A;  2DE2 A;  4ISU A;  3RLF E;  4AQ4 A;  1B0H A;  3C31 A;  2GRV A;  3TQW A;  3IOT A;  2THI A;  4H1X A;  3RPW A;  3MVY A;  4PBQ A;  3EKI A;  1N0T A;  1MQJ A;  3R7X A;  2Q89 A;  4M1V A;  4PFU A;  4RPO A;  3SEY A;  3H6W A;  2XHD A;  3T22 A;  1MH3 A;  1NUX A;  2HQ0 A;  3FXR A;  2E0S A;  1US5 A;  4FAJ A;  4P56 A;  5J1D A;  4O3B A;  3FAS A;  3MST A;  5ICQ A;  2F34 A;  3RYD A;  4GFR A;  3IOW A;  3K6X A;  1S50 A;  4H5G A;  1FQF A;  3O6I A;  1SVX B;  3QIM A;  3PPO A;  1B3L A;  2ABH A;  3FGS A;  1R1N A;  2VD2 A;  2CZK A;  3EHT A;  3O2A A;  2ZNS A;  4I9D A;  3TPA A;  4ZE8 A;  3M8U A;  1QVS A;  3SEV A;  1EZO A;  4TLL B;  4H0W A;  1YYZ A;  2QJE A;  4U21 A;  3KOS A;  4ZEK A;  2D5W A;  1FTM A;  3F11 A;  3MP1 A;  2FIE A;  4YKI A;  1NV2 A;  1H43 A;  5ITO A;  2Z8D A;  4YMB A;  1FPB A;  1VFE A;  3RNN A;  1YZ0 A;  1B9J A;  2REG A;  3PUY E;  3HV1 A;  3RPL B;  2PX1 A;  2VPO A;  3QUJ A;  5EHM A;  4AB5 A;  4R73 A;  4FED A;  1IME A;  2RIN A;  1ZTY A;  3E9X A;  3R6U A;  4ZS9 A;  4BDL A;  4LZ5 A;  2QVV A;  4Q5T A;  4GL8 A;  3R26 A;  3FV1 A;  1LFG A;  3IOV A;  1H44 A;  1O63 A;  5H8F A;  4PAI A;  4JWO A;  1UTH B;  3D4G A;  4P0I A;  5IM2 A;  3PGF A;  3OEM A;  1FQE A;  5F24 A;  4OAN A;  1JNF A;  5L9S A;  4GBV A;  3FIR A;  1K9Z A;  4YMA A;  3KZG A;  3E78 A;  2Q88 A;  3KJT A;  5ITP A;  5I2N A;  2B65 A;  2XXU A;  4GWU A;  4DI3 D;  4MLQ A;  4DXU A;  2QRY A;  1MQH A;  2BJJ X;  4MJO A;  3NOH A;  4GX3 A;  4EF2 A;  2QMW A;  1NH7 A;  1NH8 A;  1K9Y A;  1QGX A;  4DCX A;  1II5 A;  5FHM A;  3S9M C;  4M4G A;  3U72 A;  2XXP A;  3IFA A;  2H5Y A;  2HAV A;  3PUW E;  1MDP 1;  1NV5 A;  4N6P A;  4LAT A;  3CVG A;  4UA8 A;  5I58 A;  1H3D A;  1YPN A;  4OVR A;  4PFI A;  3TTN A;  1BTJ A;  1OVT A;  3T9U A;  1OIB A;  3MPK A;  4PCD A;  1SD3 A;  4X8R A;  3N26 A;  4GX4 A;  4QRZ A;  1NUY A;  4FBP A;  3FJM A;  4QHQ A;  3S2V A;  4RJZ A;  4NX1 A;  2DWH A;  5KCJ B;  3EQ1 A;  4OFL A;  2Z23 A;  4MCO A;  1DBZ A;  4F2O A;  3PPP A;  5EYF A;  4MNP A;  3SET A;  1LBB A;  3O97 A;  1FPE A;  1NI9 A;  3Q25 A;  1LBY A;  2I3V A;  3K2D A;  2DE3 A;  1NKX A;  4AS4 A;  4G8M A;  3DP6 A;  3BKI B;  3QYT A;  4OVT A;  4XKR A;  2DXR A;  4NF8 A;  1IMF A;  2FNC A;  1TXF A;  1MG1 A;  3ZSF A;  3LSF B;  3PUX E;  4E0X A;  4PAF A;  3K0V A;  3MBP A;  4F2Q A;  3ZS6 A;  3FVO A;  2W7Y A;  3W15 C;  3LC8 A;  4LQ2 A;  2G93 A;  2QL3 A;  3LUZ A; 
#chains in the Genus database with same CATH homology
 1B6H A;  4PQJ A;  1D9Y A;  2X26 A;  4BLA A;  4G8N A;  4GOT A;  1JEV A;  5IKB A;  2P0S A;  1RKM A;  2XX8 A;  2UVI A;  1H76 A;  1LLS A;  4DLD A;  3OEN A;  2H25 A;  2V93 A;  3C4M A;  4FOR A;  3OMB A;  1PB8 A;  4C1T A;  3LR1 A;  2XXX A;  3B7D A;  2Y7I A;  3VV5 A;  3U93 A;  5KZT A;  3QXM A;  3VVE A;  1ANF A;  1FQB A;  3ZKL A;  4DZ1 A;  2O69 A;  4GXS B;  4GWO A;  3MP8 A;  2XXW A;  4TOZ A;  4OFJ A;  5FHN A;  3KN3 A;  1ELJ A;  2H99 A;  4R6Y A;  3TCH A;  2ZYM A;  4OHN A;  1PB7 A;  4F39 A;  2V3U A;  3K1P A;  4WED A;  3N6T A;  1B5I A;  1FTK A;  2F36 A;  4Q0C A;  2OLB A;  2OK2 A;  3H3G A;  4MBP A;  1MPD A;  5H8N A;  5K2Y A;  5I59 B;  3VVF A;  1Y4T A;  1SYH A;  1POY 1;  1N3W A;  1MM6 A;  5AE4 A;  2O51 A;  5AA4 B;  5DVJ A;  3FUZ A;  4NTL A;  3RTW B;  4QF9 A;  1MY1 A;  3PUV E;  4RK2 A;  3FJG A;  2F78 A;  4ESW A;  3UGW A;  1Z7M E;  1NL5 A;  4EXL A;  2Y7R A;  1TFA A;  2F7C A;  2REJ A;  3ECR A;  4Z0I A;  3IB1 A;  2NXO A;  4ELR A;  3O6H A;  1DOT A;  3B6Q A;  3U1O A;  3OEK A;  3VXB A;  2DYX A;  4IO3 A;  3IAZ A;  3Q27 A;  3S9N C;  3IR1 A;  1OMP A;  4JSO A;  4NF4 B;  4RK9 A;  1SDX A;  1P1O A;  1BKA A;  3HST A;  1TFD A;  3MZB A;  4U2R A;  4OES A;  4ZEB A;  3CFL A;  5CMC A;  3N5L A;  4OEN A;  3IX1 A;  1IUD A;  1ZIU A;  4FE8 A;  5DVI A;  2VOZ A;  4JB7 A;  1M5C A;  3QSL A;  3W9W A;  4IO4 A;  4NWD A;  4RXL A;  5ISU A;  3A3C A;  2A5T B;  5B7D A;  1VR5 A;  1QUK A;  2Y7W A;  1FQD A;  1Y3N A;  5FTI A;  3FVN A;  2G29 A;  2UVJ A;  4QFP A;  3FJ7 A;  4ZEC A;  5I84 A;  5H8H B;  5CRY A;  3TAJ A;  2I49 A;  4PFY A;  2VGQ A;  3KBR A;  3PD8 A;  3IOR A;  1JW1 A;  2DQV A;  5DVF A;  1JW4 A;  4KD5 A;  1SI1 A;  3PPN A;  1PBQ A;  5M2V A;  4KCC A;  2XD2 A;  1B2H A;  1H45 A;  1M5D A;  1GV8 A;  4EDP A;  4KYE A;  4XIG Q;  1XHY A;  3N6U A;  4H5F A;  3IB0 A;  4H67 A;  1QUI A;  3IJX B;  5I2K A;  2OWS A;  5L9M A;  3VFJ A;  2DSF A;  5CI5 A;  2PYY A;  4POW A;  1Q1K A;  3K4U A;  2F6P A;  1GTK A;  4OTE A;  3MPL A;  2I0B A;  2DP8 A;  3MUQ A;  3RT6 B;  1LCF A;  2H9B A;  1B3H A;  3L6H A;  4PFT A;  2DXY A;  1SW1 A;  2QS2 A;  4GVO A;  4R9F A;  2HXW A;  4G4P A;  2FA7 A;  1MY0 A;  3PMV A;  4YU0 A;  3T93 B;  4YKJ A;  1FW0 A;  3I6V A;  4IGR A;  2QSX A;  2AL5 A;  2OBG A;  1IEJ A;  1DSN A;  1MXZ A;  3UA8 A;  4HW8 A;  5K2X A;  3TEL A;  5AA3 A;  4KQP A;  2GHA A;  4GF8 A;  3IB2 A;  2CZL A;  1POT A;  3KN8 A;  3I5O A;  3GBA A;  1URS A;  1I6A A;  4N13 A;  3RTF B;  1HSE A;  4R2B A;  1N76 A;  2ANJ A;  1PBP A;  3M3L A;  3PUZ E;  2QPQ A;  3JZJ A;  1P1N A;  3CR9 A;  1B52 A;  3DLN A;  4PET A;  2AL4 A;  2DWA A;  4Z7E A;  4E0W A;  2Y7K A;  1XOC A;  3C35 A;  2OZZ A;  1OQH A;  3C32 A;  3CFX A;  1FQA A;  1B5H A;  3MJN A;  3HHF A;  2HCA A;  4RY1 A;  5AA2 A;  4OER A;  3OXN A;  2KLF A;  4F22 A;  4R75 A;  3H6V A;  1YCJ A;  4ND9 A;  5IAI A;  4EXK A;  4JWY A;  3T9H B;  5A5X A;  3M3F A;  1I6Q A;  1IIW A;  1LFI A;  2OJT A;  3E13 X;  3H06 B;  1B1X A;  1B4Z A;  3K6U A;  2F7B A;  4POX A;  2HFB A;  4KYS A;  4OYV A;  3MZ1 A;  3KSJ A;  5JK4 A;  1XS5 A;  5CM6 A;  4DDD A;  2UVG A;  1UTB B;  4F19 A;  4DXB A;  3CIJ A;  1ZKB A;  1MM7 A;  1LAX A;  2R9J A;  4HS7 A;  3SES A;  1SW4 A;  2P2A A;  1IXH A;  1R6Z A;  2CMO A;  4IY5 A;  4ZDM A;  1R9Q A;  4NE4 A;  5H8F B;  5F7V A;  1SW2 A;  4FEC A;  5TP9 A;  2RC7 A;  2GFE A;  4F31 B;  2O6A A;  1ZU0 A;  3VE1 B;  4LUB A;  3PPQ A;  4G2Z A;  4ZEI A;  4IB2 A;  4BDQ A;  5DTB A;  1FQC A;  1PC3 A;  1OVB A;  2UXA A;  4MLV A;  2Q9T A;  1GR2 A;  1WDN A;  4ZE9 A;  5AA2 D;  2AIX A;  4HCY A;  1S7Y A;  1D4N A;  2I58 A;  4F18 A;  2PT1 A;  2D3I A;  3JV9 A;  4R6H A;  3S9E A;  1JET A;  3HO7 A;  3RQT A;  4JSD A;  1XVY A;  3TCF A;  3UOR A;  3IO4 A;  3VXC A;  1P99 A;  2RCB A;  4O3C A;  1EZ9 A;  5FHO A;  4JWX A;  4F1Y A;  2ZYK A;  5I58 B;  3H03 A;  2XXQ A;  4I8C A;  4YZZ A;  5DT6 A;  2R71 A;  4ELO A;  4YKK A;  3SKP A;  4NF5 B;  4X1D A;  3BFT A;  2RC9 A;  1JW5 A;  5DEX A;  1B7U A;  2OCU A;  3S9L C;  1URG A;  1OQG A;  2XXI A;  2F8D A;  4QSD A;  3MQ9 A;  2XX7 A;  1Y9U A;  1CE2 A;  2YPN A;  3TFL A;  2P1S A;  1A8F A;  3T66 A;  2B3B A;  1IIT A;  4QFN A;  4OFO A;  4NF6 A;  3GZG A;  2GHB A;  3OSR A;  3VVD A;  1CB6 A;  2O1L A;  4LQ5 A;  5HBC A;  2X7Q A;  4GLI A;  4NF8 B;  4R72 A;  1M5B A;  3VLU A;  4FAT A;  1B3G A;  4IO7 A;  1DTZ A;  2VHA A;  1AOV A;  1QKB A;  3OEL A;  5DYH A;  3BFU A;  4GL0 A;  3I3V A;  3G3H A;  3TTK A;  5JTY A;  1OLC A;  1B3E A;  1B32 A;  3EHS A;  5L8D A;  1B3F A;  3SEX A;  3H7M A;  1Z7N E;  3H4Z A;  2R6G E;  1J1N A;  5I56 A;  3U92 A;  5CMM A;  5CMB A;  5KDT A;  1XC1 A;  2GH9 A;  4LZ7 A;  3C36 A;  1URD A;  2QS3 A;  5H8Q A;  1RYO A;  1NNF A;  3DP4 A;  4YKP A;  3GBB A;  3MC2 A;  1HSJ A;  4Q30 B;  1LAF E;  4U1O A;  4DIG A;  4G68 A;  5BUU A;  4LA9 A;  1N7W A;  4F3G A;  5HM4 B;  1KWH A;  4X1B A;  2PVU A;  1B7Z A;  2DS9 A;  2QS4 A;  2Y7P A;  4U1Z A;  4ELP A;  1N84 A;  1AH5 A;  3DM0 A;  4XKP A;  2O7U A;  2V3Q A;  4IO5 A;  2XXV A;  4EQB A;  4EF1 A;  3KEI A;  3V5A A;  2NWJ A;  1A99 A;  5TPA A;  1MY4 A;  1LB9 A;  2ZXT A;  1IQ7 A;  1MDQ A;  4QFK A;  4LON B;  1N04 A;  3H6T A;  4GRK A;  1R9L A;  3AXF A;  4OMB A;  4ELQ A;  2PBW A;  2UYF A;  3HHG A;  3USD A;  2NOO A;  1MXW A;  4DE8 A;  2DVZ A;  2ZMB A;  1T0K A;  2XXH A;  2NUV A;  4ESX A;  3Q29 A;  1MXX A;  1ZJL A;  4JDF A;  4RYA A;  4R2F A;  4ECF A;  5I57 A;  4XXU A;  1A40 A;  4BDO A;  1JVX A;  3PPR A;  2Q8J A;  1XVX A;  3O29 A;  1A54 A;  4IO6 A;  1BIY A;  1NMU A;  4K3F A;  3SDF A;  3DEL B;  1JQF A;  2PMS A;  2ONR A;  2O68 A;  5EHS A;  4H65 A;  1IXC A;  2F7A A;  3K02 A;  1MS7 A;  3UK4 A;  1M5F A;  1B05 A;  3C33 A;  2DWJ A;  1TT1 A;  3SEW A;  2HAU A;  4EQ9 A;  1AL3 A;  2XX9 A;  3K1M A;  1D9V A;  2XXR A;  3PV0 E;  4KHZ E;  1FCK A;  4KR5 A;  3OSQ A;  3PMX A;  4GD5 A;  2Q2A A;  4IGT A;  4NMY A;  3FD3 A;  4G8H A;  3O66 A;  3FXQ A;  5CC2 A;  3CG1 A;  3OOA A;  1M5E A;  1DPE A;  3Q28 A;  3GXA A;  2XXT A;  3IOU A;  3KSX A;  3E3K A;  3TZA A;  5ICT A;  4NED A;  1SQY A;  2ZYN A;  1D3K A;  1AMF A;  2O84 X;  3FVK A;  4MH5 A;  1I6B A;  3BBR A;  4F3B A;  4RNS A;  1B5J A;  2IA4 A;  1PB9 A;  1PDA A;  5L9O A;  3CSB A;  5AA1 A;  1QUJ A;  4HTG A;  4YAH X;  1DMB A;  1SI0 A;  3P7I A;  3B6W A;  5B70 A;  3ILT B;  3MVZ A;  1MPC A;  2UVH A;  3G3F A;  3EHU A;  1P1Q A;  2V3T A;  1B46 A;  1ZBM A;  4THI A;  2F35 A;  1ATG A;  5LOM A;  2DVC A;  2I4B A;  3THI A;  5H8S A;  4WEP A;  3PU5 A;  2I3W A;  1MXU A;  3V89 B;  4XTC Q;  1VE4 A;  1DPP A;  2ALU A;  3K1N A;  1ZLQ A;  3RT8 A;  1UTH A;  3S4U A;  1Q35 A;  1Y3P A;  1B58 A;  3K01 A;  2Q2C A;  2YJP A;  1IXI A;  2A5S A;  1MQG A;  1GVC A;  4DXC A;  3WAE A;  1UIV A;  3MVX A;  1LB8 A;  3MP6 A;  1A8E A;  3G3J A;  1UTB A;  2UYE A;  1QJM A;  2F97 A;  1QUL A;  1SBP A;  2H4I A;  1RYX A;  1B7H A;  1XT8 A;  4OWD A;  4X9T A;  4ZEF A;  3L6G A;  3TTM A;  4U22 A;  1A55 A;  3CG3 A;  3LSL A;  3SER A;  4LVQ A;  1USY E;  3IJO B;  3VLV A;  1P1U A;  1USY H;  1VFD A;  4OQO A;  2I6E A;  4H8I A;  4F1U A;  3DP8 A;  3FVG A;  1B40 A;  1MXV A;  4LZ8 A;  5AA2 B;  4QSC A;  3WAF A;  1LAG E;  4YB5 A;  3K00 A;  2I48 A;  1UQW A;  3W9V A;  1JEU A;  5A5X B;  2Y84 A;  2LAO A;  3RUM A;  1ZMG A;  1UIU A;  4MFI A;  4BDM A;  1SW5 A;  2RC8 A;  5KCJ A;  5BWJ A;  3VDF A;  3IL1 B;  3TKD A;  3KG2 A;  2O1M A;  4PE5 B;  3T96 B;  4IO2 A;  4P11 A;  3K6W A;  1MPB A;  3G3K A;  3T9X B;  5I2N B;  1TWY A;  2ESN A;  3TTL A;  1NNT A;  4L17 A;  3MW0 A;  4C0R A;  3CFZ A;  4NF5 A;  3IO6 A;  4GIZ A;  2O7I A;  4I62 A;  4BDN A;  1PEB A;  1B4H A;  3A09 A;  4TQU Q;  3U94 A;  3N94 A;  1Y3Q A;  2DOJ A;  5TP9 B;  2X7P A;  5F1Q A;  4WXJ A;  2H98 A;  2VD3 A;  4U23 A;  4PFW A;  2RKM A;  4KYD A;  4U4S A;  4JXI A;  1NNP A;  3O28 A;  4X48 A;  2OWT A;  4C1U A;  1MQD A;  1L5T A;  4ZZE A;  3PD9 A;  5ELV A;  1NNK A;  2Z8E A;  3ODB A;  2B3F A;  4KFQ A;  1O64 A;  3VLW A;  2V25 A;  1WVJ A;  3M3K A;  3C34 A;  5TU0 A;  3FV2 A;  3RGY A;  3HN0 A;  1BP5 A;  1JVY A;  2F5X A;  3D4C A;  4ZZA A;  3UP9 A;  3KJ7 A;  1F9B A;  1FTJ A;  1MY3 A;  2ONS A;  3MZ9 A;  2XD3 A;  4F1V A;  1LBC A;  3FAT A;  1LAH E;  3GLB A;  4ZED A;  3ZKK A;  4H6D A;  4FIM A;  1NFT A;  4RPN A;  4U4X A;  3G3G A;  3G7W A;  5I59 A;  1EU8 A;  5FTH A;  3LUY A;  3HPI A;  4BDR A;  3A3U A;  5DEX B;  2M8C A;  2XXY A;  4TLM B;  5HPQ A;  4N07 A;  3RY3 A;  3OO6 A;  4EUO A;  5AA4 A;  3RN8 A;  3EN3 A;  3FXU A;  1N7X A;  3B6T A;  3O9P A;  2HEU A;  3V83 A;  1B0L A;  3KOT A;  4RA1 A;  3TDJ A;  2ZNT A;  4QFO A;  2IEE A;  4Q8R A;  4NWC A;  2NVU B;  4YIC A;  4YB7 A;  4NF6 B;  1IXG A;  4R74 A;  1MQI A;  4GQO A;  1MRP A;  3OO7 A;  2I4C A;  2Z22 A;  1VSO A;  1Y1M A;  2RF1 A;  4NF4 A;  4F29 A;  2ONK E;  2YLN A;  2I0C A;  3KGC A;  3UN6 A;  1B1H A;  5JTY B;  3QUF A;  2HZK A;  3KFM A;  3EF7 A;  3QAX A;  1IZ1 A;  3ONM A;  3O6G A;  1MXY A;  3FZV A;  3JYR A;  5I56 B;  1US4 A;  1FTO A;  4MF3 A;  5H8N B;  3TUS A;  2FYI A;  2A5T A;  4ONY A;  1Y4C A;  3PMW A;  2QS1 A;  2RCA A;  1LCT A;  2WKY A;  3MWB A;  3MVW A;  2D21 A;  5KDT B;  4LP2 B;  4KPT A;  1AIV A;  3Q26 A;  3G3I A;  3TQL A;  2AYS A;  1P1W A;  4WKM A;  5H8H A;  5H8Q B;  1EZP A;  4QSE A;  4PP0 A;  2F6G A;  4R6K A;  1QKA A;  3LSW A;  5CBS A;  4P0G A;  3T9V A;  4G68 B;  2ZNU A;  3LSX A;  3V8X B;  1BLF A;  3MAM A;  1I69 A;  5CMK A;  3TTR A;  4G77 A;  3SEU A;  4AB6 A;  2ZYO A;  1MH4 A;  4O3A A;  1MY2 A;  4IY6 A;  3QK6 A;  1LST A;  3CI8 A;  2DE4 A;  1Y1Z A;  4F3P A;  1O7T A;  1YTV A;  1EH3 A;  3TCG A;  3KN7 A;  4EQ7 A;  1YAE A;  4F3S A;  3IK6 B;  1B51 A;  3OD7 A;  4QFL A;  1N3X A;  3UIF A;  4UAC A;  3ILU B;  5TPA B;  1QW0 A;  4OZ9 A;  3C9H A;  2DWI A;  2QMX A;  4OVJ A;  3CRB A;  4YB6 A;  4FEB A;  3EPE A;  1WOD A;  1LFH A;  4OEV A;  3HCQ A;  2PT2 A;  1FTL A;  4XKQ A;  3OO9 A;  4OET A;  2Z8F A;  4G68 C;  4KI0 E;  3TYH A;  2HZL A;  1S9T A;  3H6U A;  4R9G A;  1GGG A;  1DTG A;  1Y20 A;  4XKN A;  4DCY A;  1SYI A;  4OXV A;  3TEP A;  3U8Q A;  3CSG A;  5I57 B;  1LGB C;  4GXA A;  4KCD A;  3OO8 A;  1OLA A;  2V84 A;  3LBS A;  5JEI A;  4I1D A;  3TMG A;  1A7L A;  4FJP A;  3E4R A;  3K6V A;  4H8J A;  3TOD A;  4OEU A;  4JBZ A;  2VP1 A;  4HCW A;  1HSL A;  5I2K B;  5CBR A;  2E1S A;  2DE2 A;  4ISU A;  3RLF E;  4AQ4 A;  1B0H A;  3C31 A;  2GRV A;  3TQW A;  3IOT A;  2THI A;  4H1X A;  3RPW A;  3MVY A;  1N0T A;  1MQJ A;  3R7X A;  2Q89 A;  4M1V A;  4PFU A;  4RPO A;  3SEY A;  3H6W A;  2XHD A;  3T22 A;  1MH3 A;  2HQ0 A;  3FXR A;  2E0S A;  1US5 A;  4FAJ A;  5J1D A;  4O3B A;  3FAS A;  5ICQ A;  2F34 A;  4GFR A;  3IOW A;  3K6X A;  1S50 A;  1FQF A;  4H5G A;  3O6I A;  1SVX B;  3QIM A;  3PPO A;  1B3L A;  2ABH A;  3FGS A;  1R1N A;  2VD2 A;  3EHT A;  3O2A A;  2ZNS A;  4I9D A;  3TPA A;  4ZE8 A;  3M8U A;  1QVS A;  3SEV A;  1EZO A;  4TLL B;  4H0W A;  2QJE A;  4U21 A;  3KOS A;  4ZEK A;  2D5W A;  1FTM A;  3F11 A;  3MP1 A;  4YKI A;  1H43 A;  5ITO A;  2Z8D A;  4YMB A;  1VFE A;  3RNN A;  2REG A;  1B9J A;  3PUY E;  3HV1 A;  2PX1 A;  3QUJ A;  5EHM A;  4AB5 A;  4R73 A;  4FED A;  2RIN A;  1ZTY A;  3E9X A;  3R6U A;  4ZS9 A;  4BDL A;  4LZ5 A;  4Q5T A;  4GL8 A;  3R26 A;  3FV1 A;  1LFG A;  3IOV A;  1H44 A;  1O63 A;  5H8F A;  4JWO A;  1UTH B;  3D4G A;  4P0I A;  3PGF A;  3OEM A;  1FQE A;  1JNF A;  5L9S A;  3FIR A;  4YMA A;  3KZG A;  2Q88 A;  3KJT A;  5ITP A;  5I2N A;  2B65 A;  2XXU A;  4MLQ A;  4DXU A;  2QRY A;  1MQH A;  2BJJ X;  4EF2 A;  2QMW A;  1NH7 A;  1NH8 A;  4DCX A;  1II5 A;  5FHM A;  3S9M C;  4M4G A;  3U72 A;  2XXP A;  2H5Y A;  2HAV A;  3PUW E;  1MDP 1;  4N6P A;  4LAT A;  3CVG A;  4UA8 A;  5I58 A;  1H3D A;  1YPN A;  3TTN A;  1BTJ A;  1OVT A;  3T9U A;  1OIB A;  3MPK A;  1SD3 A;  3N26 A;  4QRZ A;  3FJM A;  4QHQ A;  3S2V A;  4RJZ A;  2DWH A;  5KCJ B;  3EQ1 A;  4OFL A;  2Z23 A;  4F2O A;  3PPP A;  5EYF A;  3SET A;  1LBB A;  3O97 A;  3Q25 A;  2I3V A;  3K2D A;  2DE3 A;  1NKX A;  4G8M A;  3DP6 A;  3BKI B;  3QYT A;  4XKR A;  2DXR A;  4NF8 A;  2FNC A;  1TXF A;  1MG1 A;  3ZSF A;  3LSF B;  3PUX E;  4E0X A;  3K0V A;  3MBP A;  4F2Q A;  3ZS6 A;  3FVO A;  2W7Y A;  3W15 C;  3LC8 A;  4LQ2 A;  2G93 A;  2QL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...