4G6AC

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic region 412-423 bound to the broadly neutralizing antibody ap33
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
QLLEQSGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2 peptide
publication title Structure of Hepatitis C Virus Envelope Glycoprotein E2 Antigenic Site 412 to 423 in Complex with Antibody AP33.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g6aC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g6aC01
1VGKA 2EDJA 1JL8A 2LAGB 2Z8VC 1JF5A 2PKDA 4K2UL 3VXUA 4U7SA 1WFOA 1OLLA 3JZ7A 1H15B 5E2VL 1BREA 3MOBH 5EUKA 5TFSL 5ETUA 2BVOA 1J0ZA 4YXHL 5EA0L 2CDGB 5I71B 2D9QB 5H2BB 2YRLA 2FLRT 4OFKA 4JZOA 4RZCA 4F7CB 1AO7A 4JFXA 5E2UL 5C1MB 1J10A 2BNQE 1QBBA 4FQJL 3S4SG 4JZNA 4JPWH 2H1PL 2E8YA 3PV7A 3C6SA 1G1YA 5FXCH 4UV7H 2ENYA 4OLXH 5ESAA 2GTWB 3NIFF 1PYWA 1Q9LA 3AB0B 4BK5A 2EDLA 5IF0A 5KSUB 4TVPL 4LKXA 2EEAA 3S98A 4GG6F 5E6IB 4LLMB 2XWJB 5D7KE 4KJPC 3SKJL 1JNLL 2KKQA 4UTBL 2XZQL 4MSWB 1F8TH 1MHHA 5A43C 4MAYB 4NQDD 4LNRA 1IT9L 4LAQL 4K9EC 2FBJH 2YK1L 4CMMB 5IBLD 2IG2H 2O5YL 2WZPD 1XIWB 3PQYA 2Q86B 3UJIL 1H8OA 4RQQA 4BH7B 2XPGB 2VXUH 5I8KL 5MENE 3K3QA 3Q2CA 3PWNA 5E8NA 4C57C 2MKWA 4M03A 4PJIF 4TULL 2BZDA 5AYUH 1FCGA 1U3HB 2NY4B 4LKCA 4JPKL 1Y6NR 2PNDA 1TDQA 3IDJB 1YQVL 2A83A 1D5BA 3JTTA 3FQTB 4QHUB 2AJUL 3MRBB 3IYLW 3F7VA 5HJ3A 1UWXK 4M4RA 4NN5B 4FMKA 4LSRL 3PL6B 2MPAH 2MKLC 1W0YT 4ZPVB 3QDMA 1VFMA 1HWHB 1NMBL 3GGWB 4AEIL 1U58A 2XN9A 4RDQG 2KQMA 5GS0L 4QRSB 1IC7L 5KSAA 4YPGA 1FZOA 5IBTL 2P5WB 3BI9X 5E8PA 3HZMA 4R4FH 5FF6A 5KJRH 3VWJC 4U1GB 1MREL 5A2FA 3MJ9L 1UQSA 1YPZE 5D7IF 2DJ4A 4GG8B 4KK9C 1B2WL 1KCLA 3FFCD 1VFBA 4RWYH 5DVOA 5E9DA 5FCSH 2BSSB 4APQD 5I17A 1CFTB 3TFKD 4NRZA 4E41A 1A4KA 3LEVL 1MY7A 1CF8L 4ELMB 5BCAA 1NBYA 2I9TA 2I9LA 2Z31B 3GBMH 3HC4H 4Z8FL 1TFHA 5JORB 2UYLB 3LQZA 4OLVL 3FO0H 3ARRA 4XGZA 1JN6B 4HJJH 3V8CA 3EYUL 3BPLB 4OD3H 5SWSD 1IGFL 3BWUC 4PJ5B 2EXWC 5DSCB 3WN5A 5MP6L 1YN7A 4D3CH 2IALA 1DANU 3F5WB 5KSBA 2WBJC 2A6IB 4K55A 4N68A 2YBRB 2OLDA 1WBYB 2VDOL 3GSXB 5L6YL 2VKWA 4TN9A 4Y5XC 3F7YB 4Z76A 4HKXA 2OP4H 4AZ8A 3NH7L 1UENA 2WIIA 5I1AB 2Q76B 5K93A 1RURH 2WUBL 1MIEH 2B4CH 2VXSL 4WO4A 5JZ7D 1KC5H 3E6FB 4MA7L 3OR7B 1DQDH 4ONGL 3QNYA 3BGMA 1CK0L 4U3XA 5GISH 1JV5B 3WO4C 2FJFB 5DWUH 1IGIL 4G9FA 4NKDB 5GJTL 1YDPA 4JRYE 3GSNL 1F4AA 1RVFL 3MRLB 1MRFH 2ZCHL 5BQ7A 3NA4A 1I9EA 1KPUA 3U0TA 3DUUB 4HIJB 3OKKA 1A5FL 4XXDA 4GMTH 1RMFH 1G6VK 4U6TA 2AVGA 3G6DL 1LHZA 4H0GA 5CGYC 4YBQC 2WQ8A 2Q8BL 3PWPE 3S96A 4ZQKB 4PBXA 2AGJL 2YKLH 2QHRL 4OF8A 1I1AA 1FSKB 4R0LB 3CLFH 3DYPA 5GGRB 1I9RL 5AAWA 1AP2B 4Z7WA 5L2KA 5IHZA 3MJGX 3QEQD 5CJOL 4AEHH 2VLKB 3KLHC 4YDLB 3RWDA 1E4XI 4ETYA 3PGFH 4KROD 1UEYA 3V6FB 1WFTA 4S1DD 2P24A 1X7QB 2E7MA 1FNGA 1G7LB 3MUGA 5GS1B 4U05A 4LLAA 5HI3C 1PQZA 5D7LD 1MAKA 3B9KA 2AXGB 1PSKL 3GUTA 3RTQD 5I2IB 2DL9A 2J8UA 1OGAA 5IG7B 1FBIH 4N8VG 5GIRB 2OK0L 1G9EA 2R0ZH 3LOWA 4ZUSA 2IC2A 1QR1A 3GMLB 3AM8A 4OLEA 5IROA 3P4MA 4NKIH 4NQCE 3WFZA 5ADPH 5GGTL 4F58H 4NO2B 2HVJA 1V5JA 1FH5H 3U7YH 4NRYA 4EOWL 1LDSA 1IC1A 3KHQA 4HFUH 3Q3GB 1NCWH 1PJ9A 3C87A 5TJWK 1R3JA 3CMOL 4WUUE 5DHXB 3ARDB 4EN3D 2DMBA 3O0RH 3ARBD 3V5HA 1UM4L 3RFZC 1GSMA 2DBLH 1HKLL 4BSWA 2P8MA 1F4YH 3SDAC 1U3JA 3VXQB 4GW4B 4Z7VE 1KPVA 2Q7YB 2NY6C 3PGDA 4MJ2A 3QCTH 1ITBB 3TJHD 3L3HA 1M7DA 4U0RC 5FGSA 3MGOB 5IV2B 1MUJB 1T1XA 3U79A 5FYKH 3ALWA 4F7TB 2GJZA 4JY5H 3UPCA 5DJDB 1EHNA 4FQIL 3IJSB 3TLRA 4HH9A 3GIVA 2W07A 4HGWB 3SGJA 4KK8C 1G7HB 5DHYB 5D6DA 1PVHA 2AW2A 2IWGA 5C09A 4OGXL 3TC9A 2B7DT 3K4ZA 2JJVA 5E2WL 5JXEC 4OGYH 2IAND 3G04A 4JO2H 1MCBA 4OI8A 4KV5F 3G5XB 3MLSH 1JJUA 3AREC 5EN2A 2HG5B 4U6XB 2GUOA 3GJFB 3IDUA 5IJVB 1A6AB 3VFGL 2GI7A 1W8OA 1JF1B 3OHXA 4KI5D 3T4AA 1HHKB 4HWZB 4HIEB 1YEFH 3RWHA 4MXQD 3WNOA 4ENED 1U6AH 2GTWA 1I7ZA 3NIGE 4ZFGL 4PGCB 4J4PA 1R5WA 1P84K 4OCRH 4FQCH 4U6VL 3FO9B 4Y4HB 3STZB 5I73C 5E6IA 1PKQE 2L0DA 1YEJH 5FDWB 1J8HE 1MJJA 3WDHA 4P9HL 4WWKC 5EU6E 1XH3A 5KSBF 2YD2A 4HAGA 1HH9B 4N1HB 4J2XA 3WHXB 3O6MH 5F1IA 2YRPA 1JFQL 4S1RH 1XIWA 4JB9L 5DD0L 5D96B 4L3ED 3QXTA 4HT1H 4BH7A 4Y2DD 4NGHH 2ADGA 5B38B 2PF6A 3WXVL 5CJQL 4FQXB 4EI5D 4XCNB 2BY0A 1IKNA 4LVHB 1U8OB 4Y4KC 2R4RH 1FN4B 1SYSA 3B43A 3OGOE 3BP5B 3CZFB 3H0TB 4MNQA 4QF1B 1IEBB 4HKBA 3G6JB 2NY3D 2BMKA 3GKWH 4XVJL 1LVEA 4X0KB 5CJ8A 3TO4B 5IJKC 1PY9A 5F89B 4QHUA 1T1ZA 3MRBA 4UT7L 2XTJD 2D2OA 3CCHB 3QQ3B 5CEZL 4FFZH 4HWBH 2CUMA 1FVDB 2R0LL 1EFQA 1MNUL 3BE1L 5TH2B 5EOQH 3TT1H 4PJXB 4KUCD 2BCKB 4YPJA 3SDDC 1MJUL 4KXZH 5SX4H 1BLNB 2HKFH 4M6OH 1LGVA 3LIZH 4OM0H 4LVEA 2P48B 3LHPH 1LO3L 2I27N 5A3ID 4X4MA 3DV6B 4LQFL 4EBQL 5F1SA 4KJYA 5T33L 1A64A 2IAMB 1TENA 2ZUWA 2PYEB 4XNZB 3UJJL 3VG9C 5CGMA 4PBVC 1I3RB 1GCFA 3DUSB 3WFEL 5HGAB 4MA8L 5FYJU 1EX0A 5D1XC 2FWOB 4GLRH 4D0BA 4NNYA 3UYPA 4LHJB 1CS6A 5BRZB 1V7NL 3VFVA 1DQJA 4BUGA 4XMPL 2R0WH 2J4WL 2R2BA 5ERWA 4ZSOE 1P6FA 3RVVD 4OSUL 3M45A 3UO1L 3MV8D 1JN6A 2HTKD 5FK9B 1NBZA 4DZ8B 2J8UF 1U95A 4PLKC 3ZTJH 4MAUL 4Y0GA 1J0IA 2APWA 4Z18A 3WJLA 1WQVT 3VXSE 1XGYL 4WI9A 1YEHL 3W0WA 3TN0C 3VGGA 1KJ3H 5ISZA 1F3DH 3W11D 2APBA 3AY4A 5EIVA 3ECBB 1AGBB 2BJMH 5D4QA 4Z95L 2Y36L 2BSED 1FO0A 1VB9A 5SWZE 4X7CC 5KSVB 2CJUL 1QA9B 4X6FB 3R1GH 4OLWH 5E1AB 1L7IL 4M8VA 2HJLB 1JPST 1HINL 4NP4L 4R90H 2WLZA 4YE4L 1IILE 5F7EH 2DLTA 2HJFB 2ZCLL 4JREB 2NY5L 4W6YB 4XCFL 3MRPB 5T1KD 2FJFA 2VLRB 1ZOXA 2J88H 4L4TD 1NBVL 3L9RB 1TNNA 4NRXA 2HVKA 4K2UH 3WV0A 3MRLA 4XBGB 4M93C 3U0WH 2Y5EA 3P9MB 4IDJL 5E2VH 4PV9B 3H9ZA 4HIJA 1EFXB 3IETB 5TFSH 4YXHH 5EA0H 2IQAB 3HE7B 1P7QB 4PYHA 3MRCA 4CVXB 5L88L 4U2YA 1DBML 4UTAL 2W9DL 5E2UH 3W5MA 2P8PA 3VMNA 5E70A 5F9DC 4JLRB 1FAKT 1ZWIB 4FQJH 2W65B 3IU3A 1PBYA 2H1PH 1Z9SA 4DKFL 4ZNCD 4LEOA 1M05A 2X4TA 4W4OC 2ZP0T 2V5YA 1R5IA 4TVPH 4WNQB 3O4OB 4XH2B 4WU5A 2ZOLA 1QVOB 1EH9A 4QRQA 2ZG2A 1CU4H 3HC3L 3SKJH 4UTBH 2XZQH 5E1HB 2PW2B 5FUOL 3UBXG 4I2XA 4NC0B 1OWRM 1QTYT 3SJVB 4BQBA 1IT9H 4QXGL 2HAZA 4LAQH 2LQRA 4LMQE 2YK1H 2VAAA 2O5YH 4QOKA 4PRAB 2V6HA 5IW3A 32C2B 3BZEB 3UJIH 5INCA 4OIAA 2LTQC 4CDGC 1A6UL 5H94A 3ZSTA 2AXGA 3GMMA 4DAGL 3O11B 4H20L 5I2IA 1K2DA 2YZ1A 3L3JB 3GSRA 4TULH 4M8QA 4L8CB 1BD2B 2P43B 4JPKH 4HS6A 5EWIL 5T1MB 4U6YB 4FQ2L 2DLFH 1YQVH 4C4KO 5IFAL 1JZ5A 4JFFA 5EZOL 2AJUH 1IC4L 1N26A 3M1BB 3SGKC 3I6LD 1EIBA 1H3XA 3OMZA 4QRPE 1WGOA 5DEGB 4LP4A 3VDBA 3QO0A 1S78D 1YN6B 3INUL 1D6VL 4HUXA 4LSRH 3IGAA 1NMBH 4AEIH 3GKZA 5HI5D 4HUVB 5EZLB 3MFFB 5I8EB 1CE6A 4MX7A 5DGRA 2J5LC 1AXSA 1G0YR 3DGGA 4UB0L 2AI0L 5GS0H 1T04B 1IC7H 1F4HA 1S9XB 5IBTH 3DGCR 2VLJD 3LKRB 1FAIL 1MCKA 3E8UL 4KKAD 1DZBA 1N7ML 1TJGL 4FZEL 2JK5B 4P2OB 2BRRL 1MREH 1TITA 3MJ9H 5DJ2A 4FQLH 3QI9B 3MGOA 4NUGH 1U8IB 1MUJA 4FG6D 4X6CE 1B2WH 2KPNA 1CTNA 1CICC 1NCAL 3PXJA 3VFMA 3EDFA 4YX2L 4JRXA 1R3KB 4QHNB 1A7BA 3LEVH 1CF8H 3SE3A 2GJ6D 4E0RB 5CBEA 4TUKL 4B50A 4Z8FH 1CGVA 2F54D 4UU9B 5DD5L 4OLVH 2IPUG 2R0KL 1JGDB 3QJHA 5D2NC 3QZWB 1XGTB 4ZO7A 3F7RA 1J11A 3EYUH 3JWOL 5HYJD 1S5HA 3AVEA 3T1FB 1IGFH 1IAKA 4APQC 5MP6H 3SBWA 4JFDE 1ZT1A 4KVNL 5DYOA 2FYYA 4WHYH 3RHWK 4NBZB 3QYCA 3VWJB 3E6HA 2CRIA 3I3DA 5IBUG 3PWPB 2RGSA 2EDKA 4XZUA 2VDOH 5L6YH 5ICYB 1CGYA 5HYQB 3KPRA 5DJ0B 1LO4L 2YPVL 1TLKA 1OT2A 5FYLL 4PRPD 5J0BA 3FQNB 3VRLF 3B9AA 3NH7H 1C5BL 4U2ZA 4NN7C 2WUBH 4OKVA 2I24N 1OTSC 2VXSH 1T0PB 3HAEB 4MA7H 1BJ1H 5E7BA 3ZTJG 4ONGH 4Y19E 2CLVA 1UJTA 1CK0H 2NPLX 3FT4A 5F9WC 1IGIH 1HDMA 5GJTH 2G9HB 1YY8A 4QYOB 3GSNH 1RVFH 2ZCHH 4F33B 3MA7A 5B4MC 4OZFG 1A5FH 2H6PB 2WBJB 1OAXL 4HUNB 4LCUB 1G7PA 3H0TA 3G6DH 4QF1A 3LEYL 3O3AA 4DUVA 1WF5A 1IC5L 3TO4A 3AGVA 2Q8BH 5L9DL 3BWAA 2VDRL 2AJVL 1MFAL 5D1ZD 3QIBC 4Y5XB 2AGJH 3CH1B 2QHRH 1N6VA 3DWTA 2O26U 1QSEB 1FGVL 4PGBA 4GRLA 2DI8A 5C8JB 1UB6A 1I9RH 3STLB 1OW0C 3ARVA 1A4JB 2P8LB 4QCIA 1NCBH 3HTLX 4NKQB 3H9SB 3WO4B 3C60D 2AK4D 5MERA 3IAQA 4WHCA 5CJOH 3D25B 1RHHA 4I0KA 3P9LB 3WFHA 1KTDB 5IK3A 3MV7E 3FT3B 1R5VA 3OX8B 3A6OA 3QUYA 1ZS8A 2RFXB 3ZO0A 3C8KB 4JQVA 4KGJA 4NZJA 4NQEA 1RZGA 2C4FT 3GNML 2V2TA 3G5VB 1JRHI 4G6FD 1PSKH 1WBZA 2J6EL 4L8BB 1NMAL 1J88A 3BKML 5KZCD 1W72A 2F9BT 4KROC 1WWCA 5GGTH 3GM8A 3UZEA 2ADIA 3TH3T 1BPVA 3T8XB 3MRDB 4EOWH 2A74A 1CXEA 2W9EL 3UP1A 1GOGA 1U8QA 1UVQB 2M8XA 4ZUWB 4K8RC 5FK9A 5EOCJ 5C07B 2FHCA 4XBPB 1BF8A 3GK8L 3CMOH 4M7KL 4YIQA 1X5IA 1VKXB 4LF3A 3WXWL 4F57L 1QBAA 4FXKB 1UM4H 4XCYB 3MV9E 1KB5B 3CDYA 4ZUVB 1HKLH 1MRCL 5K9OA 3B83A 1K4CA 3OSKA 2OL3L 1T5WA 5DJAB 3SEPA 3D69B 2JCCE 3DX8A 2P45B 1QLFA 3S5LG 4WFEE 3WBDA 4H5SA 4P2CG 1ZHKB 5F9JB 1SEBB 3KLAB 4MQ7B 4EN3C 1IM9D 3ARBC 4OLYL 1R3LB 3TVMA 5GGSA 3SKOA 2HJFA 4BA8A 2A2QT 5FYKU 4FQIH 3HR5B 1NQBA 4QRRB 4C56E 3S9DB 1KN2L 2VLRA 4D0CA 4PRIE 5C0BD 5KVGL 2UWEA 2CLZA 3GMRA 1JWUB 3K2MC 4NHUB 4YBLC 4PJBE 2VDPL 1NFDA 4P2QD 4G5ZL 2DI7A 2ICWB 2JJSA 3MRQA 3TBSB 1KB9K 1NL0L 4OGXH 5GS3A 5E2WH 3LS4L 3UDWA 3LEXB 1HSBA 4V1DD 1WICA 4PJAB 4UOJA 2VYRE 4V2CB 4NQTA 1KF9B 4CVXA 4K7FA 1OGTA 4FTVB 3JVGA 5EU7E 2YA0A 4NSKB 1AXIB 1ZWIA 4JFED 3VFGH 3C5ZD 1Q0XL 1MFNA 2NY6B 1MLCB 2DQUL 2W1NA 5JHDD 3ULVL 2Y5TB 1NCNA 5I1HH 4HFWA 5EFIB 4U0RB 3G5ZA 4ZFGH 5FKAB 3U4AA 4WEBL 1NC4D 1E28A 4U6VH 5GRYA 3MROB 3BIKB 1QVOA 1AY1H 4YHIB 2EC9T 3SQOL 2APTA 1Z5LA 4RMVA 1EO5A 2JJWA 4XP1L 1V3LA 1CFQA 4BFGA 4P9HH 2X1PA 4DZBB 4L9LA 4KI5C 4Q6IB 2VLME 4PLNC 3DPBA 4DCQB 1ZLVK 4MXQC 4ENEC 1HK6A 1YJDC 3TESA 4ZXBC 1JFQH 2Y7QB 4WHYG 1CD9B 4JG1L 5DD0H 3BZEA 1JHKH 5KOMC 5J1AA 3AREB 4ODWA 4XPHL 1ZA6B 4NQVA 1BQSA 2VISB 4JDVA 3WXVH 5CJQH 1BZ9B 4L1HA 2VWEE 4PS4L 5DZLA 4L8CA 4PRNA 1BJ8A 5GSRA 3BX7C 2ITDA 5T1MA 4NO3B 4CADB 3KYNB 5C0JB 1I7TA 4O02H 2HT4C 3OGCB 3O45B 3RBGA 1IM3B 4XVJH 2CKBB 4Q2ZA 3NFNA 4OT1L 4WI2A 5C0EB 2BVQB 1J1XH 4UT7H 4HUKB 5CEZH 4LLUB 4ZSOB 4WWKB 2R0LH 1MNUH 3BE1H 5JW4R 1ZEAL 3L3OB 2BNUB 4G7VL 4HZLA 2XI9A 2C1PA 3MXWL 3SGEH 1VFAA 2ZUVA 1W0WB 3GSQB 4LP5A 1MJUH 2AERT 5C0IB 1EHAA 3JSSA 5TDPB 1NUGA 2YUVA 5EZLA 4XVSL 5I8EA 1JNHB 4U1JB 1NANH 2NR6C 1KNOB 1QLRB 1LO3H 1KOAA 2YHGA 5JNYB 1IAII 1YMMD 1I9IH 3NACL 4LQFH 4EBQH 2XTJC 2EE2A 2HWZL 4M9OA 4Q97A 4AYFA 1FZKB 5T33H 2H9GB 4LBEB 3UJJH 2D0FA 3WFEH 4MA8H 2VZSA 5ALCL 1BBJA 5HDBF 3W82A 4OAWA 4HUWA 4AT6B 3TCLB 1QP1A 4LLWB 3KPSB 3BD4A 5F88B 2ADFL 1V7NH 3BUYB 5CLWA 2QADD 3UTZB 3SDDB 4XMPH 4W81A 2J4WH 1T6WA 5I9QC 1PZUB 1S7TB 4OSUH 5GZOD 2H26B 3UO1H 2X6MA 3LV3A 3ROOA 1NFIA 4K3EL 5CJ5A 4QNPE 1JGDA 1F3DJ 3DBXB 1TVBB 2YD4A 4RAHA 1BVKA 4HPYL 5CD3A 2VB5A 2DTML 3OKLB 3QDJA 4MAUH 1JZ4A 5F1OB 1V3KA 2DJSA 3EO1A 3WIHA 4PY7A 1XGYH 1YEHH 4KRLB 4I0CC 3VG9B 3DYOA 1KJMB 3RVVC 1G6RB 3E2HC 5LXGL 5AWNL 3EOBA 4Z95H 2Y36H 2IADB 5HYQA 4I3RL 2HTKC 2CJUH 5F7DA 1L7IH 3FQNA 5DURB 1HINH 4BSVA 2VDML 2XA8L 4YE4H 4PJHE 3LKOB 4RGND 2ZCLH 3MJ6A 2NY5H 3P77A 2YXMA 4XCFH 2OR8A 1OQXA 1G9NL 2COQA 3HMWH 3RZCD 5DRXB 1TVHB 1T20B 4YH6A 1NBVH 4QEGA 5CJXC 1QSZA 4NQXA 3GJEA 3CFDB 4F33A 4IDJH 3D3VA 3FL7A 4JANA 3ILPA 2VXVL 3REWB 4TSAL 1NUNB 3HLAB 2VNCA 3MYJA 2V17H 3C5SA 3BH9B 5L88H 2G60L 2OR9L 3QA3A 4UTAH 2W9DH 5K59E 5D1QB 4JHZA 1R24A 2UWEF 4KK6D 5DC4B 3UZQA 4IRSC 1FE8L 5FYJE 4O58L 1NFDF 4DKFH 1OAYL 2XY1A 4P3CH 1YEIL 2BNRA 4A6YA 1A9EA 4N8PA 4XMLL 1EEZA 3T3PF 4QRPB 5C8JA 4HKZB 5D7JD 3PNWB 1C16A 5CSZA 1BIIA 3MRHB 3TIDB 2HFTA 5IM7A 1NCDL 3EYOA 2AS5M 1N59B 4XPGL 3HC3H 2CIIB 1T83A 3DURA 4PJ8A 1MI5D 5FUOH 1KTDA 3PDDA 3FT3A 3OX8A 4DW2L 3TYFA 1EHLL 4M93B 3OAYH 3FOLA 1N3NA 1KJ2B 1O7VA 3HG1E 3MRGA 3NZ8B 1RY7B 4QXGH 2XYCA 1MCPL 1QQDA 2AJZB 1MCOL 3HS0B 3FQRB 4K9EL 1AD9A 3D85B 2E3VA 1A6UH 5DD3L 43C9A 1MFEL 4DAGH 4H20H 3QFJE 1DSFL 1YEGL 5HHVL 4DVBA 4MJID 5DFVD 1ND0B 4IRZL 1JUFB 5EWIH 5FO9B 1H3WM 2X2YA 4FQ2H 1IGYA 2JIXA 3OJDB 4M5ZL 3FB6B 5IFAH 2EKSA 3K4DA 2R29L 5EZOH 1ED3A 3D18B 1HQ4B 3T8XA 3K8LA 1IC4H 1UVQA 2Q3AA 4J8RB 5EBLB 4MNGA 5BJTB 1JHLL 4KKCD 3QCUL 1W8NA 2XOTA 4U7MA 4XBPA 4G6AD 5DJ6A 1NMCB 5BS0E 2F53D 4NKMA 3INUH 1D6VH 1M1SA 2EE9A 1ODAA 4Z7QF 4UILL 4FXKA 1CXLA 5HYIA 2ARJB 1B6DA 3DMMD 3QNZA 1U91B 4ZO9A 4UB0H 2AI0H 1NSNL 3BD3A 5GGVY 2FGWL 1FQ9C 5DDHB 1FAIH 3CSGA 2B1HL 3ZE1F 3LKPB 4RFEB 5T3XD 3E8UH 1N7MH 1S7SB 1MHCA 1TJGH 3BP4A 4Y16D 5F9JA 4FZEH 3QUKB 2BRRH 2X7LA 3F65A 4NQDB 4PRBB 1BX2B 1ZGLP 3VMPA 2FECI 1NC2A 5F21B 4JFOA 1I3VA 3HR5A 4YEFA 4S1QL 1C5DB 1NCAH 5FCUL 3VXUD 4ODUA 4NYLA 4K07A 3H8NA 1I1RA 4HGKC 3WFDL 1ZHLA 4BZYA 4LCCA 3ULUC 4QY8A 4TUKH 3LEXA 1AO7D 5DD5H 2R0KH 2J5LB 2DIAA 3BN3B 5D2LB 2ATPA 3HI1A 3W39B 2QQNL 4XMKH 3T0ED 4EEEA 4O2CB 4MNHB 5DVNA 4KVNH 5HHMD 5DUBB 1MLCA 4X7EC 3C9NA 3X12A 2SEBB 2VDLL 4U1HB 3WIFA 3VWKA 3ZDXE 4O4YL 4X9HA 1N2RB 5CP3A 3MUHL 3LMJH 1CICB 1LO4H 2YPVH 5C0CE 1KJVB 3I6KB 5FYLH 2VR4A 2GSIB 3O6FA 1C5BH 4DZBA 4KKLD 3L95B 4Q6IA 5EO9B 4KMLB 4F3FA 1BF2A 3NIDF 2BERA 4OLZL 2Q6WA 1NDGB 4N5ED 4OCNC 2EIZB 3GMPB 2X4OB 4HMEA 3VDAA 3BKJL 3FQXB 4OV5A 5D2NB 3UTSE 3PP3H 1XF4A 4YGVB 1D9KC 4APQB 1OARL 4KMQA 5GXBB 3RVTD 2MCG1 1BZ9A 1QACA 4LPTA 2AEIT 4XB8A 5AZEL 3X3GH 4F37K 1NJ9B 3MMEA 3O2DL 1OAXH 1XFPA 3KS0H 2NX5D 3DTXA 4ZOCA 1QRNA 2F5AL 3LEYH 4QXTB 4KDTC 1IC5H 4FZ8L 4OZIB 5L9DH 1CGUA 2VDRH 3CIQA 1MFAH 2Q3ZA 3LKQB 4YXLL 4LRNL 1CTOA 2CPCA 5ESVA 5SWSB 3QDMD 4X5WA 1P4IL 4JM2C 2BOBB 3PWVB 1OOAA 1FGVH 2I25N 3NTCL 4N8CL 1T21A 5BO1L 4PGEA 3LAFA 5HPMB 5KSAD 1NLBL 4AL8L 4PJCE 3AS2A 3QPXL 3VH8B 5F9WB 3HI6L 3ULUE 4GO6B 4JGUA 2YS4A 2KQNA 1AXTL 1KPRB 2E7LA 4PJFE 5D70L 2ZG3A 3HNTL 4L29A 4R4NC 2F19L 2OTUA 5L0QC 1S9VB 2LAAA 3QQ4A 3B9VA 1KB5L 4P57B 5E9DD 3N50A 4PTUA 4IIQB 5KAQF 1T80A 2V2XA 3GNMH 4ORGA 2EXYC 1C12B 1HOCB 2DF3A 2J6EH 4OUUB 3VRIB 1NMAH 3BKMH 3QIBB 1I4FB 1XF3A 3TZVD 3KPSA 4MWFA 3OG4B 5EUOA 4ZFOA 4ZOBA 1JWSA 5JPMB 4JFQB 1T7YA 2D4DA 1S7TA 4JAMB 2W9EH 4WHTA 1KT2A 4G43A 4NUJA 3DBXA 2OXGA 3S7GA 4GH7B 1HZHL 3GK8H 2P42B 5IR1B 1KULA 4M7KH 2HT3D 3JV0A 4Y5VC 2XG5A 3LN5B 3WXWH 1N5AA 4YWGL 2OYPA 5I1LA 1MRCH 2VJXA 3HZVB 4PRPE 5I6XC 4FXLA 3L1OL 3ZHLA 1RUPL 1V3MA 4WFHD 2FO4B 2OL3H 2IBZY 3MRKB 4UQ3B 4CVWA 4N9GB 5KVMC 2EKJA 1LNUA 3KR3L 4YHYC 2P5EE 3GJFH 4GQPH 5KW9L 4OCXL 4WO4D 2MQCA 1S9WA 4N0UA 1UH2A 1K85A 4KROB 4OLYH 2CIKB 3EO0B 1FZJB 4G9FD 2CMRL 5IMLA 3V6OA 5DFTA 5HHOD 2VKXA 3JV4B 4QTIL 5JO5B 5IMMB 2O61A 5KVGH 1U93A 3ARGA 3MRJB 5D7LB 4AJ0A 5EIIA 1JHTB 2VDPH 4B53A 4G5ZH 5D5MA 1RUAL 1GHFL 1ULVA 1DQQB 3DJ9A 3LS4H 3REWA 3I85A 3G6AB 4ZOEA 4WV1B 4PLJD 1F58L 5EBWB 4IOIB 4OI7A 1P7KB 3D0VB 4QT5B 2VZ3A 1F90L 1U8NB 5D1QA 4X7SL 4UDUB 2Z8WC 3VI3E 1Q0XH 4G8IB 2QSCL 1I1AD 5J9PB 1DBBL 2DQUH 4LOUC 4ISVA 2FJHB 3ULVH 2X4RA 3N1QC 3IJYB 4O2FB 4EN3B 3ARBB 3S4SB 4P46A 2CUIA 2DM2A 3A6BL 4D9QD 2PTTA 3HRPA 3PNWA 3TIDA 1OP3H 3QUXA 4XTRD 2CKBL 1Q38A 3FJTA 3SQOH 2EDRA 4XP1H 4OCSL 2R23B 1D3CA 3HPJB 2KL6A 3CFKA 5FO8B 3KNBB 4LGSB 1OAKL 2GK0A 4J12A 2Y07L 1RI8A 3NZ8A 3P4NB 4F15C 4ETQB 2MTPA 5I74B 4PRHE 1QR4A 4U31A 4PJDE 2AJZA 3IAGC 4JG1H 1T7VA 4X6DB 4HMCA 3PHOA 2JELH 4PJ7E 4XPHH 5EU4B 5AG8A 3D39D 1OGAD 2AJSL 3B2VL 3T09A 1NDMA 2X4UB 1CD0A 1Z0NA 4UIKL 4PS4H 4P3DA 3BZ4A 3MBEC 3VU2A 1QNZL 1ND0A 4H1LA 2GTZA 4RFNC 5FO9A 2X89A 1ZK9A 3A0OA 3OJDA 4JJ5B 2IANB 3FB6A 4RMTA 4JZJB 4OT1H 3EJJX 3MACL 3OKDB 1HQ4A 4MA3A 4UQ2A 3FAXA 3O41B 5FYKE 4PG2A 3L7FB 1CQKA 3TV3L 3PG2A 3FT2B 1ES0A 3JUZA 1ORSB 1ZEAH 3QPQC 1AH1A 4J3XA 3MXWH 3ZE2F 1SJVA 1CDJA 3NFPB 4NO0B 3VXMA 4XVSH 1MCLA 3L7EB 5HGDB 5EBMB 5AZ2L 1AE6L 1F3JB 2BVPA 1ZLWH 3NACH 5DDHA 2HWZH 5C08A 3T77B 1FZMA 1NGQL 1PG7X 2UZIL 4F2MA 1H3GA 4GOSA 2RAMA 2ZSVB 5ID1B 4IMLB 4DN4H 4XAWL 2DIBA 3BN9C 3HCVB 5IQ9B 3CSPA 1G6RL 2Y06H 4PJHB 4L3EB 5CBAA 1OM3L 4YC2C 1C5DA 1XT5A 4Y2DB 5HGGS 4EUPA 4V1DE 5C09D 5JQ6L 3MGTB 2J8OA 5A16B 1HHHA 5FECB 2ADFH 3BQUD 4POZC 5FB8B 1KTRL 1SMAA 4EIZC 1KCUH 5F6HJ 5ANMA 5T1LA 3HA0A 2ZUXA 1OP9A 4K3EH 4M1CD 4ZDHA 3PDGA 4P4RA 4D9LL 3EDKA 3V8OA 5D2LA 4HPYH 2XTJB 1MSPA 1FYTA 2DTMH 1GZPB 4GKZB 5EUOF 3DVNA 4OIIL 1EPFA 2QADC 4U1HA 3KWWA 3L6FB 1A3RL 1S7QB 3AS0A 4CVZA 3T0DA 3GSVA 5GZOC 5LXGH 5AWNH 1B0RB 4FQQA 4PGZA 3S37L 2GKIA 1V05A 4I3RH 3ULSB 1KJVA 2VC2L 1FPTL 2VDMH 2XA8H 1P5VA 3SDXE 2QKIB 3V4UL 1EAPA 3C6LA 5D93B 5C3TA 5I9QB 5F8QC 1G9NH 4WFFE 3E0GA 4FFVD 1F11B 1AHWC 3FFCA 4O51A 1FG9C 4I0PC 4OZHA 5LCVH 1I9JL 2R2EB 3FONB 3RJQB 5I15L 2VXVH 4IOFD 1FFNB 1NJ9A 3QULA 4TSAH 3W9EB 1KJ2L 5DA4A 2PXYC 1WC7A 4XBEL 1TJHH 2G60H 2OR9H 3QFJB 5E8EB 4J1UB 4U1NA 3E2HB 5J7CC 4G8GD 4QXTA 3MV8B 4AEFA 3L3GB 1FE8H 4O58H 1OAYH 5D5MF 1YEIH 3WL9A 3ARFD 1V8HA 2BXZA 5FIEA 1SJEB 1G9MC 1K3ZA 3CUPB 2ESVD 5MHSE 1NCDH 5HPMA 1CL7I 1S7UB 3VH8A 1XR8A 5E00A 3VXNB 3FQUB 1U3ZA 1Z9LA 4KK6C 3RWFB 4KXZI 2G5BB 5SX4I 3EYQC 4DW2H 3CFEA 1FFRA 1EHLH 2EO9A 4XAKD 5JLZB 1S9VA 1UZ6F 4MQSB 3IXAB 5B38G 1MCPH 2FJGA 1QSFE 1MCOH 5LJYH 4K9EH 5JIKA 3I6GA 1LE5B 3RL1B 2GY7B 5KANI 3IDGA 3O2WL 4IIQA 1BGXL 5DD3H 5T1KB 4M7JL 1HOCA 1MFEH 2FL5A 4IRSB 5DMGD 3VRIA 1DBAL 4L4TB 1DSFH 5FA4B 5JW4N 1YEGH 5HHVH 1RZ8B 1I1YB 2X1XR 5IKCA 4IRZH 3WCYA 3DLQR 3UYRL 4M5ZH 3SOBL 1INEL 3J7HA 4GLRI 1RZKC 3AFLA 4H0IA 5FOJA 4CW1B 3QFDB 1ZA3A 3ZYOA 4LPUA 1JHLH 1OLZA 1R3IL 2YPKA 1YEDA 5D71L 4LGRB 3W0WD 1CYGA 1N6UA 4KDWA 2UZYB 1JF6A 4UILH 5DFVC 3VGBA 3VFOB 1HKFA 4P5MB 1F6AA 1NSNH 1J0YA 2FGWH 3HPLA 3MRKA 4MJ6A 1I7UB 3QEQA 3KDMB 2B1HH 4ONHB 2YSSB 5IIEA 3HUJB 5CSBA 4NOBA 4M62L 4QTHA 4G8FB 5DRWB 2IMMA 3LVEA 1LO2L 2DL2A 4JO3L 1AKJA 3M17A 2OBGA 2VE6B 1PY4A 2H3NA 2CIKA 2VSDA 3UTPE 3BJLA 4NQSA 3TA3A 4S1QH 5FCUH 2DRUA 3IF1B 5DK2B 5IVOA 4XP5L 1IGCL 3FO1A 2XWTB 3CPLB 3RTQA 1KTLA 3WFDH 3RGVD 2H2SD 3DV4A 4KMTL 4KTEL 1ORQB 1PKOA 1UA6L 4E5XA 4UIMA 2YPLE 4I8DA 1DUYA 1YZZA 1WV7T 4WV1A 4LLDB 3DX6B 3HAEH 3IDMA 4OD1L 4P5TC 1J18A 4B7IA 1ZT7B 2R69L 2AXJA 2HFFB 2WLYA 3HHRB 2WV3A 3LSOB 4MA1C 4KJWD 1JE6A 2XKNB 2QQNH 1JBJA 5D7IE 4G8IA 2VXQL 4WTXA 1G0DA 3DXAD 2ZPKL 3D2UA 3V52L 2E6PA 2VDLH 2Y4SA 4NCC2 3V6BR 1XCTB 4WFGE 4R97C 2GCYA 1CI5A 1BOGB 1FIGL 3QQ9C 2FH6A 4OI9A 3W9DB 3U7AA 1BQHB 2Q20A 1MOEA 5C7XL 4HJ0D 4AH2A 3FOMA 4OTXL 4NM4L 2VLJB 4DUXA 7FABL 4PJCB 4MCYA 4LAJH 4YFDB 3RUGE 1KIRA 4I5BA 3P4NA 4OLZH 2GFBB 5HYEA 3IDNA 3QHFL 3FRPA 3GRWA 3BKJH 4F7MB 3NCYS 2AP2A 2I5YL 2WP3O 3MODL 3UC0L 1OARH 5I1DB 4FMFA 5C0DB 3I50L 3BRFA 3VXOB 5HYFA 5AZEH 4DKDC 1LP9A 1P1ZA 3EJZC 3IDXL 3O2DH 4JFFD 3UTTE 1FL3B 5IOPB 2F54B 1RULL 2F5AH 4N5EC 4JJ5A 2IANA 4WIQA 4JZJA 4FZ8H 2D4FA 1ZVYA 1A2YA 4L4VD 2X44D 4OZHF 4WRLA 4LRNH 4PB9L 1XEDA 6FABL 3HZKB 4ZODA 3RDTC 1P4IH 1KGCE 1U8PA 1N0LA 3NTCH 2YD5A 4N8CH 4WI7A 1GZQB 1Q1JL 5FAAA 3VFWB 5IW1A 1MPAL 5ALBL 5BO1H 3PXHA 4PJEB 4QHLB 1JNNL 2P4AB 1S7XB 1NLBH 4AL8H 1A1MB 5ELIA 3QPXH 5A1AA 1A7OL 1MLBA 3HI6H 3FB8B 5BXFB 1AXTH 5KS9A 4BK4A 5D70H 3HNTH 5DK3A 4GAFB 1FFPA 2YC1A 4PRPB 5JDSB 1TQBB 2F19H 1CFSB 4P23A 1P6AB 1TCMA 1ZT4A 5HTSA 4M9PA 5DFWH 2BDNL 1IGJA 1P4LA 4XCEA 4LHQB 1KB5H 1QEWB 3HCVA 4ZAKA 5EC1B 1UXSB 1KXTB 5KSAC 3B9DA 3HZYA 5IB5B 3S35X 5A2IH 2YEZA 4JRXD 5SX5K 4QHMB 4IHOB 4L3EA 5IHLB 1ERNA 4L9DA 4ALAL 4Y2DA 4OZGB 1LDPL 3QR2A 3MRRB 5GRUL 4EI5A 3BXNA 2V5RA 1JPGA 1YC7A 1LEIB 1BFVL 2P1YA 3U7WL 3RKDC 4KHTL 1Q94A 4HV8B 4JM4L 4K8RL 1HZHH 5IB4A 5D1ZB 3VE0B 3OKNB 5L0QB 4YWGH 4QGTA 3CJJA 1M6OB 3V7AG 1JWMA 1T0NA 4M43L 4CU7A 5IGXL 1DN0A 3KPRD 4M7ZC 5MEOA 3ARQA 3L1OH 1RUPH 5CEYB 3IKCB 5CHNB 3WN5C 3KR3H 2A6KB 3PQYE 5KW9H 4OCXH 3GI8L 3JV6A 1DE4A 2NTSP 3LD8B 2HT3C 2QKIA 2PN5A 2CLRA 4HX1A 3REVB 1FGNL 2APFA 2CMRH 3S36X 2EDEA 4JN2A 1BHGA 3U9UA 2Y6SD 4E42B 4QTIH 4XP9L 2HFEB 4GXUN 3CFBB 5I1GL 5B8CA 5FGCE 5JW4Q 5C0AE 2AV7B 5ITFB 4HDIB 4PJDB 1N0XL 2R2EA 4GBXD 3DO7B 3WJJC 3AU1B 5CIPB 1RUAH 1GHFH 4Y5VB 5KZCB 4WO4C 1U8JB 1FFNA 3QXAA 4U1MB 3WD5L 3U2SB 1MH5B 1F58H 5TF0A 1D5XB 1HIML 3FO2B 3LKSB 1AD0A 1F90H 3MLUL 3QCVL 5I6XB 4X80L 2UY6A 4X7SH 3L3IA 3TBVA 3E1F1 3MV8A 3OBAA 2XN9E 4NJ9L 3O9WC 2QSCH 4MQTB 2ZCKL 4GRLD 1DBBH 5HDLA 1EGJL 5FV1L 3N1MC 1DLHB 1SJEA 5DC0A 2AEPH 3A6BH 4PLJC 1Y0LA 2FIKA 1AGEA 5F3BA 2CKBH 1E4KA 3T2PA 4MJ5B 3QUYD 2YWYA 1I3GL 1QHPA 3VGFA 3P4OA 4OCSH 3RWFA 1OAKH 1I1AC 1ZGLB 2Y07H 1OTTD 4NQED 4WCYL 4E41E 1KEML 3V9FA 1IM9B 2PCPA 3RIFF 1YJDL 5HDQL 3OL2A 4NQUA 2PO6D 3UTOA 3RL1A 4XWGL 2AJSH 4Z77A 3B2VH 4XTRC 3ZYZA 4JQIL 1OB1B 5CZXC 3SO3C 2QL1A 5C0BB 3BPCB 3CU1A 4UIKH 4L4TA 4S11A 3U6RB 1KCRL 1RZ8A 3DX9A 5DS8B 5ITBL 1QNZH 1GGIL 4O2EA 1S7VB 1UG9A 2JJTA 4V1DB 4HZAA 3FN9A 3V5DB 3MACH 2VITB 3B9KC 3V7MA 5HPOA 1P5UA 1BEYL 4CW1A 3QFDA 3ZYIA 5D72L 4HCRA 3DIFB 3E3QC 3TV3H 4JFEB 3HB3D 3KAAA 3OKOB 3C5ZB 4J3VA 3KPOA 4PD4J 1LP9F 5KAQG 4Z7UF 3THML 1HQRA 3AM8C 5IROC 5JHDB 2CRYA 3ARSA 4F15B 1UC6A 4QXWA 4HC1L 3KXFD 1DUZB 3VFOA 1MFCL 1NC4B 1UKQA 5AZ2H 1AE6H 2YN3A 3RVWC 2OI9B 4J6RL 3T3MF 1AGFA 3MREA 3MZGB 2BVUA 5TE6L 3VFTB 4AM0B 1J12A 1NGQH 2UZIH 1EUUA 3KDMA 5E95B 3WLBA 4OFYA 3RWIB 1KBGL 1GAFL 3TBYA 5EPMB 4XAWH 4NZUL 4JCMA 4RFNB 3KPLA 5BW7A 3CX5K 5FYJL 1CWVA 5F6IC 2GSGB 4JRYA 2P44B 1MCQA 1G6RH 4JY4B 3IVKA 5LGJA 1OM3H 3MRFA 1JYVA 4KWUA 5DK2A 5KS9F 3QJFA 4R7DA 5JQ6H 1CDBA 2NYYC 5ID0B 1H9VA 5JOFB 1ORQA 1WAAA 3QUMB 5JMOC 1FCCA 3NOIA 2GT9A 1HXMA 2D03L 1IRAY 4W70A 1WZKA 3BH8A 4D9LH 2HFFA 4Z7WE 3SGJC 3WIIL 2X05A 5ILTL 5L2KE 5D6DC 1EXUA 4OIIH 4C59B 1BZ7B 2BOCB 4A2MA 3IJHA 4EVNB 2ZNXA 1A3RH 4XNUL 1P2CA 4MDIB 4U6HA 3S37H 1YEKL 4IDLA 5C9JB 4M1CC 5IBUB 5F8RC 5HYSB 1MFDL 5DO2D 1YMMB 2VC2H 4CN1A 1FPTH 3GEWB 2VLJA 4CU6A 1MWAA 3IS1X 3OAYK 3V4UH 5FGBA 4J4PC 2J8UE 4MD0A 4D0DA 1JPTL 3I02A 4TVPD 2EH7L 5E6IC 2CKNA 1MJ7L 1I9JH 5KVFL 1OHQA 1U0QA 3V4PL 3OF6D 3QDGA 4YHLH 1DQTA 3KHOA 3O3BA 4Q6YA 4ELKB 4MAYC 1XZ0A 5I15H 3MOBL 4Q9BA 4JQXA 1SY6A 1KJ2H 2GJ6A 4WW2A 4XBEH 2QADB 5MEQB 1XIWC 1M7IB 5IOPA 2EDDA 2FEDC 1NBQA 4BH8A 4GG6B 4U1IA 5EO0A 2D3VA 43CAA 4OZFB 3WYRA 1CDUA 3IXTB 4P3WA 3O4LE 4WUUA 5C0NC 1IKNC 2DJUA 3FCTB 3RIAF 1BAFL 1QFUL 2MMXA 4LU5L 5DQ9B 5HYJA 2NY4C 2F8OA 3ZKSD 1A6ZA 1EO8L 4GKSA 1GL4B 3ILQC 1S7XA 1RJCA 4UUJB 3BVNA 4R96A 1A1NA 1X5LA 3FB8A 4M7LT 2FBOJ 1AHWB 4YO0A 5IQ7L 4RMQA 1J05B 1YNTA 4LLYA 1Y6MR 4Y1AA 3SGEI 1P7HL 4PJIB 2DWEA 5GPRA 1GGBL 1NANI 3AMLA 4L5FL 5J89A 3VXTB 1ACYL 2FBJL 5E4EC 2Q87A 4RGNB 1L6XA 5GS0D 4O9HL 3O2WH 1BGXH 1DANT 1FL6B 1UXSA 3VXPA 1OAQL 4M7JH 5FHAL 4AQOA 2L7UA 1DBAH 4PJ9D 4CNIB 4HWNA 4XXCC 4EJ1C 1Q9KA 2AQ3A 1G7JB 1NGXA 2BHUA 4NCC1 3UYRH 5E03A 3SOBH 2HRLA 1INEH 1J0KA 2NCMA 5FO7B 5JA9A 4PR5B 1ADQL 3O3DB 3H7BB 4HGMA 5IEKA 1S5IH 1AI1L 3K8MA 4G80A 4HV8A 1R3IH 5D71H 5D1ZA 5CKGA 3ZE0E 3VE0A 1T1YA 2G2RB 4A2LA 3SPVB 3OWEA 4UI2A 1DTUA 1M6OA 1MCHA 5D7IB 4KRMB 1G7MB 1PKQA 2PW1B 5D7JB 3OR6B 5CEYA 5F6HI 3BPLC 5EU6A 3RWGA 3C60A 2AK4A 1JVKA 1DBJL 4M62H 3CFJB 2NMSA 1LO2H 2CDFB 3WJLC 4JO3H 4LCWA 4HEME 2NY0D 3KJ6L 3AY4C 1CDIA 4KQ3L 5FDYA 3KPMA 3REVA 1DEDA 3BDYL 4E42A 3KPQA 3WUWB 3DRTA 3GSOB 3KPPA 2Z91B 3CVHA 1ZSDA 4JJHA 4PREA 3TEUA 5TDNB 4MNQE 3CFBA 4XP5H 1U8KB 1IGCH 3FHQA 3PP3K 1F13A 3D3VD 2AV7A 3BEVA 5LBSL 2B2XL 2Z92B 1RZIB 4KMTH 4KTEH 4NZRL 1UA6H 4MJIB 3BIAX 4Y5YA 3OXSB 3ULUL 4P2RD 1ZVSA 3U2SA 4LEXL 2EYSB 5DI8A 4OD1H 5J13B 1OAZL 4GMSL 4JKKA 2R69H 1KIPB 5I16B 4LVOB 1A6WL 5C0FB 4OM1L 1NAMA 3UPRB 2VXQH 3IT8D 4P99A 2BRQA 2ZUQC 2ZPKH 3V52H 1WAAF 4X4ME 4AENB 2H2SC 3CH8A 5CWSA 5IP4A 1KG0A 5JDJA 2DQJH 2UVEA 1QO3A 2P5WE 4R3SB 4YDKL 2ERJB 1FIGH 4PJ8D 1OQOA 4M6NL 5C0GB 5DJYB 5C7XH 4MJ5A 1RV6X 4KJWC 4OTXH 2BSTA 4NM4H 2OZ4L 7FABH 5D6CA 4Q0XL 3P0GB 4Y16B 3VXRD 2N56A 2RR3A 3X3FL 3BP6A 5EO1A 3QHFH 3X13A 3ZT5A 5FM5O 3LS5L 1VGKB 2F74A 2N7BA 4EIGB 3OXRA 3QEUA 3TH4T 3I75A 2I5YH 4MA1B 2ICEA 2DD8L 3UC0H 3VXUB 3I50H 4HJ0C 3BDXA 5C0BA 2AEWA 2JIXD 3DETD 2BVOB 4P2QA 3ZL4L 4GMTL 5ECJE 5A40E 4JZOB 5LKNA 1RULH 3VRLE 3B4NA 4RZCB 1AO7B 4JFXB 3NVQA 4HAFA 3T65B 1WCQA 3RNKB 2EDQA 3QEGL 4JZNB 4PB9H 5ISZE 4OGZA 3IKKA 1QRKA 3L3DA 1TETH 1VGEL 1FVCA 3C6SB 4HS3A 6FABH 3ZHDA 3VXSA 3C5ZA 5ESAB 3T0EB 1H3PL 5HHMB 1PYWB 1Q9LB 1L0YA 4WW2F 4ZUTA 5IF0B 1Q1JH 4ZYKA 1MPAH 3B5TA 4LKXB 4Y4KA 1JNNH 5SWZA 1A7OH 2OMBA 1WIOA 1JTOA 2LV4A 1MHHB 1B88A 3GJFK 3DRQA 2H41A 2EYTA 2X1OA 3BRGC 3AMKA 3VDCA 4LNRB 2Z35A 5DD6B 1YEEH 2BDNH 2EYRA 3OAZH 4RQQB 4Z7VF 5I66A 1TCRB 2NY2D 1IQDA 3PWNB 5E8NB 4JY4A 2VN7A 4ALAH 3NCMA 5CEXB 1LDPH 1CXKA 2IBBA 5ID0A 4LKCB 1X4XA 5GRUH 2NXYD 3PABA 4R7NB 2AV1A 3QUMA 4IEFB 5L2JA 2A83B 1BFVH 3J8F7 2IPKB 3JTTB 2NX5B 2DQFA 2X1WL 1II4E 3U7WH 2BSRA 3F7VB 3S88L 4CN4A 4Q74A 4JM4H 4X5XB 1INQB 4K8RH 3SE3C 4X6EA 1FV1A 1CFBA 5TGBA 1WZLA 3QDMB 2R39A 4ERSL 1HNFA 4PGJA 1U58B 1YY9D 5KN5A 1BZ7A 2XN9B 5IGXH 2DBLL 5J57B 4I2XE 3D48R 5KSAB 4YPGB 4MDIA 1I8MA 1FZOB 3SBWC 1A7RL 4QOKE 2K7QA 3Q48A 3MV01 5IEHA 3HZMB 3GI8H 1YMMA 3BJ91 5IUSA 3NIGF 5FF6B 3VRJA 4J3UA 5AD0A 1RAMA 5JW5A 1CBVL 3WFCL 1OD9A 2IH1A 5GGSY 1FGNH 2IQ9L 5C6TL 1T03L 3ARWA 4JY5L 1VFBB 3DO3A 5E9DB 4XP9H 1S9KC 3WSQL 4DGIL 5I1GH 5I17B 4NRZB 4LQ1A 3WDIA 4E41B 1A4KB 4HK3J 2HTLD 2XQYK 3LH2L 1OSZA 3WKNA 4WEMB 1NBYB 3UJTL 5JUEL 3OTTA 1DQML 3S97C 1VCAA 5HGBA 4Z0BL 4NNXA 3WD5H 3LQZB 4I4WA 5MEQA 1HIMH 1M7IA 3AXLA 4XGZB 3MLUH 3QCVH 2Y6SC 4X80H 1MEXL 5TQ0L 4YDJB 3RWEB 3IXTA 3WN5B 4NJ9H 1YN7B 1CN4A 2IALB 2ZCKH 1J1OL 3FCTA 4NC1E 5I76A 1EGJH 5KSBB 2O5XL 3QAZC 2GW5A 4JKLA 5E6ZA 5DJ8A 3TO4C 1MF2L 4XWOD 2AJXL 1CFNB 4ZO6A 1I3GH 4Z76B 1N4XL 2FEEL 2FSEB 4PRDA 4PJIA 4Z9KB 4H25A 4GRLC 4RWHA 1N8ZA 4WO4B 3VJ6A 4WCYH 4X6CA 1KEMH 5J8OA 3QNYB 3BGMB 4S1RL 1YJDH 2HMID 3LZFL 4G9FB 1YDPB 5HHOB 4NGHL 4XWGH 2X42A 3WNKA 2VDQL 4JQIH 5BQ7B 3QUYC 3RZCA 3U0TB 4KRNA 5ICZA 3VW3L 5I0ZA 1KCRH 3H9HB 4R4BB 1G7JA 5ITBH 4TPRL 1GGIH 1F4XL 4JQVC 5F7UA 4I9WD 1J1PL 4NDMA 4HKJA 1AJ7L 1P84J 4XHJD 3U4EA 4HD9A 1BEYH 3S96B 4P2YA 5D72H 2FO1A 3VH8G 1I1AB 1L4IA 2A73A 1PAMA 3THMH 3KPRE 2J1KA 2NY1D 5E5MA 4X8JA 5FEBA 1CZ8L 4TYUA 4HC1H 3HE6D 5DHVA 5L2KB 5J56B 2MHAA 1CDCA 1MFCH 5IHZB 4D9RE 3V0WL 2OM5A 1UACL 3RWDB 4J6RH 1RQ5A 1D6EA 4OJFH 5TE6H 3V6ZA 3K1DA 2F58L 5CSGA 1K6QL 1KBGH 1CDYA 4M1GL 3HB3C 1MI5A 4XNQA 4NZUH 1RK1A 1FNGB 4Y19A 2XY2A 3BMWA 3X11A 3X17A 4HH8A 4HMDA 4Q7DA 1PQZB 1FLRL 3ARGD 3GHBL 3P40A 4YHNA 4S0TD 3WUWA 1TMCB 3GUTB 4U49A 4XI5C 2J8UB 3D39B 1OGAB 3WNPA 4BZ1L 2A0LD 2MSPA 4ZUSB 4AMKL 1MQKL 1NPUA 3TVMC 3P4MB 4HF5L 2HVJB 3RPKA 4GUPA 2H32A 4FQHA 2D03H 5GRZA 2AABL 2AQ1A 4OIBA 3TIEB 1S7WB 5HHQA 5IMKA 3WIIH 3NAAL 5IMOB 2X4NA 5ILTH 1R3JB 2JJSC 3MLZL 3ORJA 3V5HB 2E5EA 3UDWC 4P46D 2JB5L 5HDBE 1PEZA 4AENA 1LILA 2F53A 3U4BL 4BSWB 1HN1A 3QUXD 5T5NG 4XNUH 5F6IB 3W81A 1LO5A 3JVGC 1XMWA 1YEKH 3DMMA 3MV7A 4J3WA 2PYEE 1KPVB 5DJYA 1J87A 1MFDH 4NQEE 4OLWL 4UNVA 3PGDB 4YR6A 4WDIA 3L3HB 1M7DB 5DEZA 3T2OA 1H0DA 4Y16A 4ZPTB 3ZKND 2XZZA 1T1XB 2BP3A 1M71A 1JPTH 2GJZB 3STBA 5BRZE 2ENSA 1BVZA 4LSPL 1MJ7H 4HH9B 1B6UA 3UTQA 3ZMRA 3GIVB 3PHQA 5KVFH 4L9LC 2D31B 3V4PH 3U0WL 5C09B 1KFAL 2X89D 1R6VA 35C8L 3G04B 1E6OL 3DSNA 1CFVL 1HI6B 2WBWB 4YK4B 2NXZD 1A7NL 5EN2B 3T65A 3HNSL 1XGUA 2GUOB 3RNKA 4BQCA 1F00I 2ZJSL 3OHXB 3T4AB 3RWHB 1KENL 1BAFH 1QFUH 4LU5H 1NGZA 2DMCA 4F9PA 1GC1C 3MV9A 2W9LA 5FUCC 3VXMD 3T0EA 1I7ZB 3EYSL 1R5WB 1EO8H 1T7WA 5AG9A 4ODVL 1G9ML 2I26N 1A6TA 1V3JA 4MJ4A 2JCCA 1KV3A 1CU4L 5C08D 5IQ7H 4GRWF 1MJJB 1XGPA 5CP7B 3V4VL 2XWBA 1XH3B 1E4WL 1GGBH 2VLRE 4HBQA 4L5FH 5F1IB 3FHAA 1ACYH 5DD6A 4Z7NF 1QPPA 1X5YA 5E24E 4TSBL 1LEGA 4C56A 5D7SL 3WEXA 4O9HH 3K80A 1D7FA 1TCRA 3TM6A 2ADGB 1OAQH 5FHAH 5JOPE 4PJBA 3QRGL 1CLCA 2W0FA 1K8DB 5CEXA 3PV6A 3WDJA 5T1LD 4P2OC 1SYSB 4X6CF 4MNQB 1B4RA 3QI9C 4R7NA 4HKBB 2DLFL 1I7RA 1XCQA 3SQBA 2BMKB 2D7PA 2IPKA 1A3QA 2NX5A 1ADQH 3GBLA 1RZKL 1T1ZB 3GSWA 1FYTD 4G8GB 1AI1H 2X41A 2VTFA 3MCLL 4X6BA 4X5XA 1J8KA 1IEHA 3TGXA 1INQA 5F97E 3ZKQD 4TNWK 3ARFB 1IFHL 1EDQA 5E4EB 1T6VN 4RAVA 5F3HA 4JFZL 3SJVE 3Q6FB 4PLOB 2BHZA 4O5LL 3P0YH 3DX7A 3JWDC 3SE8L 1DBJH 4KJYB 3RY6A 3C6LD 4TQEL 1S9YB 5E8OA 1RJLA 4K7PL 4FQLL 3KJ6H 5ADOL 4NUGL 4KQ3H 2R2HA 1T2JA 3QHZL 3BDYH 1BD2E 3OJ2C 2ICES 4NIKB 2DN7A 5FUCE 1A02N 4GRMA 4D0BB 2NZ9C 5FYLD 2EZ0C 4NNYB 5LBSH 2BVTA 2B2XH 3VFVB 3CAFA 3RNQA 4DKAA 1DQJB 4RGOH 4NZRH 3TZVA 5T3XL 1F3RB 3ULUH 2R2BB 5ERWB 4LEXH 1JYNA 1UCBL 4G42A 5GZND 4GFTB 1OAZH 1ZTXL 4GMSH 1NBZB 5L8KB 1A6WH 1R0AL 4OM1H 2VLKD 1U95B 4YDJA 3VFSA 3RWEA 1N5YL 4N0FA 4JDZA 1U2CA 1ZAGA 2ZOKA 2YOCA 3TWCL 3W0WB 3BP7A 4RGMC 3V7AE 5HVGB 5ISZB 4ZUUA 5LWYL 2Y1VA 3RL2A 3AAZA 4YDKH 5T3ZE 1QZ1A 1DVFA 5H8DA 1JGVL 1FO0B 2Y25A 4M6NH 1CFNA 3S8WA 5KVEL 4GW1A 2FSEA 3UZVB 5C2BL 2OZ4H 4ZG1A 4Q0XH 5F7HA 2AQ2A 4IBLT 3X3FH 1SBSL 1WTGT 5J11B 3LS5H 4I3SL 4XX1G 4M48L 1T83C 4PJ8C 3NMEA 5HHOA 2DD8H 4NRXB 2HVKB 2W38A 3FB7B 4LRIC 1P53A 1JZ3A 4CAGA 2ZUQB 3NCYP 5H37G 3H9HA 3RKPA 4R4BA 5GGUA 1I85A 3ZL4H 2CDEB 4LHUA 3MRCB 3UX9B 3QDJE 1FVEA 3WNMA 2J8HA 1XF5A 2P8PB 4JFHD 5BZDA 1MVUB 3QP3A 3IU3B 3QEGH 2Y72A 4M61A 1FP5A 4KZEL 1VGEH 1K8IA 4LEOB 1DFBL 1M05B 5ACLA 2X4TB 4Z7OE 2VUYA 2GQHA 1H3PH 4X7FC 3IFLL 3P11L 3DXAB 3LRGA 4RNRB 3VFNA 1R5IB 2QQLL 4PV8A 1HHIB 4WU5B 1NCBL 2ZOLB 4LSTH 4QRQB 5EU3A 3RI5F 1IAOA 4HIHA 1A1OB 2NY7L 3PWUA 1AKJD 4I2XB 4CU8A 1RIHL 3KGRA 3O3UN 2VZVA 4ODTL 1WEJL 1IKFL 3F62A 2VAAB 4QOKB 1WTLA 3TA3D 3F7PC 1SVZA 5INCB 2JCCF 2MWCA 5DTFA 4FXGB 5H94B 3GMMB 5F96L 3U36A 1K2DB 4DGYH 5EC2A 3GSRB 4N9OB 3D39A 4M8QB 3IAPA 4LFHD 4ZFFB 4W68A 2YXFA 4HS6B 3RHWF 4XNMA 4JKWA 5CCKH 4JFFB 4NJAL 5J06A 2BNRE 1QSEE 4HWUA 3HC0A 4I77L 3TIEA 1S7WA 1L9MA 4PJBF 3S88H 1U42A 3EHBD 3D2UD 5IMOA 3QO0B 4LCCC 4HUXB 3H9SE 3IGAB 5CIPH 4ERSH 4Z78A 2NXYC 1CE6B 2XA3A 2ZKHL 4MX7B 1AXSB 3CLEH 3DGGB 2V7HA 3LDBC 3P0VL 4IS6A 3PHSA 1UJ3A 1X4YA 3DVGA 1A7RH 1BM3L 3TNNA 8FABA 4M4PA 3BPNB 3ZSSA 1FFQA 3ULVD 4OD2A 3VWKC 5DJ2B 3G08A 1CBVH 3WFCH 4ZPTA 1YY9C 2IQ9H 5C6TH 1T03H 1I8IA 1QSVA 1MCEA 5IVZB 4NKOA 3WLWD 3VFMB 3WSQH 4DGIH 3VI4E 3KLDA 4JRXB 1AGCA 3HMXA 1HXYB 3LH2H 2R1YA 3O6FC 3UJTH 2D31A 4Q6IC 5JUEH 3BEWB 5BZWA 1DQMH 3B6SA 4Z0BH 5CBEB 2YN5A 1T7XA 2DQGL 3O8XA 2HYMA 3BQUA 3K8KA 3BW9A 5C07E 5I1EH 2A77L 3SKUD 3C08L 1FNHA 4HW6A 1EBPA 3U82B 4U3HA 1HI6A 3QJHB 1CVSC 2DM7A 1S5HB 1MEXH 4Y4FA 5TQ0H 1IAKB 3FB5A 2JE8A 2A6JB 2ZUSA 5BS0A 1ZT1B 7CGTA 3ARUA 1J1OH 2HTLC 2PTUA 1PX4A 5DYOB 2FYYB 5E94A 5E8DL 2O5XH 2QSTA 4WTZA 5I1HL 3E6HB 4NN6C 1BQHG 4XZUB 4CRPA 1ZGLM 4N5UA 3V0VA 4ODXA 1MF2H 2DKUA 2AJXH 4HJGA 3KPRB 1AY1L 1WLHA 1M4KA 2OJEA 4UAOC 1N4XH 4PP2A 5I75B 5CP7A 4P23D 5F1NA 1B4JL 4FNLL 1SHMA 4L8DB 1CGSL 4QRRE 4OKVB 5C71A 1CGTA 4LPXA 1KB9J 4NPYA 4ZAKD 4ZTOL 2CLVB 3FT4B 3LZFH 4YDIL 1HDMB 3QXDB 3PWJA 1C7SA 1JHKL 1YY8B 5I8CA 3MNZA 5I0DA 4XWOC 2E7LC 5DMIL 4PJAE 4YZFE 2VDQH 4N8VA 2EE6A 1C5CL 2AXFA 3MA7B 1K8DA 3VW3H 4KU1A 4FTVE 4OF5A 3IB4A 4GBXB 4TPRH 1WVZA 1Z0MA 3SCMA 3QAZB 2BNQD 1F4XH 1G7PB 4O02L 5I18L 1J1PH 3O3AB 1AJ7H 3BKYL 3KYOB 2HMIC 4MCZA 4QRUA 3SDCD 3BWAB 1J1XL 4RX4A 1TZIA 3JTSA 4G8GA 3QXWA 4IOSD 1EBAA 1U92B 2RHEA 4PGBB 4GRLB 2R56L 4M5YL 1UB6B 5D7KD 3ARFA 1CZ8H 4QCIB 3U30B 1T22A 5IB3A 3V0WH 5MERB 2ESVA 5KVDL 5ESQB 2VH5L 3Q6FA 1RHHB 1UACH 4RAUA 3WFHB 1I9IL 2ICWI 5IK3B 1E4JA 1R5VB 3QUYB 1ZS8B 2IPTL 2F58H 1K6QH 1PG7L 4M1GH 4BELD 1M7XA 2EE3A 1S9YA 1T1WA 4RDQF 4QRTA 5MEND 1QBML 2ZNWA 4NQEB 1RZGB 1T5XA 1FLRH 2E8ZA 3GHBH 4Z0XB 2V2TB 4MD4A 2HN7A 4WUKL 1WBZB 2PO6B 5F7WC 3TBTA 3K2UH 2FR4A 4I18A 1QRNE 4BZ1H 4KKNA 2HLAA 1X44A 1TZGL 1F6FB 1W72B 4AMKH 1MQKH 5IESL 2DQIL 4HF5H 1NFKA 3IRPX 3V6OC 2ADIB 3BD5A 3VCLA 2A74B 2AABH 1U8QB 2WW8A 2Y9RT 4WW1A 5GRVK 3ARGC 1DJSA 3OJMB 1KN4L 1CGWA 3NAAH 1NEZB 1QKZL 4YIQB 2AXHA 3MLZH 4LF3B 1MCIA 1JZ6A 5EBGA 2JB5H 2A0LC 5HI4D 1SYVA 5K59F 3JUYA 3U4BH 5I1CH 3UXFA 1KIUA 5B3JF 1C08A 5K9OB 3KXFB 1K4CB 5D1QC 1T5WB 1JGEA 2BVEA 3DX8B 4DFIA 1QLFB 4OZFH 4PJFA 2FIRT 4H5SB 4TUJA 4N90E 4RBPH 2APVA 2VL5A 5E5RB 4UT6L 1KLUB 2LU7A 4P46C 3TVMB 4YFLI 5GGSB 3SKOB 2DMKA 1SMOA 3QXUA 3KPSE 4WU7B 5EUOE 4LSPH 2FH8A 1HH6A 3HMWL 4D0CB 5HVFB 2UWEB 2CLZB 3GMRB 4QXUH 3SDYL 1NFDB 3FB7A 3EDEA 3MRQB 2EIDA 4K3GA 1KFAH 1HSBB 4FS0A 1T3FA 4XPFL 2V17L 35C8H 3RGVA 1E6OH 3K81A 2CDEA 4N1EA 2FB4L 1CFVH 4K7FB 2ZZUT 1OGTB 1A7NH 2V7NB 4MD5A 3HNSH 1MVUA 2ZJSH 1OF2A 3EOAA 1MCSA 1KSRA 1KENH 4P3CL 5C0RH 4D8PA 2WWKO 1DEEA 1HE7A 3QG6B 4HFWB 2DLIA 1D9KA 3G5ZB 3HRZA 3V5KA 3DXAA 4RNRA 5GJSL 3EYSH 5ABDE 4X4YA 4ODVH 1G9MH 1E28B 1HHIA 3TP4A 3Q5YA 4N0UE 2AJ3A 1MCWM 2WSKA 2J7LA 1Z5LB 4WJ5B 4PG2C 5J12C 4OFYD 1CFQB 1BFOA 3V4VH 5EZJA 1A1OA 1NCCL 4L9LB 1NMCC 2X40A 2ZUTA 1E4WH 4LLVA 1G7IA 3RX5A 1UGNA 4GKOA 2Q7NA 4G9DA 4JRYD 3RA7L 1E27A 4TSBH 4MS8D 5D5ME 5LVEA 4KFZC 5D7SH 2WNGA 5J1AB 1AQKL 4ODWB 4NQVB 4FXGA 4JDVB 4J23A 5E2TL 5HY9A 3QRGH 1EK3A 1YYLL 4EKXA 3SHSA 2OX5A 4I48A 4PRNB 3QWOA 5C86A 4ZFFA 3VGAB 5GSRB 2FHBA 2ITDB 1LQSR 2MFNA 1I7TB 4PPTA 5CILL 3PWPD 1L0XA 5IBLC 4Q2ZB 3NFNB 4KK9D 1RZKH 3MLXL 1UZ6E 4LSQL 1CD8A 3MCLH 5IB2A 5EB9A 4L4VA 4HZLB 2C1PB 3CC5A 1EEYA 1VFAB 4DUWA 2B1AL 1IFHH 5FM4A 1KEGL 4LMQI 4JFZH 1KYOJ 1U8LA 5IVXA 4O5LH 5TE4L 1TTGA 3SE8H 1IEAA 2EXWD 4TQEH 3V2AR 4NFDA 4K7PH 2VUOA 2VR9A 5TF1L 5ADOH 2EECA 1OL0A 3PIQA 3QHZH 4PJ7A 3BKCL 1BBJB 4OAWB 5IVZA 4HUWB 3QDGD 1PZ5A 3JWOC 5D9SA 4NQCD 1HXYA 2CXGA 1CCZA 5TQ2L 1U8HB 3BEWA 4KQ4L 3MLYL 4MZ2A 3C6LC 5T3XH 3W2DL 3MRIA 2M1KA 4RRPA 4JFYA 4POUB 3LV3B 3ROOB 1UCBH 1NFIB 1ZTXH 2PYFB 1K5NA 4WUUD 5DQJA 1OPGL 3OJVC 2DYPA 1R0AH 1BVKB 2VZTA 4IJ3B 5CD3B 1N5YH 1QYGL 2A6JA 4XMKL 1EAJA 1IBGL 3QDJB 4XHQA 3TFKC 1LE9B 3GB7A 3EO1B 3QH3B 2FDBP 3QG7L 4KPHH 5TPWL 4PY7B 2OXHA 3TWCH 2YRZA 2W60B 5FOBA 3WFBL 5HYSG 3MRMA 5LWYH 4JFPA 2X1QA 3O3EA 2GYSA 3EOBB 1WT5A 2OQJA 5GZNC 4Y1AD 1JGVH 5CGYD 1Z6JT 2DKMA 3LMJL 1UT9A 3UBXA 5F7DB 4NQDE 5KVEH 1P69B 3BISA 2JLLA 3B3IA 5C2BH 4BSVB 1KTKE 4L8DA 4JG0L 1SBSH 5DUPH 3P77B 3OAZK 3HR6A 4I3SH 3QXDA 4PJFF 4CKVX 4M48H 1FHGA 4NQXB 3GJEB 2P49B 5F72S 3ZDYF 1MRDL 3D3VB 4JANB 3ILPB 3X3GL 4EDWL 3FQWA 3MYJB 4GBXA 3C5SB 5D2LE 4RGMB 1BQUA 5JZ7C 3QA3B 4P2RB 4IIQC 2WK2A 3VD4A 1R24B 3KYOA 5BMFH 4GAGL 5CLTA 5HI3D 1RUQL 1U41A 2DI9A 1HYRC 3B8YA 3O6LL 3WS6A 4KZEH 1DFBH 1WWWX 2F15A 2BNRB 4NWUL 4A6YB 1A9EB 1U92A 2EDFA 3IFLH 3P11H 1EEZB 2PR4L 1NKOA 5BVPL 4KHXL 1WWBX 1C16B 2QQLH 1VA9A 5CSZB 3WE6B 1BIIB 4AK1A 5IM7B 1J8HD 3EYOB 5EU6D 4HXAL 1ROWA 3BMVA 1JI2A 5ESQA 3DURB 4PJ8B 4BM7A 2X4SA 2NY7H 5E56A 4X9GA 4LCWD 3TYFB 3BYTA 3SDXA 3FOLB 1RIHH 1N3NB 1WZMA 3MRGB 4HWBA 4U1KA 5D2NE 5A2JH 1Q8MA 3FFCE 4ODTH 1WEJH 3EYFA 1IKFH 3TYGL 1QQDB 4OZHE 3VXRB 4MHHI 1AD9B 2QR0A 3R06A 1ZLSL 1PGRB 4X99A 4GKNA 3SDAD 43C9B 4Z0XA 2OTWB 4IRJA 5F96H 2ARWA 2IMNA 4Y2OA 3S35L 2PO6A 3R0NA 3CXDL 2X4PA 3ROLA 4DVBB 1UWEL 2XZAL 3PJSA 5K9KA 1FNSL 4OZIE 5IFJA 1FC1A 1IGYB 2JIXB 4S1DC 3GSUA 2EKSB 3RU8L 5SWSE 4NJAH 1ED3B 5C6WH 3TA3C 1A9BA 4I77H 1VEMA 4YNYB 4MNGB 5DMYA 4WENB 2JJUA 1W0VA 1ZMYA 2BY1A 5EOCL 1SVCP 3RTQC 5DJ6B 1NEZA 5JPNA 4NKMB 4MQXD 2XACC 4KK8D 1SJHA 2CSPA 1AQDA 4R9HA 1O7SA 4F7EA 4WV1C 2YUWA 2ZKHH 5ACZA 5JXED 3QNZB 4DWHA 4RCAA 1IAIM 3P0VH 2I07A 3VI3F 3KXFA 4KDVA 4ONOA 4PUBL 1BM3H 4RMRA 5INDA 3BP4B 1MHCB 2M26A 3EHBC 2XTLA 1UXWA 3WUWG 5E08L 4F37F 1QSFA 2X7LB 4C55A 3EFFA 2H2PD 1KLUA 3PDOA 5K9QI 4J3TA 4L3CA 1NC2B 4JFOB 3S36L 5SX5H 4WU7A 5IVXF 4ODUB 2ATKA 4NYLB 4RIRA 3QSKB 2NY2B 4KGLA 5JTWA 1H5BA 2V2WA 1ZHLB 4LCCB 4QY8B 4LCYA 4GAYA 1XF2A 4U1SA 2DQGH 3TJHC 5I74C 2A77H 2NXYB 1XR9B 3C08H 4PJ7F 3LN9A 4OKDA 2DBJA 3LDBB 3CVIL 3NA9L 5IW6A 2V7NA 2ATPB 3HI1B 3WLWC 3VXSD 4URTB 3KYKL 1ZHNA 5DMJB 1FYHB 3C9NB 5E8DH 1HEZA 3X12B 3WIFB 3QG6A 4Y4KD 2F5BL 3VWKB 3DROA 1KCVH 3QEQE 4ZNEE 1FORL 1UFUA 5SWZD 3CGTA 5FA3B 4JZJC 1UH3A 1ONQA 4WJ5A 3OKMA 1OSPL 4ODBD 3QDAA 5JOEA 3O6FB 3LRHA 1B4JH 4FNLH 1CGSH 5F71A 4F3FB 5J1TC 3AROA 4ZTOH 1X6LA 5D7LE 2Q6WB 3C5JA 3SDDD 4X4XA 4YDIH 4OV5B 3H9YA 1XF4B 2JELL 1FFOA 2L7JA 4HEPG 2JB6A 5DMIH 1C5CH 4UBDD 4F7PB 3MJ7A 5DK0A 4P23C 3MMEB 4K3DL 1MHPL 2YPLA 3OF6A 5K9JL 3MNVA 1CL7L 1RUKL 3IDIB 4NN6B 3U46A 3DTXB 1QRNB 1IGTB 1QFWI 5I18H 3GMQB 4GQ9L 3BKYH 3Q1SL 1A8JH 5DQDL 4UV4L 4Y2DC 1PX3A 3KVQA 1XF1A 5D1XD 4UAOB 5ESVB 4DOHB 1CVRA 4LNVA 4X5WB 4EI5C 3G5YA 5C6PB 3H42L 1BQLH 2R56H 4M5YH 1T21B 1W72L 4PJGA 3MPCA 4PGEB 1FL5A 3N85L 2NY3C 3WKML 5KVDH 5JW4M 5IT2L 1O5DT 2VH5H 1I1CA 2ZUYA 4L29B 5BV7C 2IPTH 2OTUB 4X6DE 1PG7H 4PLKD 2CK0L 3GMNA 4DN4L 4JR9L 3QQ4B 1QBMH 5H35A 4HUUA 1OP5H 2BY2A 4PTUB 3TN0D 2WP3T 2V2XB 2EDNA 4ORGB 2RIKA 1WJ3A 2IBZX 2Y06L 4WUKH 4L8SA 4B5EA 1XF3B 3VGHA 5A3IC 3SDXF 4GS7C 1KLGA 2IANE 2GITA 4MWFB 2C26A 1TZGH 5EUOB 4ZFOB 4PJ9A 1U8HA 5IESH 2DQIH 1F42A 1JWSB 4S0SD 5D93C 1KCUL 2D7MA 1K4DA 3MR9B 5GSVB 3MJ9A 5EOTA 4WHTB 1KT2B 4KI5E 4G43B 4NUJB 2PYFA 5B8CC 4YFEA 1KN4H 1QD0A 1IGMH 2PUQT 4P4KA 1QKZH 1A14L 3Q5OA 2RB8A 2VQTA 4HLJA 1LE9A 2X4QA 1N5AB 4U3CA 3QH3A 1FJ1A 2LABA 1EEQA 1PLGL 2W60A 1SQ2N 1FG2B 2R1XA 3SN6N 5I1LB 2KDGA 1VENA 2EO1A 3D85D 1LNUB 3ZYJA 3N06B 3R8QA 1S9WB 4N0UB 1RJYA 4UT6H 4L3EE 5A2LH 5HI4C 4HK3N 5TDOA 3WS3B 5IMLB 2P7TB 3WUZA 1IMHC 1A7QL 3FMGL 1E4KC 3W11C 4HULB 2O61B 1U93B 3ARGB 1CLZL 5EIIB 5LCVL 3SDYH 5D5MB 2UZXB 1KXVC 3ZT7A 4BUHA 2XNAA 4XPFH 4NOFA 2FB4H 1TJHL 5E7FA 4NO5B 2XTJE 3H3KA 4CJ1A 4P2RA 4JFDD 3FN3A 3MNWA 2BFVL 1MCCA 2IF7A 4ISVB 3GSNA 2X4RB 4LVNB 2CO7B 1FNEA 1GIGL 4KTDL 4JGMA 3BHBA 1RZJC 2QV2A 2JJTC 1GC1L 5GJSH 5J6GA 4OLUL 4P46B 4ZFZA 2XXMB 4XRCA 2PTTB 5ENWA 3WE6A 5JIPA 3QUXB 1S8DA 2VABA 4HK0A 4AIXA 4HLZH 3CFKB 1NCCH 4U33A 2GK0B 4LDLB 4Y19D 4JO1H 1RIUL 3T0AA 1UB5A 1BWWA 1HILA 5DVMA 3RA7H 2BHYA 3RDTA 3VXRA 1NLDL 1RJZA 2DS4A 1JPSL 3PHOB 4JRWA 3M07A 1AQKH 2R1WA 5DVLA 4XX1E 5C0AA 3NGBC 4LHUG 5E2TH 1NDMB 2OTWA 2C3WA 1D5IL 4P3DB 1YYLH 3BZ4B 2EDHA 5T3ZL 4PGDB 4WHDA 4EZMA 1LK2A 1D5ZB 2GTZB 3MV8E 4H1LB 1KIQB 4N0RA 5BW7C 5JA8B 4MDJA 4YLQT 3GHEL 5CILH 4X9FA 3AUVA 4MS8C 4H88L 4MA3B 3MLXH 2NXZB 4UQ2B 4LSQH 1DDHA 4YNYA 5J12B 1CICD 3DI2B 4TTDD 3QIWA 3P73A 1ES0B 4P9ML 5LGHL 4MXVE 5EORL 2WBKA 2B1AH 3VXMB 1QOKA 1KEGH 1HHJA 1ZVHA 3LN4A 3F7QA 4DTGL 3MV7D 5BOZG 2NNAA 1YNLL 1RFDH 5GGTA 1T2XA 1L9NA 2BVPB 5TE4H 4FFWD 5C08B 4F2MB 1FZMB 2J2ZA 5TE7H 3JWDL 3F8UB 4EDXA 4H0HB 2VDKL 4WI3A 3LCYA 2R8SL 1RZ7L 4PJGF 1S78C 1VACA 1XGQA 3WIHL 4H26A 2APXA 4DQOL 5TF1H 2HJKA 4QKXB 4L4TE 5HI5C 5AYQA 5B3NA 4YQXL 4JN1L 3BKCH 4OFDA 2Z9TA 4BFBD 5CBAB 2FZ3B 1IL1A 1U36A 4EUPB 1FO0H 1RD6A 2E27L 1RPQA 1HHHB 3RUGF 1R3HA 3EGSA 3UCRA 5TQ2H 1INDL 4KKAC 1QPXA 3MLYH 4KQ4H 5FGBC 3OKEA 4UMGA 1I75A 1LWRA 1T0MB 5T1LB 5ANMB 3W2DH 3QUZA 1OTSD 1YNKL 1XR9A 4PG9A 4FG6C 4ZDHB 4YHML 4P4RB 4U1LA 1OPGH 4HQQL 3G9VA 4BSJA 1N6QL 2ZG1A 3B5HA 3DECA 4CMHB 1QYGH 1FYTB 3MV9D 1IBGH 3IFOA 3TNMB 3DVNB 3ZDZE 3QG7H 5TPWH 4JQXC 1CDHA 4WW2C 3T4YB 5B4MD 4GXUM 3KWWB 3WFBH 4GJTB 4M00A 3WJJA 2CO6B 2DIJA 3HUJE 4JVPA 4CVZB 3GSVB 4WFED 5FA3A 4FQQB 3QWRA 1BJ1J 2XZCL 2ITCA 5MEPA 3OV6A 1S7RA 2DLGA 1BVLA 5T1DL 3QIBD 3MGAA 1EAPB 4A6YL 3QIUA 5DJXA 3C6LB 3O9WA 4JG0H 4C56D 3SE4A 1O0VA 4G7YL 4PRID 4F9LA 5DRZA 3LB6D 1TJIL 5E5UB 1CLYL 1MVFA 3IRZA 3QEHA 2W0PA 1WAAE 2XXCB 3FFCB 4O51B 4OZHB 2WMPA 1PDKA 4DVRL 1UZ8A 3DOSA 2B8OT 3ALXA 2KUTA 5JW3L 1MRDH 1TQBC 4O00A 4OZ4A 4F7PA 4EDWH 3QULB 1WC7B 3IDIA 4PY8J 3I6LE 5CMAB 5HBBA 1FNFA 4YAQA 4U1NB 1IGTA 4POYA 4FQ1L 3BSZL 3GMQA 3LRSA 4WTZG 3TH2T 4JVWA 1U8MA 3F58L 1BFTA 4GAGH 1RUQH 5EU5A 3O6LH 2IH3B 1OVZA 5JHLL 4LSVL 1WBXA 3WL9B 5HHNA 4NWUH 5CGTA 5LQBL 2PR4H 5BVPH 4KHXH 2VLJE 2X70A 4HXAH 1XR8B 3V0AC 5E00B 2VQ1B 4MLSA 2VLMD 4OGAD 4OBSA 4ODSH 4UINL 4S2SA 2A9NL 3V95A 3MX0A 1ZLUK 4K8RD 5D1ZC 3CFEB 5GGQL 3RY4A 4P49A 3TYGH 2FJGB 3RVXD 5JMRA 4FHBD 2YR3A 3QDGE 3I6GB 1PEWA 2WANA 3FTGA 5FKPA 1ZLSH 3IDGB 5EH1A 4S10A 4CGTA 2GJ6E 2FL5B 3C60C 4RA3A 5J3HD 3S35H 2FLBT 4WWID 1EJ6A 2F54E 3CXDH 1UWEH 2XZAH 2FGZA 5IKCB 4LL9A 3C2AL 3LD8C 1FNSH 4HLZG 3BAEL 2BVYA 2DWDA 3ZKMD 3RU8H 5CZVL 5HYJE 3MOAL 1P9MA 3MR9A 5GSVA 4EI6A 4X98A 3O4LA 1ZA3B 2YMXL 1B0GA 4QHKI 1AC6A 1X5GA 1YEDB 2YPKB 4L1DA 5EOCH 4PJEE 1AIFB 3MLTA 1QHOA 4IMKA 5C9KA 1A6VL 1X4ZA 1EA9C 4Y5YC 4Y1AE 1S3KL 5AUMB 1DVFD 1FG2A 3VGEA 1F6AB 4XP4L 5IB1B 3HE6A 3ZTNH 3HPLB 2V9QA 4MJ6B 3QEQB 2EDXA 4ONFL 1RSFA 1H8NA 5IIEB 4PUBH 3K46A 4X83A 4QTHB 2FNBA 2UY7A 5E08H 1AKJB 3M17B 4MQXC 2O93L 2H3NB 1H15A 4OZGE 3WS3A 4NQSB 2WIMA 1QFPA 2P7TA 4R8WL 3TA3B 4JPVL 3S36H 3PE9A 2CDGA 5H2BA 4XVUD 1EERB 3FO1B 2OL3B 3Q6GL 1KELL 4AY0A 1WIUA 4F7CA 2CRZA 3RTQB 1KTLB 2Z8SA 4OF3A 2FX8L 3QXVA 5I8OL 3DV4B 4K94C 1VESA 4LHUD 5GQBA 3QDHA 1KUMA 4E5XB 4UIMB 2RCSL 1DUYB 3O6KL 2WWMD 2H2PC 3IDMB 4QWWD 4NO0D 4NO5A 4ZXBD 3NA9H 3CVIH 4KC3B 5KSUA 1WK0A 3DNKA 4PP1D 4LLMA 3KYKH 5CUSL 2NZIA 2XWJA 4EQ2A 3D2UB 4MSWA 2F5BH 3PWLB 3CXHK 2AK4E 1FORH 4LARL 2GCYB 3MLWL 2AEPL 4MAYA 3RVUD 1DP0A 1VEOA 2HT4D 4LCWE 4CMMA 3VD9A 4AH2B 3FOMB 2Q86A 4N1CA 1OSPH 2XPGA 3C5ZC 4MCYB 1UWGL 1KIRB 4I5BB 2IPUK 3NPZB 4X7TB 3IDNB 1U3HA 1Z9MA 4HBCL 1OD7A 4OCYL 2HT2D 2NR6D 3IDJA 2OI9C 3FQTA 1BMGA 1LP9B 1P1ZB 4Z7UB 5F7MC 4K3DH 1MHPH 5K9JH 1CL7H 1RUKH 4PGDA 1D5ZA 1KIQA 4RMWA 1GRWA 2GAZB 3PL6A 5FYJD 4GQ9H 4ZPVA 1T7ZA 4PIRF 3GGWA 3Q1SH 5ACMA 1A2YB 5DQDH 4HSQA 4NZDA 4UV4H 1JK8B 1U3YA 5GHWL 3ARZA 5FUZL 4QRSA 4U4BA 1A7PL 1U8PB 3GO1L 4UBDC 3H42H 2P5WA 4ZFOL 1W72H 5IW1B 4XPTL 1J7VR 4CN6A 4XXCA 4X9BA 3NABL 3N85H 4Z7WF 1MLBB 3WKMH 2DM3A 5IT2H 5IWLA 4GG8A 4P5KB 3HG1D 5KS9B 3TBWB 2D0HA 1FFPB 1T89A 2YC1B 3T04D 2BSSA 2CK0H 4P23B 4RBPK 1ZT4B 1LMKA 1CFTA 4JR9H 2XT1B 1CR9L 1IGJB 1P4LB 4XCEB 4ELMA 2K3TA 2ED8A 5C0BE 2Z31A 4ZAKB 5FHBH 3QFJD 1Q9WB 3HZYB 2YEZB 4BQ8A 5JORA 4P2QE 2UYLA 1MELA 2FZ3A 4GW5B 1GGTA 4EI5B 3O8XD 4S1SL 2NW2B 4WGWB 3BXNB 4PJ5A 5DSCA 1JPGB 1X5HA