4G6AC

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic region 412-423 bound to the broadly neutralizing antibody ap33
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
QLLEQSGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGYISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTTYAMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Hepatitis C Virus Envelope Glycoprotein E2 Antigenic Site 412 to 423 in Complex with Antibody AP33.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords E2 peptide
total genus 46
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g6aC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g6aC01
1G7QA 2BRRL 3MV9B 3FB6A 4YHIB 4TYUA 2H9GA 5C6TH 3UJJL 3S37H 1OAYL 2NY2B 1BQHB 1FVDA 2NY5H 3Q5TA 1EO8L 3D1MC 4PJ7F 2P8MA 4OZGB 1Y6NR 5EZOH 2LVCA 5ITBH 3KG5A 2CXKA 5L6YH 2JCCF 1C1EH 4PRIA 1RUAH 4AIOA 5IESL 1F6FB 5IFHH 3SGDH 3GHEH 3IDGA 2ENYA 2D3VA 2WWKO 5MENE 2CGRL 1LGVA 4N8CH 1A6VL 1UZ6E 3I02A 4Y5VB 3MO1A 5I1LB 3ILPB 2C1OA 2NTSP 1M7DB 3KYKH 3SKJL 5E8EB 5HPMB 3BW9A 2W0FA 1X7QA 4ZUWB 4A6YL 1D3CA 1GC1C 2A6JB 1Z0MA 2C4XA 2GJ6B 1NGZA 2VH5H 1HNGA 5T1LD 5F7FA 3QUXB 3H9HB 5JHLH 4PRAB 2IMNA 4QF1B 3F7YB 4UQ3A 5DS8A 3BWAB 3P73A 3SDCD 1YQVH 1ZVSA 1S78C 5JHDB 5D6DC 3UTSE 2V17H 1QYGL 4QRRA 3NZ8B 3DUHA 2BNRD 2ZZUT 4XNYL 1S9XB 2NY6C 3I6GA 5C2UB 1AP2B 5EOQH 4PRNA 5E95B 3WE6A 2CO6B 4MAYC 2HRPH 4HIEB 4TNWF 5C9JA 1KJ2B 4NZRL 1M1SA 5FYLL 4HDIA 1WC7B 2NX5E 3C8DA 4L4VD 3H6JA 5C7XL 3GSVA 4ZUTB 5JW4M 3MJ8A 4PJGB 3W9DB 1BFOA 3AXLA 2IC2A 2VSCA 5EB9A 4TPRL 3CFJB 1YDPB 4HULB 2DMKA 3MLSL 2C1PA 1PW3A 3MCLH 1K8DA 2VQ1A 4FRWA 1MY5A 4MAYA 3H7LA 4D0DA 5GPRA 4M1CC 5E00A 1H3GA 3C6LC 5TQ2H 1SEBA 1FFOA 2H26B 3CK0L 4MJIB 2FGWH 5KVMC 1BZ9A 1E6OL 3VD3A 1WUNT 1SJHB 3UP1A 3MNVA 3U4EB 1MFEL 5EU6B 1A7RL 1ZS8A 1FFQA 2IPUG 2XWTB 2VERN 2V2WB 1WEJL 4L4VB 3CVIH 2QSCH 3BEVB 4KXZI 4NQDD 3GMOA 2DTML 3O3EA 1H8SA 5EO0B 2VRAA 4GAJH 1JUFB 1NJ9B 2XZAL 1X5ZA 3D0LA 1JHKL 3MUGB 2D0FA 3PWVB 5IKCB 4U7SA 4YQXH 2G2RB 2K1MA 3LKOB 4JHWH 1YEEL 2H45A 4XP5L 2XOTA 1TPXC 1KTLB 5ICYA 2NLJA 3SDCB 1S7QB 3JWOH 1GXEA 2ITDA 3SDYL 4Y4FD 3SGEI 3UAJC 1ACZA 4XPTH 4P5TA 1F97A 2EIEA 3L3IB 2DKMA 1T0MA 3U7AA 4I8DA 5DHXB 1G6RH 1BD2D 4PJXA 4LIQE 3I6KB 5DFVD 2VLKE 4JKPH 2CIIB 5IGXL 3FO0L 3VXOB 3G5YB 3H42L 3KGRA 2NTFB 1ADQH 4LQ1A 1G1YA 1ORQB 5HD8D 4HH8A 1DN0B 4Z7NF 3RA7L 4LKCA 4O2FB 4KQ3H 5IMLB 1JK8A 3TVMD 4DUVA 4MNGB 1JPSH 3O0RL 2AQ1A 4JB9H 4LSSH 1HYSC 1HHGA 1DQLH 4B7IA 4AL8H 4JN2B 4NFCA 4K3GA 5IJKA 1BHGA 1UEMA 3DVGA 5HY9B 3OV6A 5D5ME 3UAJD 1NGPL 3MRKA 1QFUH 4U1KA 4IIQB 3STLA 1BPVA 3QG7L 1NC4D 1UWEH 4QRSB 4M93B 3LEVH 4U6XA 2FJFB 2YN5A 5C0GB 3H2WA 3OB0K 4MCZB 3F58H 1KELL 3NABL 3B6SA 2DMCA 4KVCH 1CXEA 3MOQA 4G5ZH 1Q9OA 1S9YB 3P4MA 2W0PA 2XTJE 4YFDB 3J7HA 3MRNA 4CU6A 3MSPA 4R6UA 4EI5C 3OR6B 4KAQL 1KPUB 1MCEA 5E5RB 2BNRA 1TJGH 3O9WB 1NBYA 3F8UB 1F90L 2F5BH 1H5BC 4NDMA 5DYOB 1JPST 1QEWB 1AGDA 3F6IA 5EU3A 1XH3A 2YD1A 3RNKB 2P5EA 2YKLH 3KS0H 2NZ9C 1T4KA 4NNYA 1RZKH 5TE4H 3S5LA 5FYKE 1GOFA 2XZCH 1AC0A 1ND0B 4P57B 4OCYH 1RU9H 2K3TA 2VDOL 4JPWH 1CT8B 1MREH 5I8EB 2HFFA 2XN9B 3MXVH 5DWUH 1EFXD 4NO5B 1I1FB 5E8DH 5JDSB 4EI6B 4HJ0D 1J0IA 3MZTA 4Y19D 4PJFE 1AY1L 5EPMB 1H3XA 5C0BB 2C3WA 5LAXA 4G6KL 1D9KB 2MCPL 4ETQA 4PJIF 1EGJA 5A3ID 5DEFB 3V52H 1AXTH 2IAMC 1IC4H 1KB5A 1MRFL 4A6YB 4OAWB 5C9KA 3JTTA 3JWOC 2FRGP 3WFZA 3GHBL 2NW2B 3IXAB 4OCLC 1WICA 3QNXB 4X6DA 4KHXH 5E2TH 3Q6FA 3NFSL 1SM3L 3JV6B 1EEYB 3CMOH 1RZFL 2QR0B 4X7TA 1MPAL 4J1UB 4DZBA 3E6FB 1QOKA 1UXWA 3SO3C 4IIQA 4NQDB 5DDHB 1S7VA 2P5ED 3MRHA 1HN1A 1ZLUK 1INEH 4AEHL 4H20L 5C07B 3DRQA 3VFVB 3VGGA 1KTDB 3VXUB 5FGBC 4I4WB 2FCBA 4KTYA 4YEEA 2X4OA 3C5SB 4E5XA 5C70A 4ZFZB 1N7MH 1E4XH 1ZMYA 5HGAB 3DUUA 2EZ0D 3B9VA 5EIQA 2OX5A 2P42B 3TNMB 3CSYB 4RAVA 1Z6JT 2A77L 1PBYA 4Y0GA 1KUMA 3O9WA 5GHWL 4DKEH 4HPOH 3GKZA 2B4CH 2DQTH 1M6OA 2V7NA 5FB8A 4ODVL 1DQJA 1AXTL 3S4SB 2ATPA 3KXFD 2BXYA 4PJ5B 4D9LL 4QWWD 1UH3A 1XCTA 1AY1H 4EI5A 3T4AA 4WFED 1L0YA 3FB8B 5E08L 1AR2A 4LEOA 2F9BT 5DWUL 2DLHA 5J57B 1T03H 4P0DA 3EYSH 5I1IL 1CGXA 3IFPA 3D69B 4HH9A 4LRNH 2HT4C 1QTYT 4V1DA 5D7IB 3O9WC 1WBYA 5GS1A 5BW7A 3KJ4B 4K7PH 1D7FA 2V5YA 1JZ5A 1L7IL 3JV0A 4HUKB 3EOTL 4O2EB 1A47A 4NKIH 5D96B 4IMLB 1YEJH 2XZZA 3PWPB 2GSIB 4CNIB 2GAZA 3BE1L 1JF6A 5DQ9B 4BZYA 5E2UH 3PP4H 3H0TA 3M17B 1ZGLP 3KPNB 1KN4L 2D7PA 5B8CB 1NDGB 2FJHB 4JDZA 4KZDH 4NO0B 2VQTA 4KAQH 2WAHA 2P5WE 2KPNA 4F8TA 3WFBH 5I30H 4UDTB 3RDTC 2VDQL 4DKFL 3O8XA 4M5YL 1U93A 1U8PA 1V7NL 1WTLA 3BZDA 4FQQB 5H35B 1CFQA 1P7QB 3O45A 5GGRY 3BH8A 3DPBA 1FGNH 1K4DA 2X44D 3OKYA 3C60B 3NABH 5C8JB 5I18L 4ZS7H 3QEUB 4WUKL 1LD9B 4D3CH 2WLYA 3OJ2C 3QXDA 1YPZF 4NWUH 5BRZE 3U1SL 4NJAH 2XQYK 3RKDC 4KDTC 1UKQA 7FABL 1O0VA 4UV4L 3K4AA 3EJZC 1BF2A 5ESAA 1T89C 4HF5L 1SVZA 1BJ8A 3KYMA 5ENWA 3IJYA 1HSAA 4Q74A 3KPSE 3LVEA 2QQKL 1NPUA 5EO1B 1S8DA 4G6JH 2Z8WC 4QCIA 3HR5A 5K9OB 1NBZB 2YUZA 2V6HA 3JUZA 3TVMA 1OPGL 3OJDA 1NMAH 2Z4QB 2UYLB 1JPSL 3LKQA 4FFZH 4M5ZL 1DZBA 3Q1SL 32C2B 3S36X 4ZUUA 5SWZD 3FOMB 3FB8A 5I8CA 2ARJA 3RA7H 4K3JL 1FNEB 4HKZB 2QTEA 4MJ6B 1ZE3C 2DL2A 4TUOA 5KVDL 3GUTB 2DJ4A 2RHEA 5DHVB 4DVBA 4ZFOL 1ZTXL 25C8H 2YA2A 3QDMD 3MV8D 4TVPE 4CADA 1X5XA 2NY6D 1QPPA 1LE5A 3SGKA 3QIWD 3OX8A 5I19H 2DQCH 3S34L 1SBBA 1OP9A 5IW1B 3S3SA 5FUZL 3OGCB 1JGEB 5AUMA 3HLAB 5LWYL 3LRGA 3SDYH 4MLIA 5GGSA 3VDCA 4NOFA 2W9DL 1TETH 4HHAB 2MQ0A 4K71C 3LKRA 4P2QA 1TVHB 3C6LA 4EN3C 1JNNL 1KTRL 1NEZG 2AXFB 2BMKA 3GK8L 3VRIB 1YN6B 3MRDB 3MLVH 2OR7A 1SMOA 3EHBC 1Z3GH 2JF1A 3G6JF 2P5WA 2WUBH 2IH3A 1FFNA 2Y5TA 1Z0NA 4F7PB 3F5WB 1LNUB 2GFBA 2F5AL 2DTMH 3ALWA 3VFMA 2PN5A 2EDNA 3S97C 3D39E 4M1CD 2HLFD 2AJXH 4JHZA 3MV7D 1YMMB 2VZTA 1TDQA 4X6BA 2HVJB 2DQDL 2BVYA 3KYNB 3CVHH 2DQUH 4GUPA 1GZPA 2AK4D 1J10A 3H7BA 4NHCH 3ELAT 5JNYB 4HV8A 4DKDC 5BVPH 5K33A 1PYWB 3CK0H 1ZLWK 4ODXA 3VMNA 1YMME 3G04B 3BP5B 2BXZA 2QQNH 5HPOA 5DVKA 3KPLB 43C9A 1CICC 3SO3B 4C56A 5EFIB 1XGTA 1U93B 3CCHA 5KTEL 4X0KB 2R4RL 1A6UL 3QDJB 3QNZA 1WBXB 4L8DA 3JV4A 3HZVA 4HKBB 2BNQB 2D4DA 1WFTA 3DUSA 2WW8A 4GKNA 3D2UB 5ETUA 1C16A 3U82B 4Z78B 1NLDL 1EHLH 1S5HA 3WIFB 2D03H 3QUMH 1B9ZA 3C8KA 2ZP0T 4JZJC 1KYOK 4KKNA 1CXHA 1FH5L 4ZPTA 5ELIA 4IM8A 1UCTA 1UWXK 1A0QL 2ZJSL 1NBVL 3BGMB 5CCKL 3Q5YA 4HX1A 4JRYA 1CS6A 5DA0B 3QDGD 4QOKB 1P7KA 5DMYA 1FZMA 1R3HB 1N0LA 2Z35A 5IG7B 5MP6L 5JNYA 4S1SH 1DN2A 1T1YB 5KZCB 3PHOA 4GQ9H 4PRPA 2XXCB 2YPKA 3FTGA 4TUJA 2VXQL 3QCUL 3ZE1F 4QHNA 4HGWB 1ONQB 1W0VB 3MXWH 3AY4C 1SQ2N 1HXMA 1UA6L 5LQBH 1T04B 1JNLL 4YO0A 4ZTPH 3O6LH 3GMMB 4GRLB 3KYKL 4U1NA 4ZOBA 2IF7A 3QXUA 1GGIL 4UQ3B 2IH3B 3EBAA 1JZ6A 4YDJA 2X4QA 4POZC 1RJLA 3MRIA 4ETQB 4LSRL 2XA8H 4JG1H 1J1OL 5MEQB 2DWEA 5F89A 4FABH 2GTWB 4P2QE 1JRHL 2GK2A 4F33B 4Y4KA 2EDFA 3MC0A 1TMCB 5T5NF 2NY5L 4PJCB 2K7PA 4XXDB 3EGSB 4APQB 4IRJD 3BO8B 1N2RA 2VXVH 3WLBA 2L7JA 3PWJB 1DQDL 1QRNA 2BRRH 4YHOH 2ORBL 2OQJB 5LBSL 4UV7H 3QO1B 2F74A 2NY4D 2P8MB 4JQVC 3RIFK 3HNVL 3OKKA 1MFBH 3HI5H 2XQBH 5TQ0H 1REIA 1M7XA 1PSKL 4YHIA 3U2SB 3BD4A 4ZFOA 5D6DA 1U95B 3GIVA 2A0LD 2A6KB 3P0VL 4C59B 1B6UA 2OP4L 3DRTA 4RISL 5ALBH 3A67H 4QY8A 5I1GH 1R0AL 2DOCA 2IG2H 3WFCH 1ZHBA 3BI9X 3CFJA 4KJQC 2OL3A 1X5HA 5J9PB 4R26H 2MQCA 3L3GA 5DHYB 3TM6A 3L6FB 1FNSH 1KN2H 1HH9A 1I7ZB 4WWKB 5EOTB 4OM1H 3LDBC 4HZLA 4Z95H 5DGRA 5F1NB 2NY4C 4JM2F 3VWKC 1FZMB 1CCZA 3MODL 3MRFB 4LAQL 3OZ9H 4JDVA 4NUJB 3BGFC 5DQDH 1BFSA 4PY7A 4X5WA 4QHMA 4FMFA 1CDYA 3S88L 1A7QH 2P5WD 5CGYC 3LPWA 5DTFA 4ZAKD 4NQEA 5M95B 4XB8A 1I9RL 4XXCC 4JE4B 3S35H 3RL1A 3D85A 4BUHA 4BSWB 1HQRA 1U3HA 4MJ5B 3E2HC 2BNUB 4QTHB 1BD2A 1T0NB 2Y4SA 5D2NE 5F89B 4DGYH 4D9RD 4QKXB 2GCYA 1LEGA 3REVA 5IFAL 2HG5B 2DBLL 4ERSL 3O6KL 1RJLB 3FONB 3MRIB 1R6VA 1JV5B 3T2OA 5MEPA 3TFKC 5DK2A 1IGCL 4WDIA 1VACA 1E0OB 1GIGL 3VFWB 4B7LA 3NA9L 4MVBD 1IBGH 4LLQA 4MA1C 4P5TB 1U6AL 5T1MB 2DICA 1HEZB 2VZSA 1KXVC 3QH3A 4Y5YC 3RUGA 3LS4H 2B0SH 1X5AA 1H9VA 1T04A 4NIKB 3DV4A 1UG9A 1N6QL 3NCYS 2BSSB 2WWMC 2AEQL 4ZFOB 1IAIL 5DD0L 4ZAKC 1NJ9A 4U1JB 4EN3B 1YUHA 2BFVL 2YPVL 5FKPB 3HZYB 5AZEH 4WFFD 1HYRC 1S7UB 5C0ND 2W65A 4M61B 2V2WA 1EBAA 4U0RB 2CUMA 1TJHH 3V8OA 5B8CA 4NP4L 4KTDL 2EEAA 4OM0L 2JELL 2UWEB 1MFCL 4WTXA 1FC2D 4HBCH 4G9DA 2ICWI 2VXTH 3NCYP 5DHVH 2W0KA 3VXPA 5F7LB 4EQ3A 2H8PB 2YK1H 4Z76A 1G7JA 4OV5A 5I1DA 2O93L 1FLRL 1NAKH 5IVZB 1VEPA 1QFOA 1K3IA 1ZT1B 1RULH 3HE6B 3KPSA 1BJMA 4YDIH 2NY1C 4LK4A 2XRAH 5I8OH 2EIZB 4UT6L 3BQUC 1FVEB 2AABH 3BKJL 5T3XL 1XR9B 1OP3H 5EA0H 3H3KA 1JGDA 4RA0C 4MQ7A 4K8RD 3SKNB 5D5MA 5FDWB 1NUNB 2RBLA 5FM5O 5L8JB 2V5MA 1JGLL 4JFQA 4MCYA 5M7QA 2CRIA 5HHNB 3FFCE 5F3BA 3BAEH 3WFDH 1G6RB 4UDUA 1P2CA 1RIVL 3HC3L 4NM4L 2YBRB 4TOYL 4ONOA 5L8KB 2HTLC 2H32H 1MAML 5SWQA 1X44A 4HIHB 1K9TA 3B3IA 3U2SA 5HYIA 4CGTA 4LP4A 1MFCH 4LCUB 1D5ZA 5EU4B 5GGQH 5DUMH 2A6DA 4PRDA 3L9RA 2WBKA 1T5WB 4OIBA 5DK0B 2XKNA 2DMBA 2GFBB 3U79A 1JZ7A 4PJFF 4FFVD 5IT2L 5KVFH 3WCYA 1I3VA 2X4UB 1U8OB 1F11A 2X40A 4MNQE 3D85B 4BQBA 1CLOL 1F8TH 3UO1H 4K3DH 4PRAA 3R4DA 4XI5D 4K7FA 4HT1H 3IDIB 2P5EB 3F7YA 4KXZH 1RMFL 4TRPH 4L29B 1FL3B 4LHUA 3TPUB 2JJWA 2X70A 2A9MH 6FABH 1G7PB 3NA9H 1WISA 2Y25A 4PJAE 3BN3B 4AQ1B 5D2NB 2OTWA 1ZLSL 4UNUA 3OKEB 2VDNH 2PXYC 5DEZA 1NLBL 1QRND 1QSFA 3O6KH 3ULUF 1IKFL 5JQ6H 4FS0A 3B5GA 5SWZA 1P69B 4I3RH 4O00A 1XF5A 4XC1H 1D9KA 1XAUA 3WUWG 4ALAH 5BQ7B 2D0HA 3FT2B 1G7LA 1KTKE 1I9RH 4U1LA 3DV6B 3VXSE 5ESVB 5ACZB 3VG9B 1H3PL 1YNKH 3TO2B 1IJ9A 3GBNL 4QRPD 4JO4H 3D2UD 4P4RA 3ULVC 1I9JL 5IFJB 4JVUA 4ORGB 3F7VA 1I9JH 1CK0H 1DLFL 4YR6A 4N5EC 3WJLC 3RDTB 1GGCL 5IVXE 3TO4C 4YHNA 4TULH 3QWQB 4P2RA 2A6JA 2RJMA 1KN2L 2RR3A 5BS0B 3CZFA 3BYYA 5DGQA 4FA8A 2HAZA 3A0OA 5CBAB 3ULUL 1FC1A 1BJ1H 2I9TA 4ALAL 1I4FA 3WFCL 3B5TA 3IXTA 5JW4R 3O41A 1GC1H 2ADFL 1LWRA 5DF0A 1UB5A 3VCLB 4EIZC 2M1KA 1A6ZB 1NLBH 1LP9B 3S4SG 1A2YA 2R2HA 1KF9B 3BPOC 4F7TB 4Y4FB 3ARDC 5LKNA 4H26B 5E6ZA 2ZSWB 4NQDA 5DDHA 5I2IA 2Z91B 5IHUH 3FQXB 4ZAKB 1CXKA 4FQCH 5CJOL 5ICZB 4G6AC 2BY2A 4TSAL 2MPAH 4ODTH 4BKLA 3GBMH 4PRDB 5D9SA 3VXRD 3QIWC 3DHMA 2HTKC 5T1DL 2H3NA 3MNZB 3D3VB 5JZ7D 5I15H 4H88H 2Z93A 3FFDB 2VLKD 4DCQB 5KVFL 5C0FA 1JRHH 4JG0H 3PXJA 5IBTL 1CG9A 1Z9MA 2LABA 4Z9KB 1PY4A 1LK3H 3O6MH 4R7DA 5GS2D 2DIJA 4YXHL 4BQ6A 5F3BB 2RB8A 4MQXD 4LSTH 3TWCL 4YK4B 1KIPB 3KPMB 2BVUA 1NFDE 2YA0A 3W5MA 1UADC 3U30B 2VLKA 1AR1C 3HZMB 4C56D 3BSZL 4UIMB 1FDLL 1AXIB 2UY6A 1IGJA 2Q76A 4IHOB 4WCYH 5DEGA 3HNSL 2WBJB 4QLRA 3JVGA 4WW2B 3MRLB 3PWUA 4GO6B 3MRPA 1YEGL 3RIAF 2DQIH 2G60H 5J13B 4QTIH 3L7FA 3N9GH 5D2LE 4ZNEE 4TSBL 4RZCA 2H2PD 3O45B 4GQ9L 2D2OA 3C2AL 4WIQA 3VH8G 3MBEC 1XIWA 5JPMA 4KK9C 1EUTA 1Q9KB 1JYVA 1UYWL 1QFWM 3IDIA 4X9IA 3RPIA 2YRZA 5CJ5A 4OLEA 2FD6H 2UYLA 1AXSA 1B2WL 4LNRA 3EFFB 3WN5C 4KRPB 1CDBA 1F45A 5EC2A 2W59A 3CC5A 5HVGB 3O3BA 2ZOKB 5T33L 1WFOA 1CU4H 4U1LB 3TBVB 1CXLA 1DUZB 2VISA 4IRJC 1IMHC 2L7UA 4OM0H 4M00A 3WHE0 1NGXB 1S9WB 1NC2D 2AV7A 3UDWC 4HUWA 1CLZL 2R4RH 3FB7A 4WENB 3EJYC 4AH2B 5C0BD 3AAZA 2O5XL 4XBPA 5EUOE 1NFDF 3LQZA 2DQGL 1E28A 2XN9D 3VFWA 3QJHA 4KMTH 3HUJA 5D2NC 3QUXD 5BVPL 1FYTA 4CN6A 4JANB 1RHHB 4U1GB 5E8EA 3ULUD 2DQUL 2OTUB 1EXUA 43C9B 2DQDH 4POZD 2JIXB 4PJIA 5FKAB 1TXKA 2J8UF 4KK6C 3VMPA 4GRLD 3ULVL 1MI5E 2AJXL 3Q2CA 1NSNH 1PYWA 4QYOA 3GSWB 4PJGF 1QKZL 5FEBA 4MMZC 2FECI 3VXMB 4DGYL 2Z92A 4MXQD 3S35L 3NACH 4MMXC 3ZKMD 2AAVA 4PYHA 2VN7A 2Q8AL 1FJ1B 3MRGA 2VXUH 5HGGS 3VJ6A 2VDLH 3BIBX 3MV01 4Y1AA 1JNNH 3IKKA 1H3WM 4NUGH 4EJ1C 3MRCA 1FNGB 2X4TB 3U7YL 5DMKB 3AAZB 3OKNA 1A4KB 4LAQH 3IF1B 1WBZA 2MKWA 5DJZA 5FUZH 2P5EE 5C08E 4PTUA 1KT2B 3BKML 4OGAC 4YXLL 3ARFB 2DM7A 2YC1A 3V6BR 1J8HB 3QXVA 4UTAL 4HEME 4L8CB 1TVBB 1LDPL 1RHFA 3QIUB 5EU7C 3EAKA 3MLUL 5F88A 3IU4H 1MF2L 4F37F 3SBWA 4P57A 1CDUA 4QRUB 3RVTD 1EO7A 1IC5H 1R0AH 2G5BB 3BRDA 1KJ2L 1NMAL 3IDNB 3P0VH 2PYFB 4Q6IB 4OZ4A 3B9AA 2QQKH 3GJFK 4PGDB 1U91B 2WWMD 3CFIC 4HS8L 4X4XB 3SKOA 5DD1H 4X5LA 3KR3L 4RGNC 1RD6A 3FQNB 2BK8A 1EA9C 3EYUH 5GZOD 5E00B 5FV1L 3BIKB 3WO3B 4O2CA 1DR9A 4BFIB 5I0ZA 1RHHA 3QHZH 4N0RA 4P5TD 1ZWIB 4D0BB 4WUKH 4WU5A 3RL2B 1SJXA 2Y36L 5GIRB 3SN6N 4FFWD 1F4HA 5AD0B 3FO2A 1V7NH 4NBYB 3K8LA 4FABL 3WFHA 5FA4B 1M05A 4RRPA 1J1OH 2XNAA 3SE4C 1BF8A 1MLCA 2BVOB 5DRWB 3HB3D 1OGAE 4MNQA 1S7TA 4G42B 3C5ZC 4Y5YB 3DGCR 4MS8C 1KC5L 5HDQH 4M1DL 1KN4H 3EJJX 4JVWA 1GGIH 3DYMA 4HKJB 3VRJA 4JFOB 4HQQL 3GDBA 4HGWA 4IEFB 1BQUA 1HKLL 5B39A 3O6LL 1U58B 4M6NH 2PTVA 2VZ3A 4FQJH 4KKLC 1J05A 1UA6H 2P45B 3IETA 4B0MM 5ADPH 1ZLVK 2VXQH 1DCLA 3QCUH 1G0YR 1CIDA 1BBDL 2OTPA 3O2VL 5ADPL 4M9OA 4S1SL 5HVHB 1S7RA 1FO0A 3QDME 4TVPD 3C8KB 2AI0L 1P53A 3FN0H 1FVCA 5E08H 4QYOB 3MLTB 1MJ8H 3WNLA 4MA7H 2R23B 5CCKH 3C5ZD 3ZT6A 3RNQA 2HVKB 5E5UB 2ERJB 2BCKA 5TE7L 1I3RA 1BFTA 2E27L 3F12A 4BUGA 4OCMC 2UZIL 5F97E 5C0AD 2UV3A 2FHBA 3CZFB 1F4XH 1LO0H 4PTUB 2JJTA 5T5FH 2NZIA 5DMGD 4DKEL 2C5DC 3TV3L 2GT9A 4N9GB 3LRSA 4FTVE 3MRBB 3I9GH 3HA0A 1AHWB 1IGTA 2A77H 2P7TA 5CZVH 4UT9H 5ICYB 4XCYA 4G9FB 4QRSA 3GIVB 1RY7B 4U6XB 3ZKNC 2ID5A 4W68A 4XMKH 4JPVL 4C57C 4PG9B 5D7LE 5IB5B 3VXNA 3L3HB 1XIWD 3MRKB 4WUUA 1WTGT 3ZDZE 1MRCL 5DSCA 1JI2A 1DJSA 1U92A 5F9WC 1RZFH 4ZNCD 3PQYB 5FUOH 4UOJA 2EXWD 4E9LA 1UM4L 1SM3H 4LDOB 4OZFH 1N5YL 5I1CH 3G5VB 1RJYA 2DQJL 1BD2B 2DJSA 4O2FA 1IC5L 1NC2B 4KUCD 3QQNA 1JK8B 3UBXB 3Q0HA 4PTTB 4NNYB 3KAAA 5HYSA 5CLTA 1J8HA 4B50A 4ONFH 1WZLA 5IB4A 1ES0B 4EXKA 4Y2DC 3U6RB 2FATH 5EO9A 4N0CC 2YEZA 1FCGA 3TGXA 1TZIA 5DYOA 3NCEB 1QQDB 1AO7D 4JO2H 4DQOL 1OTSD 4HKJA 4YBQD 5DZLA 1MEXH 5FUCC 1DQQA 3RBSA 3GM8A 3H3PL 2UZXB 2CDFA 2DI8A 3GMQB 4X8JA 2BNRE 1CFNB 3D6GA 4PJ5D 1GZPB 1AGEA 4R8WH 5DEFA 5DZOA 4K7PY 1DSFL 1LEIB 4OCYL 3SPVB 3MNZA 4D8PB 2GTZA 2XZCL 3ZSSA 4HIEA 2EDJA 1FNEA 2LU3A 1OGTB 1A1NA 1G7QB 2BNQD 1CL7H 4G9FE 4I5BA 3KVQA 1DBAH 3UTQA 5I8EA 5DD3L 4JAMA 5KVDH 4QTHA 2FBOJ 4RMSA 4GG8B 3MCKA 4ZPVA 2XG5A 1PLGL 3WDHA 2NCMA 4U1KB 1Q9WB 3ZHDA 1P2CB 1V05A 5JOFA 4P23A 2X4NB 3ULVH 1C08A 5D70L 1KENL 2EIDA 1AD9A 1CTNA 3PWNA 5HYEA 2F8VA 3C6LB 4HD9A 4I48A 3C8HA 2X1WL 1INQB 4NZTL 5A2LH 4P9ML 3RU8L 4JKWA 1CFSA 1KLUB 3VA6A 1KPRB 3ARVA 5B38A 5L7XL 1F58H 4Z0BL 2NY2D 4X5XB 4WFHD 5DT1H 2VAAA 4PG2A 3L5IA 3PDDA 4CKVX 1UWEL 3T0VA 1FL6B 5HGAA 4ZS7L 3AXLB 1DBMH 4Y4KD 5DRZA 4JJ5B 2X4SB 4Y2DA 3OKLB 1CGYA 1T66D 3QHTC 1QVOB 4U31A 2XFXB 4RX4A 3DX8B 2BVPA 2V2XA 3O3BB 3NAAH 5I30L 4PRHA 3UTQB 1CU4L 1NFIA 1KENH 1NUDA 4LSSL 3T09A 3B5HA 3WS6A 2R4SH 1I1AB 4WW2F 1MCHA 4PJEA 3GMRB 1U3YA 1XEDA 1J18A 2VLJE 3ARDD 1X5YA 4I18A 2FIRT 1DQMH 4D2NA 3PP3K 3B3IB 4OZFG 3HUJE 5J1AA 5LGHH 1VSCA 4LLMB 5DD3H 1DBAL 5TE6L 5DS8B 2DD8L 3QJFA 3B2VH 3D69A 4D94A 3MRBA 4LMQE 1QSFB 3IKCA 1XGYH 1SEQL 4YXKL 1G84A 4XPTL 2DQIL 2G60L 2E5EA 4ODUB 4JY5H 1RVFL 1UQSA 4LRNL 5D2NA 1G1CA 3BPCA 3EYSL 3VRLE 4K7PX 1T03L 2Z31C 1AGCA 1YEEH 3BSZH 3PIQA 4G6AD 4LBEA 2FYYA 3GSNB 4OZHF 4RFNC 1MEXL 1M6OB 1MHPH 1K4DB 3GKWH 4PB0H 1KCKA 2F54E 1IT9H 2DLGA 2NLJB 5B21A 1JTPA 4H25A 3SDCA 4OZIA 4P59L 3T3MF 4OCNC 2GAZB 3ARBB 4XZUB 4KGLA 3RVXC 3TH4T 3X12A 4H88L 5IB4B 1BIHA 1OP5K 4OFPA 3VGAB 1MAKA 2OSLA 1IEBA 1JHLL 2OS7A 2YD3A 3TEUA 3K4DA 1UM4H 1J11A 4P4KB 2QADD 3FT4B 1WBYB 2XKUA 4WY7H 1INEL 4AEHH 3MJ7A 3ULSA 2Q1EA 5T1LA 4FQPA 1NGYB 4RMVA 1FCCA 1S9YA 3P4MB 2HT3D 1MJUH 5BQ7A 3RZCB 3FRPA 5A2IH 3ET9F 2ATPB 3C5ZA 5CZVL 3Q3GB 3QEHB 3O81A 2D9CA 3IDXL 2B1AL 1R3IL 3G9AB 4FNLH 4H26A 3TIEA 3QDHA 4XCFH 4LVOB 4L8SB 4L4JA 4XP9L 1LO0L 5C7XH 2A0LC 1F4XL 5J6GB 4HWUA 3BH9B 2CLVB 2R9HC 4NQCD 3BN9C 3BYTA 2YD2A 4DUXA 3HRPA 3ZMRA 3PQYD 3D5OF 2H6PB 3VXSB 1JZ8A 4XCEB 5KANI 3GGWA 4WO4D 1R5WB 4YLQT 5GRYA 4MX7A 1GGCH 4U3HA 5KSAA 1CDHA 5FGSA 4WU7A 3O4OB 4DFHA 3PHQA 1EH9A 3VWJC 4YR6B 5SX4H 1RU9L 2VDOH 3TZVB 3RVWC 1YQVL 4DCQA 5I1EL 1UVQB 3E3QE 4L9LB 2NXYB 2FZ3B 5TE4L 3NIDF 2AK1H 4KVNH 3OR6A 4BKLB 1XZ0B 4KI5C 1HYSD 4M6NL 4A6YH 5EOTA 5F6IC 2VZUA 3U48A 3ULVE 5DUPH 5DZNA 5D93B 1S7UA 4HQQH 3ZKMC 3PV6B 3X12B 2VWEC 1A6VH 4U2ZA 1AKJD 1KC5H 1RZIA 2VDNL 1AO7E 1LDSA 1Z2KA 4ISVA 3QT2A 3G6JA 4OF7A 5CD3B 5B4MC 5J6HB 1C1EL 3ZKQD 5CIPB 2UY7A 3WUWB 5KJRL 4NO5A 5JMRA 2EEDA 5BO1H 4MNGE 1N3NB 1J88A 1P6AB 2JCCA 2AKRA 1H15B 2R0LL 3ZSTA 4OFYD 2NXZD 3UJJH 2Y36H 4K3DL 5HGHA 1KELH 3AVEA 4XNQA 3QULA 3BDXA 3G6JE 4OQTH 3VFSA 4NO2A 2QL1A 5E70A 5ERWA 1MCRA 4GW1B 3QHZL 3TNMA 3TO4A 4EI5D 1RZ8A 2Y7QB 4GKZA 4MNQD 1BIIB 4BH8A 4PYGA 5E94A 1A6AB 5TFSL 1N4XH 5DJ0B 4XNMA 3WXWL 1MY7A 4X6CA 1MAMH 1ULVA 4KKLD 4WFEE 5AAMA 4XP4L 4PB9L 3QNXA 4X6DB 1JWSB 5F7EL 2BSTA 2VJXA 1X5GA 3OG4B 1A02N 2A9NL 1WCBB 3DX6A 1MF2H 3ZE0E 1IE5A 2UVEA 2W38A 5C1MB 3OAYH 5BJTA 2P24B 5EA0L 4A6YA 3QIBA 1VKXA 1UH4A 2P8LB 4U6YB 4OAWA 3W0WE 2NX5B 2ZUXA 5E1AA 5D7IA 3BKJH 5T3XH 3P9MA 1HINH 5D7KE 4X7SL 5HI3C 3WLWC 2J5LC 1A9EB 4JGJA 5ICXB 4XVSL 1YY9C 3GSUA 4PBXA 5I6XB 2EDTA 4JGMA 1NGQH 2NY1D 4ODWA 3FRUA 4OIIH 3KPRB 2UWEE 4J3WA 3EUUA 2ZUSA 2ATKA 3L5WA 3SCMD 1JZ3A 2R0WH 3IFOA 1A3LL 3PF2A 1LO3H 4NNPL 3KPRD 4YJZL 4JHWL 1AO7A 2B1HL 4H0IA 4X9GA 2Q8AH 5HYSB 2VXTL 4HBCL 2FEEI 2HKHL 4BK5A 4U7KA 3BPLC 1I8LA 4GAJL 5D1ZD 4RGNE 2A83B 5C0NC 2G9HA 4Z7VA 2PYEB 2R29L 5DJYA 4HWEL 5BS0E 1QR1B 3QO1A 3ARGA 3VG0L 2W60B 3QUYA 1FYTB 1Q9WA 2G5BA 4TTGA 2LV4A 3MBEA 4PRIE 3ARGD 3ZE2F 1CBVL 1ETZA 5DJCB 1FORL 4D0DB 2X05A 5C0CA 4GKSB 1N6QH 1N3NA 2ITDB 1L6XA 1NANH 2KL6A 2GSGB 1A3RL 3F65A 1B6DA 4RMTA 3SDDD 1RPQA 3PDOB 5C0DB 1IBGL 4LCYA 3VD9A 3MUZ1 2X7LB 2OL3B 1BVLA 3BQUA 4HUVA 3KPTA 1UWXH 1A4KA 3SOBL 1CLCA 1GL4B 2AV1B 1CFTA 1T6WA 3DMMB 1YPZB 2PNDA 1ZA3A 2DBLH 1CLZH 3SKMA 3RVUC 1IL1A 2R29H 3MRCB 3I6LD 2HJKB 4Z77A 1QUNA 2QLVB 3SGEH 2FHFA 4MHHI 1OTTD 1L7TL 3KS0J 2B1HH 1I8IB 4JN2A 4P48A 1R3JA 2G9HB 1BMGA 4JY6B 5ALCH 4PRPB 4BH7A 1A3LH 3D9AH 5T1KA 1MHEA 2IMMA 4RAHA 4PLJC 5C86A 1B2WH 3RJDA 2VKWA 3T3PE 3ROLA 4R96B 4U1IB 1QFWL 4OIIL 1AFVL 5D1XC 2C4FU 4M7KH 1NGWB 3MODH 4PJAB 4DEPC 4OLXL 5H8DA 2Z9TA 1QYGH 3M45A 1W72H 2YMXL 4NKMA 4Z95L 4NBZB 3WBDA 2WMPA 3IFOB 4R2GC 4NWTH 4NYLB 2E8ZA 4JFOA 2B4CC 4XCCH 2BSRB 4LVNC 3CX5J 3VXMD 4R26L 5D7JB 1WLHA 4G42A 3CSPA 4Y5YA 4OD2A 5D1QB 4ELME 5MI0C 43CAA 3ARFA 1LO5A 3RZCC 4JFEE 5ALBL 1TITA 3BJLA 3DBXB 4HKZA 3S35X 3FO2B 4MD4B 4B5EA 4JLRB 5IFHL 1LK3L 4U6TA 5ITBL 2QV2A 1OSZA 5EZOL 4JG0L 3HMXH 3OXSB 1ZVSB 2CDGB 3VD5A 4BQ8A 5F93C 1MCWW 5E4EC 1NCNA 3G08B 1J12A 1DBJL 3LQAH 3MPCA 4ZSOE 3LV3A 3GBML 3KLDA 2FR4A 2MPAL 4ODTL 4TSAH 3UPRA 2P44B 1QFPA 3LQAC 2E8YA 4OB5L 5C0BE 1KGCE 3HMXL 5BO1L 1XIWB 1H3VA 5HHOD 1NUFA 3BW9B 4M93C 3IU3B 4JG1L 1FZJA 1N59B 3V6OE 4M7ZC 3IGAA 4LSRH 4J4PD 2EO9A 1J1PL 1SYVA 1CGTA 2PXYA 3DECA 4GXUM 3NPSC 3C5ZB 1IGJB 4IHOA 3ZE1E 1YMMD 5DUPL 1X5LA 5CZXD 1NEZA 2JJUA 5GRVL 4HJGB 1MI5D 5C08A 1KCVL 3TBVA 4NN5B 3RVVD 5DRXA 4P5KB 3VFOA 1K2DB 3LKNB 1OW0C 4QRTB 1GYAA 2O5YL 1IGIL 3G5VA 4NWTL 4JO1H 4NZUH 1CG9B 2D7TL 4O4YH 1WC7A 3HCVA 1TQBB 1AIFB 4P3WA 4JGUA 1W72L 2YMXH 4X9BA 2CRZA 4G7YH 4QHNB 5GJTL 5IVNA 3PABB 5DC4B 5C3LD 1D5ZB 4M7KL 5DD6B 4HBQA 1QSFD 1NBVH 1WZ1H 2HJKA 1YECH 4X6DF 5HHME 3U9UA 4Z77B 2V5SA 2NYYD 3ARED 3MUJA 3PGCA 1SBSL 5ALCL 4FQXA 4MXWH 4K3EL 1YN7B 4ZSOB 1R5IA 1R3LA 1NLDH 3KWWA 5JZ7C 1L7TH 4PJBB 4MQ7B 3IJSB 4PJHF 4WWKC 5BV7C 5CINL 4Y4KC 3K7UA 1FG2A 4YX2L 2YWZA 5INCA 1JWUB 4YWGL 2FWOA 1R3IH 3QYCA 1T66C 3V5DB 2VLLA 3IDXH 1H8OA 1A6UH 1IKFH 2VABB 4R7NA 1K5NB 3D2UA 3R06A 4JFFD 3TPUA 5E2VL 2LTQC 2ED9A 3PL6C 4MD0A 3SOBH 4ESKA 5B3JE 1BOGB 4RBPH 1WBXA 1KJMB 4JCLA 3LHPL 5KSBE 3K8MA 2BNQA 6FABL 3S3JA 1RUPL 4PS4H 2RGSA 4WY7L 1FNHA 4TRPL 3L3KB 2APXA 4G3YL 4HT1L 4CVXA 3BUYA 3RKPA 3CVHL 2Y5EA 2HA1A 4NC1E 1JHLH 4W81A 2DM2A 3TH2T 1BX2A 1U8NA 3ARSA 5IB5A 1CBVH 3MUGA 3MCKB 4ZPVB 2ITCB 2R9HD 4QT5A 1OTUD 4BQCA 3IAQA 4UTBL 2YD7A 2CDGA 2I25N 4X98B 3H0TB 3M17A 4APQC 3V6ZA 5JLZB 1V3KA 3HPLA 2NXZB 1TZHB 4HIHA 5E9DA 3OKOA 1A1NB 2HT2D 4JPIA 1KACB 3MRMB 3QPXH 5BS0D 3DTXB 1CDIA 2HKHH 3L9RB 3SPVA 1RJZB 4D8PA 4EI5B 1I1AA 2XTJD 3PGDB 3GMRA 1JPGA 1LO3L 3LZFH 1G9NH 4RCAA 4QRRE 1SYSB 4HH9B 1TETL 1CFNA 1UENA 4LLAA 4Y19A 2OR8A 5AG8A 3OKLA 2W9DH 5FKAA 1RVFH 3C60A 4NT6B 5C8JA 5F7HA 4HEPG 4JY5L 5KBNC 5TDPA 1HXYA 3UX9B 5CP3A 4RIRB 2DTSA 4KI5D 4OKVB 3HFMH 1XGYL 3VE0A 3RGVB 4LFHG 4OJFH 5EU5B 5T3ZD 2AABL 2DQCL 3EJYD 2F53D 3VWKB 1KGCD 1FL3A 1A7BA 3EYOB 3B2VL 1DP0A 2DD8H 4P46C 2XWJA 3IS0X 4NRXA 2XRAL 5TE6H 4NKQB 3RHWK 2YEZB 3OJMB 3L3OA 1DANU 5LGJA 1RULL 5KSBF 1R3LB 4IDLA 3C09B 4R97B 5GRXG 1U3HC 1DUYB 1IKNC 3DX9A 5AG9A 4AT6B 4GG8A 5HYQB 3PGCB 3TVMB 1F02I 2X4UA 4UB0H 2YK1L 2VZOA 1A9BB 4LF3A 3FOMA 3QCTH 3MRFA 3FT2A 1N4XL 2PCPA 2VAJA 3O2DL 5E7BA 2EKJA 4TVPH 1A7OH 4NN7C 2BOBA 1FNAA 2V2TA 3CFDB 4XX1E 2EH8L 1F6AA 3VXSD 2WNGA 4AEIL 1DBML 4PJEB 4M7ZB 3RUGB 1KIQB 4ZUSA 1PEZA 3ZTJH 4PRHE 2BFVH 4NWUL 5H37G 4PJIE 3L3GB 3RWJA 1F58L 4RGND 4LP5A 1BREA 1HHJB 5EBMA 3T0EB 4EN3A 1LILA 3IJYB 5CJXA 4EI6A 1FGNL 1EV2E 1ORSB 4Z5RB 3RU8H 4KZEH 4Z7UB 3FQWA 3LS4L 4NZTH 3SE9H 1NMCC 1MI5B 2FJFA 3CPLA 4I3SL 1HQRB 3WFBL 4RNRB 1RFDH 1CT8A 1MCKA 1B0RB 5HY9A 2CR3A 3QIUC 1K5NA 5E7FA 5KSBA 4ERSH 1T0PB 3MUHL 1C5CH 2VLRB 3MV11 5DTFB 3M07A 3QXTA 1MAJA 4WI3A 4Z7OF 3V7MA 3SY0B 4WO4B 2V9QA 3AM8A 2YUWA 3E6FA 5FYJU 1T4KB 5I1EH 4M61A 1QSFE 3G5ZB 1DSFH 1G7IA 2MMXA 1F3JA 1S9KC 2BOCA 4LKXA 4MNHB 5I1IH 4XGZA 4EOWH 1P4IL 1VB9A 2BERA 5ID0B 3PL6B 1ZGLA 2BVQB 2WINA 5GSVB 4WFHE 4JO2L 2X4RA 5IV2B 3FB7B 2FJGB 4GBXD 4UU9B 2EDOA 2FATL 3HE6A 4ODVH 3L3DA 1ERNA 3B9KA 4XP9H 4BQ9A 2GITB 4MVBC 4XCFL 4HPOL 4P2OC 1DUZA 5HHXH 4URTB 1P6FA 1J7VR 2K7QA 3VXUE 3MGTA 3O3EB 2ZOKA 2ZNWA 3BDYL 5F7WC 1OARH 1MCOL 1T2XA 1V7ML 4N1HB 2R2EB 3ALXA 2R23A 5E99H 4AT6A 4XVJH 1QACA 2B20A 3HI5L 4J1UA 4PJIB 3SY0A 1YZZA 2FBJL 1LHZA 4MAUL 5F9JB 2OJZL 5I66A 1AD0A 3ORJA 3V79C 4GG6E 4Z7OE 3Q6FB 3H9HA 2E7LC 1NAMH 1KTDA 4UI2A 3VXUA 5EC1B 1XGQA 3HAEH 1DQDH 3K2MC 3PG2A 4IMLA 3C5SA 2H8PA 3QULB 5E2TL 3QG6B 3I9GL 3L3IA 5EH1A 1M4KA 3SQBA 2BVTA 5D7LA 4HLJA 4X80L 4Y1AD 4KRNA 5GS1B 2BNQE 4WW1B 4L8SC 2JCCB 4HIIB 2CK0L 2IBZY 4IOIB 4ONGH 4OCWL 4P59H 2XA8L 1Z9OA 1AQDB 2O5ZH 1T1ZB 5FM4A 4JFZH 5JORA 3GKWL 4G6KH 1HHIA 2J1KA 3TBYB 3IXAA 1HHHB 2HH0L 3QRFM 1KEGL 4MA7L 1MJ8L 4KKAD 3EW3B 3FN0L 4LMQI 2QKIB 2C7UB 4HGMA 2J12B 2AI0H 2Z35B 3C60D 4NN6C 2ICCA 1T1YA 1FNGA 3DMMC 5LQBL 1F6AB 4QRQB 4PJ8D 3GIZH 1BAFL 2WQRA 2X70B 4HKXB 1I1AD 1RZKL 3MJ9L 4L9LA 5L88H 2J8UE 1ZS8B 1K8IA 5DVNA 5BRZD 3DUUB 3MLZL 1AIFA 4JO3H 5EC1A 3RX7A 4P3DA 1EHAA 1HKLH 3IDYC 4F7CA 1TTFA 2EE9A 3VWJB 1U91A 4FZEL 4E41B 3P4OA 4JFFB 2DLEA 1TJGL 2ZJSH 3SCMB 1A0QH 3D18B 5AYQA 3WS3A 1NC4A 3K80A 1UB5B 2EE6A 2R4SL 4L4TB 2DWEB 1CD1B 5IHZA 2AVGA 1T7VA 4NKDB 3EYQC 5J6HA 5F1OB 1EHLL 5J9PA 3KPRA 2PR4H 3I6KA 4G5ZL 5E0QA 4QRUA 2X4RB 1EEUA 1QLEL 1KSRA 2A6IA 5EU6D 4XHJD 2C7UA 4UU9A 3HS0B 1GOGA 1JPFA 3SGKC 5TGBA 4NO3A 2BVQA 2WINB 4TUOB 2EYTA 2PW2B 4WHTB 4Z0BH 5L7XH 4GFTB 1E6JL 3TBSB 1KCUH 3ES6B 5CS7A 5TJWK 4U1HA 1KLFA 1KT2A 5CHNB 1QFUL 32C2A 4FTVB 5TH2B 3I2CH 2FLRT 4HS6A 5KANG 4OTXL 1Z9LA 4XGZB 5FO9B 5L2KD 1FO0L 1NFIB 3N06B 4AL8L 1EEZA 4XNMB 1DQLL 4JB9L 3O0RH 4I0KA 4Y88A 1KJ2H 1WGOA 2NR6C 3F5WA 4C56E 4Y4FA 2M26A 1CQKA 1OD7A 3KYMB 3RHWF 2W60A 3D25B 1OQXA 1JMXA 5IBUG 1A2YB 4DTGH 3AU1B 5E6IB 5HJ3B 1WIUA 5IOPB 4WEMB 4UTAH 2AXGB 5JQHC 4XAKD 3QXDB 2CKBL 4GW1A 3TO4B 4KDTA 3RZCD 4P4KD 4JKPL 1JL8A 5IGXH 1KPVB 3L7FB 3BKMH 3I02B 3GK8H 1U3JA 3L7EA 3OHXA 3TO4D 5JIIA 4LGSB 2GJZB 2NXYC 5EU7E 1M71A 5DHVA 3CXHK 4R8WL 1DBKL 3FRUB 2N7AA 2KZ1B 3RDTA 4XP5H 5LWYH 1R5VA 4NQCB 2Q3ZA 2VXUL 5I19L 3OGCA 5AUMB 3QQ9C 2Q8BL 4MZ2A 3T0WA 4AQOA 4J3TA 3OF6D 4RWYH 1NFKA 3NACL 3WFHB 1ZTXH 25C8L 1TZHA 3RWHA 4ORZC 4WFGE 2P8LA 3QJFB 1KCLA 3GSOB 5ID1B 4ONFL 1EAJA 3CVIL 4JRWA 4PLKC 3V6OA 2XV6B 2VDML 2CDEB 3DBXA 1PG7W 1A7RH 1OPGH 1MFEH 5IMMB 1N5YH 2OI9B 1L6ZA 5BW7C 3B83A 1FO0H 1P7KB 1S9VA 2H41A 4RZCB 2NY1B 3DMMA 5FUOL 3WIHA 2DKUA 5I2IB 3HTLX 4HF5H 1AO7B 3JWDH 1VEMA 1YN6A 3MRDA 5H2BA 2DQGH 1T3FB 1E6JH 3EYOA 4ELKB 3BGMA 4HC1A 4U3XA 2R15A 4HHAA 3EDJA 2O5XH 2VLKB 3T0BA 4TPRH 1HHKA 1KJ3H 1OSPL 3MJGX 1P5UA 2CKNA 1CI5A 3TV3H 2APFA 4GH7B 4WGWB 2NMSA 4L8DB 4L8SA 2FL5B 3PWUB 1JCKA 4HWZB 1IM3B 2VDQH 4DKFH 3B9KD 3HR6A 4MJ2A 2DIAA 4P9HH 1U8QA 5I1DB 1PQZB 2WM0A 5DQ9A 5TDNB 4GAYB 4XCNB 3SDXA 1DE4A 4CJ1A 4BM7A 4NZRH 4ZQKB 4NC0B 1NDGA 3BP5A 5FO8A 5D5MF 3VFTB 5EOQL 5CJBA 5E2UL 1B4RA 3O2DA 2PTUA 3ZDZF 5EO0A 5A16B 3QAZB 4JFEA 1CFTB 1BLNA 3VJ6B 5SX5H 3MJ9A 4QRTA 3O2VH 1HOCA 1C8PA 1KJ2A 4NQVB 1G0XA 2X1OA 3WJJC 4JRYB 1I8KA 3FRPG 3OXRA 2XWBB 5I74B 2N1KA 4OFVA 1SJHA 3VFSB 5GS0L 1AGEB 2J6EA 3B9KC 3HNSH 3BO8A 1IVLA 1FNLA 5CP7A 1YEDB 1FP5A 3BHBB 4BSVB 4WEUD 4AIXA 4LEOB 5T3XD 4M1DH 5C09B 5HDQL 2BSRA 2CGRH 1E4KC 4HC1H 4JFZL 1Q94A 1MSPA 2MJWA 2O5ZL 3IU3A 3BMWA 3NCMA 4LGRB 4PJ7A 4I2XE 1T20B 2EYRA 1KOAA 2DQTL 3K46A 3T0DA 1E4JA 4GQPH 4X80H 3T8XA 1JWMA 1OAYH 3MZGB 4W4OA 5T1DH 3TIDB 4JZNB 5MENA 1QLFB 3QBTB 5L0QC 4HAFA 2E9WA 2Y7QA 4O2EA 3F7VB 2VC2H 4XP6L 3EYUL 1MLBA 1Q0YL 2Y6SC 4IBLT 3QIUD 3HCVB 3WXVL 5C0AA 3S96B 5IM7A 4PP2B 1G7MA 1J8HD 1OGAD 5E99L 3ZKSD 4O51B 3QIUA 4PBWD 5K9OA 3RIAK 3LD8B 1H3TA 3NFSH 4NSKB 4MA8H 1S7SA 1HH9B 1UH2A 3UYRH 2ESVB 3VI4E 5AD0A 3GHBH 4ZQKA 4RQQA 2A74A 2V9RA 4PJ9C 2R2BB 1FL5A 3MLUH 3O8XB 1PQZA 3KLSA 1LP9A 4FTVD 3HZKA 4JRXE 4HG4J 5C6PB 3G5XB 5BXFA 1GHFL 4OLUH 4POUB 4CN1A 5JPNA 2FJHA 4JDZB 3MO1B 2I26N 4JVPA 3QPQD 3QRGH 5E2WH 5I71B 3HPJB 1JGEA 1KPRA 1MCSA 4J8RA 5D7LD 1FAKT 5E8DL 5KZCD 4UDTA 5FYJL 4EOWL 2BY0A 1U8MA 2ADJB 1AGDB 1MREL 3O6FA 3U7YH 2F74B 4GBXC 5HDOA 1LP9E 1JWUA 1U8IA 4U3CA 4QHUB 4CBPA 2IAMB 1MUJA 2LU7A 3MR9A 1EX0A 4WV1C 5A40E 1D5BB 3MRJA 2GW5A 4Z7QF 4G6FB 3I75A 4CN4A 3U0TA 1ND0A 5E6ID 4YNYB 5IB3A 2VB5A 3T1WA 2W9EH 5HVWA 1CGVA 5KAQG 3LKQB 2ZPKL 1OD9A 1WF5A 2DYPA 2L4OA 3NCBB 4XC1L 3MLPA 3T77B 3HUJF 3UPAA 2F5BL 4MA1B 1QKZH 3HZYA 1NMBL 5JQ6L 3BXNB 4QRPA 4I18B 1ZGLM 2I60L 3RIFF 5ECJE 3WFEH 4M4RA 2BSSA 1ZLSH 4JKLA 4NQXB 3GRWH 3FOLB 1U41A 4OSUH 4C83A 4G9FA 1YC7A 5A1AA 1HCFX 3GEWB 4FQ2H 4GBXA 4JFHD 2G75A 3LRSB 1RMFH 2WIMA 3UTSB 5BV7L 4CU8A 4XNUH 4YPGA 3IYLW 3NIFF 3EOBB 5IM7B 4HAGA 4WDIB 4P2QB 3MREA 4ODHL 2N4IA 4LF3B 2GK0A 2IAMD 3KPQB 4NKMB 2VLME 3LEVL 4BZ2L 2YUXA 5DQJB 2Z8RA 1LEGB 2BCKB 1IAOA 3REWA 4E41A 4JM2B 5HDLA 1S7VB 1A7OL 1FIGL 2P8PA 4Y5XC 3RL1B 4PJ9A 4WU7B 2F19H 1I8MA 4Q9QH 1J05B 3IETB 5A2KH 2O26U 3U4EA 1X5FA 1R3JB 3U46A 4J23A 3FQTB 5T33H 2OJEB 3W9EB 4U05A 4TOYH 3WNPA 4CVUA 3AB0B 4X9FA 1JGLH 3EYVB 5F6HI 5J1SC 2UWEA 1ADQL 3RUGF 4MAYB 3V5HB 4XBPB 3H42H 4KKCD 1RZJC 3I3EA 4UT6H 4CMHC 4G6MH 2GT9B 4JZOA 4N9GA 4I0PA 2IALB 3GMNA 4PGBA 1YNLL 3ARXA 1GZQA 4QTIL 2FDBP 4P5MB 3EDDA 1A4JB 3QR2A 3EYQD 4R97C 3GMLA 4LLDB 3TPKA 1I1RA 1LO2H 5BV7B 3RY5A 1FDLH 5MHSD 1ZK9A 3NBNA 4YBQC 3F12B 5CSBA 2XT1B 2F53E 4LSTL 1FIEA 3TWCH 1E4KA 4B41A 3DLQR 4KTDH 1WQVT 3GSQA 4OF0A 5IOPA 3K4ZA 4ZXBD 3T2QA 2Z92B 1FSKC 4F80A 3NA4A 2QSCL 4KY1L 1WWBX 4UTBH 1V3LA 4ZXBB 5HYJD 3JWDC 4Z78A 4Q9CA 1OM3L 2QHLA 3EGSA 2V9TA 1KEMH 1TQBC 1U8OA 2IADB 1EAPA 4HIXL 1RJYB 4OZHA 5IR1A 3WJJA 4R4NC 3ABZA 1KYOJ 3KDMB 4P2CG 2FX9L 3MGAA 3X13B 4AK1A 5D1ZA 1MIMH 5FCSH 4FQCL 5CJOH 4CW1A 2NR6D 4F9LC 4HUNB 1FHGA 1BFVL 4MA3B 4PS4L 5TQ2L 4U1GC 5IEHA 1XF3B 5H2BB 1GIGH 1TTGA 2X9XA 5EBMB 1QSED 1JVKA 2WANA 1U8HA 1KJVA 2ADGB 5FAAA 3OB8A 4EDXA 2DWDB 5F1SA 5IFAH 3K0WA 5GSVA 4NQXA 1KCRH 4YX2H 1YMHB 1EVTC 3OWEA 1JWSA 4TNVK 3V4VH 4LKXB 4JDTH 4H5SB 1I7UB 1KB9K 4PJFA 1OT1A 3ARUA 3T77A 4DW2H 2CUHA 1WFUA 4MCZA 2BY1A 4YHLL 4YGAB 2YUVA 3N1MC 3STLB 5JW4N 4LCIL 4MAYD 5DQDL 4TULL 1N2RB 1TQCB 2HRPL 1MELA 3OZ9L 1A6WL 1ORQA 1G7LB 4CAGA 1FFRA 5E56A 1D6EB 3IDUA 4JO4L 3W9EA 3P4NA 4O4YL 2D7TH 4PJBF 3ULVD 2VUYA 4HKXA 4R3SA 4CUCA 3T2PA 3X3FL 5B38B 5ILTH 3TA3A 2PTTA 3HRZB 3PWJA 5F88B 1XCQA 5JR1H 5JHLL 3AMKA 2IQAA 2EDLA 2VDRH 4WWKA 2CR6A 2EDEA 3UYPA 4N9OB 5F8QC 4HZLB 4LPVA 1HH6A 3SKJH 4Y5XB 5IVXA 4Y16A 3TN0A 3VXOA 4P2QD 3RY4A 3RWDA 3HC4L 3WIIL 3G9VA 4WW2C 5F44A 3FQUA 2ARJB 1NCAL 1XGRB 3P30H 4YGVB 1Q9LB 5FYLE 5DJXA 2ENSA 5IESH 5I1KH 5JA9A 2APTA 5L6YL 3UTZA 3W0WD 1WT5A 1HEZA 4RRPG 1OQOA 1JPGB 1OGAB 3AROA 4R9HA 1A7PL 5LBSH 4UAOB 3GM0A 3ROOB 1DBJH 3LQAL 4X6BB 1CLOH 3HC0B 4M4PA 2H2PC 2B2XH 2GCYB 3ZKXB 2VOTA 1YC8A 4ZYKB 3V6ZB 1AD0B 3EO0A 3VXTB 2Y06L 3BPLB 5JLZA 3FQRB 2Z91A 3TBWA 4YDLC 3MV7E 4LAJH 3ZHLA 1VGKA 1UZ8A 2V2XB 5DVOA 2DQHH 1PAMA 3L3OB 1ROWA 1QLRB 2VIRA 5IB2A 1U8KA 5GGQL 1N6UA 2QQQA 5HDBF 5BVJA 5F7YC 3OQ3B 4Y4FC 3P11H 1XGPA 5E24E 5HPMA 4AMKL 4QNPF 4ZUWA 1Y0LA 3VFPB 1WK0A 4W6YB 3BAEL 3WFDL 3GSUB 5D71H 4ZTPL 2F54B 4JREB 1JNLH 4QXGL 4MLSA 3QISA 1NEUA 3KPSB 3ULVF 3CLFL 5DVMA 3AS0A 4XCCL 4KRLB 4MWFB 5SV4A 1QBMH 1ZSDB 3Q3GA 4LVHC 2P1YA 3S36L 3LEXA 2YWYA 5IW6B 4CU7A 3GFUA 5T1KB 1NQBA 2DI7A 4XPHH 3MROA 1MLBB 3CXDL 1EVUA 4HUWB 4P9HC 5IB1A 4FQIL 4KQ4L 5I16A 2X09A 4V1DD 3KPLA 3SGJA 3P0YH 3TZVC 5CLWA 3NGBB 1K3ZA 4DZBB 4NSKA 4JRXA 4WI2A 4ZOCA 1MOEA 3D9AL 3W2DH 1BP3B 3EO0B 4LNRB 3NFPA 1FRGH 3UTTA 3WNMA 3W5NA 3CFEB 4P4KA 1D5BA 3MRJB 3ARFC 2D03L 3QUML 5FKPA 3MJ6A 5JTWA 2PCPB 4LHUD 1FFPB 5BZDB 3B8YA 5BCAA 1J8KA 4WUUE 3VW3H 1TJHL 1YNTA 3F62A 5SWZB 4UQ2B 5DJ6A 3O2WH 4OUUA 1F3RB 4ONHB 5F7DA 1JTTA 5B22A 1QBLL 1EGJH 3MFGB 2YPVH 3V6FA 3GMQA 4X8JB 3FCTB 1KB5H 3MLWH 1UXSB 4P3CL 1SY6H 2EC9U 1VFBA 1G9MC 3QIBC 4FQQA 5H35A 3IDYB 5KS9F 4Y16B 2B0SL 3RWEB 2IPTH 4U1SB 3IRPX 5J6GA 4IRSC 2X6MA 1T3FA 4N8VG 1F4AA 1CLYH 4G7VL 4HG4K 3HG1E 3BD3A 3IGAB 2R0KH 3IS1X 1GCFA 1AC6A 3BN9D 4ZUSB 2Q7NA 4HXBH 3LCYA 1ITBB 4HWEH 3MQIA 2VL5A 1NAMB 3O4LE 1X4YA 2CKBB 2C3VA 3D0LB 2DYPD 2VISB 4KFZC 1PKQE 1U8QB 1Z3GL 1OGAA 3GSOA 2D31B 4GG6B 2HFTA 3S88H 4NJ9L 4LIQH 4ZMAT 2R0WL 5FECA 3IVKB 3MV7A 1UWGH 4OT1H 4F58L 1Q9LA 3VDAA 1U3ZA 3QIBB 4IJ3C 4IRSD 5E5MB 5GS3A 5A3IC 1VKXB 5T1KD 1BBJB 4K07A 4XVSH 1XCTB 4OI9A 3S34H 2YZ8A 4LPTA 2R8SH 4X7SH 4DWHA 1HINL 1IGML 3KPOB 3QUYC 1U8KB 4ZO9A 1FNSL 2GYSA 5GGSB 3BRFA 1LD9A 1I3UA 4M3KB 1WZKA 1T22A 1PDKA 4D0CB 4Q0XH 2HFEA 1ACYH 1U2HA 4K3JH 4P2OA 4KJWC 1JBJA 4K94C 5AYUL 4LOUD 4G6FD 3Q1SH 2IG2L 2R69H 3HE6C 5GSRA 4XP4H 1HCVA 4RISH 2OP4H 1VGEL 2J7LA 2RIKA 4P2RE 4L9DA 3G08A 4JQIL 4OKDA 5CEYA 1JPTH 5ID1A 4Q2ZA 1UT9A 4HPYH 1KCSL 3LN4A 3K81A 2XQBL 4NZJA 1FAIL 5D4QA 1MFBL 2D31A 4UV4H 5IFJA 4M7JL 2ITCA 4JREC 1DQTA 4E41D 5GGUA 4GLRH 3U1SH 5FO8B 5CGYD 3CU1A 5DI8A 1ZEAH 2VXVL 1FE8H 3V0VB 1P5VA 5I18H 4H8WL 4NCC2 1PZ5B 1D6VL 5ESAB 2VLJD 4WI9A 3SKMB 5JXAH 5HYJE 1JHTB 4IOIA 2CIKB 1MIEH 5JIPA 4HWZA 4XP1L 1HIMH 5KJRH 3U30C 5LVEA 1XF3A 3VD7A 2EDDA 1E4XI 1HHKB 4PUBL 5CWSB 4Z7WF 1EJ6A 5MEOB 4PGCB 3VCLA 2FWOB 3V5DA 4H1LG 1XGQB 3BE1H 5C07E 1ZLUH 1S7RB 1YEHH 1J5OH 4OCXL 3UMTA 3VFNA 1MFAH 4XPFL 1I4FB 2DDQH 2NPLX 2ARWA 3MLXL 4KV5F 4PJAA 4NKIL 4XWOC 4JFYA 3MXWL 3B2UC 4S11A 4KKAC 3OMZA 1AGBA 2E3VA 3LN9A 1G7JB 3F7PC 4JCMA 4OV5B 3GUTA 3EYFB 4LPCA 5DSCB 5SWZE 5MP6H 3NH7L 1QA9A 3I3DA 3D3VA 2A83A 1RSFA 5SWSD 4PD4K 1VFAB 4XBGB 4WHTA 4OZGE 1NBYB 5GRUL 1CDGA 1NDMB 3VGDA 2I24N 5SV3A 1JGVH 3K2UL 5HI4C 4N0FB 4WTZG 3LS5L 3T0ED 2VDKH 4HLZG 5I75B 5D2LA 4L1DA 2EDKA 4G43B 4LCWB 1QRNE 2P7TB 1FH5H 3U0WL 3T1FA 1RAMA 2VE6A 2X89D 4YBLC 3DETD 4HUVB 3MNWA 1CGWA 4YO0B 1N0XL 5ISZB 4GSDL 4F57H 3DO7A 2GSGA 4HJJH 1EZVY 4ZUTA 2NY6B 5CJ8A 5KVGH 4FNLL 2B1AH 1I3RB 3EOAA 3HI1A 5SWSA 5C0CB 3VXME 4P46A 1XR8A 4GUPB 3VWJA 3SE3A 3AS2A 4BZ1L 4IRZL 1AXSB 1MJUL 4H20H 1FJ1A 1QNZL 2AGJH 3NN8B 2PXYD 3MLYL 4PV9A 4NPYB 3C60C 4J3SA 5IHZB 1GH7A 4JR9L 3CMOL 4Q58C 1ZT4B 4PR5B 5I1HH 4JRXD 3WO4B 3WS6C 4OZFA 1I1AC 1MRDH 3ZTNL 4FQLH 3AC0A 2A1WH 1OSZB 1RZ7H 4IDJH 1MUJB 2GJ6A 2AJZB 4KMQA 4L4VE 3ZO0A 5JMOC 3NIFE 1XGTB 1JN6B 1U8MB 3RQ3A 1IEAB 5IHLB 3R8QA 4LVHB 3TBSA 5MEOA 4U1HB 4U49A 3OTTA 4Q7DA 1GGUA 1BFOB 2WUBL 3FJTA 3MMEA 4RQQB 3HE7D 4GRWF 4N5ED 2RCSH 5INDA 1KULA 1B0GA 1TNMA 2F8XC 1KXTB 1JI1A 4GKOA 3TH3T 3HZKB 4FN0A 1N64L 5E9DE 5D5MB 5FDWA 4JPWL 3DXAA 3N50A 1M7IA 3O4LB 5I1JH 2NQCA 4YXKH 1SEQH 4JQXC 2G2RA 3S6CA 4QRPB 2J8HA 2DLIA 4KHTL 4XHJC 4JZOB 4KTEH 3FZUC 4QXUH 1DQJB 4LSVH 4O2CB 5C0CE 3U9PH 1FGVH 3U6RA 3TNNA 3ULUE 3FHQA 1I8MB 4BA8A 1BEYL 5KW9L 3BIAX 1MHCB 1A6AA 3RX8A 2HP4A 4M8VA 2R2EA 5EBWB 2V2TB 1F90H 3RAJH 1DQML 3WL9A 4PFEA 4HW6A 4PGEB 3VMOA 5E8PA 3LQMA 4JM2D 2LTQB 4M7LH 4HJGA 3HE7C 1C7SA 3NAAL 4LLYA 4G6JL 2QJDA 4G8EB 5JW5B 3M8OL 2AKRB 2PO6D 4LKCB 4EBQH 5FA3A 5T3XE 5HHMD 1Y6MR 3R0MA 4GBXB 3VRLF 4YDJB 2PO6A 3O3AB 5C2BL 4XH2B 3VFNB 3F58L 7FABH 4S1RH 1UGNA 5F3HA 3UPCA 5B39B 1EHNA 5DT1L 1T2QH 4FXGA 5HHPA 3QFJD 4P5MA 3RGVC 4D3CL 1V5JA 3L6FA 4PIRF 1T0MB 2Y9RT 3QDGE 1TNNA 4PJDF 3A6CL 4GAFB 1T1ZA 3T0XA 4P9MH 4NM8L 2X4TA 3B6SB 3CX5K 5JOFB 1A14H 1AR1D 3C2SA 4OLYH 3H9SA 5I71C 4M5YH 5IV2A 3IF1A 2GY7B 4JM2C 5E9DB 4HXAH 2P46B 3T04D 1OCWL 4XMPH 2EYSB 1NDMA 5C07D 3PL6D 1UFUA 3STZA 3UTPE 1VENA 5D70H 4KZDL 4J3OC 3QQ9D 4Q6IC 5E4IA 3JV5A 4HS3A 3G6AB 5DJ8A 1F3JB 1JZ4A 1MNUH 1EAPB 5IR1B 5HYJA 1QRNB 3GJEB 5C09E 4KK8D 3X3GH 3P0GB 1MJ7L 1YEJL 5HYSG 1CL7L 1MCNA 3FO0H 4PRHD 3LD8C 1VERA 2JJVA 3EOTH 4O02H 1S3KH 1L7IH 5DR5H 3S3PA 2WP3T 1G6RL 1ZOXA 5DLMH 1DVFC 4P49A 1CF8H 3G5YA 4NRZA 5LG1A 2FH6A 3IDMA 4NRXB 3JWOL 4MD5B 4OZIB 1VA9A 2AJSL 1CFVL 4NQDE 5I17B 4OKVA 3VE0B 2FLBT 1WAAF 4Y5VA 5I1LA 3H3PH 2XACC 4NNXA 1QHOA 4O9HL 3C5JA 3IAGC 1FYTD 4D9LH 1NH6A 4CL7A 3PE9A 1JHKH 4ZSOA 3E3QC 4DN3L 4P23C 2BHYA 4HK0B 3KPOA 1GOHA 1N8ZB 4FOMA 1ED3B 3RZCA 4RFOL 5INCB 3FO1A 3MJ8B 4PJGA 2GJ6D 1YMMA 1AE6L 5CGTA 5GHWH 2X1PA 2V7HA 4XH2A 1DVFD 2DQJH 3MBED 2AJUH 4P46D 1IFHH 2IH1A 2CRMA 2JJSC 3JV6A 3NFNB 4WHYH 4XBEL 3LKSB 1D5XB 2Q86A 2P5WB 4HFWA 1XF4A 4MQTB 2LE9A 3I6LE 4QRRB 4CVXB 5D1XA 4AZ8A 5IROC 1ODAA 1MPAH 1I1YB 2Y1VA 3ZT5A 4H25B 1D9KD 3SJVE 2E9IA 3QH3B 1RUKL 5HYQA 4QF1A 3CFBA 2HFEB 4MSWB 2GY5A 3NTCL 1LVEA 4MX7B 1VPOL 2CMRH 4Y8AA 2Q76B 2X9YA 1A8JH 3NCJH 1G7PA 1QG3A 4LSUH 5CD5C 5C0AE 4PPTA 2J88L 4UINH 4CDHA 5JDJA 3V52L 2MTPA 2XN9E 3X14A 2UZIH 5C0EB 3VXPB 1Q0XL 2E27H 5BVJB 4OLWH 5HHVH 1GPOL 2MCPH 5IEKB 5TPWL 5IJVB 2D0GA 1B88A 2VDPL 4KKBD 3FN3A 1AQKL 1F11B 5CSZA 1BM3H 5F1KC 3FOLA 1AKJA 4EDWL 3PWNB 1YEKH 4M43L 5IWLA 2ZUYA 5C9JB 2ZUUA 2OXHA 2V17L 3OKDA 5SX4I 5FK9B 2XKNB 3MR9B 2GJJA 4W70A 2FR4B 3ESUF 4YHPA 1BBDH 5JOPD 3IDJA 3TCLB 5JIHA 5EZLA 3DROA 3RVTC 1E4WH 5EORH 1XF5B 4ZTOH 4FQJL 4P99A 3IFPB 1SJEA 4V1DB 3OAYK 3MRQB 2F15A 5DD5L 1G6RA 4UDUB 3VFUA 2JCCE 4V2BA 4GS7C 3JBG7 2ZUQB 4KJYB 2ZCLL 4EXPX 1EJOH 3N1QC 5FHBL 5I1AB 1H0DB 3GSXB 3RWIB 4JM4L 4C58B 2B7DT 4HFUL 2E7CA 5I73C 4MJ4A 1X5JA 1J0JA 2RQ8A 4KVCL 1UZ8B 4BH8B 2XIDA 3D39A 4OUUB 4XC3H 3RY6C 4UAOC 3SJVA 5IMMA 1QSZA 3OBAA 4EQ2A 4K2UL 4X6CE 2XYCA 1BVKB 1OAZL 3DNKA 2P4AB 1XF4B 4H0GA 4PRID 2X4NA 3MV8B 3EDKA 3MA7B 4MNGA 3LOWA 4DGVL 4ENEC 1TENA 1OHQA 3THML 3CFEA 3BP6B 4WV1B 3RWFA 5GGRA 5BMFL 1J87A 4Y4HC 4PJ8A 2IH1B 4WFGD 1TVBA 5GISL 4F33A 5EO1A 4PJXF 4G80B 1YY8A 4O5LH 1NBZA 4XWOD 2DB8A 2V7HB 3DVFA 1SJVA 5E6IC 2AQ3A 3NMEA 4Y4HA 2J5LB 1N8ZA 3W11C 1AKJB 3C6SA 1LDPH 4ELMA 4YE4L 5BZWA 1I7RB 3E6HA 2XTLA 1ZSDA 5IJVA 2CLRA 3WDIA 3TLRA 1RK1B 1U8JB 2W0LA 4OGYH 4KH2A 4YEFA 2CUIA 2XZQH 3R1GH 3H3BC 3JXAA 1IZJA 2R2CA 4PREA 2VZ1A 3BJ91 3FCTA 2B5IC 4BJLA 3QDGB 1RQ5A 4NUGL 4G8GA 2ZKHL 2BDNH 5CP7B 4W6XB 4NO0A 3RI5K 4YQXL 1INDL 1BVZA 2R1XB 2YPLB 4X6CF 5CBAA 2DQEL 5GISH 1J0ZA 3V0AC 2IBZX 4FP8L 3V4PL 3QZWA 3KYNA 3BD5A 3THMH 1I3GH 1T1XB 2MHAA 1OLZA 3QHFH 4DGVH 1I8IA 4YHPB 4JEGB 4N90E 1K4CA 4ZUUB 4NDMB 3MROB 1XIWC 3IAPA 1HK6A 2EDHA 4K23L 2OK0L 4MQSB 2R1WB 3EZJB 4NQSB 4BELD 1OP3K 1U9KA 2ESVD 2IFFL 4Q2ZB 3HI6L 4X0KA 2X89A 2FGWL 3CGTA 4KMTL 3V5KA 2DS4A 1HSAB 5IWLC 3JVGC 5CHNA 5D1XD 3SDDB 4NYLA 2FECL 9CGTA 3PDOA 4HCRL 5C0DA 3G04A 4L4TA 2ICWJ 1KB5B 3MCLL 5FHBH 3NPZB 2I27N 3EJZD 1JYWA 5D7SL 4JFFA 2SEBA 4TQEL 1A1MB 3PP3H 1LMKA 3WKMH 2FO4A 4EVNA 2Y72A 2PTTB 1UCBH 5E6IA 2W9LA 5HJ3A 2P47B 4LHJB 4OD3H 5DJYB 5F71A 3QIWA 3X11B 4JFED 1KIUA 3CFKB 2D9QB 4LSPL 3DX7B 1BZ7B 4QGTA 1MWAB 4MDJB 4PJ8C 5DXWA 1DEEA 5FYLH 2FX7L 3LKPA 3WNKA 3IVKA 2FD6L 1KB9J 4AM0A 1TCRB 3RTQD 5JXED 5IROA 3RNKA 3MLRH 1UYWH 1EEZB 4DJMA 1EXUB 4DEPB 1IGYB 4XMLL 3C2AH 4ZOEA 5TH2A 2BHUA 1B4JL 1Q0XH 4TSBH 5LCVH 5GGTA 2VLJA 1HQ4A 4AIZA 2HLAB 3U7WH 4DOHB 5LJYH 1A1OA 3ZYJA 2VH5L 4R4FL 2F58L 2CMRL 3L5XL 3ECBA 1OP5H 4P4KC 2RFXA 4ETYA 3SDCC 4RGMC 5DO2D 1RUKH 4YAQB 2H2SC 1DFBL 4N8CL 1ONQA 1W0VA 3S4SA 4YXHH 3VH8A 5EO9B 4G80A 1RUAL 4K55A 4OUOA 4PJEF 5DMKA 4Z18A 4YHYC 2C3GA 3SGJC 3TZVA 3QO0B 5IBTH 4X6CB 2HLFC 3FT3A 4OF3A 3UEZA 4XVTH 1AGBB 3CC5B 3UCRA 1CWVA 4Y1AB 2R0ZH 2D7OA 4MB4A 4U1IA 3S8WA 5IT2H 4MHHG 2IJ0C 2X9WA 5I15L 5KSVB 1EO8H 2R56H 2HJLA 4LCCB 3S37L 1IFHL 3SJVD 4OLVL 4MB3A 4PJCA 4RA3A 2GSIA 4BK4A 1ZHLA 4JRYD 4KRMB 5FHAL 4NZDA 1RIHL 3ARTA 4XCEA 1RZ8B 5C3TA 4WEBL 4OD1H 3GSWA 4YHMH 5GSRB 5C07A 3ARRA 4M02A 4S10A 5EU4A 3OL2A 4CVWA 4KI5E 3T65B 5C0IA 5C92A 5DO2C 1F6LL 1T83A 4OV6F 4I18C 4BFGA 4JFDD 5DHYA 2ATKB 1I1CA 5MEQA 5I76A 4ISVB 2ADFH 1GC1L 2AP2A 3KPPB 4F7MA 3EDEA 1F2QA 4LL9A 2E9BA 1UM5L 1CFVH 3OKNB 3ARPA 4LDLB 4Q9RL 1HKFA 1WBZB 5D6CB 2EXYC 2B5IB 5GGTL 1S7QA 3ULUH 2Z8VC 2NY2C 3P9MB 1BQSA 4QXWA 4GW5A 4HK3J 1UB6B 4X6EB 1FBIH 5TF1L 3W82A 4RDQG 2VUOA 3HNTL 4O02L 5DR5L 4TTDD 4AM0B 4F7EA 1CK0L 2ADIB 2NY4B 5IQ9B 2PO6C 3PDGA 2AW2A 2OQJA 5CEXB 1MCPH 1T0NA 4BFEA 2JJSA 3GBNH 3DYOA 4KK9D 3ZL4H 3VGAC 4S2SA 4GRWE 1ZHNB 4GAGL 3W39B 4Y89A 2P8PB 3S5LG 2NNAB 2FX8L 1XR8B 2VR9A 4M7LT 3TNNB 3L1OL 5F1IB 4HXAL 4YHKL 3QWOB 4UIKL 4GKZB 3PWPE 4YK4C 3GJFA 3V7AE 4NM8H 4PV9B 3M1BA 5JOPE 3QQ3B 4NFBA 2IEPA 1JGUL 1PD6A 3LH2H 2BVEA 2XNAB 4Y19B 2ZG3A 4NT6A 5A43C 4JQXA 4LLUA 5JUEH 3QA3B 1DLHB 2A9ML 5FGRA 1AI1L 2VLJB 4FQXD 1TJIL 1WCBA 3DX6B 4EBQL 3VFGH 4C4KO 2I07A 1T5XA 3ZDYE 1JV5A 6CGTA 1JN6A 4NQTA 5BZDA 3PNWA 2H3NB 5F96L 3N1FC 1WITA 1U36A 3FQTA 2HFFB 4IMKA 3SHSA 3FT4A 1HI6B 4LQFH 4HDIB 3RAJL 1MWAH 5C0IB 3WHE1 1ZVHA 1S8DB 4S2SB 1G7MB 4GXVL 2WP3O 4PV8A 2YD5A 3KYAA 5KW9H 1E27A 2H1PH 2QSTA 4FHBD 3K3QA 1GJIA 3VFMB 1DE4B 2FO1A 3V4UL 4LSVL 1BWWA 1P84K 1QO3B 3FQXA 4ZAKA 4PJDE 2CH8A 4Z7QE 4KDVA 5FO7A 4LCCA 2HWZH 4OBSA 2HT2C 1RIVH 4LSQH 4F7EB 1DL7H 5I74C 1FFNB 2Y5TB 5MENB 4Y16D 2J4WL 1HNFA 4S1DD 4F9LA 3ARBD 5F72S 1ZKAA 1G9MH 1IC7H 1FSKB 1YEDA 2AXFA 3G5XA 3CCHB 2ICES 3AFLA 3OX8B 5EWIL 5HD8C 3GSNL 4XNZC 1YEFL 3PGDA 3WO4C 4X99A 4C4KT 3SE3C 2F53B 2YZ1A 3VWKD 1I8KB 4NC1C 4YFLF 4U33A 3WUZA 3QEQD 4XAWH 3VFVA 4B53A 4JPIB 2MCG1 2J6EL 4PJ9D 1QBBA 1S7SB 1KJVB 2DYPB 5B4MD 5F7MC 4G8GD 2OZ4H 1RZ7L 2C9AA 3ZDYF 4OLZL 4ZNEA 1NAKL 1D5MA 3ULUC 1IC1A 3BP4A 4BSJA 4LEXH 3KLHD 1D5IH 3I75B 3GB7A 4HS3B 5DJ8B 3HE7B 3GO1H 5I1HL 2FZ3A 5IQ9A 1AP2A 4KJWD 1A9BA 1TZGL 2NY5C 3SEPA 3WE6B 4LCUA 4PLNC 2EYSA 4N68A 4NQUA 4L1HA 1RJCA 5JW3H 2BC4A 5HI5C 1MH5A 5K9KB 3OXSA 3VWJD 4D9QE 4J2XA 2C3HA 4LGPB 3C5JB 5IVXF 4I9WD 2GQHA 4N0YH 3U0PA 5EU6A 2AEQH 3VDBA 1EPFA 4RMQA 3QUMA 1QRKA 1VEOA 1DBBH 1V8HA 1MVFA 3H8NA 1M7DA 3FB5B 1FVEA 1FL5B 2AJVH 3RWCB 4DN4L 1U6AH 2PYED 1QFHA 2YSSA 3O3DB 3BOVA 4KJQD 4F2MB 1Q72H 1I85A 1IGCH 4G8EA 4WI8A 5JW5A 4PRPE 5E8OB 5B38G 4LPXA 3CFBB 2COQA 2FEEL 4N0UA 3N0PB 4Y19E 3D3VD 2VXSH 3L3JA 1ES0A 5DI8B 3HB3C 4HWNA 2YXMA 4KMLB 4P4RB 5BOZG 1KBGH 1NC2A 1PFCA 3NFNA 4JAMB 3VXNB 3V5HA 3LKSA 1T7XA 1HI6A 1FZKB 3V0WH 1G7HA 3RJQB 3BEVA 1LK2B 5EDXA 3STBA 3PNWB 5ACZA 3EYVA 4I5BB 1JNJA 1YJDC 1DVFB 2LU4A 3RGHA 5L9DL 2VNCA 1F4YH 1UACH 2DDQL 4M1GH 3W0WB 3PABA 3U83A 1KNOA 3LMJL 1LEIA 2YD4A 1HH6B 1A7NH 3O11B 4MJIA 3BT2H 4RGOL 1FNFA 3QFJE 2AEPH 3FFCD 4GRMA 5IW6A 2NY7H 3RWHB 2PUQT 1WCQA 3UJIH 2FO4B 2BVPB 5EULV 5IMKA 4QNPE 1JF1B 2YD8A 3QUKB 3BISA 3CH8A 4XPAL 5CJQL 1MIEL 1VHPA 5HI4D 3X14B 1HILA 3A6BH 3PWVA 5IKCA 5C0CD 3SBWC 1T21A 4YZFF 3MOBL 4XXCA 3TYGL 1P7QA 1ZLVH 1D6VH 3A67L 3VFRA 1C08B 4NRZB 2W1NA 1FE8L 4FZ8L 1ZEAL 4TUKH 4KPHL 3TT1H 4F15C 3I50L 3ETBF 4KWUA 1TCRA 5AWNH 5EZIH 4GXUN 5F7DB 5FFLA 3T3PF 3O6FC 3MRRB 2DRUA 4OGXH 4UILL 5TQ0L 3VXTA 3KPRE 1B3JA 3QO0A 2GJ6E 1OGTA 4G8FA 4TNVF 3DROB 3CIQA 5HVHC 4HPYL 2CD0A 4KJPC 4UV7L 1S7WA 1JPTL 4YHOL 5E9DD 4E42A 1F42A 2H9GB 1QHPA 4JQIH 3TT3H 1CDJA 4AG4L 4CRPA 3FO1B 1VGEH 3OR7A 5J12C 2Z8SA 2MFNA 2R1YB 2A73A 2UVFA 2R69L 4L3EB 2YOCA 4LPUA 4ZFGH 1OAXH 1IGFH 2AQ2A 2QKIA 3DX8A 4NQED 4AY0A 2BHZA 3G6DL 2DJUA 5AEAA 4Z7UE 3SDXB 1FYTE 2ZOLA 1FL6A 2LFGA 3GI9L 5K59E 5FXCH 4G9FD 2NY7L 4I0PB 3BX7C 5EUOF 2CJUL 1CICA 3LEXB 1T21B 4Y2DD 5GRZA 4HIIA 3LMJH 2WWKT 1NCWL 1JIBA 4JQVA 4F2MA 4YUEH 4LLYB 4OZFB 1X3DA 3BGFB 3RFZC 3EFDH 1MCIA 3DSFL 2A38A 2Y07H 1FPTL 1U8LB 2FB4L 3INUH 4LIQL 5E4EB 2JLLA 2W92A 5MERB 4XB7A 5C09D 2YN3A 1I75A 3QFDB 1YYML 4PJDA 2LQRA 2FIKA 2BNUA 4M48H 5BRZB 5ADOH 4KUZL 4PJGE 4XRCA 5EBWA 1NGWA 1RUMH 2VXSL 4LFHD 1SJEB 3WL9B 3DO3A 4QHLB 2CQVA 5AZ2L 3AUVA 4LVNB 1CVRA 5EUOB 5DEGB 4PJFB 2C3VB 3GI8L 3UTPD 3BP7A 4UOW0 3KPMA 3TYFA 2AJVL 2APWA 1NCBL 1RZJH 1MCCA 2DQFA 43CAB 4Z7UF 5I6XC 1UKTA 3EDFA 1MFDL 5KTEH 1YQ2A 3RDTD 1HDMA 1ZHKB 3MLTA 1W0WB 1Q1JH 5FYJE 3BQUB 3KXFE 1FN4A 2QQNL 3O2WL 2PKDA 3DIFA 5FIEA 3IFLL 5F7KC 1IAKB 1QD0A 1RZJL 1S7XA 1C5DB 4L29A 1P9MA 1A22B 1OAUL 15C8H 3CDYA 5HGDA 4JKMA 2XN9A 2HTKD 1RV6X 4NHCL 4GJTB 1OVZA 3V8CA 4K94H 5ACLA 3GI8H 3BWAA 3P73B 4YNYA 5D8JH 3VXQA 5IB3B 4LEXL 3IJHA 5DVLA 3WV0A 5MEND 3QDGA 2W07A 5T5NG 5AZ2H 1UVQA 2M8XA 3RRQA 5J56B 2F5AH 4JANA 4ZO6A 2A6DB 4KROB 4QRRD 1ZT7A 4FQIH 4PG9A 4PV8B 4KUZH 3C08H 2AJ3B 1UXWB 1YYMH 5DMIH 5ESQB 3HPJA 5B3JF 5KG9B 2YBRA 3DVNA 3MLVL 4JHBA 1MI5A 2A6IB 2AJYL 1QBML 1NL0H 1A5FL