4G6NA

Crystal structure of the erk2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
341
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK0
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 341
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g6nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g6nA01
2XB7A 1XH5A 3FQSA 2C6EA 3HRCA 3MY1A 4EJNA 5J1VA 3MH1A 5J79A 4XNEA 3T3UA 3UBDA 4O7LA 2J4ZA 4UY9A 4RIOA 3QCSA 3QRIA 2PUPA 1QPJA 2VD5A 3VRZA 3C0GA 4I20A 5E8TA 2H34A 2I40A 4DH3A 5G6VA 4XUFA 4H05A 4FV1A 4P2KA 5KMOA 1OKZA 4GYGA 1WBNA 2GS7A 3SKCA 4ARKA 2WHBA 4BICA 2NRUA 4JS8A 4I93A 4NSTA 5GIPE 2FSLX 3M1SA 4PPBA 3IK3A 4IB1A 4KINA 3Q9ZA 3P78A 4O1PA 4GJ3A 4UWBA 4JT3A 5HE3A 4FZ7A 2G15A 2IVSA 4LG4A 2W1EA 1JLUE 3OTUA 5A4EA 1O6LA 3I60A 5TE0A 4ANLA 1RJBA 3U9CA 3OCSA 4CEGA 1OBGA 4RJ3A 2NP8A 4G3FA 3GU8A 3KULA 5E90A 4AA5A 1J7LA 4FGRA 5AX3A 3NUNA 2Y4PA 1Q3WA 4KAOA 1H4LA 3NNXA 3DLSA 1WBSA 2VTOA 2F2UA 2RFEA 5EM5A 2WD1A 4HVHA 3W18A 5CAQA 4NWMA 3U87A 3VS5A 5IEXA 1MRUA 4DTBA 4DN5A 1Q61A 4IE9A 4P5ZA 5HCXA 3KRWA 4XP2A 3NVKI 3QRUA 4C4GA 4RZVA 2I0EA 5IEYA 4OTDA 3QYWA 4FK3A 4X2KA 2HOGA 3SRVB 5EDRA 4ZY5A 4O96A 2QD9A 5GJDA 1ZOGA 2XIYA 2PUUA 4YSMA 3FXWA 4I0SA 3MW1A 4O7WA 1KV2A 4ZTNA 4X3JA 4FZ6A 1UWJA 4CNHA 4S2ZA 2BMCA 3FQEA 4JBVA 2YCSA 5FLFA 4FKVA 1Q8ZA 4AN2A 4TYJA 3HMMA 4L7SA 4AUAA 3H0ZA 4PL3A 4EOOA 3QKMA 3NCZA 1P2AA 3Q32A 3KVXA 4KD1A 3LZBA 1Q24A 2YAKA 1ZYCA 3G9LX 3OFMA 2OBJA 4O0XA 5CT0A 5CY3A 4Z7HA 1KUTA 3NUUA 4HZRA 3F5UA 4A07A 5AWMA 5DE2A 4HPTE 2CN5A 4CYJA 3DY7A 5FTGA 1XBBA 4F7JA 3F3TA 3NLBA 5IA5A 4UXLA 2I0YA 2YM7A 4ORKA 3GEQA 2ZJWA 2W9ZB 2ERKA 2BRMA 3ANRA 3Q3BA 4KUJA 2W1GA 2BAQA 1JSVA 4DGNA 4QD6A 1ZXEA 4C4FA 4K0YA 3QZIA 2PSQA 4QYHA 3OW4A 3LCDA 4H3PA 3K2LA 4ZS4A 5EHOA 4QP3A 5HBEA 3JYAA 2C3IB 4JL9A 2GQSA 2IVUA 2CSNA 3E8CA 4WUAA 2BDFA 4B99A 3UOLA 4USDA 2VWYA 3COMA 4ZY6A 4G5PA 2HELA 3EN9A 4M13A 3HKOA 3GT8A 2X6DA 3OP5A 4J96A 3U6HA 4Y5QA 3PG1A 5M08A 2CGVA 3S0OA 3U4UA 3WZEA 3FLQA 3GGFA 4I21A 4KS8A 5K0KA 3HV3A 5BMMA 4QOXA 4RLLA 4AFJA 1PXJA 4IACA 4E73A 2RGPA 3OY1A 2YDKA 3ZUVA 2HXLA 3B2TA 3ORNA 5FRIA 5M4CA 3EQBA 3ULIA 4ACHA 4O83A 4AFEA 3DLZA 3FMJA 4DFNA 3ZOSA 4RSSA 2PVJA 5HNBA 3ENMA 3NRMA 4XJ0A 5AP1A 3IG7A 2X7GA 2WGJA 3EJ1A 3HMPA 3I79A 2RFDA 3S1HA 2F7ZE 3EQGA 5HTBA 5CTPA 3HDNA 3COIA 3F7ZA 4BDGA 3CC6A 1OMWA 4X6RA 3DKGA 5EDPA 3LFAA 3TXOA 1P4OA 1PXMA 3C5UA 3KRJA 3D94A 3PA5A 4FTCA 5E8UA 5EOBA 3ORZA 4WG4A 3UDBA 4XG6A 4M14A 4O2PA 4ITHA 4CTCA 3PVGA 3QTZA 4PTCA 2B54A 4WA9A 3CD8A 1YVJA 1JNKA 5HD7A 3QA0A 3LFQA 4V0GA 4A06A 3KREA 4FYOA 4FSNA 3FBVA 1BUHA 3NX8A 4AOTA 3EMGA 4L3JA 2W05A 4GU6A 5CQUA 3B2WA 2CPKE 3T9IA 4JDHA 5B7VA 5CXHA 3VQUA 3R7UA 3IQ7A 4C3FA 3EN6A 1M52A 2BAJA 2C1BA 1MRYA 2WO6A 4GYIA 3FMMA 3C0HA 5AP2A 1XHAA 3V8WA 2YFXA 4EYJA 3LAUA 4ASEA 4IZAA 2PZ5A 3NUYA 5HG8A 3PRFA 1Z9XA 2W9FB 3QKLA 2GU8A 3IW8A 5EI6A 4PMMA 2OXYA 2W1HA 4OTQA 1UV5A 1GY3A 4XLVA 3W8QA 4DA5A 2J90A 5KE0A 2YDJA 3PJ1A 4AGCA 5AP4A 4YZNA 2F7XE 4WIHA 1O6YA 3FWQA 4EKLA 4N57A 2ACXA 4HPUE 3ROYA 3DFAA 4NTTA 3V51A 4DGLC 2GHLA 3QGYA 3FZSA 3GCPA 3PYYA 2GTMA 5DGZA 5E8XA 1WBVA 3CKWA 3W2SA 2AYPA 4BDFA 4E4LA 4OAUC 2XYNA 3DCVA 3P79A 2G1TA 3IECA 5CXZA 5HZNA 3C4CA 3FKNA 4E4MA 2VTPA 4CCBA 4D55A 4E8AA 4LGDA 5AP5A 1H26A 2W1FA 5JGAA 2H6DA 4WBOA 5BYYA 3OCTA 5TO8A 4CLIA 3OTVA 2YHVA 2A0CX 5D11A 4DT9A 3AC1A 2FH9A 5HQ0A 4U40A 3FC1X 4G16A 4GIHA 4AXAA 4U8ZA 2PE0A 5D41A 2OJFE 2OJJA 2PUIA 4F0IA 4LM5A 2ITYA 2HY81 4J52A 4IXPA 4FEWA 3P7AA 2XCHA 5KX8A 3NUPA 4IAKA 1WBOA 2B9FA 4EBWA 3ORLA 3FPMA 4F7SA 5L2TA 3TUBA 3KKVA 2WTIA 3MTFA 1GZ8A 4AN9A 4NKAA 5DNRA 4BCFA 4KSQA 4K33A 3MY5A 3FI8A 2ZAZA 4MYGA 2ZM4A 3THBA 4C2VA 3M42A 5HIEA 1FINA 2J5FA 2WIPA 1TQIA 3NW5A 2QU6A 3EQDA 2HCKA 3GENA 4PPAA 2BRHA 1OB3A 3KL8A 4S34A 5AA8A 3VNTA 5IZFA 2WOUA 4CMOA 2CGUA 4YZ9A 4W8EA 4L01A 5EM8A 3V5JA 5AV2A 3R8LA 1CTPE 2REIA 4ASXA 3LJ0A 2IPXA 5KBRA 4AW0A 4FGBA 4EH7A 2GNJA 1XBCA 3FZ1A 2EVAA 5IUIA 1P5EA 4MXOA 1EH4A 2VO7A 2JIVA 3VS3A 4CG9A 3DOGA 3IKAA 4B8MA 4EOKA 3PDTA 2OSCA 5C8NA 4EZ5A 3R83A 2O65A 5I9UA 2HZ4A 4CKRA 4LI5A 4ZJVA 3TM0A 1JWHA 4K11A 2C5OA 1YOLA 2W1CA 2YABA 4RLKA 5TOZA 3F3WA 1FGIA 3DT1A 4RT7A 3TJDA 4YC6A 3ZC6A 5LXMA 3NW6A 4BTMA 3QQKA 3T8OA 3CTJA 4BYIA 2GFSA 3A7FA 3WYXA 4C3PA 4A9SA 2W4OA 3A4OX 4NK9A 2VX1A 3BHUA 3O23A 2Y7JA 3POZA 4IWPA 2PVRA 3ZS5A 4TPTA 4F7NA 2BRNA 3EL7A 3VUKA 3DK3A 1YOJA 2IZUA 1K2PA 4XLIA 4DFXE 4DGMA 4MWIA 3GU6A 2XJ0A 4WRSA 4YBKA 5AJQA 2YCRA 3G0FA 3QQUA 5AEPA 5CAOA 2C6IA 2P2IA 4U81A 4NCTC 1JAMA 4MNEA 3SXSA 4AN3A 5LQFA 2YAAA 3ACKA 4RIYB 3EFWA 2JAMA 3LHJA 2UW6A 5H2UA 5AA9A 4CKIA 2BKKA 4RJ4A 1G8SA 2W99B 5T3QA 4TZRA 2UZTA 4FKLA 2IZSA 3I7CA 4EHEA 4CMTA 4DCEA 4G3EA 3GVUA 3WF9A 3PUPA 1HCKA 1MQBA 1PXKA 2BTSA 5GNKA 4C62A 5DT0A 3NIEA 2QURA 4YZMA 3WOWA 1IAHA 3AT2A 2B0QA 3GCUA 3SW4A 4BY9E 4KB8A 4HCVA 1IG1A 5B2LA 3R9RA 4ZSAA 2OGVA 3E64A 2B4SB 4RIWB 5EKNA 1OL1A 4NJDA 3ITZA 3ZBFA 3SXRA 1L3RE 4RVKA 5DEYA 4YC3A 5E8YA 4QMXA 4ZLZA 3VO3A 3VUMA 5HORA 3U55A 2YM5A 3R8PA 4BDBA 3QLFA 4BYJA 4DFLA 5M51A 2CCHA 1NW1A 3NS9A 3ZRLA 3QYZA 3ZLWA 2CKPA 3HX4A 4UB7A 4UWYA 2C3KA 4S32A 1PMNA 4K6ZA 3RCDA 3UIXA 3ZO4A 2B1PA 4F6UA 3KXMA 2HY0A 2W96B 4XEYA 3AT4A 4Y5HA 4JBQA 4FTLA 3G0EA 4O82A 1KWPA 3AC5A 2ONLC 3MYGA 4AZFA 4FVPA 3MH0A 3QTUA 1ZY5A 4HYSA 2VWIA 2EXEA 2GNLA 2XKCA 3BYSA 4IZ7A 4DLIA 4TTHB 4K9YA 1OL7A 3CQUA 4ZXTA 3U6IA 4AT5A 3QALE 5DRBA 4DAWA 2ZDUA 4FTOA 1FOTA 2CCIA 5M56A 2B55A 5HHWA 3OBJA 2QU5A 4NIFA 2YERA 4FOCA 2PZRA 3FKOA 5EW8A 4V01A 5HICA 3FUPA 4BL1A 5JGDA 2E9OA 2H9VA 2A1AB 4LRKA 3HAVA 3BV2A 4D4VA 3DK6A 4QTCA 3VUGA 4BGQA 3E7OA 2J0LA 3CTQA 2YLEA 1LPUA 1MP8A 4UMTA 4YJTA 3SAYA 3MESA 2XUUA 4NKSA 2WTDA 4O81A 3R1QA 4IDVA 4MXZA 4O0VA 4HGLA 2ITWA 4GCJA 4FODA 3SDJA 3EQIA 3RPRA 3R21A 4TNDA 3NYVA 1APME 2C6DA 1T46A 1Y8GA 4AE6A 3BU6A 3UIMA 3V6RA 1S9JA 4BB4A 4JQ8A 4M0ZA 4F9YA 2GHMA 1CKIA 3GC9A 3RKBA 2XKFA 4BKJA 4DEDA 3U54A 2WKMA 3IPHA 4O0SA 1M2QA 3QHRA 4ITIA 3E8NA 3HP2A 5AADA 3BI6A 1HOWA 4FG8A 4HVDA 1U5RA 3RMFA 3R9NA 4FKTA 3PG3A 5E1SA 2QLQA 3KF7A 4TY1A 3R30A 2R7IA 4IQ6A 2V7OA 3LCKA 4KIPA 1S9IA 3IOPA 4ZZMA 4CTBA 4DG3E 1Q8TA 3L9MA 4U0IA 4U80A 4ZK5A 3HUBA 4YJUA 3RJCA 3EYGA 5AUTA 3S95A 2CDZA 3OWJA 4RC2A 4APCA 1A48A 3TKUA 4I23A 4TYGA 2PPQA 4X2JA 3PLAE 2JD5A 4RIXA 3HL7A 5B0XA 1M2RA 4M97A 5HVYA 3GBZA 4RG0A 1E9HA 5J9LA 2V55A 4WNPA 4GT3A 4I5HA 4AG8A 1REKA 4JAJA 3C13A 4X3FB 3DXNA 5A54A 3QWKA 3ZM9A 4CQGA 2C0IA 1RW8A 3WF5A 2CMWA 3C0IA 3D0EA 3OT3A 3UZTA 3ROCA 5J9ZA 3ZLXA 3OD6X 4MQ2A 1FMKA 3GUBA 4FTAA 2UVXA 4FV6A 5GJGA 3EQCA 1Q4LA 3DQWA 4FICA 5BYLA 3W16A 3IW4A 3Q04A 5ACKA 4CFMA 5ANKA 3LFBA 1B6CB 2EB2A 4HVSA 1XH7A 1J3HA 1VJYA 4D0WA 1T45A 3WI6A 2JDVA 3KF4A 2OXXA 2EU9A 4BN1A 4FKSA 1H01A 5HLWA 3A4PA 3IDPA 3CJGA 3DJ7A 5HTIA 4G2FA 2QODA 4K2RA 4GK4A 3V8TA 5JH6A 4I92A 3RK9A 3RP9A 3HNGA 2H8HA 5FDXA 4EH9A 3E87A 4IX3A 4RGJA 4EOSA 2ITNA 3FLNC 4PDPA 1F5QA 4AWIA 5HIBA 2WTKB 2BFXA 4ANSA 4B8LA 4WG3A 2CNUA 4I94A 5GZAA 4JLCA 1H07A 3QQLA 4QP6A 4HYHA 5IMEA 2OIBA 4G9CA 5GINE 3CBLA 5AAEA 2UW3A 5ANGA 3R00A 3VJOA 4C2WA 3EKKA 1FGKA 4R77A 1XJDA 2JGZA 3OS3A 4FK6A 3UVPA 5J5TA 1ZYLA 4C37A 2XBJA 4QPMA 2RKUA 3FSKA 1DAWA 5CVFA 4I22A 4NFMA 1IEPA 3EL8A 4GKHA 1CKJA 3BHTA 4XG8A 2ITXA 3PSBA 3U4WA 4BR3A 4FKPA 2QOLA 3QKKA 4FKJA 5LVLA 5AP0A 1DI8A 3QC4A 4CYIA 3BKBA 3ORPA 4W9WA 3DNDA 4YTFA 2UW0A 4JAIA 3MDYA 5LWMA 3BEGA 5IH5A 3PE1A 4R7IA 4E7WA 5CAUA 1M17A 3HUCA 2J2IB 3L8VA 2CKEA 3PWYA 4NEUA 1XR1A 2GFCA 4IAIA 5B2KA 3RPSA 4HVIA 3K3IA 2VGPA 5G1XA 2AC5A 5BVDA 1Q41A 4HJOA 2O63A 5KNJA 3MN3A 3UE4A 3NCGA 2WQEA 4IADA 4QP2A 1TQPA 1OZ1A 4YJVA 2QVSE 2R0IA 3NIZA 2C0OA 3DTCA 3KEXA 2XNEA 4IVAA 1OPLA 4A4OA 4ID7A 4J7BA 3TZ7A 3HYHA 2RG5A 4U43A 2C47A 4K1BA 5EYCA 1WBWA 3R7GA 4XS2A 3KK8A 3LE6A 3UODA 3HLLA 3ZYAA 3F5PA 2JIIA 2GTNA 4PDOA 4AU8A 2Z02A 3GOPA 4J98A 4QTAA 4O7YA 4RWJA 1PKGA 5DT3A 3PJCA 3TNWA 3BBWA 2XNBA 2ZV2A 5M4UA 4FTNA 4H3BA 2FSTX 2X7FA 3NUSA 3W10A 2W7XA 4GW8A 1YRPA 3D83A 3IONA 2UW5A 4RZWA 2VTHA 3SW7A 4FUYA 3SG8A 4ENYA 2OFVA 3MV5A 2XK4A 3PJ8A 2WEIA 4PDSA 2PE2A 4PMTA 4ZMFA 5BNJA 5FBNC 4KKEA 2Y4IC 3R9DA 2DS1A 3OWLA 2R5TA 5BYZA 4D5KA 3TKIA 1H1RA 5HOAA 1WBTA 2BVAA 3NWWA 3ZU7A 2H96A 3QQGA 2XJ1A 3UC4A 5IQIA 2UW9A 3ODZX 2UVYA 4AGWA 4AW2A 4EH2A 5DYJA 4TN6A 4XH6A 5HU9A 4BCGA 1Z57A 4TYHA 1K3AA 1M7NA 2WEVA 2IWIA 5BQ0A 2VTSA 5IU2A 2PK9A 3FLWA 3R1SA 3VS0A 3VBTA 2YDIA 4F65A 4QQTA 2PVMA 5CENA 4I6FA 4FSUA 4FV2A 2ZM1A 3UMWA 3I1AA 2CJMA 4RFMA 4EHVA 1JVPP 5HE0A 2J51A 3QQHA 3TI1A 3F2NA 4L6QA 1YHVA 4DEIA 4QMLA 2BDWA 2JDRA 3A2CA 2CN8A 3RTPA 4E4XA 3DS6A 3LXNA 3JXWA 3KMUA 3NNWA 3UPXA 3BWJA 4GUBA 2GDOA 1VEBA 2HWPA 5FP6A 2OXDA 3H9RA 4Q5HA 1ZZ2A 4IWOA 3SV0A 5CZHA 5KZIA 4EONA 4M66A 4RWLA 1YWRA 4ACGA 3EWHA 2YM3A 2QR8A 4QMNA 5K3YA 4QQCA 4D9UA 1CKPA 3R22A 3MBLA 4NTSA 3SG9A 2QOCA 4G5JA 3VS4A 4KRDA 3I5NA 4HGSA 3RZFA 4AQCA 4O7RA 3V5WA 3QWJA 2XS0A 4DCAA 3VWAA 3CE3A 1UU7A 4GH2A 4XMOA 2XK3A 3K5VA 1J7UA 4U9AA 2X9FA 4L44A 4WNOA 2RL5A 4JBPA 4EH8A 3NNUA 4LRMA 4U79A 4DFBA 2ZYBA 4ONAA 4N4SA 5LMKC 4USEA 2KULA 4BDHA 3A8XA 2GQRA 4ZSJA 5M53A 3KY2A 5F20A 4CFFA 2UVZA 4EK3A 4XV2A 2GHGA 1JSUA 4IM0A 5CZIA 2F7EE 1QMZA 3AD4A 3KK9A 4EL9A 3TZ9A 2GMXA 4J99A 3PY3A 4IB3A 1W82A 2J6MA 5KKRC 3OXIA 4RFYA 3MB7A 1OKVA 5H3QA 2X81A 4YSJA 2W1IA 3W55A 3NAYA 3U8WA 4G3DA 4I0RA 3ZO2A 2OIDA 3EQPA 2YM6A 3NAXA 3VBXA 3NSZA 3R63A 3P5KA 2XEYA 4GKIA 4RBLA 5IA1A 1ZYSA 3A60A 5T6KA 1ZWSA 5HO6A 2LAVA 4BHNA 4O0TA 2XNOA 1VR2A 1AQ1A 3DAKA 4YURA 4PP9A 3ZSIA 2F49A 3QAME 1PXIA 2YIRA 5T68A 2C69A 3ACJA 1R0PA 3AC4A 5ETIA 3UNKA 2BDJA 2E9NA 1YKRA 1SNXA 4LYNA 4KBKA 1PMEA 3DV3A 3QUEA 5FTQA 4M69B 1WVYA 3R8ZA 3HECA 2ETMA 5FXSA 5A14A 3ORXA 5L4QA 3LIJA 2EXMA 4YJSA 2UUEA 3Q9WA 1H0VA 4BGGA 1SNUA 3BGQA 1SYKA 1BMKA 4ANNA 4B9DA 4E3CA 2PVYA 2X8IA 4FTKA 1YXXA 4ZTSA 3CSVA 4MD9E 4UMUA 1OVEA 4YJOA 3BGZA 4FV3A 4WOVA 3VBVA 4FT7A 4YNOA 4BDAA 3SOAA 4Y72A 5IH4A 4LV8A 3AC3A 4TWPA 4ASZA 2CHLA 4AS0A 1UU8A 3SLSA 4OTFA 2PVKA 5DR6A 4QT1A 4FTJA 5DN3A 4FV8A 3OROA 4BDDA 5EW9A 5C01A 3DTWA 4HYIA 2A2AA 5LCKA 3RHKA 2C30A 4XG3A 3R9OA 2G2HA 1U54B 5L3AA 5CEPA 2WFYA 3KU2A 3HRFA 3ZO3A 2YIQA 3QL8A 3FEGA 3G33A 4UYNA 3E63A 2VO0A 3OEZA 2WQNA 4MWHA 4EWHA 1UNHA 4LOQA 4GT4A 5A4CA 1H27A 3BCEA 3SXFA 3C4WA 1J91A 3OUKA 3EN4A 4R3RA 3CEKA 1U46A 3IGOA 2QLUA 4O6EA 4RVLA 5IQBA 1FVRA 1OPJA 3D2IA 3PIXA 5CYIA 5EYDA 3ZH8A 1YHWA 4F1MA 3QCXA 3VUDA 4EC9A 4AGUA 3BLRA 4FSRA 3IS5A 4I24A 5EG3A 4QP9A 3II5A 4C02A 4YR8A 3DA6A 4PQNA 4WSQA 4F0GA 1XH4A 3CIKA 1Q97A 2OO8X 3V5QA 4C61A 3Q4ZA 1V0OA 3BHVA 4YHFA 2JAVA 3DU8A 1VYZA 4R7HA 2VTIA 2VWBA 4PTGA 4DINA 3K5UA 4E6CA 1Y8YA 4UBAA 1CDKA 3MI9A 2WU6A 3LFSA 4HNIA 5BUIA 5I0BA 4BIDA 3E8DA 4L3PA 4D2RA 5LMKA 1CM8A 1GJOA 3KB7A 4HCTA 3RAKA 2C0TA 3V6SA 4EH4A 1YXTA 2BZJA 3Q5IA 4XCUA 4W8DA 2PVHA 3C1XA 2RF9A 2HIWA 3ZC5A 3KA0A 5LJJA 1OIRA 4UMQA 5DR9A 2F9GA 3MPAA 5JT2A 2XM9A 4IFCA 5L8KA 4FL3A 3Q2JA 3TV6A 3MVLA 2JKOA 4X2NA 4DTKA 2OFUA 3C4XA 1IR3A 1YWNA 4F0FA 1O9UA 3H3CA 5HGIA 3CY3A 5ANEA 4GFMA 4FSMA 5ITAA 3VBQA 3BELA 2AUHA 4YGAA 4XX9A 3ORIA 4WT6A 4DH7A 5L6OA 4EEVA 3AQVA 3HZTA 3JR1A 4XG9A 4I3ZA 4M67A 3VJNA 2Y9QA 2HZNA 4D4SA 2WPAA 4RX5A 3R02A 1NY3A 4FNXA 5AAFA 2HENA 5E1EA 4JVGA 4GVJA 4KWPA 2XA4A 3MA3A 3NDMA 3LVPA 1JSTA 2W5AA 4MK0A 4PTEA 3FPQA 3MH3A 3PA4A 1Q99A 3UVQA 5AP7A 3AD6A 3OHTA 4FL1A 3TZMA 2YJRA 4UN0C 2R3IA 4L67A 4XHKB 1ERKA 3ORTA 4U3YA 5HTCA 1PJKA 3G15A 3PPJA 1MUOA 5HX8A 3QU0A 1OECA 4JIAA 4G6LA 1FBNA 5CSHA 3AMAA 3KRXA 2QKRA 3DKCA 4U6RA 3KRLA 4RMZA 4IDTA 4I6HA 2VO3A 2WMVA 3SRVA 1ZMWA 5E91A 4CT1A 3PWDA 3TACA 4E4NA 3RI1A 4IB5A 3DBQA 5EHYA 2O5KA 3QF9A 5TT7A 5H8BA 4EQMA 2BPMA 3MVMA 1YXUA 4YP8A 3TJCA 2OI4X 4AOIA 4EWQA 3PXFA 2VTJA 2XCKA 2ZDTA 5FWKK 4AZEA 4Z16A 2BTRA 4JJRA 3E3BX 3LCOA 4TYIA 5L2IA 4E93A 2IJMA 4NH1A 5ANIA 4EH3A 3MIYA 3MY0A 4AACA 4OR5A 2C6OA 4FG9A 2GNIA 3I4BA 3A62A 4J1RA 2Z7QA 3QX2A 3R7YA 4ZTRA 3FY2A 5CNNA 3KRRA 3DBDA 3DFCB 4X2GA 4DEBA 5CVGA 3P9JA 2UZNA 2QOHA 5JKGA 3AGLA 4V05A 3F3UA 4EZ3A 4YU2A 4JXFA 5EM6A 4F9BA 4YLJA 2WB8A 3HA6A 4QQ5A 3N51A 4FIEA 4BTJA 4CFNA 3S00A 5K9IA 1X8BA 2J9MA 3VUIA 3WZJA 5BUJA 4Q5EA 4FZDB 5AR8A 3P08A 4AF3A 5JFVA 2C6MA 5M09A 3C4ZA 4HW7A 5B2MA 1Q8YA 2YITA 5C8KA 3RM6A 1GZOA 2RSVA 3HP5A 4X21A 2X4FA 3LM5A 5CU4A 5DEWA 3EFJA 5EKOA 2PZIA 4RRVA 4D4YA 3KMMA 4E1ZA 3POOA 5CU6A 2WU7A 4YJPA 4QNYA 1NXKA 3PSCA 3COHA 3ANQA 3FZRA 3GB2A 3MIAA 5DRDA 3Q9YA 4NIFB 3NR9A 2UW8A 4D5HA 1YDSE 3WYYA 4CFUA 4G31A 4IZYA 4FSYA 4J8MA 3VHKA 1K9AA 3IDBA 3OWKA 4J95A 5K4JA 1YI3A 3DDQA 3R8VA 5EQYA 4RJ5A 5I9ZA 3EZVA 2ZVAA 4BKZA 4PNKA 2JEDA 5L8LA 2J0IA 3JPVA 3T9TA 4RQVA 5K5XA 4BBEA 3LKMA 2PTKA 5DLSA 3FV8A 3VS6A 5F94A 3UQCA 4NW5A 4CFWA 2IW8A 3TTIA 4L46A 4NT4A 1B38A 3F5XA 4I6BA 5HG5A 4F64A 3LCSA 3AXWA 1NVQA 1YWVA 2R9SA 4C3RA 1UU3A 4EOQA 2FSMX 4IH8A 1OUYA 4WNKA 2YWVA 4BCJA 1UA2A 3V3VA 3QGWA 3NEWA 4D58A 5EQPA 5HESA 3G9NA 4ERKA 5AIRA 3HDMA 4K77A 1J7IA 4BCPA 4G9RA 3U6JA 4CD0A 4FE2A 5EK7A 3QTQA 5L8JA 3UYSA 3FI2A 4ZSGA 5H8GA 4MEDA 2ZB0A 4O7ZA 3GFWA 3IGGA 4B7TA 4X7QA 5KBQA 4UXQA 1R3CA 3HV4A 5DH3A 5BVOA 1XH6A 3F5GA 4OBPA 4D0XA 3A7JA 4GS6A 3BE9A 4FTMA 4NM3A 3VRYA 2JKKA 4USFA 3TT0A 3O7LB 5KHXA 4FSQA 1V1KA 4X6QC 5DA3A 1MQ4A 4FSWA 4G6NA 3FMDA 4YJNA 5IQGA 4ANMA 3FLZA 4PNIA 5CI6A 4YPSA 4RIXB 4FV5A 2DWBA 2VZ6A 3KN5A 1BLXA 3OG7A 5CAPA 5M44A 3QTIA 3NYXA 4GEOA 5HNIX 4DTAA 4I4EA 5HI2A 4IM2A 1PYEA 2J50A 2HZ0A 3OY3A 4Z3VA 4UWCA 1U4DA 1VZOA 1QPDA 2WOTA 3R7IA 2R3QA 3LQ8A 3WF7A 3R6XA 1B39A 4ACDA 2QKWB 3AG9A 1WZYA 4II5A 4Q9SA 1HCLA 5BPYA 3QD0A 2HYYA 4H1MA 1OIYA 3DBFA 5KMIA 3GCQA 2HK5A 2XKDA 3TCPA 3UMXA 3UZPA 5FM2A 4WG5A 4BZOA 2VUWA 2XM8A 3ZBXA 5CEOA 3GC8A 5KO1A 3TWJA 3W2QA 3RHXA 4N0SA 3RAIA 5CALA 5DVRA 2WMRA 5LVMA 5CANA 3H0YA 2P3GX 4BWKA 5CX9A 2XIZA 5CSWA 3Q4CA 3ZUTA 5L2SA 1IAJA 4AA4A 2VU3A 2OH4A 5C26A 1MRVA 4YJQA 3RWQA 2B9IA 2CLXA 2YN8A 1Z5MA 2WXVA 1UU9A 3FDNA 2Z8CA 3P1AA 4GJ2A 5DPVA 5CEMA 5IUHA 4CZYB 3FAAA 2IVVA 2RFNA 1ZOEA 3GFEA 2J5EA 2JBPA 4KIKB 4KRCA 4C35A 4QMMA 4BIBA 2VGOA 3R71A 3Q96A 4U5JA 4JQEA 2OU7A 4O6LA 4DH1A 2BALA 4FKOA 3CLYA 3ZDUA 4N6ZA 2PL0A 2ZV7A 3WIGA 3G6HA 4KSPA 3FYJX 2ETKA 3QCQA 4BF2A 4PUZA 4ZAUA 5EOLA 2YISA 4FTTA 3LXLA 1PXLA 1BI7A 1W98A 2Z2WA 4LL0A 1PXPA 4RX7A 3FXZA 4E5BA 4YO4A 2XRUA 4MKCA 4QP7A 4OW8A 3EB0A 4BZNA 3HGKA 2GNFA 2W5HA 3MVHA 2XJ2A 3WILA 3FL4A 4JOAA 3I6UA 4R8QA 4ZJIA 4BI0A 2QG7A 2BRBA 1P14A 4BKYA 2CGXA 2W06A 5AUWA 2WMSA 4DH8A 5CSPA 3LLAA 4FT3A 1URCA 1ZMVA 1AGWA 3QTSA 4D4RA 4YPDA 3RAHA 3L8PA 3O50A 4PMPA 4TWOA 3L9NA 2OIQA 3MGYA 4RPVA 2YCFA 2P33A 2R3GA 5D7AA 4CMUA 3ZRKA 4FIJA 1QPCA 3E93A 2YM4A 3OT8A 2YA9A 4FIFA 4FNYA 4JDKA 4OTRA 4E26A 4EBVA 5IA3A 4P7EA 4ZTLA 1JOWB 4D1SA 2JLDA 4FT0A 3N9XA 2GCDA 1UWHA 5AM6A 3FI3A 2A27A 4H39A 3ENHA 5AV4A 3PZEA 4N70A 3AC2A 3MVJA 4L00A 2Y6OA 1NVSA 4EZ7A 3EFKA 2QC6A 3UO6A 5CF6A 3I0OA 4WKQA 3VUHA 4FKUA 3ORMA 4PL5A 5M57A 4E6AA 5CLPA 3C4EA 3BZ3A 4MQ1A 4BVUA 1I44A 5E8ZA 4UMPA 4C4IA 4F08A 3W33A 2PE1A 3FLSA 2GSFA 1STCE 3VS7A 4EOMA 4S33A 5TR6A 4ALUA 4DFZE 3QCYA 4FSTA 3C9WA 5I9VA 3QZHA 5I3RA 4OTWA 4WRGA 3ZUUA 4C0TA 2YWPA 3SQQA 1URWA 4G3CA 4I4FA 5BVNA 5C1QB 1W0XC 4MTAA 5HE1A 4W4XA 3FMNA 4LUEA 2VTTA 3F61A 1M2PA 2C6KA 1JKLA 5EH0A 4O91A 4RVTA 4QNAA 5AV1A 3BE2A 3LFEA 5AR7A 5I9YA 2NO3A 3RGFA 5F4NA 4AZVA 4IZ5A 3L9PA 3B8QA 4F4PA 4RIYA 3D4QA 5AX9A 1TVOA 3FJQE 5I9WA 3GC0A 2V22A 3BQRA 4QYYA 3UIBA 3VF8A 1KE5A 2IW6A 4F9CA 3TDWA 1R78A 2HZIA 2PYWA 1SM2A 1DS5A 2IVTA 3F88A 3A8WA 3NPCA 4TNBA 2QOFA 5FM3A 3RPYA 4J53A 4U44A 2HW6A 4ENXA 5ETAA 2I7QA 4OT5A 5F95A 3SHEA 5IEVA 3G6GA 5HNGA 4MBIA 4F63A 5IG1A 4R1VA 4IJPA 4K18A 1XO2B 4B0GA 3Q60A 5CU3A 2F4JA 1UKHA 3VBWA 3ALOA 2X4ZA 3TN8A 2I6LA 4QO9A 2G9XA 4AGDA 4RIWA 4D2SA 5E4HA 4IFGA 5FGKA 4ZEGA 4EHGA 2X1NA 2O8YA 1IRKA 2QHMA 2O64A 3F7WA 4RWKA 3VIDA 3DJ5A 4UEUA 1ZLTA 2OG8A 3LQ5A 4BBFA 2UW7A 4FEVA 3F9NA 1KE6A 3QRJA 3TTJA 3D7TB 2XZSA 5KZ0A 4O1OA 1PF8A 2WMXA 4IVBA 5D9HA 5AAGA 4DG2E 3U51A 4ZTMA 3N4TA 4YZBA 1U59A 3BU3A 3DK7A 4QMPA 1OIUA 3M11A 1DM2A 3MFUA 3ERKA 1ZYJA 4GT5A 3KQ7A 3ZEPA 3VC4A 2DYLA 2FVDA 4L45A 1SVEA 3LQ3A 4FV4A 5LMAA 4C8BA 3KC3A 3PLSA 3R7OA 4YTCA 3PVUA 4EK4A 2VO6A 4JDJA 5HCZA 2WMQA 2R3LA 4FNWA 4IAYA 3PXQA 3QC9A 4YHJA 4ZLYA 2ZOQA 4BFMA 4PWNA 3HMIA 5AR3A 4QPAA 3CP9A 2EXCX 3QHWA 4GUEA 1XWSA 2QO9A 4PV0A 3ZEWA 4BWPA 3SVVA 4FEXA 3LOKA 4GVAA 4XOZA 2UW4A 4GG7A 4M8TA 4ACMA 5C03A 1OL2A 5L2WA 2V5QA 3OCBA 2R0UA 2XNPA 3CGOA 4P5QA 5EYKA 3BWFA 5J5SA 4ALWA 1GZKA 3ZSGA 2QNJA 4GFGA 3UG1A 4B4LA 3FMLA 4UZHA 5ANDA 1H24A 4DLJA 3F3ZA 4XYFA 5H9BA 4EI4A 4R5YA 1Q62A 4ZIMA 2OK1A 3F66A 5HLNA 4BCKA 2XEZA 3CQWA 1H1PA 4IM3A 3KULB 4FF8A 4ZS0A 3RPOA 5DOSA 4OTHA 3R7VA 1BYGA 2VWWA 3FY0A 1UVRA 4RC3A 1WVWA 4MF0A 2BRGA 4C36A 4LMNA 2X6EA 3ZONA 4L68A 1JKTA 3DZOA 4EOIA 4BI1A 2VTQA 3OZ6A 1WBPA 3W2RA 3BQCA 4EUUA 3VAPA 3E5AA 4L42A 4C4HA 5FG8A 5A46A 2YZLA 5HU3A 2XMYA 3ZLYA 1G5SA 3A61A 2C5XA 4GK3A 4HCUA 2IZTA 1ATPE 2F57A 5LVPA 3UQFA 2XKEA 1WVXA 2UZOA 2WTCA 3ET7A 3FC2A 3ZZWA 4H1JA 3DAJA 2C4GA 2O3PA 2YIYA 1YQJA 3CS9A 4QMTA 2I0VA 1E1VA 4ZTHA 5KMNA 3UNJA 3WZKA 5CEQA 4B6LA 2GS6A 2OZAA 3PVBA 4FVQA 4IX4A 4L9IA 3L9LA 2DQ7X 2OF2A 2C1AA 2VWUA 3EQHA 3F3VA 5AUVA 1A06A 5FD2A 5GHVA 3V5PA 5LCJA 2CGWA 2HXQA 4DT8A 2ITTA 2XIXA 4FEQA 4LUDA 3QBNA 2BHHA 4FV9A 3R8MA 1R39A 4DITA 4CLJA 3FZPA 4MXYA 4BBMA 3ZHPC 1H1SA 1W7HA 2VN9A 5ACBC 1WAKA 3SA0A 4DFUA 1NVRA 2X9EA 4FKIA 4LQMA 2BROA 2XIRA 4ZSEA 5DG5A 3RAWA 5AP3A 3CCNA 4DEHA 4I1ZA 3R9HA 4IX6A 2JDOA 2VTRA 4EK5A 4ZY4A 2QOBA 5E92A 1KE8A 4P90A 4YTIA 5HLPA 4YMJA 1U5QA 2QOIA 3O2MA 2VWVA 3DGKA 3AMBA 3MJ2A 2XRWA 3PP1A 4QPSA 3BBTB 4RJ6A 5KMJA 4YHTA 4LV5A 3ETAA 4ACCA 4ERWA 1ZMUA 4R7BA 3TEIA 1R0EA 3RBWA 5M06A 1YI6A 2QR7A 2R3JA 5J8IA 4OUCA 4C4EA 4WBBB 4A7CA 4BCQA 5JK3A 3G51A 4TXCA 3LM0A 2PUNA 3A7GA 5AFVA 5CASA 4A9TA 4CXAA 4DHFA 4O86A 1WCCA 3RK5A 3RINA 4C4JA 3ZZEA 2ITZA 2WQMA 5BX0A 5ETCA 5BVFA 1QCFA 3ALNA 1OPKA 3SOCA 4U41A 3UO5A 2E2BA 4J8NA 2P55A 4NJ3A 4ALVA 5CU2A 4G1WA 2J7TA 4Y46A 3VULA 3UC3A 2VTLA 5DMZA 4CVAA 5IA4A 3S3IA 2CKQA 1V0PA 3MWUA 5FEQA 3Q53A 2X0GA 4FKRA 3W32A 1RE8A 2FSOX 2XNMA 1YDRE 2FO0A 4EHZA 5AUYA 1KV1A 1YOMA 5AR5A 3KXXA 4I5PA 4LRJA 2XK6A 3ULZA 4JBOA 5M4FA 3L8SA 3QXOA 1I09A 3PP0A 4NFNA 5HG9A 3K3JA 5BUEA 2HAKA 3PXRA 4J97A 4OTIA 3TIZA 3W2CA 4LGGA 1JQHA 2QI8A 2FGIA 3BRBA 3BYMA 4GK2A 5GZ8A 2JDTA 5JZNA 5GZ9A 5CWZA 2BZHB 3FHIA 3R28A 3TNQB 1Q8WA 2WTJA 4J71A 4ZTQA 3WZUA 2ITVA 5JEBA 3PPKA 4V0GB 5HG7A 4CQEA 3Q6UA 3Q9XA 3R04A 4CRLA 3E88A 5BMSA 4BDEA 3F6XA 4WSYA 5CF8A 1NA7A 3Q5ZA 2ITOA 2WTWA 3FSFA 5KMKA 4I41A 5FUTA 4C58A 2OW3A 4F9AA 3TL8A 1XH9A 5A9UA 4YZDA 4OGRA 4AW1A 3L8XA 2BIYA 2W4KA 4YC8A 4D28A 2OLCA 4RC4A 2E9PA 4KKHA 1LEWA 2W1DA 4M12A 4W4VA 5DR2A 4PY1A 3BEAA 3D5XA 5HE2A 4IEBA 5LVNA 1YDTE 5AUUA 4QP4A 3BYOA 4GFOA 4GL9A 2C3LA 2IZRA 3ZXTA 4DGOA 5JN2A 2V62A 1AD5A 3GCVA 3VW8A 4EOPA 4YUQA 4NU1A 4U42A 5KUPA 2JBOA 5CQWA 4FTUA 5FBOA 4FUXA 3HV5A 2Z7LA 5D10A 2R3NA 4BDKA 4F1OA 2Q83A 3GU4A 3QXPA 3VVHA 3LFFA 2OZOA 2Y4IB 2R64A 2WNTA 5AV0A 1NT2A 2R3OA 4WHZA 2V7AA 1BKXA 4DH5A 4MXXA 3UNZA 5FDPA 3EQRA 3KXNA 4P4CA 2ZV9A 3PY0A 3MFTA 1LUFA 3O51A 4EYMA 4NYEA 4JR7A 3P7BA 4E5AX 5AP6A 4M15A 3GOKA 2R3PA 4YZCA 5AUZA 3ATTA 3NZ0A 3W1FA 3NW7A 5CT7A 1W83A 4E6DA 4NM7A 4Y83A 5JMSA 3UP7A 5IH6A 3HAMA 2A4LA 2C5NA 2EB3A 1KSWA 2R4BA 3CPCA 3GNIB 3PY1A 4LOOA 3PXKA 5JZJA 5GIOE 1Y6BA 3SX9A 2DUVA 5HBJA 5HVJA 3DXQA 1OL6A 4O38A 2VV9A 3PA3A 2HWOA 3CY2A 1J1BA 3EHAA 4DEGA 4APPA 2R3KA 3OC1A 4CFXA 4JDIA 4U3ZA 3CJFA 3FYKX 3RM7A 3UOKA 2QOQA 1GIIA 2X2LA 3KMWA 3TIYA 5CF4A 2G2FA 3WF8A 3JY9A 2XK9A 3KCFA 4TWNA 4E5WA 3SGCA 4EC8A 3ZMMA 3FQHA 3GCSA 4AT4A 3PTGA 2C6TA 3DKOA 2QG5A 4R78A 3QZFA 3QLGA 4AZTA 4PP7A 4MBLA 4E20A 4IBMA 4R1YA 2X2MA 1FVTA 4E6QA 5ANOA 1Y91A 4QTEA 3PFQA 3V04A 4TKSA 4NW6A 3E92A 2Q0NA 4QMUA 4QRCA 3HMNA 1IA9A 2JFMA 2VAGA 1SMHA 1IA8A 4QMWA 4F1TA 2QOKA 3BYUA 3F2AA 4NL0A 4N6YA 2BFYA 5DHJA 4RVMA 2X39A 1PMVA 2EWAA 4FIIA 4HGTA 5IUGA 5KKRB 3N4VA 2FB8A 4JRVA 5HIDA 3PE2A 1M14A 2Z7RA 4BC6A 5CEKA 5K0XA 1OBDA 1PMUA 3D5VA 2UZVA 3AMYA 4HGEA 1ZOHA 3UO4A 4CFVA 2PHKA 1OITA 1TQMA 2WIHA 3DAEA 4R6VA 3MPTA 3RALA 3V8SA 3VS2A 3PVWA 3GU5A 4A9UA 3JVSA 3EN7A 2YIXA 5HO8A 2P0CA 4GMYA 4AE9A 3NMUF 4A4LA 4HNFA 3C5IA 2E9VA 4R5SA 1BX6A 1LEZA 1H25A 4C57A 4QMOA 4MXCA 3FMEA 4IC8A 5LOHA 1SZMA 3QRKA 4FV7A 1OUKA 2VRXA 1DI9A 1KOAA 5E7RA 3FKLA 2OJGA 5IQEA 2NNWB 2IO6A 3H30A 3DQXA 4EH6A 4KIOA 4WUNA 4BCMA 4CG8A 4FTRA 4QP1A 4XBUA 3P23A 5TF9A 4MNEB 5IPJA 4O21A 4V04A 3A99A 4TL0A 3I7BA 3MA6A 4M0YA 1W84A 3O96A 5C27A 5A4TA 4PDYA 4U45A 3RZBA 4M69A 1FVVA 4RQKA 5E8VA 4EUTA 3AD5A 2F2CB 2X8EA 3JVRA 3MH2A 3QX4A 4GG5A 4A9RA 2B7AA 1RDQE 4EKKA 5EYMA 4IAFA 4FYNA 3UGCA 1XKKA 4FIGA 3LMHA 2ZM3A 3RNIA 3RWPA 4CGAA 5D1JA 3ZTXA 3ZCLA 1E1XA 2FYSA 3AC8A 4BTFA 1PY5A 3QQJA 4Y8DA 4RJ8A 3R8UA 5EW3A 2CNVA 3E7VA 3PIZA 3WBLA 3PZHA 5A3XA 3JY0A 4Y73A 3GU7A 2WMWA 3MS9A 4UZDA 1BL7A 3OCGA 3P0MA 4I0TA 5DWRA 2NRYA 5C9CA 4HZSA 3RCJA 4AAAA 5IDPA 3MPMA 4IVDA 4L3LA 4MAOA 1U54A 4BCHA 3KCKA 4MHAA 3PJ2A 5I9XA 3G5DA 3R7EA 1FQ1B 4BDIA 3NGAA 5CSVA 2RG6A 4BWXA 4MD8E 4O0WA 1L8TA 2R2PA 2ESMA 2Q0BA 4LOPA 5I5ZA 1YI4A 4KIQA 4W4WA 4UMRA 4QYGA 2RIOA 3EN5A 4F9WA 3R1YA 3D15A 2GNHA 4DG0E 3R01A 3SC1A 2ZMDA 5IA0A 2OKRA 3ORKA 3W2PA 3IOKA 5DIAA 3F69A 2XH5A 3UQGA 3DKFA 2UZBA 4O7TA 5ETFA 3HV7A 4R3CA 3O0GA 3OF0A 5EQEA 1GOLA 3V5TA 4DEEA 3Q6WA 4LMUA 3D2KA 4RA5A 3CGFA 4GSBA 2YACA 5JSMA 3FLYA 4XV9A 5I4NA 5D7VA 4KBCA 2ETRA 2JKQA 2PZPA 3H4JA 4ZOGA 5H8EA 2J0MB 3A7IA 3FMKA 3Q52A 2B53A 4XBRA 3OXZA 3DB8A 3UZRA 1OKWA 4JNWA 1G3NA 2XF0A 2W17A 2PULA 3FL5A 2C68A 1JKKA 3LJ2A 3VS1A 4BCOA 2JDSA 1Y6AA 2XBAA 4CV8A 4FIHA 1JPAA 2ITPA 3MSSA 5HO7A 5HX6A 2PVNA 3UOHA 3LFNA 3KXHA 2ERZE 3AGMA 4IIRA 2JIUA 3EKNA 2O0UA 5DT4A 1GNGA 4NM0A 4KA3A 4QMZA 3NUAA 5A6NA 5LARA 4DBXA 4EH5A 2WAJA 3M2WA 4BHZA 4OT6A 2IN6A 3ZDIA 4JIKA 3QZGA 3PXYA 3GXLA 4ASDA 5KMLA 2WZJA 2VTMA 1J1CA 4KKGA 5EHLA 2GPHA 4HVGA 3UG2A 3PJ3A 3T3VA 5K4IA 4QMQA 2BZKB 3KGAA 3VQHA 3VW6A 4FX3A 2XVDA 4ZLOA 5HBHA 2OWBA 1BI8A 4G34A 1Q3DA 3KFAA 3R0TA 4D1ZA 4FKQA 4BDCA 3ZSHA 3VN9A 3IW5A 4MCVA 5HD4A 5DBXA 4X2FA 4O0RA 2OJIA 2XNNA 2GNGA 2BAKA 2X8DA 3D7ZA 3OBGA 2WMBA 4MVFA 3CD3A 1ZRZA 4UALA 4AZWA 5EM7A 4QYEA 2OH0E 4JI9A 2PMNX 1ZY4A 2Z7SA 3OOGA 4JG6A 4MBJA 4R3PA 1LP4A 4TYEA 3MB6A 3KN6A 4QQJA 2QOOA 2PMIA 4Q2AA 4W4YA 4AT3A 4MXAA 4PF4A 4BCNA 3ATSA 4UX9A 4ZZNA 4NM5A 1H8FA 4M7IA 3O8UA 3RK7A 1PXOA 4XV1A 4BI2A 4X3FC 5EFQA 2QO2A 3AT3A 4ZZOA 3L1SA 5GJFA 3MTLA 4H36A 4FL2A 3UTOA 4WO5A 4AW5A 1H1QA 4FSZA 4PX6A 5AR4A 3DXPA 4TRLA 1WFCA 5FEDA 3GP0A 3OEFX 3H9FA 4H58A 4DC2A 3P7CA 4XP3A 4O27B 5JFWA 3UPZA 4MNFA 4TWCA 5CSXA 3QD3A 2YJSA 3I81A 2QO7A 4MF1A 1DAYA 3I0QA 2W5BA 1SVHA 5JQ5A 1CSNA 3MJ1A 4QMYA 2C3JA 4G17A 1Q5KA 4EOJA 4AOJA 4D2TA 4G6OA 4JX3A 5E8WA 5E8SA 1GAGA 2PMLX 3P86A 4BRXA 2GQGA 4L53A 4C38A 4DYMA 2BUJA 4GV1A 4IW0A 4AA0A 2YZAA 2GS2A 1YW2A 4ZMEA 1V0BA 4KS7A 3HEGA 4LGHA 4IVCA 5I3OA 4BTKA 5M4IA 2XNGA 2WTKC 4XG7A 5AM7A 5DFPA 3BHYA 3O8TA 4GIIA 3ZFMA 2VNWA 5J95A 2OICA 4GU9A 1PRYA 3BLQA 3DNEA 4M68A 4YNEA 2WELA 2Y8OA 3BGPA 4FBXA 3TKHA 1H08A 3FZOA 3QD2B 5E9EA 4ZSLA 4OAVB 2B52A 1LR4A 1JBPE 4F99A 2JKMA 3QUPA 2I0HA 3HV6A 3UOJA 4CZTA 2Z60A 4L52A 4IHPA 3GQIA 1OGUA 4FC0A 5EI8A 3HVCA 3W2OA 3C50A 3Q2MA 3QRTA 3ZFXA 2BR1A 5IISA 2B9HA 3U9NA 4D2WA 3WZDA 3ZXZA 5LWNA 1OI9A 4O84A 4S31A 2A19B 5FXQA 2CNQA 4KBAA 1TKIA 3EIDA 3GC7A 4DF3A 5CI7A 5BVWA 1Y57A 3BHHA 1QPEA 3CR0A 3WARA 2NPQA 1BL6A 3DPKA 4HYUA 4TT7A 4XG2A 3TDVA 4U97A 4Z7GA 2BHEA 2ZV8A 3ZLSA 4BZDA 2VWZA 4LFIA 4LL5A 2R7BA 4OTGA 2B9JA 4NUSA 4L8MA 1SVGA 5L6PA 3IDCA 4FV0A 4IWQA 4EORA 4O22A 5CNOA 3OW3A 3PSDA 2EUFB 4NZWB 1OKYA 1XH8A 4AZSA 3NNVA 2QHNA 4O7VA 3LXKA 4WNMA 3B8RA 5A4QA 3GI3A 4G3GA 3BV3A 2UZEA 2OJ9A 5CS6A 3CQEA 2BILB 1YXVA 2J0KA 4Z9LA 3UYTA 3V01A 3E62A 5D12A 4D9TA 4IMYA 5KHWA 2XP2A 4CRSA 4F6WA 4Y85A 1H0WA 5HKMA 1REJA 1ZARA 3O17A 3QUDA 4O7NA 4RJ7A 2C5VA 2PVLA 4YTHA 4U7ZA 2O2UA 4BCIA 5A4LA 5CAVA 3D5UA 3LFCA 3EYHA 3ZFYA 2PU8A 3QTRA 4DBNA 3LW0A 2XYUA 3O71A 1KOBA 3Q4TA 4FA2A 4YLLA 4A9YA 2ZMCA 3BU5A 4CSVA 4BIEA 4FT5A 1FMOE 3LXPA 5IQDA 4D1XA 3FI4A 2AC3A 3DBEA 4C59A 4D2PA 4F7LA 4AP7A 3IW7A 4BGHA 2OZAB 3E3PA 4XV3A 3TZ8A 3JUHA 2WTVA 4CV9A 4H3QA 5JGBA 3PPZA 1G8AA 5AR2A 2ZB1A 2UZLA 3WE8A 3HRBA 2P4IA 4FG7A 4TYHB 3CTHA 2P2HA 4RX8A 4MX9A 3ZM4A 5CF5A 3C7QA 2YEXA 5LMBA 1PW2A 3PIYA 5JRSA 3WIKA 1PKDA 1W8CA 3ZRMA 3OMVA 5ANJA 3TUCA 4DEAA 4I5MA 4I6QA 4KNBA 1WMKA 5F9EA 3H9OA 4JG7A 4O0YA 5IQAA 3DZQA 3REPA 4XP0A 4QMVA 2Y6MA 4FTQA 1OL5A 2IG7A 5CEIA 4C33A 4CCUA 5JQ8A 2PMOX 3FMHA 4QTBA 3ODYX 3EZRA 2X7OA 5JFXA 4XG4A 3C4FA 1H28A 2G01A 4JR3A 3E8EA 3NYNA 1KE9A 4BDJA 2WMTA 3LCTA 4RA4A 2UZUE 2IW9A 3FXXA 5HCYA 3V5LA 5J1WA 1P4FA 4FKWA 3C51A 3G2FA 2HW7A 4GRBA 3MFRA 5EI2A 1ZYDA 4ANOA 2XK8A 4FR4A 3KVWA 4TW9A 3F82A 2VX3A 3R2YA 3PXZA 2ITQA 5L2QA 3RPVA 1CMKE 5AUXA 3WF6A 3BX5A 1F3MC 1R1WA 4FZAB 5FP5A 4A4XA 3PRIA 1JKSA 4W9XA 4XOYA 3N4UA 4FMQA 5JFSA 4AX8A 2KTYA 2PVFA 4QMSA 4IB0A 3CKXA 4KIKA 3MFSA 1Q8UA 4DFYA 1PYXA 2C5YA 2XIKA 3WE4A 5AMNA 3QA8A 1GIJA 4L43A 4PL4A 3LJ1A 3FZTA 5L6WL 4YBJA 3TV4A 4EK6A 3LLTA 4F70A 5J7BA 2WQOA 4ITJA 4PPCA 3DB6A 5FEEA 2W4JA 2WQBA 4IAZA 2R3HA 4S30A 5C4LA 1GIHA 3IO7A 4XRLA 2CKOA 2BZIB 2JC6A 2UZWE 3DDPA 1F0QA 4ZP5A 4DE4A 5CVHA 5DI1A 3AOXA 5IF1A 3IW6A 3VBYA 4QP8A 2PWLA 4IAAA 5BVKA 3BYVA 3ELJA 3EQFA 3P4KA 3VHEA 5IA2A 3LMIA 5C4KA 4EQUA 5IQCA 4OLIA 3QD4A 5HEZA 3TUDA 5FQDC 4EOLA 2I1MA 2BCJA 4YLKA 2YIWA 5ICPA 1A9UA 1RQQA 4O0UA 2QQ7A 1XBAA 4FTIA 4MD7E 4ZJJA 4I5CA 3I5ZA 2J0JA 3HA8A 4K8AA 3EFLA 2W1ZA 3LPBA 3K54A 3QQFA 4UYAA 2W0JA 4IANA 2R3FA 2X2KA 4IJ9A 4JQ7A 3UP2A 2QONA 4O7SA 3D9VA 4HOKA 3FE3A 4RFZA 4M3QA 3SD0A 3NVMB 1PHKA 1YHSA 5TKDA 3QTXA 4IC7A 1ND4A 4FVRA 4XRJA 2YLFA 2VTAA 1O6KA 1XQZA 2UV2A 5BVEA 3NYOA 5J7HA 3A7HA 2C6LA 4O2ZA 5CU0A 3UJGA 5A6OA 5EDQA 4EQCA 4Q9ZA 3EH9A 1YXSA 2FUMA 2VNYA 2Y0AA 3LFDA 4ANBA 3BPRA 1KE7A 4IWDA 4OBQA 4F6SA 1IASA 3G90X 4YJRA 3D14A 3DJ6A 3ZO1A 4EJ7A 2LGCA 2PY3A 5JRQA 3GQLA 1M7QA 1OIQA 4FOBA 4KABA 2OF4A 5IKWA 4QYFA 5LVOA 4NCTA 5J87A 5M07A 4IX5A 1FPUA 3LMGA 3TNIA 4X3FA 4FNZA 2ITUA 3VUTA 4UV0A 5AIKA 2BIKB 2UZDA 3R73A 4Y95A 2CLQA 2VX0A 1H00A 5IQHA 4L7FA 3VF9A 1PXNA 3TG1A 4DGGA 3TNPC 4C7TA 5KCVA 2R3RA 1UKIA 3R1NA 3UIUA 2XK7A 5M55A 3F2RA 4Z55A 4ANQA 2R3MA 3CPBA 5J9YA 3H10A 4RX9A 3KXGA 4FKGA 2G2IA 4FT9A 1QL6A 3BIZA 4RWIA 2WMUA 2WMAA 3OWPA 5IMXA 4MH7A 4F09A 4JX7A 3TNHA 4CT2A 5FXRA 2QCSA 3QFVA 4OBOA 2VTNA 5KMMA 3UVRA 1VYWA 2YM8A 3S2PA 4CKJA 4PMSA 3I6WA 3OXTA 4FZFB 4QTDA 3W8LA 5AV3A 3D5WA 2JITA 5FTOA 4JRNA 1UNGA 4CZUA 1ZAOA 3CXWA 1H1WA 1UNLA 2FA2A 2PZYA 3BLHA 5F1ZA 4D2VA 1ZZLA 3JS2A 2SRCA 3DBCA 3O8PA 2JFLA 4M84A 3EOCA 3OOMA 4WD5A 4FI1A 5IDNA 3D7TA 3KXZA 2V0DA 3RNYA 3R2BA 2BKZA 3FHRA 4PRJA 5HVKA 2YCQA 3NUXA 2VWXA 1GZNA 2ONLA 4OTPA 4X0MA 4JG8A 5C8MA 3QTWA 3RVGA 3TV7A 3ID6C 4FEUA 3Q4UA 3HMOA 2E9UA 3OVVA 3COKA 2RFSA 3S4QA 5IQFA 3OUNB 5K5NA 1OM1A 4C34A 3O7LD 4YO6A 4EK8A
chains in the Genus database with same CATH superfamily
2XB7A 1XH5A 3FQSA 2C6EA 3HRCA 3MY1A 4EJNA 5J1VA 3MH1A 5J79A 4XNEA 3T3UA 3UBDA 4O7LA 2J4ZA 4UY9A 4RIOA 3QCSA 3QRIA 1XMMA 2PUPA 1QPJA 2VD5A 3VRZA 3C0GA 4I20A 5E8TA 2H34A 2I40A 4DH3A 5G6VA 4XUFA 4H05A 4FV1A 4P2KA 5KMOA 1OKZA 4GYGA 1WBNA 2GS7A 3SKCA 4ARKA 2WHBA 4BICA 2NRUA 4JS8A 4I93A 4NSTA 5GIPE 2FSLX 3M1SA 4PPBA 3IK3A 4IB1A 4KINA 3Q9ZA 3P78A 4O1PA 4GJ3A 4UWBA 4JT3A 4QEBA 5HE3A 4FZ7A 2G15A 2IVSA 1W2DA 4LG4A 2XALA 2W1EA 1JLUE 3OTUA 5A4EA 1O6LA 3I60A 5TE0A 4ANLA 1RJBA 3U9CA 3OCSA 4CEGA 1G8JA 1OBGA 4RJ3A 2NP8A 4G3FA 3GU8A 3KULA 5E90A 4AA5A 1J7LA 4FGRA 5AX3A 3NUNA 2Y4PA 1Q3WA 4KAOA 4O4EA 1H4LA 3NNXA 3DLSA 1WBSA 2VTOA 2F2UA 2RFEA 5EM5A 2WD1A 4HVHA 3W18A 5CAQA 4NWMA 3U87A 3VS5A 5IEXA 1MRUA 4DTBA 4DN5A 1Q61A 4IE9A 4P5ZA 5HCXA 3KRWA 4XP2A 3NVKI 3QRUA 4C4GA 4RZVA 2I0EA 5IEYA 4OTDA 3QYWA 4FK3A 4X2KA 2HOGA 3SRVB 5EDRA 4ZY5A 4O96A 2QD9A 5GJDA 1ZOGA 3ML1A 2XIYA 2PUUA 4YSMA 3FXWA 4I0SA 3MW1A 4O7WA 1KV2A 4ZTNA 4X3JA 4FZ6A 1UWJA 4CNHA 4S2ZA 2BMCA 3FQEA 4JBVA 2YCSA 5FLFA 4FKVA 1Q8ZA 4AN2A 4TYJA 3HMMA 4L7SA 4AUAA 3H0ZA 4PL3A 4EOOA 3QKMA 3NCZA 1P2AA 3Q32A 3KVXA 4KD1A 3LZBA 1Q24A 2YAKA 1ZYCA 3G9LX 3OFMA 2OBJA 4O0XA 5CT0A 5CY3A 4Z7HA 1KUTA 3NUUA 4HZRA 3F5UA 4A07A 5AWMA 5DE2A 4HPTE 2CN5A 4CYJA 3DY7A 5FTGA 1XBBA 4F7JA 3F3TA 3NLBA 5IA5A 4UXLA 2I0YA 2YM7A 4ORKA 3GEQA 2ZJWA 2W9ZB 2ERKA 2BRMA 3ANRA 3Q3BA 4KUJA 2W1GA 2BAQA 1JSVA 4DGNA 4QD6A 1ZXEA 4C4FA 4K0YA 2AQXA 3QZIA 2PSQA 4QYHA 3OW4A 3LCDA 4H3PA 3K2LA 4ZS4A 5EHOA 4QP3A 5HBEA 3W0OA 3JYAA 2C3IB 4JL9A 2GQSA 2IVUA 2CSNA 3E8CA 4WUAA 2BDFA 4B99A 3UOLA 4USDA 2VWYA 3COMA 4ZY6A 4G5PA 2HELA 3EN9A 4M13A 3HKOA 3GT8A 2X6DA 3OP5A 4J96A 3U6HA 4Y5QA 3PG1A 5M08A 2CGVA 3S0OA 3U4UA 3WZEA 3FLQA 3GGFA 4I21A 4KS8A 5K0KA 3HV3A 5BMMA 4QOXA 4RLLA 4AFJA 1PXJA 4IACA 4E73A 2RGPA 3OY1A 2YDKA 3ZUVA 2HXLA 3B2TA 3ORNA 5FRIA 5M4CA 3EQBA 3ULIA 4ACHA 4O83A 4AFEA 3DLZA 3FMJA 4DFNA 3ZOSA 4RSSA 2PVJA 5HNBA 3ENMA 3NRMA 4XJ0A 5AP1A 3IG7A 2X7GA 2WGJA 3EJ1A 3HMPA 3I79A 2RFDA 3S1HA 2F7ZE 3EQGA 5HTBA 5CTPA 3HDNA 3COIA 4F78A 3F7ZA 4BDGA 3CC6A 1OMWA 4X6RA 1ST0A 3DKGA 5EDPA 3LFAA 3TXOA 1P4OA 1PXMA 3C5UA 3KRJA 3D94A 3PA5A 4FTCA 5E8UA 5EOBA 3ORZA 4WG4A 3UDBA 4XG6A 4M14A 4O2PA 4ITHA 4CTCA 3PVGA 3QTZA 4PTCA 2B54A 4WA9A 3CD8A 1YVJA 1JNKA 5HD7A 3QA0A 3LFQA 4V0GA 4A06A 3KREA 4FYOA 4FSNA 3FBVA 3AKKA 1BUHA 3NX8A 4AOTA 3EMGA 4L3JA 2W05A 4GU6A 5CQUA 3B2WA 2CPKE 3T9IA 4JDHA 5B7VA 5CXHA 3VQUA 3R7UA 3IQ7A 4C3FA 3EN6A 1M52A 2BAJA 2C1BA 1MRYA 2WO6A 4GYIA 3FMMA 3C0HA 5AP2A 1XHAA 3V8WA 2YFXA 4EYJA 3LAUA 4ASEA 4IZAA 2PZ5A 3NUYA 5HG8A 3PRFA 1Z9XA 2W9FB 3QKLA 2GU8A 3IW8A 5EI6A 4PMMA 2OXYA 2W1HA 4OTQA 1UV5A 1GY3A 4XLVA 3W8QA 4DA5A 2J90A 5KE0A 4LV7A 2YDJA 3PJ1A 4AGCA 5AP4A 4YZNA 2F7XE 4WIHA 1O6YA 3FWQA 4EKLA 4N57A 2ACXA 4HPUE 3ROYA 3DFAA 4NTTA 3V51A 4DGLC 2GHLA 3QGYA 3FZSA 3GCPA 3PYYA 2GTMA 5DGZA 5E8XA 1WBVA 3CKWA 3W2SA 2AYPA 4BDFA 4E4LA 4OAUC 2XYNA 3DCVA 3P79A 2G1TA 3IECA 5CXZA 5HZNA 3C4CA 3FKNA 4E4MA 2VTPA 3UDZA 4CCBA 4D55A 4E8AA 4LGDA 5AP5A 1H26A 2W1FA 5JGAA 2H6DA 4WBOA 5BYYA 3OCTA 5TO8A 4CLIA 3OTVA 2YHVA 2A0CX 5D11A 4DT9A 3AC1A 2FH9A 5HQ0A 4U40A 3FC1X 4G16A 4GIHA 4AXAA 4U8ZA 2PE0A 5D41A 2OJFE 2OJJA 2PUIA 4F0IA 4LM5A 2ITYA 2HY81 4J52A 4IXPA 4FEWA 3P7AA 2XCHA 5KX8A 3NUPA 4IAKA 1WBOA 2B9FA 4EBWA 3ORLA 3FPMA 4F7SA 5L2TA 3TUBA 3KKVA 2WTIA 3MTFA 1GZ8A 4AN9A 4NKAA 5DNRA 4BCFA 4KSQA 4K33A 3MY5A 3FI8A 2ZAZA 4MYGA 2ZM4A 3THBA 4C2VA 3M42A 5HIEA 1FINA 2J5FA 2WIPA 1TQIA 3NW5A 2QU6A 3EQDA 2HCKA 3GENA 4PPAA 2BRHA 1OB3A 3KL8A 4S34A 5AA8A 3VNTA 5IZFA 2WOUA 4CMOA 2CGUA 4YZ9A 4W8EA 4L01A 5EM8A 3V5JA 5AV2A 3R8LA 1CTPE 2REIA 4ASXA 3LJ0A 2IPXA 5KBRA 4AW0A 4FGBA 4EH7A 2GNJA 1XBCA 3FZ1A 2EVAA 5IUIA 1P5EA 4MXOA 1EH4A 2VO7A 2JIVA 3VS3A 4CG9A 3DOGA 3IKAA 4B8MA 4EOKA 3PDTA 2OSCA 5C8NA 4EZ5A 3R83A 2O65A 5I9UA 2HZ4A 4CKRA 4LI5A 4ZJVA 3TM0A 1JWHA 4K11A 2C5OA 1YOLA 2W1CA 2YABA 4RLKA 5TOZA 3F3WA 1FGIA 3DT1A 4RT7A 1OGYA 3TJDA 4YC6A 3ZC6A 5LXMA 3NW6A 4BTMA 3QQKA 3T8OA 4DDIA 3CTJA 4BYIA 2GFSA 3A7FA 3WYXA 4C3PA 4A9SA 2W4OA 3A4OX 2XARA 4NK9A 2VX1A 3BHUA 3O23A 2Y7JA 3POZA 4IWPA 2PVRA 3ZS5A 4TPTA 4AQKA 4F7NA 2BRNA 3EL7A 3VUKA 3DK3A 4I6LA 3BLAA 1YOJA 2IZUA 1K2PA 4XLIA 4DFXE 4DGMA 4MWIA 3GU6A 2XJ0A 4WRSA 4YBKA 5AJQA 2YCRA 3G0FA 3QQUA 5AEPA 5CAOA 2C6IA 2P2IA 4U81A 3TYKA 3NFGB 4NCTC 1JAMA 4MNEA 3SXSA 4AN3A 5LQFA 2YAAA 3ACKA 4RIYB 3EFWA 2JAMA 3LHJA 2UW6A 5H2UA 5AA9A 4CKIA 2BKKA 4RJ4A 1G8SA 2W99B 1W2FA 5T3QA 4TZRA 2UZTA 4FKLA 2IZSA 3I7CA 4EHEA 4CMTA 4DCEA 4G3EA 3GVUA 3WF9A 3PUPA 1W2CA 1HCKA 1MQBA 1PXKA 2BTSA 5GNKA 4C62A 5DT0A 3NIEA 2QURA 4YZMA 3WOWA 1IAHA 3AT2A 2B0QA 3GCUA 3SW4A 4BY9E 4KB8A 4HCVA 1IG1A 5B2LA 3R9RA 4ZSAA 2OGVA 3E64A 2B4SB 4RIWB 5EKNA 1OL1A 4NJDA 3ITZA 3ZBFA 3SXRA 1L3RE 4RVKA 5DEYA 4YC3A 5E8YA 4QMXA 4ZLZA 3VO3A 3VUMA 5HORA 3U55A 2YM5A 3R8PA 4BDBA 3QLFA 4BYJA 4DFLA 5M51A 2CCHA 1NW1A 3NS9A 3ZRLA 3QYZA 3ZLWA 2CKPA 3HX4A 4UB7A 4UWYA 2C3KA 4S32A 1PMNA 4K6ZA 3RCDA 3UIXA 3ZO4A 2B1PA 4F6UA 3KXMA 2HY0A 2W96B 4XEYA 3AT4A 4Y5HA 4JBQA 4FTLA 3G0EA 4O82A 1KWPA 3AC5A 2ONLC 3MYGA 4AZFA 4FVPA 3MH0A 3W0NA 3QTUA 1ZY5A 4HYSA 2VWIA 2EXEA 2GNLA 2XKCA 3BYSA 4IZ7A 4DLIA 4TTHB 4K9YA 1OL7A 4BJJA 3CQUA 4ZXTA 3U6IA 4AT5A 3QALE 5DRBA 4DAWA 2ZDUA 4FTOA 1FOTA 2CCIA 5M56A 2B55A 5HHWA 3OBJA 2QU5A 4NIFA 2YERA 4FOCA 2PZRA 2XAMA 3FKOA 5EW8A 4V01A 5HICA 3FUPA 4BL1A 5JGDA 2E9OA 2H9VA 2A1AB 4LRKA 3HAVA 3BV2A 4D4VA 3DK6A 4QTCA 3VUGA 4BGQA 3E7OA 2J0LA 3PFYA 3CTQA 2XAOA 2YLEA 1LPUA 1MP8A 4UMTA 4YJTA 3SAYA 3MESA 2XUUA 4NKSA 2WTDA 4O81A 3R1QA 4IDVA 4MXZA 4O0VA 4HGLA 2ITWA 4GCJA 4FODA 3SDJA 3EQIA 3RPRA 3R21A 4TNDA 3NYVA 3W0SA 1APME 2C6DA 1T46A 1Y8GA 4AE6A 3BU6A 3UIMA 3V6RA 1S9JA 4BB4A 4JQ8A 4M0ZA 4F9YA 2GHMA 1CKIA 3GC9A 3RKBA 2XKFA 4BKJA 4DEDA 3U54A 2WKMA 3IPHA 4O0SA 1M2QA 3QHRA 4ITIA 3E8NA 3HP2A 5AADA 3BI6A 1HOWA 4FG8A 1TZDA 4HVDA 1U5RA 3RMFA 3R9NA 4FKTA 3PG3A 5E1SA 2QLQA 3KF7A 4TY1A 3R30A 2R7IA 4IQ6A 2V7OA 3LCKA 4KIPA 1S9IA 3IOPA 4ZZMA 4CTBA 4DG3E 1Q8TA 3L9MA 4U0IA 4U80A 4ZK5A 3HUBA 4YJUA 3RJCA 3EYGA 5AUTA 3S95A 2CDZA 3OWJA 4RC2A 4APCA 1A48A 3VONA 3TKUA 4I23A 4TYGA 2PPQA 4X2JA 3PLAE 2JD5A 4RIXA 3HL7A 5B0XA 1M2RA 4M97A 5HVYA 3GBZA 4RG0A 1E9HA 5J9LA 2V55A 4WNPA 4GT3A 4I5HA 4AG8A 1REKA 4JAJA 3C13A 4X3FB 3DXNA 5A54A 3QWKA 3ZM9A 4CQGA 2C0IA 1RW8A 3WF5A 2CMWA 3C0IA 3D0EA 3OT3A 3UZTA 3ROCA 5J9ZA 3ZLXA 3OD6X 4MQ2A 1FMKA 3GUBA 4FTAA 2UVXA 4FV6A 5GJGA 3EQCA 1Q4LA 3DQWA 4FICA 5BYLA 3W16A 3IW4A 3Q04A 5ACKA 4CFMA 5ANKA 3LFBA 1B6CB 2EB2A 4HVSA 1XH7A 1J3HA 1VJYA 4D0WA 1T45A 3WI6A 2JDVA 3KF4A 2OXXA 2EU9A 4BN1A 4FKSA 1H01A 5HLWA 3A4PA 3IDPA 3CJGA 3DJ7A 5HTIA 4G2FA 2QODA 4K2RA 4GK4A 3V8TA 5JH6A 4I92A 3RK9A 3RP9A 3HNGA 2H8HA 5FDXA 4EH9A 3E87A 4IX3A 4RGJA 4EOSA 2ITNA 3FLNC 4PDPA 1F5QA 4AWIA 5HIBA 2WTKB 2BFXA 4ANSA 4B8LA 4WG3A 2CNUA 4I94A 5GZAA 4JLCA 1H07A 3QQLA 4QP6A 4HYHA 5IMEA 2OIBA 4G9CA 5GINE 3CBLA 5AAEA 2UW3A 5ANGA 3R00A 3VJOA 4C2WA 3EKKA 1FGKA 4R77A 1XJDA 2JGZA 3OS3A 4FK6A 3UVPA 5J5TA 1ZYLA 4C37A 2XBJA 4QPMA 2RKUA 3FSKA 1DAWA 5CVFA 4I22A 4NFMA 1IEPA 3EL8A 4GKHA 1CKJA 3BHTA 4XG8A 2ITXA 3PSBA 3U4WA 4BR3A 4FKPA 2QOLA 3QKKA 4FKJA 5LVLA 5AP0A 1DI8A 3QC4A 4CYIA 3BKBA 3ORPA 4W9WA 3DNDA 4YTFA 2X0PA 2UW0A 4JAIA 3MDYA 5LWMA 3BEGA 5IH5A 3PE1A 4R7IA 4E7WA 5CAUA 1M17A 3HUCA 2J2IB 3L8VA 2CKEA 3PWYA 4NEUA 1XR1A 2GFCA 4IAIA 5B2KA 3RPSA 4HVIA 3K3IA 2VGPA 5G1XA 2AC5A 5BVDA 1Q41A 4HJOA 2O63A 5KNJA 3MN3A 3UE4A 3NCGA 2WQEA 4IADA 4QP2A 1TQPA 1OZ1A 4YJVA 2QVSE 2R0IA 3NIZA 2C0OA 3DTCA 3KEXA 2XNEA 4IVAA 1OPLA 4A4OA 4ID7A 4J7BA 3TZ7A 3HYHA 2RG5A 4U43A 2C47A 4K1BA 5EYCA 1WBWA 3R7GA 4XS2A 3KK8A 3LE6A 3UODA 3HLLA 3ZYAA 3F5PA 2JIIA 2GTNA 4PDOA 4AU8A 2Z02A 3GOPA 4J98A 4QTAA 4O7YA 4RWJA 1PKGA 5DT3A 3PJCA 3TNWA 1VLRA 3BBWA 2XNBA 2ZV2A 5M4UA 4FTNA 4H3BA 2FSTX 2X7FA 3NUSA 3W10A 2W7XA 4GW8A 1YRPA 3D83A 3IONA 2UW5A 4RZWA 2VTHA 3SW7A 4FUYA 3SG8A 4ENYA 2OFVA 3MV5A 2XK4A 3PJ8A 2WEIA 4PDSA 2PE2A 4PMTA 4ZMFA 5BNJA 5FBNC 4KKEA 2Y4IC 3R9DA 2DS1A 3OWLA 2R5TA 5BYZA 4D5KA 3TKIA 1H1RA 5HOAA 1WBTA 2BVAA 3NWWA 3ZU7A 2H96A 3QQGA 2XJ1A 3UC4A 5IQIA 2UW9A 3ODZX 2UVYA 4AGWA 4AW2A 4EH2A 5DYJA 4TN6A 4XH6A 5HU9A 4BCGA 1Z57A 4TYHA 1K3AA 1M7NA 2WEVA 2IWIA 5BQ0A 2VTSA 5IU2A 2PK9A 3FLWA 3R1SA 3VS0A 3VBTA 2YDIA 4F65A 4QQTA 2PVMA 5CENA 4I6FA 4FSUA 4FV2A 2ZM1A 3UMWA 3I1AA 2CJMA 4RFMA 4EHVA 1JVPP 5HE0A 2J51A 3QQHA 3TI1A 3F2NA 4L6QA 1YHVA 4DEIA 4QMLA 2BDWA 2JDRA 3A2CA 2CN8A 3RTPA 4E4XA 3DS6A 3LXNA 3JXWA 3KMUA 3NNWA 3UPXA 3BWJA 4GUBA 2GDOA 1VEBA 2HWPA 5FP6A 2OXDA 3H9RA 4Q5HA 1ZZ2A 4IWOA 3SV0A 5CZHA 5KZIA 4EONA 4M66A 4RWLA 1YWRA 4ACGA 3EWHA 2YM3A 2QR8A 4QMNA 5K3YA 4QQCA 4D9UA 1CKPA 3R22A 3MBLA 4NTSA 4QDEA 2QOCA 4G5JA 3VS4A 3SG9A 4KRDA 3I5NA 4HGSA 3RZFA 4AQCA 4O7RA 3V5WA 3QWJA 2XS0A 4DCAA 3VWAA 3CE3A 1UU7A 4GH2A 4XMOA 2XK3A 3K5VA 1J7UA 4U9AA 2X9FA 4L44A 4WNOA 2RL5A 4JBPA 4EH8A 3NNUA 4LRMA 4U79A 4DFBA 2ZYBA 4ONAA 4N4SA 5LMKC 4USEA 2KULA 4BDHA 3A8XA 2GQRA 4ZSJA 5M53A 3KY2A 5F20A 4CFFA 2UVZA 4EK3A 4XV2A 2GHGA 1JSUA 4IM0A 5CZIA 2F7EE 1QMZA 3AD4A 3KK9A 4EL9A 1TFFA 3TZ9A 2GMXA 4J99A 3PY3A 4IB3A 1W82A 2J6MA 5KKRC 3OXIA 4RFYA 3MB7A 1OKVA 5H3QA 2X81A 4YSJA 2W1IA 3W55A 3NAYA 3U8WA 4G3DA 4I0RA 3ZO2A 2OIDA 3EQPA 2YM6A 3NAXA 3VBXA 3NSZA 3R63A 3P5KA 2XEYA 4GKIA 4RBLA 5IA1A 1ZYSA 3A60A 5T6KA 1ZWSA 5HO6A 2LAVA 4BHNA 4O0TA 2XNOA 1VR2A 1AQ1A 3DAKA 4YURA 4PP9A 3ZSIA 2F49A 3QAME 1PXIA 2YIRA 5T68A 2C69A 3ACJA 1R0PA 3AC4A 5ETIA 3UNKA 2BDJA 2E9NA 1YKRA 1SNXA 4LYNA 4KBKA 1PMEA 3DV3A 3QUEA 5FTQA 4M69B 1WVYA 3R8ZA 3HECA 2ETMA 5FXSA 5A14A 3ORXA 5L4QA 3LIJA 2EXMA 4YJSA 2UUEA 3Q9WA 1H0VA 4BGGA 1SNUA 3BGQA 1SYKA 1BMKA 4ANNA 4B9DA 4E3CA 2PVYA 2X8IA 4FTKA 1YXXA 4ZTSA 3CSVA 4MD9E 4UMUA 1OVEA 4YJOA 3BGZA 4FV3A 4WOVA 3VBVA 4FT7A 4YNOA 4BDAA 3SOAA 4Y72A 5IH4A 4LV8A 3AC3A 4TWPA 4ASZA 2CHLA 4AS0A 1UU8A 3SLSA 4OTFA 2PVKA 5DR6A 4QT1A 4FTJA 5DN3A 4FV8A 3OROA 4BDDA 5EW9A 5C01A 3DTWA 4HYIA 2A2AA 5LCKA 3RHKA 3UDSA 2C30A 4XG3A 3R9OA 2G2HA 1U54B 5L3AA 3P5JC 5CEPA 2WFYA 3KU2A 3HRFA 3ZO3A 2YIQA 3QL8A 3FEGA 3G33A 4UYNA 3E63A 2VO0A 3OEZA 2WQNA 4MWHA 4EWHA 1UNHA 4LOQA 4GT4A 5A4CA 1H27A 3BCEA 3SXFA 3C4WA 1J91A 3OUKA 3EN4A 4R3RA 3CEKA 1U46A 3IGOA 2QLUA 4O6EA 4RVLA 5IQBA 1FVRA 1OPJA 3D2IA 3PIXA 5CYIA 5EYDA 3ZH8A 1YHWA 4F1MA 3QCXA 3VUDA 4EC9A 4AGUA 3BLRA 4FSRA 3IS5A 4I24A 5EG3A 4QP9A 3II5A 4C02A 4YR8A 3DA6A 4PQNA 4WSQA 4F0GA 1XH4A 3CIKA 1Q97A 2OO8X 3V5QA 4C61A 3Q4ZA 1V0OA 3BHVA 4YHFA 2JAVA 3DU8A 1VYZA 4R7HA 2VTIA 2VWBA 4PTGA 4DINA 3K5UA 4E6CA 1Y8YA 4UBAA 1CDKA 3MI9A 2WU6A 3LFSA 4HNIA 5BUIA 5I0BA 4BIDA 3E8DA 4L3PA 4D2RA 5LMKA 1CM8A 1GJOA 3KB7A 4HCTA 3RAKA 2C0TA 3V6SA 4EH4A 1YXTA 2BZJA 3Q5IA 4XCUA 4W8DA 2PVHA 3C1XA 2RF9A 2HIWA 3ZC5A 3KA0A 5LJJA 1OIRA 4UMQA 5DR9A 2F9GA 3MPAA 5JT2A 3W0RA 2XM9A 4IFCA 5L8KA 4FL3A 3Q2JA 3TV6A 3MVLA 2JKOA 4X2NA 4DTKA 2OFUA 3C4XA 1IR3A 1YWNA 4F0FA 1O9UA 3H3CA 5HGIA 3CY3A 5ANEA 4GFMA 4FSMA 5ITAA 3VBQA 3BELA 2AUHA 4YGAA 4XX9A 3ORIA 4WT6A 4DH7A 5L6OA 4EEVA 3AQVA 3HZTA 3JR1A 4XG9A 4I3ZA 4M67A 3VJNA 2Y9QA 2HZNA 4D4SA 2WPAA 4RX5A 3R02A 1NY3A 4FNXA 5AAFA 2HENA 5E1EA 4JVGA 4GVJA 4KWPA 2XA4A 3MA3A 3NDMA 2XANA 3LVPA 1JSTA 2W5AA 4MK0A 4PTEA 3FPQA 3MH3A 3PA4A 1Q99A 3UVQA 5AP7A 3AD6A 3OHTA 4FL1A 3TZMA 2YJRA 4UN0C 2R3IA 4L67A 4XHKB 1ERKA 3ORTA 4U3YA 5HTCA 1PJKA 3G15A 3PPJA 1MUOA 5HX8A 3QU0A 1OECA 4JIAA 4G6LA 1FBNA 5CSHA 3AMAA 3KRXA 2QKRA 3DKCA 4U6RA 3KRLA 4RMZA 4IDTA 4I6HA 2VO3A 2WMVA 3SRVA 1ZMWA 5E91A 4CT1A 4LDTA 3PWDA 3TACA 4E4NA 3RI1A 4IB5A 3DBQA 5EHYA 2O5KA 3QF9A 5TT7A 5H8BA 4EQMA 2BPMA 3MVMA 1YXUA 4YP8A 3TJCA 2OI4X 4AOIA 4EWQA 3PXFA 2VTJA 2XCKA 2ZDTA 5FWKK 4AZEA 4Z16A 2BTRA 4JJRA 3E3BX 3LCOA 4TYIA 5L2IA 4E93A 2IJMA 4NH1A 5ANIA 4EH3A 3MIYA 3MY0A 4AACA 4OR5A 2C6OA 4FG9A 2GNIA 3I4BA 3A62A 4J1RA 2Z7QA 3QX2A 3R7YA 4ZTRA 3FY2A 5CNNA 3KRRA 3DBDA 3DFCB 4X2GA 4DEBA 5CVGA 3P9JA 2UZNA 2QOHA 5JKGA 3AGLA 4V05A 3F3UA 4EZ3A 4YU2A 4JXFA 5EM6A 4F9BA 4YLJA 2WB8A 3HA6A 4QQ5A 3N51A 4FIEA 4BTJA 4CFNA 3S00A 5K9IA 1X8BA 2J9MA 3VUIA 3WZJA 5BUJA 4Q5EA 4FRFA 4FZDB 5AR8A 3P08A 4AF3A 5JFVA 2C6MA 5M09A 3C4ZA 4HW7A 5B2MA 1Q8YA 2YITA 5C8KA 3RM6A 1GZOA 4MUQA 2RSVA 3HP5A 4X21A 2X4FA 3LM5A 5CU4A 5DEWA 3EFJA 5EKOA 2PZIA 4RRVA 4D4YA 3KMMA 4E1ZA 3POOA 5CU6A 2WU7A 4YJPA 4QNYA 1NXKA 3PSCA 3COHA 3ANQA 3FZRA 3GB2A 3MIAA 4O4BB 3Q9YA 4NIFB 5DRDA 3NR9A 2UW8A 4D5HA 4DDGA 1YDSE 3WYYA 4CFUA 4G31A 4IZYA 4FSYA 2X0OA 4J8MA 3VHKA 1K9AA 3IDBA 3OWKA 4J95A 5K4JA 1YI3A 3DDQA 3R8VA 5EQYA 4RJ5A 5I9ZA 3EZVA 2ZVAA 4BKZA 4PNKA 2JEDA 5L8LA 2J0IA 3JPVA 3T9TA 4RQVA 5K5XA 4BBEA 3LKMA 2PTKA 5DLSA 3FV8A 3VS6A 5F94A 3UQCA 4NW5A 4CFWA 2IW8A 3TTIA 4L46A 4NT4A 1B38A 3F5XA 4I6BA 5HG5A 4F64A 3LCSA 3AXWA 1NVQA 1YWVA 2R9SA 4C3RA 1UU3A 4EOQA 2FSMX 4IH8A 1OUYA 4WNKA 2YWVA 4BCJA 1UA2A 3V3VA 3QGWA 3NEWA 4D58A 5EQPA 5HESA 3G9NA 4ERKA 5AIRA 3HDMA 4K77A 1J7IA 4BCPA 4G9RA 3U6JA 4CD0A 4FE2A 5EK7A 3QTQA 5L8JA 3UYSA 4QDVA 3FI2A 4ZSGA 5H8GA 4MEDA 2ZB0A 4O7ZA 3GFWA 3IGGA 4B7TA 4X7QA 5KBQA 4UXQA 1R3CA 3HV4A 5DH3A 5BVOA 1XH6A 3F5GA 4OBPA 4D0XA 3A7JA 4GS6A 3BE9A 4FTMA 4NM3A 3VRYA 2JKKA 4USFA 3TT0A 3O7LB 5KHXA 4FSQA 1V1KA 4X6QC 5DA3A 1MQ4A 4FSWA 4G6NA 3FMDA 4YJNA 5IQGA 4ANMA 3FLZA 4PNIA 5CI6A 4YPSA 4RIXB 4FV5A 2DWBA 2VZ6A 3KN5A 1BLXA 3OG7A 5CAPA 5M44A 3QTIA 3NYXA 4GEOA 5HNIX 4DTAA 4I4EA 5HI2A 4IM2A 1PYEA 2J50A 2HZ0A 3OY3A 4Z3VA 4UWCA 1U4DA 1VZOA 4DHZA 1QPDA 2WOTA 3R7IA 2R3QA 3LQ8A 3WF7A 3R6XA 1B39A 4ACDA 2QKWB 3AG9A 1WZYA 4II5A 4Q9SA 1HCLA 5BPYA 3QD0A 2HYYA 4H1MA 1OIYA 3DBFA 5KMIA 3GCQA 2HK5A 2XKDA 3TCPA 3UMXA 3UZPA 5FM2A 4WG5A 4BZOA 2VUWA 2XM8A 3ZBXA 5CEOA 3GC8A 5KO1A 3TWJA 3W2QA 3RHXA 4N0SA 3RAIA 5CALA 5DVRA 2WMRA 5LVMA 5CANA 3H0YA 2P3GX 4BWKA 5CX9A 2XIZA 5CSWA 3Q4CA 3ZUTA 5L2SA 1IAJA 4AA4A 2VU3A 2OH4A 5C26A 1MRVA 4YJQA 3RWQA 2B9IA 2CLXA 2YN8A 1Z5M