4G6NA

Crystal structure of the erk2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
341
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK0
rcsb
source organism Homo sapiens
total genus 109
structure length 341
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4g6nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4g6nA01
3KRRA 3CPCA 5CSPA 4X21A 3O8PA 2XBAA 3U9CA 4NIFB 4CYJA 2G2IA 5DRBA 3GU8A 3NWWA 3O23A 4S31A 4FEVA 5FEQA 3IDBA 2JIVA 1RQQA 2R3MA 3R9HA 3RI1A 4FIGA 2W7XA 4FG7A 4D28A 3C7QA 2Y4PA 3DCVA 2CGXA 3U55A 4O84A 2ZV7A 3PYYA 5BYZA 4K0YA 4C62A 3OF0A 2CN8A 3I7CA 3UTOA 5JMSA 4RA4A 3LLAA 3F3WA 2GNHA 2HAKA 4HVSA 2WQOA 3HMNA 3FLNC 2O0UA 4RX7A 4YTFA 4FSWA 3G51A 2ZB1A 3G9LX 4X7QA 1Y8GA 2ERKA 3BEGA 4KABA 5LVPA 4CFMA 2J5FA 4I5PA 4DITA 4U44A 2IZRA 4O7RA 2DUVA 1GIIA 2UW6A 4FIHA 2WPAA 4HVIA 4FX3A 2ITVA 4U80A 5FLFA 4BN1A 3ORIA 4NFNA 2VAGA 3BHYA 2X7GA 4O82A 4Y83A 2ETMA 1ZZ2A 2XRWA 3UG1A 2OZAB 1BX6A 3VF9A 3BU6A 3SKCA 4I4FA 3CC6A 5CI7A 3KK9A 4MNEB 3OCBA 4D1XA 3ROCA 2PYWA 1H1PA 1U59A 1XH6A 1WMKA 4G9CA 3NIZA 4NSTA 1WBVA 4IANA 3TN8A 4USDA 3W8LA 1KE7A 2G2FA 3EQHA 4YZCA 3L9MA 4RPVA 4FKUA 3A61A 3QU0A 4MKCA 4G6NA 4MX9A 4V04A 4YO6A 2VX1A 5E8TA 2QLQA 4BCGA 4ZTMA 1Q24A 1ND4A 3R1SA 5EHYA 2OIBA 2IVTA 2UVYA 3KQ7A 3ELJA 2J50A 2QHNA 4JBQA 2F2UA 4DEEA 2QOCA 3D4QA 3UBDA 3H9OA 5A4TA 4CCUA 4GIIA 3N51A 2XVDA 3UVRA 4CCBA 5EW8A 1WBTA 4HGSA 1HOWA 3DZQA 1ZLTA 4QYEA 4Y8DA 5HG7A 2C69A 3IDPA 1Q3WA 2X8DA 3LM0A 4L3JA 4ASDA 4KSPA 4ALWA 3MY1A 2OGVA 3FHIA 1Q8YA 4C02A 4G3CA 2BRMA 2C6IA 1M7QA 2JFMA 1B38A 1TVOA 3OMVA 4L44A 3VJOA 2E9PA 3ORZA 4NFMA 5E1EA 4I22A 4I20A 3GCSA 1IAHA 3DPKA 5BX0A 1ZY5A 3ZM4A 3FLWA 3E7VA 1PW2A 4O1PA 4ZSLA 4L9IA 3RPOA 3GUBA 3HMIA 3AC1A 3P08A 2WKMA 4EK3A 3JYAA 3CP9A 1YOJA 1IA9A 2VZ6A 4GSBA 3NEWA 5J9YA 4FVPA 2W5BA 3BEAA 5C01A 3K3IA 2IW9A 3ZH8A 3ENHA 3DBCA 4RIOA 2EU9A 3KC3A 2CKOA 2ONLA 3UE4A 1A48A 4J8NA 5IEVA 4L52A 3WF9A 3DT1A 4RQVA 4BDHA 1GIHA 1BKXA 2AC3A 1B6CB 4PNIA 4ANNA 3I1AA 2BRNA 3D5UA 1W83A 4DH5A 3R73A 3PJ3A 1ZZLA 3HL7A 2W99B 4ZTLA 4EYMA 3WE4A 3LOKA 5B0XA 5K4IA 4YNEA 3RGFA 1UNHA 5KZ0A 2XEZA 4RFMA 5AR3A 3V8SA 2YEXA 5A9UA 1FINA 3GP0A 4O2PA 1J1BA 4D58A 4D9UA 3R9OA 3F61A 3D5VA 1JAMA 2LGCA 2CLQA 2WIPA 3MH3A 2R7BA 2GS6A 4I5MA 4K2RA 4WA9A 4WO5A 2RFSA 1PMUA 3LM5A 4F7LA 3CKWA 1U5QA 2C0TA 4IZAA 4USFA 4CFVA 5CZIA 4CLIA 2JC6A 4OTGA 2YFXA 4L7SA 2E9NA 4S2ZA 5EQPA 4C7TA 1BI8A 4G3FA 4FKPA 4YJTA 5IMXA 4GKHA 3OD6X 5J87A 1W8CA 3QZFA 4MD7E 3BV3A 4CT1A 2PPQA 5B2MA 4ZMEA 4L43A 3PP1A 4FTJA 1YVJA 4AZSA 2JAMA 2BFYA 3LXKA 4MCVA 4ANSA 4AFEA 1OB3A 3FUPA 4X3FC 3UC3A 5FDPA 4IACA 5KBQA 3UIUA 5AV3A 4BB4A 4QMPA 2OZOA 4YZMA 1O6LA 4AUAA 1PHKA 2CDZA 4KS8A 3BYUA 5TT7A 4HVHA 4CQGA 4R5SA 4E6CA 2Y4IC 2Z2WA 4CTCA 3DLZA 4FICA 2YCFA 5E91A 4DFNA 4BCQA 5AM7A 4BCMA 2X1NA 1E1VA 2PZPA 2DQ7X 3OCSA 3ZXTA 4QT1A 1UU9A 5CF8A 4AZTA 2ZJWA 4TWPA 3MFUA 4NTSA 5JGDA 4OT5A 3K3JA 4E6AA 5IH4A 5FGKA 4M0ZA 3Q9WA 5EYDA 3KXGA 4IXPA 4JVGA 4IWPA 4TWOA 4HYSA 1DI8A 4Z16A 2ERZE 4ZOGA 5LMBA 1QPCA 3C4XA 4Y73A 4A4OA 4DC2A 5DT4A 2VTMA 1V0PA 3CTJA 3P7AA 4FKSA 4D5HA 5ANGA 3HGKA 4MBJA 3LFDA 3WE8A 3GC0A 4U5JA 4M12A 3PVGA 5HESA 3C4WA 5HO8A 5JZJA 2JDVA 4J7BA 3HUBA 2OJFE 3LAUA 3BLHA 1KE5A 3R22A 3RK9A 1L8TA 3FI8A 3HAVA 2VO0A 3E92A 3Q4UA 4C4JA 4QNYA 3SD0A 3DTCA 2QURA 4IH8A 4OTHA 3SC1A 3MV5A 3POZA 4KSQA 5DN3A 4FR4A 1R1WA 3CD8A 2WOTA 2VTIA 3DTWA 2HWPA 4RX5A 5L2QA 3OBJA 2P2HA 5C4KA 4D4RA 3HX4A 3GXLA 4IAAA 4PL4A 1BLXA 4WSQA 3PY1A 4O6LA 3GFEA 4ZAUA 5LMAA 3ZONA 3PIXA 4NZWB 4HCTA 4CV8A 3COMA 2YA9A 2C3LA 1DAYA 4RJ7A 5CY3A 4C61A 5JGAA 5LWNA 1HCLA 2XS0A 3KN6A 4O2ZA 2V5QA 3REPA 5CEQA 3ZO2A 2XIKA 3GENA 2XZSA 1WBWA 5IA5A 2UW4A 3DQXA 4XYFA 3MB7A 1OPLA 5BYLA 2GTMA 2QOIA 3LCOA 3MJ1A 5D12A 4IM2A 3TZ9A 3V3VA 5HCXA 4AF3A 4ZLOA 3BPRA 3VHEA 4GVJA 3UZTA 2PUPA 4H1JA 4CZYB 3UNJA 3EN9A 2RGPA 4OTWA 2QOQA 3HVCA 5EH0A 4BCJA 4E7WA 4EK6A 5H8GA 4EL9A 2YZLA 5L4QA 4ALVA 2C5YA 3R1YA 3ORPA 3R1QA 3FLSA 4FTCA 3GU6A 4CEGA 1PXJA 4LGDA 2V0DA 3SRVA 4U79A 3TZ8A 1MQ4A 5BVKA 3NX8A 3N4TA 3A7HA 1H08A 3F3ZA 4AACA 4GK4A 4K8AA 3U4UA 4ONAA 3GEQA 5FEDA 1JSTA 3KMUA 4HYUA 5EKNA 5JFSA 5JK3A 3GCPA 1Y6AA 1XJDA 4NM0A 4R1YA 4O21A 4KD1A 4X2JA 3TNQB 2UW7A 4L46A 2ITZA 3LFEA 1U54A 2YDKA 3GC7A 3EOCA 3MFSA 4D2PA 2GU8A 4BWKA 1UNGA 3BCEA 2GSFA 1GJOA 4XCUA 2J0IA 1YXXA 4QYYA 3KF4A 3CSVA 5FTGA 3BBWA 4H05A 2O8YA 5K5NA 4FIFA 5IQBA 2O63A 4KNBA 4IAZA 3RAIA 3UC4A 4PNKA 4YJRA 4ZSAA 4RJ5A 4MXZA 1LUFA 3ZDUA 4RIWA 3T3UA 4BDGA 3NW6A 4L42A 2OWBA 3HDNA 3WYXA 4DHFA 2I0EA 1XH5A 4GVAA 5L8KA 5HE2A 3QXPA 3HMPA 1IG1A 3OS3A 2QO9A 2XNGA 3MN3A 3UOHA 2NRUA 2RG6A 4HOKA 4EOLA 3I79A 4XBUA 4H39A 3RZFA 3CGFA 1H24A 2GS7A 5M4UA 1FVTA 3LJ1A 3E62A 2R3GA 5HBEA 1H1RA 3KULB 3RAKA 4JLCA 4D4YA 4QPMA 2EWAA 3GOPA 1OBGA 3OROA 5ACKA 4IC7A 3S00A 4BTKA 3FI2A 1PRYA 5KCVA 1A9UA 4FKRA 3FI3A 2IW6A 4FL2A 4USEA 1ZMUA 3PDTA 5HX6A 3ZO4A 3NUAA 2EXCX 2V55A 3LFFA 5M08A 2QG5A 4IZ5A 4QMZA 3NVKI 1RDQE 4F7NA 4HVGA 3VUIA 3ZFYA 1Q97A 2VWYA 4LQMA 4ACGA 2C6KA 4AA0A 5B2LA 4FNWA 2CGWA 4YHJA 4ZTRA 1OKVA 4DGOA 4IDTA 5HBHA 2HELA 4DFZE 3QWJA 3LMHA 4PDPA 3KA0A 3LZBA 3P7BA 2BIYA 5CEIA 2VWUA 1YWVA 3TEIA 4O0RA 4CTBA 2QHMA 4FV0A 4IAIA 4EQUA 1Z57A 5HX8A 2R4BA 2ZDUA 3PY3A 3FMEA 2VTPA 2A1AB 3R21A 3PWDA 3R83A 3SW4A 4U45A 3JR1A 3VF8A 1R3CA 5FG8A 3FZPA 4NWMA 4CZTA 4O38A 4KBKA 2EB2A 4ZTNA 4C36A 2OU7A 3GC9A 1RE8A 4C4GA 4ZXTA 2AYPA 3CKXA 5L2TA 5JEBA 2B54A 3Q60A 5EDPA 3D2KA 2WQMA 4G16A 3TJCA 2WQEA 1L3RE 3A4PA 4RLLA 5HO7A 4Y46A 4WKQA 4EZ7A 2VNWA 3LPBA 3ET7A 3FZSA 4X3JA 2A4LA 4I6FA 3S2PA 5L2WA 3OCTA 1YWRA 3QCYA 4RJ4A 4MVFA 5K0XA 4UWBA 4UX9A 3I5NA 3H10A 3H0YA 3G33A 5IEXA 3CIKA 5J5SA 5D41A 4MTAA 1YXTA 5CT7A 5J7HA 1FMKA 2QR7A 2WMAA 4MWHA 3W16A 4BDDA 4BCFA 1G5SA 4D9TA 2HZIA 4QP2A 1UKHA 4FTQA 3OWLA 1V1KA 5AP4A 1SMHA 1JVPP 4W8EA 4K1BA 3WZUA 2XK4A 3L9NA 3HEGA 4EONA 1R39A 1R78A 5CXHA 5GZ9A 5I0BA 4R7HA 4D5KA 4F63A 2UUEA 4C3PA 1PF8A 2YIQA 2VUWA 2OJGA 4G31A 4XRJA 4QP3A 3FSFA 4H58A 5K9IA 3EN6A 3SDJA 3R7EA 3QXOA 4O22A 2PU8A 3LMIA 4C33A 5KMJA 4NM5A 1E9HA 3O51A 2J4ZA 3ORMA 4UMPA 3KVWA 4FV4A 3H4JA 3PJ2A 4RIWB 4M0YA 5T3QA 3M2WA 4LMUA 5AAGA 1KUTA 3HUCA 3JY0A 2ITWA 5BVOA 2WMRA 4GFMA 2F4JA 3IW8A 4M15A 3TZMA 5DFPA 5K3YA 3OVVA 1OGUA 4RVKA 4YJUA 4FTIA 5CTPA 3R0TA 3NZ0A 4M84A 3ZRKA 4FODA 4BZDA 4DG0E 3ZM9A 3CTHA 3R8PA 2P55A 4FYNA 3C9WA 3UNZA 4BWXA 4C38A 4D0XA 1RJBA 4YSJA 5KKRC 4ZTQA 4C4HA 3ERKA 4QMLA 4YC6A 3E8CA 4UEUA 4O0TA 5DHJA 3TNPC 2PWLA 5EM6A 4FEUA 5JN2A 2I0YA 1XH8A 3O71A 1YWNA 4DH8A 2YISA 4DINA 3IOKA 3G90X 5KMLA 1OIQA 2X6EA 3BU5A 2YM5A 4F1TA 4L3LA 4IB5A 3NUPA 2PVNA 1PY5A 1OPJA 4A9RA 2YIWA 3MGYA 5ANJA 3HRCA 1FVVA 3QD2B 3FMNA 3RK7A 4CVAA 4PL3A 3NPCA 4EZ3A 4YC8A 4DGMA 2C4GA 2UW8A 5K5XA 3NS9A 4O1OA 5BUEA 1ZYJA 2F7XE 4FOBA 3EN5A 3QZHA 4P2KA 3VQUA 1VR2A 5AAEA 2W1FA 1E1XA 3DAJA 4JAJA 4LMNA 4OTFA 4RZWA 4YC3A 4EOQA 4PDYA 4BYJA 4PRJA 2YCRA 4IJ9A 4M3QA 2Z7RA 3TUDA 4MAOA 2OW3A 4OBPA 1GZ8A 4BGQA 4F09A 3NUSA 2BAJA 3QLGA 2IZTA 4JR7A 2XUUA 4GCJA 3L9LA 3QF9A 3EWHA 4LV8A 5HE0A 3EJ1A 3O7LB 5TF9A 2W0JA 2YJSA 4D2TA 3IG7A 3BRBA 5AV0A 3BLRA 3DDPA 5CU0A 3COHA 5HTCA 3ZRLA 4ZTHA 5AV1A 3ZUTA 3RK5A 3QYZA 1CSNA 1JWHA 3EKNA 4FC0A 4RJ8A 5ANEA 4YMJA 5CXZA 2XNEA 2QO2A 2C5OA 3QGWA 4MXCA 3SW7A 2XJ2A 1UVRA 2ZV9A 3QCSA 3IPHA 2B9HA 3KXXA 2V7AA 4BGHA 2PMIA 4IM3A 3R9RA 3LXPA 4GIHA 4IFCA 4IHPA 3BHUA 4HPUE 2UZDA 3O7LD 4XEYA 4BCOA 5HCYA 4F7JA 3MESA 2HK5A 1ZMWA 4WNMA 3W55A 2C5XA 2Z7QA 3N4UA 5CNOA 1NVSA 3UIMA 4Q2AA 3Q53A 3CTQA 2PHKA 1W7HA 3AT4A 3D9VA 4ZP5A 3BWJA 2DYLA 4FV6A 4O0XA 3VBTA 3LKMA 5KMOA 3ANQA 5CWZA 1H25A 4UWCA 3QZGA 4WG5A 1PXPA 4RBLA 1Q62A 4UMUA 5CF5A 4C4FA 4DH1A 4YZBA 1OUKA 4CXAA 2JKKA 3QC4A 4FV7A 3NCGA 5DG5A 5EQYA 4QQJA 4AFJA 1MQBA 1ZYLA 1KSWA 2WNTA 4EBVA 4TPTA 3VJNA 4ACDA 2GMXA 5IDPA 4OR5A 4WOVA 2VN9A 3D0EA 2OZAA 5EDQA 2QCSA 4PDOA 4FV9A 3SV0A 1OL1A 2PULA 4QMNA 5BYYA 5L8JA 4C4IA 4MF0A 5M07A 5IA3A 2QONA 4FKVA 5EYMA 5GHVA 5F4NA 4CZUA 5I9YA 4MNFA 2HXQA 3LFSA 3DJ6A 1JKTA 3P1AA 4R7IA 3KRXA 1VJYA 3HNGA 2WTDA 3GQLA 4AWIA 3D7TB 2EXMA 3QTZA 1FPUA 4LUEA 4LGGA 4UYAA 2C6OA 4WG3A 5ACBC 2R9SA 3RJCA 3RNYA 1NT2A 2R0UA 4BICA 3QUEA 3PXKA 4BCHA 2E2BA 5FM3A 3F5GA 4YJPA 2R3FA 1XH9A 3VW6A 1FBNA 2BUJA 2Q83A 3OTVA 3R01A 3SAYA 4HVDA 4YTIA 4LRJA 5AX9A 4APCA 4R3PA 5DGZA 4O0YA 2A27A 3D15A 4AU8A 3QD0A 3OFMA 3U54A 2P3GX 3TUCA 4BRXA 2ZDTA 2CN5A 2C30A 1YW2A 2X2MA 1UNLA 1EH4A 3O0GA 2JFLA 3GCQA 3MPTA 4RLKA 3ZUVA 4KUJA 2GDOA 4BHNA 3IS5A 4YLJA 3AXWA 4E5AX 1IA8A 4YZNA 4JDIA 4WRSA 5IDNA 3R8ZA 1AD5A 4EH8A 3QL8A 2UZVA 2E9UA 4FUYA 4PL5A 3KXZA 3C0GA 3N9XA 3QRJA 2W4OA 3EQGA 4A4XA 3R28A 3VULA 3CXWA 4AN9A 4F1OA 1S9IA 3WZDA 5CSVA 3I81A 3UNKA 1H28A 4X6QC 2P0CA 4XOZA 5TR6A 5M57A 4FSRA 3A8WA 3VUHA 4L3PA 5F9EA 1YOLA 2C6EA 2W1DA 4QMYA 3TTJA 3DBQA 3KRLA 3UQGA 4M14A 4BHZA 5EW3A 5IA1A 2NP8A 5AWMA 1IR3A 1JKKA 4IVCA 2WD1A 3Q9YA 3OT8A 3FL4A 2HWOA 4IAFA 2PE1A 4PMMA 5A3XA 4DG3E 3W2QA 4CFFA 3MVLA 3OY3A 4TNDA 5AX3A 4EJ7A 3ETAA 4J97A 4ACCA 3C4EA 4BDFA 4UV0A 3ZHPC 4L01A 5DT3A 2OIDA 5GJGA 2O2UA 2SRCA 3P7CA 3QUDA 3MH2A 1ZYDA 3N4VA 5CNNA 4D2SA 4TL0A 4C3RA 1H1WA 4DLIA 1APME 4S33A 2Q0NA 5DLSA 4IDVA 4D4SA 5GINE 1Y6BA 3VS1A 1M2PA 3RZBA 4RWKA 3CQUA 1KE6A 2OJJA 4O0VA 2ZMDA 5E90A 4AS0A 3W2PA 5H3QA 3MTFA 4MK0A 1Z9XA 5HLPA 2W9ZB 5AP3A 3RWQA 4EHVA 4DCEA 5HU3A 4XG6A 4FEXA 4DGNA 4I6BA 5HD4A 4O81A 3EFKA 4DEGA 4EC9A 4DEBA 4U97A 3SXFA 2BKZA 2PZ5A 4JL9A 4CRSA 4TYHB 3ROYA 3T9TA 3UOKA 3HV6A 3QTSA 2RKUA 4FIEA 2J0KA 2JEDA 5C8NA 4AW1A 4IBMA 3D14A 4V0GA 1XWSA 2BDWA 4WT6A 5HVYA 2JD5A 1J7UA 2WTJA 3VRZA 1M52A 2NPQA 4ZY4A 4DTBA 2PTKA 1M7NA 5CX9A 3S4QA 3KCKA 3LJ2A 4UN0C 2IVVA 1NW1A 4RX8A 3CS9A 3R00A 2X8EA 4PWNA 1DI9A 4XS2A 5HHWA 3UMXA 4F64A 5FBOA 3QGYA 3UVQA 4F9BA 5L6PA 4DEIA 1XH4A 2WMXA 3JVRA 4MQ1A 3UMWA 2XM9A 4IWQA 3IONA 3R1NA 3NLBA 4M97A 4AA5A 2R3QA 3HRFA 3P9JA 3WIKA 3EH9A 3VBQA 4BIEA 5CQWA 3PSBA 4J53A 2R3KA 5G1XA 2BZHB 4NJDA 4RT7A 3EQCA 3MFRA 3KN5A 3EQIA 4I3ZA 4IWOA 2QOFA 5T6KA 3RNIA 4O0SA 3PPZA 3UO5A 3C50A 4C37A 4L68A 2I0VA 5FTOA 3T9IA 3SVVA 1QPJA 4DN5A 1BI7A 2YCSA 3QD4A 4C3FA 4NM3A 2BR1A 1Y57A 4MD8E 3P79A 5A14A 4LYNA 3U51A 3BYMA 4I6HA 4Y95A 5GNKA 3DNDA 2B0QA 2XCHA 5CU3A 2NRYA 4YZ9A 4YR8A 1Q8WA 3F2NA 4RWLA 3ZLSA 5JRQA 4FL1A 2BZIB 2WMSA 2ZOQA 3A2CA 1WCCA 2PVYA 3LFAA 4MD9E 5AJQA 2QQ7A 4JRNA 3CJFA 4BDAA 4O96A 5HI2A 4PX6A 3SG8A 3TIZA 4F0IA 3FMHA 3E8EA 2XA4A 3ZC5A 2R64A 5ANIA 3O96A 2C3KA 3S1HA 3FKLA 3Q96A 2CLXA 2UVXA 1GZOA 2C6MA 5ANDA 1XQZA 1UWJA 4U6RA 3ITZA 5ITAA 4LL5A 4OTDA 3ENMA 2Y6OA 4YNOA 4FZ7A 3NR9A 4EZ5A 4O7VA 4RJ6A 3FKNA 2OO8X 3WOWA 3QX4A 3PP0A 5AA9A 4O7LA 3C1XA 4ANBA 5IZFA 3DB8A 2JDOA 2R0IA 2WIHA 4EI4A 5C03A 4DF3A 2G15A 2YM6A 3FYJX 4TZRA 4UMTA 4DEHA 5AUYA 3GVUA 2NO3A 4JOAA 3GOKA 1OPKA 1P5EA 3QTUA 4WRGA 3TI1A 4QMOA 4TRLA 3GGFA 5AUTA 4AG8A 2H8HA 1F5QA 3PA5A 4ZS4A 2JIIA 3I0QA 3PLSA 3KXMA 2A2AA 1PKDA 3C5IA 4DGLC 5CAUA 1JNKA 2IG7A 3NNWA 3OUKA 4IAYA 2VTHA 5AIRA 3UODA 3LXLA 5IA0A 5EFQA 3TV7A 4OTIA 5FXSA 3W2SA 3D83A 4FEWA 1Q8ZA 1REKA 5M06A 4LG4A 5M55A 4V0GB 3DAKA 5DPVA 2ZV2A 4Z7GA 4H36A 2XF0A 4JT3A 4RX9A 4U0IA 4RFZA 5D11A 3R9DA 2EXEA 4E20A 1OITA 2IVUA 3WF7A 4BBEA 3AD4A 3Q3BA 3G9NA 5E8VA 5DEYA 5ETFA 4H3PA 3CE3A 3EKKA 4EHZA 2YIYA 4FYOA 5KO1A 5AMNA 1ERKA 4FL3A 1IRKA 5FUTA 2B9FA 2IWIA 2C47A 3BYSA 5ANOA 3QWKA 4BDCA 3TKUA 4LFIA 4CMTA 2YIRA 3NYNA 5D7VA 3IGGA 4L6QA 5K4JA 4G3DA 4ITIA 4JQ7A 1F0QA 2IZSA 2VRXA 1F3MC 3MVMA 3PXQA 2VU3A 3LW0A 2C3IB 2I1MA 5LOHA 1PXKA 2XKFA 2PK9A 4ARKA 4WD5A 5HTIA 4RSSA 4CGAA 2UW9A 4BY9E 4NKAA 5IEYA 5D9HA 1K2PA 3DAEA 3C4CA 4E73A 4F0FA 4GKIA 3AC5A 4B9DA 2CJMA 1CTPE 2PE2A 2WHBA 3EN7A 3KULA 4M7IA 4E4MA 5HG5A 3VS2A 3HDMA 3I4BA 3VUGA 1PMNA 1UA2A 3OG7A 2YHVA 1FGIA 2ZM1A 2HW7A 3DKOA 5FQDC 5J1VA 2XBJA 2C6LA 4WIHA 1K3AA 3V8TA 4BCKA 4O27B 1JBPE 3RCJA 2X7FA 2H9VA 3PUPA 4QTEA 5AP0A 4CQEA 2R3RA 5KMKA 3QKMA 3UP2A 3QQLA 3EIDA 3RAWA 2WFYA 5HKMA 5BVNA 4NL0A 2OKRA 5CALA 3CD3A 5M53A 2GNIA 3U9NA 3QC9A 3QFVA 4Q9SA 5HVJA 3ZSGA 4DBXA 4BKYA 1GIJA 1SVEA 3TKHA 3Q2MA 4GUBA 4BZNA 5CAQA 1TQIA 2IPXA 4YJVA 3LFNA 1KV1A 4RWIA 3WF8A 4BIBA 5FXRA 5HNIX 2X4FA 3UQFA 2OF4A 5AP5A 5I5ZA 1AGWA 4RQKA 5EQEA 4JQEA 1ZAOA 1CKIA 4V05A 4AAAA 3HLLA 4IWDA 4O86A 3FQSA 3G5DA 3QTIA 4R8QA 3Q9ZA 4QMXA 1S9JA 2G2HA 4EHEA 3LJ0A 4FSQA 2Z8CA 3FY2A 3G2FA 4ANLA 5LMKC 3BHHA 3QRUA 2C6TA 5TOZA 4EQCA 3DXNA 1WFCA 2JKOA 4O6EA 5ETCA 3R7VA 1SVGA 4DLJA 3B2WA 4NW6A 3E88A 4ACHA 4E26A 4ANQA 3V04A 1PXOA 5I4NA 2FYSA 3FZTA 5JFXA 3DXPA 2XNNA 2I7QA 2UV2A 3ORKA 2ZYBA 4NEUA 3Q52A 5F95A 1U5RA 1W0XC 5HQ0A 5LARA 3MH0A 3OXZA 3ZEPA 4QP6A 1ZXEA 2PVLA 1U46A 1PYXA 2B9IA 4FZDB 2Y7JA 3JUHA 1YDTE 4NT4A 2EUFB 2RSVA 4E93A 4MXYA 5TO8A 4PDSA 5AR7A 1M2RA 2QOHA 4HJOA 5IA2A 4NH1A 3W10A 3HV3A 3SHEA 5L2SA 5IUIA 2OFUA 4BVUA 3R7OA 1JLUE 1GY3A 2F9GA 3D2IA 3DBFA 3NAYA 3PXFA 3NUYA 4GG7A 4W4VA 5AFVA 5JH6A 1J91A 3K5VA 3FEGA 4DCAA 3F5XA 4MYGA 3C51A 2JDTA 4A9YA 3NUXA 2W1IA 2BILB 5BVEA 4EH2A 4TWCA 4LGHA 4TKSA 2XCKA 4FTRA 1OL6A 2RL5A 4WNPA 4YTHA 3WARA 4FT7A 3SOAA 4IVAA 2ITUA 2CPKE 4ALUA 5BNJA 3AOXA 2XRUA 3MVJA 5D10A 4ERKA 4C35A 3B8QA 3CQEA 3TL8A 3GCVA 3WZKA 2OK1A 4NJ3A 5HNBA 1BMKA 3UIXA 3LMGA 3R8LA 3SG9A 4NTTA 4JG8A 4NKSA 2BPMA 4M66A 1M17A 2QU5A 4DA5A 3OWPA 5J95A 2HZ0A 2QKRA 5DYJA 2WTCA 3LQ8A 3MIYA 4QP9A 2PUNA 3PTGA 3LE6A 4KINA 1M14A 3PY0A 3ZMMA 3Q9XA 1BL7A 1Y91A 4Y5HA 4K11A 2JBOA 4Z9LA 1I09A 2IW8A 3I0OA 3ID6C 2J9MA 5HNGA 3UIBA 4IB1A 3MY0A 3NRMA 3PVBA 2FO0A 2J5EA 4L67A 4W4YA 4MHAA 3C0IA 2ETRA 2PE0A 4GJ2A 5CSXA 3K5UA 3BE9A 2WMWA 1ZMVA 4KIKB 5C4LA 4E3CA 5AR8A 2JBPA 4U41A 2WELA 1ZARA 3FWQA 3ORNA 2H34A 5HICA 3DDQA 1Q61A 4FOCA 2BRGA 2OXYA 4AT4A 4CG9A 2BZJA 4QMTA 5GZAA 4KA3A 3IECA 3F5UA 4TW9A 4IX4A 5CEKA 4GRBA 4HW7A 3VWAA 2QOBA 2QO7A 3IK3A 2B55A 3V5JA 4PQNA 2UW5A 3R8VA 4BDIA 4X6RA 3LLTA 2QI8A 5EI8A 4I0TA 3OEZA 4S30A 5LCKA 4BTFA 3UO6A 4GG5A 4RJ3A 4UYNA 4E1ZA 3MB6A 2Z7LA 3U8WA 4BKJA 2JKQA 2ITXA 4Y72A 4YBJA 3BHTA 4FV5A 3UO4A 2XNPA 4KWPA 2VD5A 4ZLZA 3VRYA 5J7BA 5J9LA 4A9SA 2VWVA 4E8AA 2X4ZA 3ACJA 4I23A 4IW0A 4ZY6A 4R77A 5E4HA 4R6VA 3FAAA 5CU2A 4DFYA 3E8DA 3KMWA 2PVHA 4GW8A 5CENA 3IKAA 2C5VA 3ZLWA 4AP7A 4BI0A 4FTUA 4XX9A 1Q41A 2CGUA 3I6WA 2BRBA 3LCKA 1STCE 4F9AA 5EG3A 3DV3A 4JX7A 2PL0A 5I3RA 3TV6A 3M1SA 3CJGA 4CMUA 2Y6MA 3NUUA 4FGBA 3FI4A 4I6QA 4C34A 2YM3A 2R3HA 2WMUA 4GT5A 3RTPA 4KB8A 3PXZA 1WVYA 4U40A 4ZIMA 2ZVAA 3NW5A 3VNTA 4O7SA 4HGLA 4FMQA 3I60A 3AD5A 4FIIA 4F9WA 3R30A 1OL2A 4BI1A 3LCDA 4Q9ZA 4DTAA 2XNBA 4FA2A 2PY3A 3DFCB 3FMLA 4F4PA 4ID7A 4OTRA 1JKSA 1H0WA 2B7AA 1XKKA 2VTNA 2VWWA 4QYFA 5CQUA 1SVHA 4O0UA 5AUXA 3Q32A 4PPAA 2XIYA 1IASA 2Y0AA 5FP5A 4DH3A 2UW0A 3V01A 3BLQA 2GFSA 3O17A 3BHVA 5CAVA 2F7ZE 2YM4A 5J1WA 2W4JA 4K9YA 4W9WA 4QQTA 3BI6A 4TYEA 2EVAA 4G9RA 5DWRA 3MDYA 3ZO3A 5IQCA 4H3QA 4BCNA 3AMYA 2Y9QA 4U3YA 3SXRA 1YQJA 4LI5A 3KL8A 4OTQA 3ZTXA 4Z3VA 3QKKA 1Q4LA 2WTKB 2WO6A 3HYHA 3E63A 4KRCA 2B53A 1R0PA 1WBNA 4JRVA 1I44A 4ZY5A 3ORTA 4JAIA 1DS5A 3KRWA 4QMMA 5E8SA 4R1VA 4RVLA 3W8QA 4TYIA 4C2VA 5M44A 3AT2A 4BDKA 2BKKA 3KKVA 2ITYA 5IPJA 3VC4A 3DKCA 4IQ6A 2YITA 4JJRA 1OKYA 1LEWA 4RWJA 1A06A 3CLYA 5B2KA 5IQGA 2WMTA 4QTAA 3EB0A 3EMGA 3WZJA 3P23A 3C13A 5FP6A 4XG8A 5IG1A 3PRFA 2WAJA 4QPSA 4UY9A 5HIBA 3WF5A 5M4CA 5A6OA 2ONLC 3D7TA 4RA5A 4NK9A 2PVKA 3W2OA 3KXNA 1FMOE 4U42A 3AC4A 2VV9A 3WI6A 3T3VA 1ZWSA 3M42A 4WSYA 4G17A 3FBVA 3PA4A 4RIXA 1XBBA 2VTRA 3ZU7A 1P4FA 1O6YA 3MWUA 3VBWA 3I6UA 3V6RA 3NAXA 1Q5KA 1BL6A 3R2BA 4C8BA 4DE4A 2R3IA 2VTAA 4ZSGA 3FLYA 1UV5A 4PMTA 4EK5A 2FUMA 2PVFA 4X2GA 2V7OA 1PXMA 3RKBA 4QP1A 5DH3A 4KAOA 2C6DA 3PZEA 1J7LA 4JX3A 3HMMA 3V5PA 3PRIA 4GV1A 5C26A 4U81A 4ANMA 4EOMA 3WZEA 4N4SA 5E7RA 5E8ZA 5FTQA 3G6GA 4EK8A 4JI9A 1NXKA 5M4FA 3A62A 1MRVA 4FSYA 3II5A 4EOKA 1OMWA 2YAKA 4DG2E 2W5HA 3H30A 3FQEA 3FPMA 3DK6A 5I3OA 1UU7A 3Q04A 4GYGA 4IFGA 4ERWA 3AG9A 2HZ4A 3DOGA 4FSMA 4OUCA 2B52A 3AD6A 2BFXA 2VX0A 2W1ZA 4EYJA 2GFCA 2Z60A 4XP0A 4WUNA 2CCIA 4F70A 3CPBA 2HZNA 3MIAA 3ZXZA 4IX5A 4ZTSA 3LCSA 3FPQA 3ACKA 3ALOA 2C1BA 3CEKA 3KF7A 3DK3A 3P0MA 4G1WA 4QYGA 4IMYA 4JG7A 3VS3A 1WVWA 4ANOA 1YXVA 4DAWA 4L45A 4Z55A 5IUGA 1XR1A 5JRSA 5AA8A 3F7ZA 3EFWA 4A9TA 4DT9A 2WMVA 4I24A 3VQHA 2W06A 2IZUA 1KOBA 4IEBA 4FVRA 2WEVA 1URWA 3QTWA 2HW6A 4FKTA 4B0GA 3EQFA 4FKLA 3A7IA 2NNWB 4AQCA 4GH2A 1DM2A 2X81A 4KIPA 2XK8A 5EKOA 3TG1A 2QR8A 3FMJA 4F6SA 5HG9A 4RMZA 5AR4A 3BE2A 2E9VA 4O91A 2OXDA 4TYHA 2XNMA 2HY81 2BCJA 2PZIA 3Q4TA 2YLFA 4U43A 5CI6A 3PPKA 3TACA 3FMDA 4FF8A 4FEQA 3O8UA 3FKOA 4XBRA 1YDSE 4FK3A 3W1FA 3JVSA 4X2NA 5JZNA 4B6LA 4S34A 4BZOA 3QX2A 3VS0A 2YLEA 3DBEA 3GB2A 4ZS0A 4JR3A 4M68A 2Y8OA 3D94A 3RMFA 4YPSA 3ZBXA 4AZWA 4MF1A 3R71A 3MI9A 2QVSE 3EZRA 3PIYA 4UB7A 4X2FA 3F88A 5FD2A 4Q5HA 3UP7A 2BHEA 3RBWA 3E7OA 4O83A 5DT0A 3OC1A 5EM8A 2JDSA 3B8RA 2GHLA 4L53A 4RRVA 2OH4A 3KEXA 3MPMA 2PUIA 2H96A 4RGJA 2QD9A 1OL5A 3IOPA 4RIXB 3AC8A 4XHKB 2R5TA 3NNVA 4NU1A 4ZLYA 1LPUA 2XJ1A 3SA0A 2WB8A 3B2TA 3LVPA 4IB3A 5IA4A 3R63A 2CNQA 3I5ZA 2BTRA 3TJDA 1CDKA 5GIPE 1QPDA 2AC5A 3HV7A 5JKGA 3EHAA 3ATSA 3AGLA 4UZDA 3G15A 5I9ZA 5IF1A 5AP2A 4ITHA 5C9CA 4AT5A 2XKCA 5A4LA 3ZYAA 3OOMA 2R3OA 4N57A 5DIAA 3DGKA 4XJ0A 4X3FB 5AAFA 5LCJA 4FE2A 4CKIA 3R7GA 3ULIA 3GC8A 4LOQA 4PP7A 5A4CA 2YERA 5DVRA 2UZTA 4UXLA 3KMMA 4C4EA 3LXNA 4UBAA 3RPSA 3L8SA 2R3JA 4J1RA 3A4OX 4PV0A 3TTIA 4UXQA 2XYNA 2QLUA 4FKOA 3VS7A 1XHAA 5IH5A 1SNXA 4JDJA 1H0VA 5AR2A 3KY2A 3MSSA 3OTUA 5HEZA 4HZRA 4EK4A 3PA3A 4X0MA 3FXWA 1WVXA 3OXIA 3LQ3A 2CKPA 2R7IA 2XKEA 4EEVA 4FV2A 5F94A 1Q8TA 3UG2A 4EOSA 4PMSA 2RFEA 3PWYA 4G34A 4TXCA 3P5KA 4YJOA 3ZCLA 3QALE 4PTGA 5AUUA 1ZRZA 3QRTA 5DNRA 2X9EA 1FQ1B 3FLZA 4JIKA 4KBCA 3E3PA 5KE0A 4D1SA 4WG4A 4XUFA 3Q2JA 1GAGA 2JITA 3BYVA 4GK3A 4AN3A 5FWKK 4YPDA 3PG1A 4YU2A 5HE3A 4CFXA 2OICA 4NCTA 1J7IA 3RINA 2VTLA 3POOA 3HZTA 4IX3A 1OKZA 5CSWA 5D1JA 1QCFA 4YP8A 5D7AA 3VUMA 4ZZOA 3SGCA 3H9RA 5IQAA 2YABA 3PVWA 2J51A 4CD0A 4O0WA 3UOJA 2YM8A 3TXOA 4XNEA 4A9UA 5CF6A 1VEBA 1P2AA 4BF2A 4F7SA 2FSMX 5CVFA 3G6HA 3KVXA 4K77A 1M2QA 4GU6A 4IC8A 3F66A 4IADA 3DQWA 2A19B 4FK6A 1ZY4A 4OW8A 2X8IA 2HENA 2YM7A 4O7YA 3FYKX 1JPAA 5GZ8A 3TT0A 3EYHA 4AT3A 1LEZA 4KBAA 4C57A 1YHWA 4EOJA 3ULZA 2O65A 4FKJA 1ZOEA 1JSVA 2BTSA 3QA8A 5EYCA 3HRBA 4A07A 4U7ZA 4ZMFA 2PVJA 4XG4A 5AV2A 5KMIA 1JKLA 4ITJA 3IQ7A 2HIWA 1UU3A 3QQFA 4FV3A 4AW2A 4U9AA 4P7EA 3SLSA 3BU3A 2UZEA 4HGEA 2O64A 2XK6A 4XLIA 3R02A 5TKDA 3Q4CA 4IM0A 4F6UA 3EQPA 2WTVA 1VYWA 3LIJA 3QAME 2PMOX 2XMYA 3D7ZA 1FVRA 3EQRA 3QTRA 4BDBA 4LRKA 4QNAA 2I40A 4CFNA 4XH6A 4P5QA 4XG2A 1B39A 2X9FA 1ZOHA 3RP9A 3VUDA 3AC3A 1W82A 3G0EA 1CM8A 2J7TA 3KU2A 1OM1A 2J0LA 3QYWA 5KBRA 5EI6A 5BVDA 3U6IA 2BMCA 1AQ1A 5GJDA 4I1ZA 3FZ1A 3WYYA 4OLIA 1HCKA 1CKPA 2BROA 3IW7A 3Q6WA 4QTDA 5CU6A 2CCHA 2OFVA 4C0TA 4GK2A 4BCIA 2W5AA 2REIA 4J8MA 3ANRA 4ASZA 4EQMA 1G3NA 4BC6A 5J5TA 3HP2A 3ZSHA 5KHWA 3JS2A 2GNLA 5AUVA 1V0BA 2ITQA 4QMWA 4LL0A 5K0KA 2IVSA 4DGGA 5IQHA 3R8MA 2XK9A 4FTOA 4TYGA 5EK7A 3C5UA 3G0FA 1GZKA 3ZFXA 4QP7A 4F1MA 4AGWA 2GHMA 1P14A 1RW8A 2JDRA 4MEDA 4AOJA 3VAPA 2GTNA 4I94A 3R7IA 3WIGA 4AGCA 4J52A 3UOLA 4AOTA 3U4WA 3PVUA 3E3BX 1Z5MA 4P4CA 4EC8A 3HV4A 3QHWA 3WILA 2VO7A 1UU8A 2UZWE 3FLQA 5EM5A 2ZM3A 4ZJIA 2BZKB 5LWMA 3TV4A 3BYOA 3W32A 2JLDA 4BTMA 3GT8A 3KCFA 2PZYA 5HLWA 3RM6A 3PJ8A 5A4EA 3ZC6A 3E8NA 2XP2A 4PUZA 1CKJA 2XH5A 5FDXA 5H2UA 3NIEA 3LHJA 4FG9A 4MXOA 3VUTA 4EJNA 1OECA 3DFAA 3O2MA 4GL9A 4ASEA 3RVGA 4EWHA 5C8MA 3DNEA 4FTKA 2VTOA 4W8DA 4FG8A 3L8PA 2GNJA 3W33A 1YOMA 3EN4A 2YDIA 5L6OA 2PMLX 1YI4A 2CGVA 2QC6A 4RC3A 5EHLA 4BR3A 4EOIA 5DR9A 5DRDA 3IDCA 5AUZA 3VW8A 2DS1A 4EH5A 5HORA 3BELA 4FT9A 3FXZA 4O7WA 2VGOA 2WOUA 3A60A 4OBOA 2XB7A 4FSUA 4UZHA 1PJKA 1ZYCA 2F57A 5AR5A 5CAPA 5HE1A 4CKJA 4WBBB 3S95A 4YSMA 4JXFA 4DEDA 1PMEA 2GQRA 3NNXA 2OIQA 2PMNX 5CU4A 5I9WA 5JGBA 2Q0BA 4BCPA 1H8FA 5EW9A 4BKZA 4EWQA 4FNZA 4L00A 4RIYA 4QMQA 3FHRA 4WNOA 5IKWA 5LQFA 2PVMA 2ACXA 3MBLA 4UMQA 1MRUA 4IAKA 1IAJA 4J95A 4NUSA 4LUDA 4F08A 3QTXA 2XIRA 3OUNB 3QRKA 4HCVA 5FRIA 1OL7A 3BBTB 4FSTA 4FTAA 5KZIA 5T68A 1PYEA 3C0HA 3FZRA 5BUJA 3ZUUA 5E8WA 4KIOA 5CYIA 4YJNA 4ZSEA 5HU9A 4FKWA 4GS6A 4ZSJA 5AADA 2HCKA 2VGPA 3QRIA 2VWXA 4QP4A 1JQHA 5E9EA 2YIXA 4AZFA 5EHOA 3FV8A 4GUEA 4QQCA 5TE0A 1MUOA 4GFGA 3GNIB 3LQ5A 4QTBA 4CFWA 4B7TA 1O9UA 1J3HA 1TQMA 2YWPA 3AGMA 3EZVA 1W98A 4F9CA 1QPEA 4I93A 4OT6A 3UGCA 4F65A 4QMSA 2C1AA 3PSDA 4YLKA 4N6ZA 5HZNA 1H1QA 5J9ZA 3NYOA 1XO2B 2KTYA 5A4QA 5IQIA 2OSCA 2JIUA 2QG7A 3EL7A 4M67A 4FT3A 2KULA 2ZAZA 2R3PA 4L8MA 4ZZNA 2WTWA 4BDJA 5IQFA 4HGTA 4AOIA 4KIKA 4E5WA 3DB6A 2XEYA 2UZOA 4J71A 3TNWA 2XKDA 4QTCA 4R3CA 4EKLA 5KUPA 3LFQA 3PXRA 4FKQA 3OEFX 1SZMA 3ZO1A 5A54A 3DU8A 4ORKA 2Z7SA 4FT5A 3OBGA 3KXHA 4FI1A 3U6HA 2QODA 2BRHA 3EQDA 4DFUA 2YJRA 4KKHA 2VTSA 1YI6A 4LM5A 4O7ZA 1OKWA 3NCZA 2PSQA 3K2LA 2CNUA 4RZVA 2FH9A 5I9VA 4JNWA 5L3AA 1FOTA 5DOSA 2VO3A 2FB8A 1TQPA 4IZYA 5M4IA 2OBJA 4AE6A 3OHTA 3FY0A 5A6NA 5KMNA 2WGJA 2QKWB 4KS7A 4HPTE 5CZHA 3R9NA 5LJJA 4B4LA 2W1EA 2FA2A 3I7BA 3EYGA 3NW7A 3UYTA 4EH6A 3ZOSA 2CNVA 4MBIA 1H01A 3Q4ZA 4I5HA 3KREA 3HECA 4FVQA 3F5PA 2G9XA 4AZVA 3UYSA 1H26A 1OBDA 2BAKA 2FSTX 3CGOA 3UJGA 5EOBA 1YXUA 3VBVA 1W84A 3PSCA 1NA7A 4BYIA 2DWBA 4IJPA 3F3UA 4Z7HA 5BUIA 3TUBA 3NVMB 5DE2A 3DXQA 2GNFA 3MPAA 3IW4A 5C27A 5DR2A 3RALA 3ZRMA 5KKRB 4OAVB 1ATPE 5IQEA 3U87A 4BBFA 1YHSA 3R8UA 4N70A 4QRCA 3FQHA 3MS9A 4TNBA 4HNIA 3ORXA 4X2KA 4ZK5A 3PE1A 5G6VA 2PVRA 3E64A 4YLLA 3NDMA 2J0MB 2XJ0A 5EOLA 5CVHA 2HOGA 2GQSA 3OXTA 1VYZA 3UVPA 4YO4A 5IUHA 5FEEA 2XYUA 4XV3A 3WF6A 3NMUF 4TY1A 3NUNA 4FTTA 4XG9A 4RG0A 3H0ZA 1ZYSA 3SXSA 2W1HA 4RIYB 4YHTA 5HCZA 1OIUA 3BIZA 4QPAA 4I21A 5I9XA 5JQ8A 3NGAA 4D2VA 2WZJA 4QD6A 4G5PA 2GPHA 4EOOA 2XNOA 4MWIA 2LAVA 2YAAA 4FZAB 4JBVA 4EOPA 3QHRA 4I5CA 4ENYA 1KV2A 5AP7A 2I0HA 2J0JA 1YXSA 2P33A 3RCDA 4AN2A 5M51A 3FJQE 4V01A 5KNJA 2BAQA 4RVMA 4HNFA 3IO7A 5FM2A 2WXVA 4HZSA 3VO3A 1PKGA 4II5A 5L8LA 4MXAA 5AP1A 3GU5A 3KRJA 4XV9A 5F20A 1YHVA 3TWJA 4AX8A 2JKMA 3H3CA 1GNGA 3MH1A 2X39A 1BUHA 4BTJA 1X8BA 3F2RA 2B1PA 3QD3A 5CEPA 2OLCA 4R3RA 4FBXA 4DFLA 4BI2A 4PMPA 2JAVA 3TZ7A 4GU9A 4K18A 3K54A 1H07A 3V6SA 2B4SB 3OW4A 4YURA 2RF9A 4H1MA 4TTHB 4F0GA 4PPBA 1YRPA 5CF4A 3GQIA 4MXXA 4FNYA 4DFBA 4DBNA 2QOKA 2O3PA 5HGIA 3TCPA 2IN6A 3BZ3A 2VWIA 3W18A 2CKEA 2QU6A 2E9OA 2IJMA 3E93A 3PIZA 3C4FA 4N0SA 4F9YA 3RAHA 4XRLA 4FIJA 2AUHA 3MYGA 3BGZA 5DEWA 1UWHA 3TDWA 4PP9A 3SOCA 3QLFA 3ZDIA 4AW0A 3PJ1A 4J96A 1H1SA 4QYHA 1NVQA 4NM7A 5BVWA 1T45A 4J98A 4A7CA 4D55A 5JSMA 4R78A 1XBCA 2A0CX 3OWKA 4I0SA 4EH3A 2W1CA 3FE3A 2W1GA 4ASXA 4EUUA 4QMVA 3C4ZA 1KE8A 3AMAA 4JS8A 4XV2A 2FSOX 4FKIA 4CV9A 3H9FA 4NCTC 4D2RA 3OT3A 1DAWA 3A8XA 4CRLA 3A7JA 2W05A 5E8XA 5LVNA 3RHKA 2BALA 2B9JA 2O5KA 4MH7A 4AZEA 3BQCA 3UZRA 4WHZA 3MTLA 4AGUA 1OUYA 2WU6A 3U6JA 2Z02A 3QZIA 5HOAA 4H3BA 3COIA 5B7VA 4CKRA 4P90A 4C2WA 1JOWB 2F7EE 3F6XA 4AA4A 5LVLA 3A99A 3DK7A 1NVRA 2F2CB 2G01A 2GS2A 4CYIA 1H00A 1XBAA 1G8SA 2C0IA 4XMOA 5DA3A 3OZ6A 4JQ8A 3TKIA 4EKKA 5IU2A 2OI4X 2YACA 4E4XA 3VHKA 3JXWA 2CKQA 1U4DA 4AGDA 2BVAA 4IVBA 3F7WA 3D5XA 2P2IA 1SYKA 4LV5A 4PPCA 5BQ0A 2J6MA 5LXMA 1WBSA 2RFDA 1BYGA 3FSKA 3ORLA 3RHXA 4GJ3A 3HA8A 4BGGA 3R7YA 1REJA 4W4XA 4TT7A 5M09A 3KFAA 2ITNA 1OIYA 3T8OA 3DJ7A 1GZNA 5CASA 1LR4A 3QQHA 3AC2A 3FZOA 1LP4A 4PY1A 5FBNC 4YZDA 4R7BA 3HV5A 3JY9A 4EH4A 3RM7A 3W2RA 3ZEWA 3QCQA 4B8MA 2BIKB 4PF4A 5HBJA 3SRVB 2WQBA 2QOOA 4PTEA 2OH0E 4UWYA 2HYYA 3ODZX 4XV1A 4QP8A 1GOLA 5A46A 4IVDA 4LRMA 4OBQA 3TM0A 4Q5EA 4BL1A 3HAMA 4YBKA 3PLAE 3DKFA 2XIZA 4EUTA 3ALNA 4G3GA 2V22A 4AXAA 4BDEA 2RG5A 3MFTA 3S3IA 5ICPA 5KMMA 4UMRA 3DLSA 4GMYA 3AQVA 1U54B 2VTJA 4D0WA 2YCQA 3ZZWA 3NNUA 3PG3A 4K33A 4IE9A 3WBLA 4ZJVA 1WBOA 3MA3A 4G6LA 4FTMA 4KKGA 4C59A 4C58A 3DZOA 2C0OA 3PZHA 4G6OA 4LOPA 4M69A 3COKA 3QA0A 2WMBA 3BQRA 3L9PA 5CS6A 3V5LA 3VUKA 4A4LA 5AM6A 5HVKA 4D4VA 1Y8YA 5DR6A 4ZJJA 4FUXA 3AT3A 5E92A 4DTKA 1H27A 2W96B 4ZZMA 5L2IA 1WZYA 5CANA 5JT2A 5IMEA 3OWJA 3QTQA 4BWPA 3PXYA 2CHLA 5AIKA 2VX3A 3O50A 2OJIA 3DA6A 3F9NA 4FT0A 4W4WA 4XLVA 4AE9A 5EDRA 3VBYA 5BMMA 3BWFA 1J1CA 4S32A 4WBOA 2OXXA 3FMMA 3ZS5A 5E8UA 4R5YA 3F3VA 5CT0A 3SQQA 5JFVA 5H9BA 5C1QB 3CCNA 1K9AA 5LVOA 1YI3A 2WMQA 3DKGA 3F69A 5J8IA 3FDNA 5CEOA 1O6KA 5F1ZA 3VS6A 5LVMA 5BPYA 2EB3A 2W4KA 4U8ZA 4BFMA 3CBLA 4TWNA 3P78A 2HY0A 3BKBA 4QMUA 3PPJA 5AUWA 4M13A 3DY7A 4LOOA 3R6XA 3TNHA 3ZSIA 4JIAA 4DH7A 4OTPA 3CY2A 2FVDA 3L1SA 4X3FA 1PMVA 1VZOA 4FV1A 4XP3A 2BHHA 5L6WL 3Q5IA 3HP5A 4I92A 2GNGA 3JPVA 4ENXA 4DEAA 3VS5A 4APPA 4L7FA 4I4EA 2YN8A 4JBOA 4D2WA 2VNYA 4E6QA 2UW3A 3OY1A 4GYIA 3UQCA 1Q8UA 4W9XA 4F6WA 1CMKE 2X7OA 2C5NA 2ZMCA 5E1SA 3EQBA 3ZFMA 5EM7A 2ZV8A 3M11A 2HXLA 4NW5A 4DFXE 2CSNA 4O7TA 3MY5A 2R3LA 3GCUA 3UPZA 4IZ7A 5HIEA 4PTCA 2VWBA 4G2FA 4XP2A 3UDBA 5DMZA 4DT8A 2QNJA 3FC1X 4G5JA 4BBMA 4K6ZA 2WU7A 1TKIA 3A7GA 4QOXA 4EH7A 1YKRA 4YJQA 4TYJA 3TIYA 4FSZA 3V5QA 3GBZA 4GFOA 2UZNA 4IB0A 3DJ5A 3CR0A 2ZM4A 3MW1A 5FXQA 1PXNA 2UZUE 3F82A 1XH7A 4FGRA 2YDJA 2ZB0A 5DI1A 2PUUA 5IH6A 4HCUA 4EORA 4A06A 1NY3A 1QL6A 5H8BA 3E87A 1IEPA 3OW3A 4QO9A 5JFWA 1YDRE 3EL8A 4EHGA 2ITOA 4P5ZA 4BIDA 4JG6A 2C3JA 4KKEA 1WBPA 3LFCA 2RFNA 4OAUC 3EFJA 4J99A 4B8LA 5HLNA 1KE9A 5CEMA 4NIFA 1T46A 2OJ9A 4RC2A 5BVFA 5JQ5A 3PFQA 4CLJA 5ETAA 5J79A 5HIDA 3TNIA 4EH9A 5CAOA 2I6LA 3FXXA 3FMKA 1FGKA 3V8WA 3DBDA 1JSUA 3ATTA 3CY3A 2UVZA 3P4KA 4CFUA 4IIRA 5CLPA 3QQKA 3QQGA 4CT2A 4FTLA 4QQ5A 4M69B 4GT3A 4G3EA 5ANKA 3BV2A 5E8YA 5CVGA 3SX9A 4CMOA 4E5BA 4YUQA 2FSLX 1OVEA 2QOLA 3VS4A 3TDVA 2C68A 4YJSA 2X2LA 4YGAA 2GQGA 3MVHA 3QUPA 3RPRA 3MA6A 2VTTA 3L8VA 4XOYA 2X0GA 4I0RA 2P4IA 3W2CA 5LMKA 1OI9A 3O8TA 4OGRA 4WUAA 3OOGA 5KHXA 4YHFA 2R2PA 1SM2A 5IQDA 5HTBA 4M8TA 1KOAA 4FTNA 3UZPA 3ZZEA 3V5WA 3BGQA 4O7NA 2WTIA 2PZRA 2UZLA 4FZFB 4E4NA 1ZOGA 4WNKA 4XG7A 4FKGA 3BGPA 4E6DA 2GCDA 3DS6A 5AV4A 2IO6A 2J2IB 2VO6A 3HMOA 3NSZA 4FSNA 3MJ2A 4MNEA 3VVHA 3CQWA 3LFBA 4Y5QA 4E4LA 3QCXA 5C8KA 1QMZA 3F3TA 4D1ZA 1PXLA 3GFWA 2W9FB 5KX8A 4YTCA 2YWVA 4EBWA 3AMBA 3LCTA 2V62A 3V5TA 4DYMA 2H6DA 2WQNA 2GHGA 4Y85A 5ETIA 4FV8A 3KGAA 4XG3A 1Q3DA 2XK7A 2F49A 3QQJA 3THBA 4AW5A 5BMSA 2XIXA 3VIDA 3R04A 5H8EA 3OCGA 3R7UA 4U3ZA 2ITPA 4HYIA 3NYVA 1Q99A 4ZEGA 3ZLXA 2BDFA 3Q6UA 5EI2A 2VTQA 3R2YA 4RC4A 4CG8A 3IGOA 3HKOA 4RVTA 3KB7A 3F2AA 3A7FA 3FL5A 1R0EA 2VWZA 2XK3A 3Q5ZA 3GU4A 5I9UA 2X2KA 3EFLA 2G1TA 4GEOA 2OG8A 4HYHA 5EYKA 5GJFA 3ZBFA 2Y4IB 4GT4A 4NYEA 1MRYA 1OZ1A 5HG8A 2XM8A 4B99A 3NYXA 1SNUA 1V0OA 2ETKA 5IISA 3ZLYA 3GU7A 3UPXA 2R3NA 3V51A 2ITTA 1P4OA 3QQUA 1PXIA 1WAKA 2W17A 3IW6A 1URCA 4CNHA 3RPVA 4IX6A 4JDHA 3VBXA 1UKIA 5M56A 4TN6A 5DBXA 3IW5A 3L8XA 5GIOE 2RIOA 4FZ6A 4CSVA 2BDJA 4MBLA 2UZBA 4MQ2A 2WTKC 4KIQA 2CMWA 1OIRA 3HA6A 4FNXA 4ACMA 3D5WA 2WEIA 4KRDA 3FC2A 4JDKA 1MP8A 3BX5A 1G8AA 3P86A 4N6YA 3RPYA 2FGIA 5HO6A 3E5AA 2JGZA 3PJCA 4JBPA 5AEPA 3S0OA 3QKLA 2OF2A 3GI3A 5HD7A 4UALA 2X6DA 5CSHA 3ODYX 3PE2A 1KWPA 2ESMA 4I41A 2J90A 2YZAA 3QBNA 1H4LA 3OP5A 3RWPA 3VN9A 5AP6A 4F99A 4RFYA 3KK8A
chains in the Genus database with same CATH superfamily
3KRRA 3CPCA 5CSPA 4X21A 3O8PA 2XBAA 3U9CA 4NIFB 4CYJA 2G2IA 5DRBA 3GU8A 3NWWA 3O23A 4S31A 4FEVA 5FEQA 3IDBA 2JIVA 1RQQA 2R3MA 3R9HA 3RI1A 3UDTA 4FIGA 2W7XA 4FG7A 4D28A 3C7QA 2Y4PA 3DCVA 2CGXA 3U55A 4O84A 2ZV7A 3PYYA 5BYZA 4K0YA 4C62A 3OF0A 2CN8A 3I7CA 3UTOA 5JMSA 4RA4A 3LLAA 3F3WA 2GNHA 2HAKA 4HVSA 2WQOA 3HMNA 3FLNC 2O0UA 4RX7A 4YTFA 4FSWA 3G51A 2ZB1A 3G9LX 4X7QA 1Y8GA 2ERKA 3BEGA 4KABA 5LVPA 4CFMA 2J5FA 4I5PA 4DITA 4U44A 2IZRA 4O7RA 2DUVA 1GIIA 2UW6A 4FIHA 2WPAA 4HVIA 4FX3A 2ITVA 4U80A 5FLFA 4BN1A 3ORIA 4NFNA 2VAGA 3BHYA 2X7GA 4O82A 4Y83A 2ETMA 1ZZ2A 2XRWA 3UG1A 2OZAB 1BX6A 3VF9A 3BU6A 3SKCA 4O4EA 4I4FA 3CC6A 5CI7A 3BLAA 3KK9A 4MNEB 3OCBA 4D1XA 3ROCA 2PYWA 1H1PA 1U59A 1XH6A 1WMKA 4G9CA 3NIZA 4NSTA 1WBVA 4IANA 3TN8A 4USDA 3W8LA 1KE7A 2G2FA 3EQHA 4YZCA 3L9MA 4RPVA 4FKUA 3A61A 3QU0A 4MKCA 4G6NA 4MX9A 4V04A 4YO6A 2VX1A 5E8TA 2QLQA 4BCGA 4ZTMA 1Q24A 1ND4A 3R1SA 5EHYA 2OIBA 2IVTA 2UVYA 3KQ7A 3ELJA 2J50A 2QHNA 4JBQA 2F2UA 4DEEA 2QOCA 3D4QA 3UBDA 3H9OA 5A4TA 4CCUA 4GIIA 3N51A 2XVDA 3UVRA 4CCBA 5EW8A 1WBTA 4HGSA 1HOWA 3DZQA 1ZLTA 4QYEA 4Y8DA 5HG7A 2C69A 3IDPA 1Q3WA 2X8DA 3LM0A 4L3JA 4ASDA 4KSPA 4ALWA 3MY1A 2OGVA 3FHIA 1Q8YA 4C02A 4G3CA 2BRMA 2C6IA 1M7QA 2JFMA 1B38A 1TVOA 3OMVA 4L44A 3VJOA 2E9PA 3ORZA 4NFMA 5E1EA 4I22A 4I20A 3GCSA 1IAHA 3DPKA 5BX0A 1ZY5A 3ZM4A 3FLWA 3E7VA 1PW2A 4O1PA 4ZSLA 4L9IA 3RPOA 3GUBA 3HMIA 3AC1A 3P08A 2WKMA 4EK3A 3JYAA 3CP9A 1YOJA 1IA9A 4LV7A 2VZ6A 4GSBA 3NEWA 5J9YA 4FVPA 2W5BA 3BEAA 5C01A 3K3IA 2IW9A 3ZH8A 3ENHA 3DBCA 4RIOA 2EU9A 3KC3A 2CKOA 2ONLA 3UE4A 1A48A 4J8NA 5IEVA 4L52A 3WF9A 3DT1A 4RQVA 4BDHA 1VLRA 1GIHA 1BKXA 2AC3A 1B6CB 4PNIA 4ANNA 3I1AA 2BRNA 3D5UA 1W83A 4DH5A 3R73A 3PJ3A 1ZZLA 3HL7A 2W99B 4ZTLA 4EYMA 3WE4A 3LOKA 1TFFA 5B0XA 4FRFA 5K4IA 4YNEA 3RGFA 1UNHA 5KZ0A 2XEZA 4RFMA 5AR3A 3V8SA 2YEXA 5A9UA 1FINA 3GP0A 4O2PA 1J1BA 4D58A 4D9UA 3R9OA 3F61A 3D5VA 1JAMA 2LGCA 2CLQA 2WIPA 3MH3A 2R7BA 2GS6A 4I5MA 4K2RA 4WA9A 4WO5A 2RFSA 1PMUA 3LM5A 4F7LA 3CKWA 1U5QA 2C0TA 4IZAA 4USFA 4CFVA 5CZIA 4CLIA 2JC6A 4OTGA 2YFXA 4L7SA 2E9NA 4S2ZA 5EQPA 4C7TA 1BI8A 4G3FA 4FKPA 4YJTA 5IMXA 4GKHA 3OD6X 5J87A 1W8CA 3QZFA 4MD7E 3BV3A 4CT1A 2PPQA 5B2MA 4ZMEA 4L43A 3PP1A 4FTJA 1YVJA 4AZSA 2JAMA 2BFYA 3LXKA 4MCVA 4ANSA 4AFEA 1OB3A 3FUPA 4X3FC 3UC3A 5FDPA 4IACA 5KBQA 3UIUA 4DHJA 5AV3A 4BB4A 4QMPA 2OZOA 4YZMA 1O6LA 1ST0A 4AUAA 1PHKA 2CDZA 4KS8A 3BYUA 5TT7A 4HVHA 4CQGA 4R5SA 4E6CA 2Y4IC 2Z2WA 4CTCA 3DLZA 4FICA 2YCFA 5E91A 4DFNA 4BCQA 5AM7A 4BCMA 2X1NA 1E1VA 2PZPA 2DQ7X 3OCSA 3ZXTA 4QT1A 1UU9A 5CF8A 4AZTA 2ZJWA 4TWPA 3MFUA 4NTSA 5JGDA 4OT5A 3K3JA 4E6AA 5IH4A 5FGKA 4M0ZA 3Q9WA 5EYDA 3KXGA 4IXPA 4JVGA 4IWPA 4TWOA 4HYSA 1DI8A 4Z16A 2ERZE 4ZOGA 5LMBA 1QPCA 3C4XA 4Y73A 4A4OA 4DC2A 5DT4A 2VTMA 1V0PA 3CTJA 3P7AA 4FKSA 4D5HA 5ANGA 3HGKA 2X0PA 4MBJA 3LFDA 3WE8A 3GC0A 4U5JA 4M12A 3PVGA 5HESA 3C4WA 5HO8A 5JZJA 2JDVA 4J7BA 3HUBA 2OJFE 3LAUA 3BLHA 1KE5A 3R22A 3RK9A 1L8TA 3FI8A 3HAVA 2VO0A 3E92A 3Q4UA 4C4JA 4QNYA 3SD0A 3DTCA 2QURA 4IH8A 4OTHA 3SC1A 3MV5A 2ZFYA 3POZA 4KSQA 5DN3A 4FR4A 1R1WA 3CD8A 2WOTA 2VTIA 3DTWA 2HWPA 4RX5A 5L2QA 3OBJA 2P2HA 5C4KA 4D4RA 3HX4A 3GXLA 4IAAA 4PL4A 1BLXA 4WSQA 3PY1A 4O6LA 3GFEA 4ZAUA 5LMAA 3ZONA 3PIXA 4NZWB 4HCTA 4CV8A 3COMA 2YA9A 2C3LA 1DAYA 4RJ7A 5CY3A 4C61A 5JGAA 5LWNA 1HCLA 2XS0A 3KN6A 4O2ZA 2V5QA 3REPA 5CEQA 3ZO2A 2XIKA 3GENA 2XZSA 1WBWA 5IA5A 2UW4A 3DQXA 4XYFA 1G8KA 3MB7A 1OPLA 5BYLA 2GTMA 2QOIA 3LCOA 3MJ1A 5D12A 4IM2A 3TZ9A 3V3VA 5HCXA 4AF3A 4ZLOA 3BPRA 3VHEA 4GVJA 3UZTA 2PUPA 4H1JA 4CZYB 3UNJA 3EN9A 2RGPA 4OTWA 2QOQA 3HVCA 5EH0A 4BCJA 4E7WA 4EK6A 5H8GA 4EL9A 2YZLA 5L4QA 4ALVA 2X0OA 2C5YA 3R1YA 3ORPA 3R1QA 3FLSA 4FTCA 3GU6A 4CEGA 1PXJA 4LGDA 2V0DA 3SRVA 4U79A 3TZ8A 1MQ4A 5BVKA 3NX8A 3N4TA 3A7HA 1H08A 3F3ZA 4AACA 4GK4A 4K8AA 3U4UA 4ONAA 3GEQA 5FEDA 1JSTA 3KMUA 4HYUA 5EKNA 5JFSA 5JK3A 3GCPA 1Y6AA 1XJDA 4NM0A 4R1YA 4O21A 4KD1A 4X2JA 3TNQB 2UW7A 4L46A 2ITZA 3LFEA 1U54A 2YDKA 3GC7A 3EOCA 3MFSA 4D2PA 2GU8A 4BWKA 4O4DA 1UNGA 3BCEA 2GSFA 1GJOA 4XCUA 2J0IA 1YXXA 4QYYA 3KF4A 3CSVA 5FTGA 3BBWA 4H05A 2O8YA 5K5NA 4FIFA 5IQBA 2O63A 4KNBA 4IAZA 3RAIA 3UC4A 4PNKA 4YJRA 4ZSAA 4RJ5A 4MXZA 1LUFA 3ZDUA 4RIWA 3T3UA 4BDGA 3NW6A 4L42A 2OWBA 3HDNA 3WYXA 4DHFA 2I0EA 1XH5A 4GVAA 5L8KA 5HE2A 3QXPA 3HMPA 1IG1A 3OS3A 2QO9A 2XNGA 3MN3A 3UOHA 2NRUA 2RG6A 4HOKA 4EOLA 2XARA 3I79A 4XBUA 4H39A 3RZFA 3CGFA 1H24A 2GS7A 5M4UA 1FVTA 3LJ1A 3E62A 2R3GA 5HBEA 1H1RA 3KULB 3RAKA 4JLCA 4D4YA 4QPMA 2EWAA 3GOPA 1OBGA 3OROA 5ACKA 4BJJA 4IC7A 3S00A 4BTKA 3FI2A 1PRYA 5KCVA 1A9UA 4FKRA 3FI3A 2IW6A 4FL2A 4USEA 1ZMUA 3PDTA 5HX6A 3ZO4A 3NUAA 2EXCX 2V55A 3LFFA 5M08A 2QG5A 3NFGB 4IZ5A 4QMZA 3NVKI 1RDQE 4F7NA 4HVGA 3VUIA 3ZFYA 1Q97A 2VWYA 4LQMA 4ACGA 2C6KA 4AA0A 5B2LA 4FNWA 2CGWA 4YHJA 4ZTRA 1OKVA 4DGOA 4IDTA 5HBHA 2HELA 4DFZE 3QWJA 3LMHA 4PDPA 3KA0A 3LZBA 3P7BA 2BIYA 5CEIA 2VWUA 1YWVA 3TEIA 4O0RA 4CTBA 2QHMA 4FV0A 4IAIA 4EQUA 1Z57A 5HX8A 2R4BA 2ZDUA 3PY3A 3FMEA 2VTPA 2A1AB 3R21A 3PWDA 3R83A 3SW4A 4U45A 3JR1A 3VF8A 1R3CA 5FG8A 3FZPA 4NWMA 4CZTA 4O38A 4KBKA 2EB2A 4AXDA 4ZTNA 4C36A 4QEBA 2OU7A 3GC9A 1RE8A 4C4GA 4ZXTA 2AYPA 3CKXA 5L2TA 5JEBA 2B54A 3Q60A 5EDPA 3D2KA 2WQMA 4G16A 3TJCA 2WQEA 1L3RE 3A4PA 4RLLA 5HO7A 4Y46A 4WKQA 4EZ7A 2VNWA 3LPBA 3ET7A 3FZSA 4X3JA 2A4LA 4I6FA 3S2PA 5L2WA 3OCTA 1YWRA 3QCYA 4RJ4A 4MVFA 5K0XA 4UWBA 4UX9A 3I5NA 3H10A 3H0YA 3G33A 5IEXA 3CIKA 5J5SA 5D41A 4MTAA 1YXTA 5CT7A 5J7HA 1FMKA 2QR7A 2WMAA 4MWHA 3W16A 4BDDA 4BCFA 1G5SA 4D9TA 2HZIA 4QP2A 1UKHA 4FTQA 3OWLA 1V1KA 5AP4A 1SMHA 1JVPP 4W8EA 4K1BA 3WZUA 2XK4A 3L9NA 3HEGA 4EONA 1R39A 1R78A 5CXHA 5GZ9A 5I0BA 4R7HA 4D5KA 4F63A 2UUEA 4C3PA 1PF8A 2YIQA 2VUWA 2OJGA 4G31A 4XRJA 4QP3A 3FSFA 4H58A 5K9IA 3EN6A 3SDJA 3R7EA 3QXOA 4O22A 2PU8A 3LMIA 4C33A 5KMJA 4NM5A 1E9HA 3O51A 2J4ZA 3ORMA 4UMPA 3KVWA 4FV4A 3H4JA 3PJ2A 4RIWB 4M0YA 5T3QA 3M2WA 4LMUA 5AAGA 1KUTA 3HUCA 3JY0A 2ITWA 5BVOA 2WMRA 4GFMA 2F4JA 3IW8A 4M15A 3TZMA 5DFPA 5K3YA 3OVVA 1OGUA 4RVKA 4YJUA 4FTIA 5CTPA 3R0TA 3NZ0A 4M84A 3ZRKA 4FODA 4BZDA 4DG0E 1XMMA 3ZM9A 3CTHA 3R8PA 2P55A 4FYNA 3C9WA 3UNZA 4BWXA 4C38A 4D0XA 1RJBA 4YSJA 5KKRC 4BJJB 4ZTQA 4C4HA 3ERKA 4QMLA 4YC6A 3E8CA 4UEUA 4O0TA 5DHJA 3TNPC 2PWLA 5EM6A 4FEUA 5JN2A 2I0YA 1XH8A 3O71A 1YWNA 4DH8A 2YISA 4DINA 3IOKA 3G90X 5KMLA 1OIQA 2X6EA 3BU5A 2YM5A 4F1TA 4L3LA 4IB5A 3NUPA 2PVNA 1PY5A 1OPJA 4A9RA 2YIWA 3MGYA 5ANJA 3HRCA 1FVVA 3QD2B 3FMNA 3RK7A 4CVAA 4PL3A 3NPCA 4O4FA 4EZ3A 4YC8A 4DGMA 2C4GA 2UW8A 5K5XA 3NS9A 4O1OA 5BUEA 1ZYJA 2F7XE 4FOBA 3EN5A 2IF8A 3QZHA 4P2KA 3VQUA 1VR2A 5AAEA 2W1FA 3P5JC 1E1XA 3DAJA 4JAJA 4LMNA 4OTFA 4RZWA 4YC3A 4EOQA 4PDYA 4BYJA 4PRJA 2YCRA 4IJ9A 4M3QA 2Z7RA 3TUDA 4MAOA 2OW3A 4OBPA 1GZ8A 4BGQA 4F09A 3NUSA 2BAJA 3QLGA 2IZTA 4JR7A 2XUUA 4GCJA 3L9LA 3QF9A 3EWHA 4LV8A 5HE0A 3EJ1A 3O7LB 5TF9A 2W0JA 2YJSA 4D2TA 3IG7A 3BRBA 5AV0A 3BLRA 3DDPA 5CU0A 3COHA 5HTCA 3ZRLA 4ZTHA 5AV1A 3ZUTA 3RK5A 3QYZA 1CSNA 1JWHA 3EKNA 4FC0A 4RJ8A 5ANEA 4YMJA 5CXZA 2XNEA 2QO2A 2C5OA 3QGWA 4MXCA 3SW7A 2XJ2A 1UVRA 2ZV9A 3QCSA 3IPHA 2B9HA 3KXXA 2V7AA 4BGHA 2PMIA 4IM3A 4MUQA 3R9RA 3LXPA 4GIHA 4IFCA 4IHPA 3BHUA 4HPUE 2UZDA 3O7LD 4XEYA 4BCOA 5HCYA 4F7JA 3MESA 2HK5A 1ZMWA 4WNMA 3W55A 2C5XA 2Z7QA 3N4UA 5CNOA 1NVSA 3UIMA 4Q2AA 3Q53A 3CTQA 2PHKA 1W7HA 3AT4A 3D9VA 4ZP5A 3BWJA 2DYLA 4FV6A 4O0XA 3VBTA 3LKMA 5KMOA 3ANQA 5CWZA 1H25A 4UWCA 3QZGA 4WG5A 1PXPA 4RBLA 1Q62A 4UMUA 5CF5A 4C4FA 4O4BB 4DH1A 4YZBA 1OUKA 4CXAA 2JKKA 3QC4A 4FV7A 3NCGA 5DG5A 5EQYA 4QQJA 4AFJA 1MQBA 1ZYLA 1KSWA 2WNTA 4EBVA 4TPTA 3VJNA 4ACDA 2GMXA 5IDPA 4OR5A 4WOVA 3W0QA 2VN9A 3D0EA 2OZAA 5EDQA 2QCSA 4PDOA 4FV9A 3SV0A 1OL1A 2PULA 4QMNA 5BYYA 5L8JA 4C4IA 4MF0A 5M07A 5IA3A 2QONA 4FKVA 5EYMA 5GHVA 5F4NA 4CZUA 5I9YA 4MNFA 2HXQA 3LFSA 3DJ6A 1JKTA 3P1AA 4R7IA 3KRXA 1VJYA 3HNGA 2WTDA 3GQLA 4AWIA 3D7TB 2EXMA 3QTZA 1FPUA 4LUEA 4LGGA 4UYAA 2C6OA 4WG3A 5ACBC 2R9SA 3RJCA 3RNYA 1NT2A 2R0UA 4BICA 3QUEA 3PXKA 4BCHA 2E2BA 5FM3A 3F5GA 4YJPA 2R3FA 1XH9A 3VW6A 1FBNA 2BUJA 2Q83A 3OTVA 3R01A 3SAYA 4HVDA 4YTIA 4LRJA 5AX9A 4APCA 4R3PA 5DGZA 4O0YA 2A27A 3D15A 4AU8A 3QD0A 3OFMA 3U54A 2P3GX 3TUCA 4BRXA 2ZDTA 2CN5A 2C30A 1YW2A 2X2MA 1UNLA 1EH4A 3O0GA 2JFLA 3GCQA 3MPTA 4RLKA 3ZUVA 4KUJA 2GDOA 4BHNA 3IS5A 4YLJA 1W2DA 3AXWA 4E5AX 1IA8A 4YZNA 4JDIA 4WRSA 5IDNA 3R8ZA 4DHIB 1AD5A 4EH8A 3QL8A 2UZVA 2E9UA 4FUYA 4PL5A 3KXZA 3C0GA 3N9XA 3QRJA 2W4OA 3EQGA 4A4XA 3R28A 3VULA 3CXWA 4AN9A 4F1OA 1S9IA 3WZDA 5CSVA 3I81A 3UNKA 1H28A 4X6QC 2P0CA 4XOZA 5TR6A 5M57A 4FSRA 3A8WA 3VUHA 4L3PA 5F9EA 1YOLA 2C6EA 2W1DA 4QMYA 3TTJA 3DBQA 3KRLA 3UQGA 4M14A 4BHZA 5EW3A 5IA1A 2NP8A 5AWMA 1IR3A 1JKKA 4IVCA 2WD1A 3Q9YA 3OT8A 3FL4A 2HWOA 4IAFA 2PE1A 4PMMA 5A3XA 4DG3E 3W2QA 4CFFA 3MVLA 3OY3A 4TNDA 5AX3A 4EJ7A 3ETAA 4J97A 4ACCA 3C4EA 2AEGA 4BDFA 4UV0A 3ZHPC 4L01A 5DT3A 2OIDA 5GJGA 2O2UA 2SRCA 3P7CA 3QUDA 3MH2A 1ZYDA 3N4VA 5CNNA 4D2SA 4TL0A 4C3RA 1H1WA 4DLIA 1APME 4S33A 2Q0NA 5DLSA 4IDVA 4D4SA 5GINE 1Y6BA 3VS1A 1M2PA 3RZBA 4RWKA 1KE6A 2OJJA 3CQUA 4O0VA 2ZMDA 5E90A 4AS0A 3W2PA 5H3QA 3MTFA 4MK0A 1Z9XA 5HLPA 2W9ZB 5AP3A 3RWQA 4EHVA 4DCEA 5HU3A 4XG6A 4FEXA 4DGNA 4I6BA 5HD4A 4O81A 3EFKA 4DEGA 4EC9A 4DEBA 4U97A 3SXFA 2BKZA 2PZ5A 4JL9A 4CRSA 4TYHB 3ROYA 3T9TA 3UOKA 3HV6A 3QTSA 2RKUA 4FIEA 2J0KA 2JEDA 5C8NA 4AW1A 4IBMA 3D14A 4V0GA 1XWSA 2BDWA 4WT6A 5HVYA 2JD5A 1J7UA 2WTJA 3VRZA 1M52A 2NPQA 4ZY4A 4DTBA 2PTKA 1M7NA 5CX9A 3S4QA 3KCKA 3LJ2A 4UN0C 2IVVA 1NW1A 4RX8A 3CS9A 3R00A 2X8EA 4PWNA 1DI9A 4XS2A 5HHWA 3UMXA 4F64A 5FBOA 3QGYA 3UVQA 4F9BA 5L6PA 4DEIA 1XH4A 2WMXA 3JVRA 4MQ1A 3UMWA 2XM9A 4IWQA 3IONA 3R1NA 3NLBA 4M97A 4AA5A 2R3QA 3HRFA 3P9JA 3WIKA 3EH9A 3VBQA 4BIEA 4AAYA 5CQWA 3PSBA 4J53A 2R3KA 5G1XA 2BZHB 4NJDA 4RT7A 3EQCA 3MFRA 3KN5A 3EQIA 4I3ZA 4IWOA 2QOFA 5T6KA 3RNIA 4O0SA 3PPZA 3UO5A 3C50A 4C37A 4L68A 2I0VA 5FTOA 3T9IA 3SVVA 1QPJA 4DN5A 1BI7A 2YCSA 3QD4A 4C3FA 4NM3A 2BR1A 1Y57A 4MD8E 3P79A 5A14A 4LYNA 3U51A 3BYMA 4I6HA 4Y95A 5GNKA 3DNDA 2B0QA 2XCHA 5CU3A 2NRYA 4YZ9A 4YR8A 1Q8WA 3F2NA 4RWLA 3ZLSA 5JRQA 4FL1A 2BZIB 2WMSA 2ZOQA 3A2CA 1WCCA 2PVYA 3LFAA 4MD9E 5AJQA 2QQ7A 4JRNA 3CJFA 4BDAA 4O96A 5HI2A 4PX6A 3SG8A 3TIZA 4F0IA 3FMHA 3E8EA 2XA4A 3ZC5A 2R64A 5ANIA 3O96A 2C3KA 3S1HA 3FKLA 3Q96A 2CLXA 2UVXA 1GZOA 2C6MA 5ANDA 1XQZA 1UWJA 4U6RA 3ITZA 5ITAA 4LL5A 4OTDA 3ENMA 2Y6OA 4YNOA 4FZ7A 3NR9A 4EZ5A 4O7VA 4RJ6A 3FKNA 2OO8X 3WOWA 3QX4A 3PP0A 5AA9A 4O7LA 3C1XA 4ANBA 5IZFA 3DB8A 2JDOA 2R0IA 2WIHA 4EI4A 5C03A 4DF3A 2G15A 2YM6A 3FYJX 4TZRA 4UMTA 4DEHA 5AUYA 3GVUA 3UDSA 2NO3A 4JOAA 3GOKA 1OPKA 1P5EA 3QTUA 4WRGA 3TI1A 4QMOA 4TRLA 3GGFA 5AUTA 4AG8A 2H8HA 1F5QA 3PA5A 4ZS4A 2JIIA 3I0QA 3PLSA 3KXMA 2A2AA 1PKDA 3C5IA 4DGLC 5CAUA 1JNKA 2IG7A 3NNWA 3OUKA 4IAYA 2VTHA 5AIRA 3UODA 3LXLA 5IA0A 5EFQA 1W2FA 3TV7A 4OTIA 5FXSA 3W2SA 3D83A 4FEWA 1Q8ZA 1REKA 5M06A 4LG4A 5M55A 4V0GB 3DAKA 5DPVA 2ZV2A 4Z7GA 4H36A 2XF0A 4JT3A 4RX9A 4U0IA 4RFZA 5D11A 3R9DA 2EXEA 4E20A 2NYAA 1OITA 2IVUA 3WF7A 4BBEA 3AD4A 3Q3BA 3G9NA 5E8VA 5DEYA 5ETFA 4H3PA 3CE3A 3EKKA 4EHZA 2YIYA 4FYOA 5KO1A 5AMNA 1ERKA 4FL3A 1IRKA 5FUTA 2B9FA 2IWIA 2C47A 3BYSA 5ANOA 3QWKA 4BDCA 3TKUA 4LFIA 4CMTA 2YIRA 3NYNA 5D7VA 3IGGA 4L6QA 5K4JA 4G3DA 4ITIA 4JQ7A 1F0QA 3ML1A 2IZSA 2VRXA 1F3MC 3MVMA 3PXQA 2VU3A 3LW0A 2C3IB 2I1MA 5LOHA 1PXKA 2XKFA 2PK9A 4ARKA 4WD5A 5HTIA 4RSSA 4CGAA 2UW9A 4BY9E 4NKAA 5IEYA 5D9HA 1K2PA 3DAEA 3C4CA 4E73A 4F0FA 4GKIA 3AC5A 4B9DA 2CJMA 1CTPE 2PE2A 2WHBA 3EN7A 3KULA 4M7IA 4E4MA 5HG5A 3VS2A 3HDMA 3I4BA 3VUGA 1PMNA 1UA2A 3OG7A 4JMQA 2YHVA 1FGIA 2ZM1A 2HW7A 3DKOA 5FQDC 5J1VA 2XBJA 2C6LA 4WIHA 1K3AA 3V8TA 4BCKA 4O27B 1JBPE 3RCJA 2X7FA 2H9VA 3PUPA 4QTEA 5AP0A 4CQEA 2R3RA 5KMKA 3QKMA 3UP2A 4AXFA 3QQLA 3EIDA 3RAWA 2WFYA 5HKMA 5BVNA 4NL0A 2OKRA 5CALA 3CD3A 5M53A 2GNIA 3U9NA 3QC9A 3QFVA 4Q9SA 5HVJA 3ZSGA 4DBXA 4BKYA 1GIJA 1SVEA 3TKHA 3Q2MA 4GUBA 4BZNA 5CAQA 1TQIA 2IPXA 4YJVA 3LFNA 1KV1A 4RWIA 3WF8A 4BIBA 5FXRA 5HNIX 2X4FA 3UQFA 2OF4A 5AP5A 5I5ZA 1AGWA 4RQKA 5EQEA 4JQEA 1ZAOA 1CKIA 4V05A 4AAAA 3HLLA 4IWDA 4O86A 3FQSA 3G5DA 3QTIA 4R8QA 3Q9ZA 4QMXA 1S9JA 2G2HA 4EHEA 3LJ0A 4FSQA 2Z8CA 3FY2A 3G2FA 4ANLA 5LMKC 3BHHA 3QRUA 2C6TA 5TOZA 4EQCA 3DXNA 1WFCA 2JKOA 4O6EA 5ETCA 3R7VA 1SVGA 4DLJA 3B2WA 4NW6A 3E88A 4ACHA 3AKJA 4E26A 4ANQA 3V04A 1PXOA 5I4NA 2FYSA 3FZTA 5JFXA 3DXPA 2XNNA 2I7QA 2UV2A 3ORKA 2ZYBA 4NEUA 3Q52A 5F95A 1U5RA 1W0XC 5HQ0A 5LARA 3MH0A 3OXZA 3ZEPA 4QP6A 1ZXEA 2PVLA 1U46A 1PYXA 2B9IA 4FZDB 2Y7JA 3JUHA 1YDTE 4NT4A 2EUFB 2RSVA 4E93A 4MXYA 5TO8A 4PDSA 5AR7A 1M2RA 2QOHA 4HJOA 5IA2A 4NH1A 3W10A 3HV3A 3SHEA 5L2SA 5IUIA 2OFUA 4BVUA 3R7OA 1JLUE 1GY3A 2F9GA 3D2IA 3DBFA 3NAYA 3PXFA 3NUYA 4GG7A 4W4VA 5AFVA 5JH6A 1J91A 3K5VA 3FEGA 4DCAA 3F5XA 1XMLA 4MYGA 3C51A 2JDTA 4A9YA 3NUXA 2W1IA 2BILB 5BVEA 4EH2A 4TWCA 4LGHA 4TKSA 2XCKA 4FTRA 1OL6A 2RL5A 4WNPA 4YTHA 3WARA 4FT7A 3SOAA 4IVAA 2ITUA 2CPKE 4ALUA 5BNJA 3AOXA 2XRUA 3MVJA 5D10A 4ERKA 4C35A 3B8QA 3CQEA 3TL8A 3GCVA 3WZKA 2OK1A 4NJ3A 5HNBA 1BMKA 3UIXA 3LMGA 3R8LA 3SG9A 4NTTA 4JG8A 4NKSA 2BPMA 4M66A 1M17A 2QU5A 4DA5A 3OWPA 5J95A 2HZ0A 2QKRA 5DYJA 2WTCA 3LQ8A 3MIYA 4QP9A 2PUNA 2XANA 3PTGA 3LE6A 4KINA 1M14A 3PY0A 3ZMMA 3Q9XA 1BL7A 1Y91A 4Y5HA 4K11A 2JBOA 4Z9LA 1I09A 2IW8A 3I0OA 3ID6C 2J9MA 5HNGA 3UIBA 4IB1A 3MY0A 3NRMA 3PVBA 2FO0A 2J5EA 4L67A 4W4YA 4MHAA 3C0IA 2ETRA 2PE0A 4GJ2A 5CSXA 3K5UA 3PFYA 3BE9A 2WMWA 1ZMVA 4KIKB 5C4LA 4E3CA 5AR8A 2JBPA 4U41A 2WELA 1ZARA 3FWQA 3ORNA 2H34A 5HICA 3DDQA 1Q61A 4FOCA 2BRGA 2OXYA 4AT4A 4CG9A 2BZJA 4QMTA 5GZAA 4KA3A 3IECA 3F5UA 4TW9A 4IX4A 5CEKA 4GRBA 4HW7A 2X0QA 3VWAA 2QOBA 2QO7A 3IK3A 2B55A 3V5JA 4PQNA 2UW5A 3R8VA 4BDIA 4X6RA 3LLTA 2QI8A 5EI8A 4I0TA 3OEZA 4S30A 5LCKA 4BTFA 3UO6A 4GG5A 4RJ3A 4UYNA 4E1ZA 3MB6A 2Z7LA 3U8WA 4BKJA 2JKQA