4G6VB

Cdia-ct/cdii toxin and immunity complex from burkholderia pseudomallei
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
AIDLFCYLSIDRGAAESDLNKIRSNHSELFEGKFLISPVRDADFSLKEIAAEHGLVAESFFLVSLNDKNSADLIPIVSKILVDGFNGGAILILQDNEYRRTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of toxicity and immunity in contact-dependent growth inhibition (CDI) systems.
pubmed doi rcsb
source organism Burkholderia pseudomallei 1026a
molecule tags Toxin
molecule keywords Adhesin/hemolysin
total genus 30
structure length 103
sequence length 103
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4g6vB00
4G6VB
chains in the Genus database with same CATH superfamily
2W4DA 2NS1B 3QO9B 2NR0A 4HEA9 2YNFB 2LP4A 4P73A 2MQLA 1SL1A 2BJEA 3FEZA 2RT3A 1S6OA 2FHMA 5LMUJ 2Z56B 5LMUF 5HROA 1KQSR 4KPCA 1S77D 4K7QA 1IN0A 3GSDA 2M52A 1G2EA 4KV8B 3U27A 3M6VA 4QCLA 3N79A 3SCJE 3EGNA 3IRXB 5AT1B 1KVIA 2XZTB 2ZUAA 4QYRA 3U1LA 4AXIA 3Q2TC 2B51A 1AUDA 4G1IA 2DGTA 4C8MA 1FVSA 4RJVA 2E1PA 1YK9A 3GTYX 2DYAA 4Y3CA 3TW0A 1H7XA 3X1LB 1HNVB 2CPEA 4H4OA 2RRNA 5IT0A 2QFIA 3JTNA 4TLQA 3FGVA 1D3WA 4V1Ak 3NKYA 5KT6A 2VKRA 3BDEA 4F25A 3TAPA 2J6TA 2B8PA 3HVTA 3MMBA 3N9UC 1WTFA 2JL9A 2DKOB 1HNZJ 1HNZF 5KT2A 1S4EA 1GX6A 1WOSA 5CYMB 3V6DA 3NL0A 1U4BA 2K06A 4RNFA 2J0WA 1HR0J 1HR0F 3VVTA 3H4DA 4EI2A 4JI4J 4JI4F 2KM8B 1YG0A 3FBEA 5I42B 3GR1A 4ECUA 2HHVA 2BW7A 1GAOA 2GQ2A 1TL4A 2IJNA 3OXLA 2YKMB 4WFZA 3CJKA 4DR3J 4DR3F 1WEXA 5HROB 5D8HB 3W64A 2HHUA 4CLUA 4DPUA 3T5LA 3NCQA 3NS7B 4QU7A 1RT4A 2C2DA 4M5MA 1O0PA 1TQLA 5KT4A 1Q8BA 2HNYA 2ZC4A 4WKYA 4FS1A 2OTJS 1HFEL 4ZKAA 5A8WA 4F4KA 3FBBA 3CCUS 3KWMA 3CJ2A 3QBCA 3RW6A 3SYZA 3TYTA 3Q8UA 7AT1B 3K0JA 2F40A 2XSJA 1RYSA 3W63A 4CYUA 1UJ5A 2KL8A 4ECQA 3HSZA 4DQRA 3TQEA 2JRSA 1R8CA 5GAGI 3JQKA 4XPCA 3L95X 2RNEA 1RLDA 5KFFA 1IKYB 3FVYA 2MY7A 3UWTA 4LRCA 4I56A 2ZVIA 1N0VC 1RWUA 4M5GA 2KXFA 5K8PA 2WBMA 3CJKB 2KG1A 2DO4A 2N3OA 5GAHI 1U8SA 3L3CA 2ADBA 1SXLA 3D6FB 3PHTA 4DWIA 1WF1A 3DLEA 3R2DJ 5ETNA 6FD1A 3EZOA 2GIRA 1VQ6S 2AHOB 3OR1A 1RTIB 3R27A 2ZH1A 4IOAQ 2AJ2A 3SV3A 4USKA 2V2KA 1MMDA 3BZQA 2CQCA 1T7PA 1FESA 4LRDA 2DR7A 4NZ6A 2KM8C 1NSQA 1D8YA 2UUCJ 2AJ1A 3QWUA 1A0OB 1T9WA 2QSFA 4FXVA 4GC7A 2UUCF 4OIXA 1MSWD 2CPDA 2ZJPQ 1SH2A 5F3TA 3A3OB 2DEJA 2RUGA 3EDRB 3I87A 2D9OA 4ZN3A 5KFQA 1U49A 3MCMA 4PQAA 4YB7A 1S48A 4ZA1A 2HHXA 4WTOB 3I4PA 3HLUA 2VASA 2H1YA 1TR0A 2KHDA 2HHPA 2WZ1A 3I82A 1CJUA 1S49A 2VG5A 2WONA 3M32B 3PNIA 3VGTA 2CG8A 4DUYJ 4DUYF 3H90A 3MECB 2GMJA 3D28A 3EMTA 3PTWA 3H5SA 3IMQJ 2NSBA 1S1WB 3A13A 3SFUA 4CQ1A 2BJ7A 1S6UA 4CO1A 1C1CA 1OJ4A 1FRHA 3PJXA 4B3MJ 5DO2A 2J7KA 3MPVA 3ZZUA 3AODA 1XK8A 4OHVA 2QYCA 2CQ2A 3H2VE 3ICLA 4C0HA 2CZ4A 2OSRA 5B0CA 4DX8H 3I0SB 3QLHB 1C0TA 3VV2B 5EWFA 2VODA 1RA6A 3BN4A 3W65A 4KH1B 3J80U 3BGUA 3RB3A 4IQXA 4GKJJ 2RKIB 1PJ5A 4KGVB 2QG9B 1LW0A 3SSQA 3M2UA 1R0AA 4IRDA 2YTCA 2C2ZB 1RAJA 3HFVA 1U02A 2W4CA 5J2PB 3EVWA 2AP6A 3NNCA 2ZWOA 4Q45A 1U7LA 2BQRA 2HWIA 4P75A 4MIWA 1KHVA 3MM6B 1WHYA 1X4HA 2A3JA 3R5GA 4PWUA 4WIQA 2ZE2A 3K8VA 4N47A 4DCOB 2FD2A 4CTAA 5GAEI 1V3SA 1UPPA 4ID5A 2FVSA 3WX4A 1LW2A 4UUWA 1J5OA 2JEIA 2ZNZA 1S9GA 1RAHB 3G82A 3PRVA 2JLGA 3OTEA 3KMQA 2L3MA 4Q44A 2VPZB 3PACA 3R2CJ 1HW8A 2G1DA 2F8MA 3MAAB 3H20A 5HMWA 1WNEA 4B3SF 4B3SJ 1T95A 3KJQB 4PYDA 3RAMA 3HT3A 4LFAJ 2G0JA 4LFAF 2LQ8A 2YWWA 2ZJQQ 4EGLA 1VRUA 1UETA 5DM7Q 4FF3A 4LF8F 1SI9A 4LF8J 4ED7A 1U09A 3HDSA 4I6WA 3CJ5A 2B4UA 1NK7A 1G1XA 3M8WA 1NK0A 1WJ9A 3MEDA 2YH1A 3PYDA 2YQ1A 2KT3A 2KVQE 3MMAB 1FVQA 4G6VB 2GVDB 4ZCMA 1FI4A 2PI5A 1IXKA 1HBOA 4K59A 4KV8A 4NOHA 4IR1A 3BBBA 3Q24A 1UA0A 2XLKA 2ROGA 3G8QA 5KFXA 1N5YB 1BLUA 3FMWA 4WE1B 2BE2A 2X7IA 3DYAB 1RU1A 4MKVA 1VRQC 2RAQA 3BYRA 1PKUA 4JI0F 4CNZA 4DV0F 4DV0J 3R1HA 1VC6A 1JMTA 4ITSA 5H9EJ 2W2PP 2QA1A 4CLWA 2AF6A 4DU8A 5F9NA 2CVEA 4C3LA 1JLQB 5C42A 5J2MB 2FHJD 1NPRA 5A2QY 5D0GA 4JI7J 1OQ3A 1FT8A 5FLXY 1URNA 4URQU 5HJXA 2VIHA 1NB7A 3M6XA 4IO9Q 4P2XA 2K1RA 4N76A 3W5ZA 2RILA 3OTDA 3D2WA 2B6AB 2VJUA 1F2GA 2HVEA 5HQ8A 1JLCB 1RB0A 4O4GB 1D09B 2HNYB 4XDDA 1TP7A 5ETVA 4F4AA 2DNRA 2CPYA 5A8WB 3OHBA 2ZH6A 1DQAA 2N3LA 3UN2A 9ATCB 4USJC 5E3RA 1IKWA 1CG2A 3SSSA 2L9DA 2ZOFA 3MM8B 1F1BB 1DJ0A 4IYQA 4RW9A 1GQEA 4OLPA 1N5TA 1NH7A 2DXFA 2MHNA 2BKNA 3BYPA 2OPSB 3CT9A 4CM2A 4H4KC 1K47A 4P72A 3S8SA 3VZIA 3L7PA 4DR4J 4ANDA 1KOOA 2Z2ZA 3LWLA 3DLKB 5BXIA 4USTA 3KLEA 2HZAA 3UDEA 1NKBA 4DUZJ 2DNMA 2FGOA 2EKYA 4DUZF 3RG6A 3IM9A 3M8YA 5RUBA 2XY5A 4JI5J 4JI5F 3GIJA 3GFYA 3MR6A 5DLFA 1N5YA 3TP2A 2XS7A 3OTCA 4OI4A 3ZTPA 4CNYA 3T5KA 3PW5A 1G4CA 4MK7A 3M8SA 2DPIA 1TKXB 2FZCB 2ZVSA 2JX2A 3J7A1 1CJVB 1R89A 3BF4A 1FWPA 1H2TZ 3NS6A 1N4LA 2E9RX 1YDLA 1ZA2B 3DC2A 1UEKA 3FBFA 3GONA 3MM9A 3TA2A 3T1AA 4E98A 1OY6A 3RBEA 4K4ZA 1SC6A 2ZEJA 2DNLA 2W9CB 1QY7A 5MAOA 1JX4A 2CQ1A 3CDAA 3J7ZT 4DL6A 3BV8A 1NMEB 1YJNS 1P9QC 1Q0NA 3PHEA 2VDIA 1NDLA 3SDEB 3Q83A 5F0WA 3TAMB 3CJQA 2OPSA 3GYGA 4L3KA 4P2MA 2E5IA 1RWXB 4HACA 1MWQA 4YFUA 4ID8A 3MFHA 4DQSA 3TAQA 4WF9Q 1JQGA 4C8KA 2E7WA 2KJVA 4PQUA 1LW2B 2MHEA 4L72B 1KEKA 2X3GA 1J5OB 3HT0A 2IHR1 2IVMA 1VHFA 5JXSA 3THPA 1U1LA 2OPRB 4QYZJ 3EGVA 3IBCB 1ZBTA 2ALZA 1MROB 3F0NA 4ENOA 1QE1B 1CJTA 2VU5A 2BKOA 3IA0A 4JI6F 4FPRA 4JI6J 4USMA 1FJGJ 1S59A 1FJGF 3BGFA 4AXJA 2JDJA 4JI2F 4JI2J 1HMVB 2RMLA 3GJSB 1YQHA 1S1XA 4ZPVR 3OLAA 1R0AB 1CBKA 1YBAA 4PUOB 2BA9A 4A8QA 2VOOA 4XTTA 3NS5A 5A8RB 2RE1A 1N34F 1N34J 3UQSA 2OEJA 3C14A 1T11A 3TUZC 1S12A 1ZM2A 5C5JA 4RO0A 3M9MB 4NEZA 3N6NA 2ADCA 3PDNA 4O0IA 1RHRB 1X4CA 4MT1A 3QIPB 1KONA 1UW9A 4JUZA 2RSQA 2HNDA 1UFWA 3M2RB 4DL4A 2IRXA 2BEFA 3OUYB 1FHTA 3EJMA 4IKAA 2WVFA 2IPOB 5AJ3J 2FC9A 2BANA 1VQ4S 2VFTA 2WW4A 3NGUA 3QJLA 3D6HB 4H4KA 4NLQA 1SKWA 1LFPA 4HYKA 1EKSA 4ZVRB 5E41A 2UP1A 4DFKA 2QMUB 5SUHA 4A48A 2FVQA 3UNYA 5K8OA 1CEZA 3TNVA 3ILIA 1RK8A 2ZH9A 1DTQA 1FK9B 3PVXA 3NGKA 1NEEA 3BSAA 5KFVA 1HHTP 2V9WA 4PWDA 3A12A 1PAUB 2VICA 2RD5C 3MPWA 3W3SA 4I2QB 3MI7X 1VHIA 1O51A 1FE4A 2WSFC 4EMDA 4QWAA 5HQLA 1S1XB 1J2VA 1NJWA 4HLBA 1AYEA 4A8WA 3CCJS 3W9JA 2GO9A 5A0YA 4CM0A 3PW7A 4OV6A 2B56A 3TJAA 4X66J 4X66F 1N5QA 4CLPA 3N4WA 2GHWA 5KFMA 4ES1A 4TQSA 1VGYA 4CLTA 4OLOA 2NLWA 4HI2A 3NP5A 2RH3A 4F7VA 4QWEA 1TFWA 2NUHA 3GFZA 3FFIB 2CPZA 4KIAA 4U6PA 1HL6A 4J37A 3CCLS 1U6ZA 2JLEA 1HNXJ 1HNXF 4X4SA 2POKA 3B54A 2HIQA 3CJ4A 1SH3A 1UJ6A 2IJRA 4TQRA 4Y00A 2N4DA 2XHWA 1B0TA 2AX1A 2J9DE 3DRPB 2F9DA 5KFZA 2BANB 3SEOA 4BC9A 3Q8QB 2P8IA 1M1HA 2UXBF 2M0GB 2UXBJ 2LMIA 3TOQA 4WFXA 4DFJA 3R7BB 1RI7A 5IC4B 3RBZA 3AJDA 1HBMB 1WG5A 4LF5J 4LF5F 4UOGA 2GQCA 4TU9A 5C24B 2DRAA 3ZXWA 1BXNA 1S7HA 4Q0BB 4L76A 3RW7A 3BB5A 3SIPB 4DLGA 4LRBA 2WB4A 4ETZA 4YHHJ 4YHHF 3R5DA 5T7LB 1WKLA 3SCKE 3ENVA 2IDEA 1HWJA 2PSZA 3DOKB 1XMOJ 1XMOF 4JI0J 3RGIA 4ICLB 4OYOA 2NPFA 3VWSA 1QLNA 5AE2A 1VQ9S 4B9TA 2BKPA 5F8MA 4EUVA 1FD8A 5A8KA 1QSLA 3IWNC 2K7KA 3PO4A 3H98A 2B7BB 4IQMA 2HSEB 2W7OA 1IKWB 3V81B 2GC8A 1P9YA 2O66A 1RISA 4P71A 2BOPA 2JSXA 2LDIA 2W2OP 1P1TA 5IS2A 2HNZB 2WVEA 2V34A 5HJYA 3BR9A 1PYSB 4NLPA 3GCWP 4DHVA 4DL5A 2OH2A 1GXTA 1WELA 2ZDOA 2VD3A 4DV4J 1OYEA 2A2DA 4DV4F 2F8EX 3OXFA 3CCVS 3VAKA 2AZ3A 3ITHA 1FXDA 3JSRA 1FJEB 5C42B 1WTBA 2OO4A 3AD7C 4FDFA 1FFGB 1FKPA 4PXDA 4NXMJ 3FCVA 4LMZA 5KFNA 5CQGA 3V4MA 5L46A 2XYPB 3U1MA 4MK8A 1WF2A 2VBXA 1LOUA 2A1BA 1HPZB 1TKZA 2VF3A 3KJNB 2HQDA 2WAQD 4P7VA 3SQGA 4CT8A 2JWNA 2P2CB 1C0UA 1F3VA 2BE2B 2D3UA 2MKJA 2V69A 2PE8A 2XMWA 3DYAA 4LBIA 4Y2AA 5C25A 3MOZA 3V81A 3BDPA 1LNQA 3F56A 1FJCA 4N7TA 2CWXA 1CULB 3M8PA 3QLHA 4XPEA 4R25A 4DSFA 1LV5A 4IG0A 2H9ZA 1RU2A 2QL7B 2IFXA 4KFBA 5GVQA 2B4OA 4QW8A 3S6EA 3HKZD 4USWA 1QTMA 5EX3A 1FRKA 5DDOC 2M4MA 3T9ZA 1HBNB 1H3DA 3DLKA 4C97A 3BKFA 1EP4A 2U2FA 1RTZA 4DLEA 2RQCA 2OGUA 4FF1A 1UKUA 3PCOB 4IR9A 2GZOA 2K8GA 3HHDA 4M5DB 4X4PA 2V8VA 1H73A 2UUBF 2UUBJ 1QVGR 1FCAA 4DQPA 2KZMA 1RHQB 2HHHJ 2HHHF 2BDPA 1HBMA 1WC3A 1SBRA 3TRGA 4QIVA 3DLHA 2CRLA 3KK3A 1Q5YA 1X9WA 1DTTB 3CJ0A 2UUAF 2UUAJ 2C2OB 1Z2ZA 3LPEA 2CNOB 3KLEB 1UTAA 3GCXP 3R1LA 1S1VB 5JMNA 1ZTWA 1C2PA 1VQKS 1F9EB 1XR5A 2ROPA 4I2PB 4DPOA 4IG0B 1PC5A 3GWCA 2FZGB 3OR1B 1S79A 3W9IA 3VAHA 4F4XA 1VQ5S 2GX8A 4FYYB 1WHWA 2IC3B 1GX5A 1H98A 3CNQP 4CO0A 3NWRA 4FVMA 3QSYB 2I8EA 1PO6A 3MEKA 1XQIA 2CPIA 2JFKA 4LSNB 4BBYA 1BQNA 3DU5A 3KLIB 3VGSA 4RBTA 1NBEB 4NLSA 2R7QA 3PX4A 5KTQA 2MZ1A 2QFJA 1LXJA 1TL3B 2J8SA 2B9YA 3MCSA 5F41A 4RW6A 2QLWA 3PIPQ 1S1WA 3HD1A 1N33J 1N33F 2Q6CA 5J2MA 4KKOB 3KJVA 3QAUA 1U45A 4CO5A 4JB8B 5E2QA 4U7CA 3BBCA 2BJDA 4OFZA 1DLOA 3LALA 2OPQB 2LQ5A 1HQEB 1R8HA 1U1MA 2XYGB 2QL9B 1TVRB 3KXDA 2Y1JA 2RKIA 1RWOB 3GG0A 2B5JA 2H4YB 2NXCA 1TMJA 2QIFA 5HP1B 1FA0A 3PW4A 2JVOA 3BPSP 2AYMA 2RJZA 2RQMA 4O44B 2UUTA 3DOLB 2DGXA 4HR2A 2COLA 4DR7F 4DR7J 3BKUA 1GH8A 3ZZRA 4DX5A 4G1QA 4URGA 3HFKA 2XGQA 1IKVB 2QLJB 3W8PA 1CULA 5L38A 4DV7F 4DV7J 4URSA 5HMZA 1D1UA 1HNIA 4UY85 2GO8A 4NLYA 2XLIA 3DMJB 4ZIWA 2V50A 3I56S 1L3KA 2HFZA 4HT7A 5EHHA 1RT5A 1HI0P 5CXTA 1F5CA 5H1SV 2AYEA 1HNVA 2XWXA 2R2RA 3VALA 2DNOA 2YY3A 4X4OA 4GKKF 4GKKJ 1TAUA 3MPYA 1FTRA 1P1LA 3A8JA 1KFDA 1RAOA 2DCLA 4FPIA 1HPZA 1PSDA 1TKZB 2J7WA 3HD2A 4IFYA 1Q86T 1KVJA 2EFQA 1RTDA 1R27B 5GMKa 3ZC4A 4C11B 4MKYA 1SH0A 1HBUA 4IDKB 1NPKA 3OHAA 4EWTA 3IM8A 4UW2A 3HHLC 3FSXA 3Q8VA 4GO5X 3R5BA 1M1GA 4WPAA 4B9NA 1CC7A 1Q7LB 1R7IA 5LSLA 3SXLA 4QIFA 5LXYA 4YR0A 1AROP 3IR6B 2VA2A 1T03A 2OTLS 1RT4B 4EFAC 4P2SA 3IBWA 2MQMA 3UD5A 4RKUC 2ATCB 4LF9J 4LF9F 3TUIC 3OFGA 1Z1ZA 1FDAA 3I5BA 2RU3A 2EC0A 5E33A 5BR8J 5BR8F 4K5SA 5E3CA 2YVSA 3UN5A 4YMEA 5DG7A 2NZ4A 2R7XA 1U2CA 4Y2CA 4CH7A 1OS5A 2LU1A 3DCAA 3LANA 1ZYQA 4TN2A 3LP2A 5DDQC 4CYUB 5ETRA 1BMQB 4RW4A 2A6MA 4YP3A 3DRRA 3CW2C 2VG6A 3LP0A 1PC4A 3G86A 1UVKA 1JJ2R 1YTYA 1QAJA 1KQGB 2B9EA 1HWLA 4LF1A 1REGX 1X4BA 3T19A 1M5VC 4UF4A 2K3KA 2OEMA 2C3MA 4H4OB 3HSDA 1WWHA 2DTJA 2YX7A 4OX8A 1YHQS 3M6WA 1EETB 1RYRA 3CJTA 2W9BA 1YJVA 2XNQA 2CZVC 2L08A 3NY0A 1X5PA 2CKWA 4ZVPB 2AGOA 1QSSA 1RHUB 1N54B 2GIFA 2MGZB 3O5TB 1XNRF 1XNRJ 5HK4A 4D3HA 2GQQA 2O5DA 2CAJA 2SXLA 3M2RA 5D4PA 4OYMA 2W8LA 1RAEB 2FDNA 1PAEX 3VGVA 1NJZA 2KYXA 4FF4A 4CZCA 3CCES 2XC9A 3PO5A 3KMSA 5KG3A 4K2JA 3BH6B 2V63A 2GGPB 1R8BA 2HPUA 2WVCA 5B0AA 2A6OA 5A6WA 1TKDA 2E9TA 1NH8A 1T9UA 1WKJA 2G0CA 3P49B 2HYIB 3MEEA 5A76A 1YZ7A 3JQMA 4KH0B 3J81Y 1X5OA 3S1TA 2IC3A 1UEVA 2XBPA 4KT0C 3OD2A 5A8KB 1E6YA 1HQUA 3EXCX 2R8HA 3D6TB 3CCWA 2NREA 4U7UD 2PT0A 4NLVA 1NHKL 4ZPBA 1YSJA 1SJFA 1HBUB 1WOOA 5I3UB 1MROA 3FDSA 1R3NA 4M5KA 3HHLA 2G4BA 1ZAWA 2MTLA 1DTTA 3GLJA 4OYZA 4ECWA 4KTQA 4F02A 5LJ5Y 4MYUA 1OPIA 2CA9A 4F4WA 2C2RA 5B09A 3GFXA 4DV1J 4DV1F 1VBXA 3EWGA 3FSIA 4LIWA 4KPYA 2IJFA 5K8MA 1JLEB 2AEMA 4RR5A 2MGZA 2OD6A 3A3NB 3FZ2A 3PR5B 4IFVB 3E2EA 1BQMA 1BQXA 3NOGA 2FJBB 5LOQA 4DFMA 3QRPA 1PBAA 3DDNA 1S9EB 4USHA 1FX4A 1U2FA 3IFEA 4OJ3A 4WU2A 1WC4A 5J1EB 3HVTB 2XS2A 1RT2A 2NXNA 2ASJA 2JEFA 1YKWA 2L9NA 5DQGA 2VH7A 5DG9A 2VG7B 5HBMA 2WSEC 3O44A 3IP0A 3KFWX 2JLFA 3P5TL 3LA0A 5F8JA 2AT1B 3PEHA 1DZ5A 2PFFB 1RT1B 2XZWA 3ONQA 2R8KA 3HP6A 4QPXA 4O3OA 3CCTA 2VBZA 4FZVA 1NK6A 1EHWA 4ZIVA 3LUYA 4Z2XA 2XB2D 2B7CB 1K0TA 1VDHA 3K17A 3ZTOA 4F50A 1DQ9A 3HXMA 4NA3A 2VKZG 4B3TF 4B3TJ 4EU0A 3DLLQ 2OAUA 1EB0A 4FP9A 2DNKA 2D1CA 4LBHA 3D3CJ 4ED3A 4B3OB 4PWDB 4MAKA 1Q7YT 1JJCB 1I5OB 1UVNA 2E5GA 1Y9OA 1C0TB 2Z58B 1JKHB 4YDDB 1REVA 5K14A 2IVYA 4OI3A 2DBBA 2RF2B 1NZ8A 5KT5A 2PO4A 5F0UA 5G0RB 4LFBF 2DNZA 2I9SA 2VQFJ 2VQFF 2WCXA 1N56A 4PQUB 4I4BA 2VL1A 3GV5B 1NAQA 5DRKA 1R8PA 1RWWB 2V2QA 2XMKA 3HCXA 1X31C 5I3PA 3KNGA 2Y1IA 3KNAA 3IS9A 3A8KA 3MMCA 1SJ1A 3K8WA 6FDRA 1M90T 3CWJA 2ILYA 1I51B 3GU0A 2WBRA 3POTA 4KY3A 4F0MA 1AB8A 1VRTB 1XR6A 5H9FK 2CJXB 3TA1A 5ETTA 3R5CA 1IBLF 3FCHA 1IBLJ 4ZS6A 4DG1A 2QLBB 3P45B 1RABB 1X4EA 2BRKA 2AWZA 3A1YG 3NGTA 2OI2A 4IOCQ 3ISND 4OZNA 4YUDA 1SKUB 4P6QA 5A8RA 3DNCA 1ZM3A 2H54B 4ZP6A 2H5IB 2N4CA 2LQJA 4RNMA 2V4JB 3C6UB 3CC4S 2M5YA 2HGLA 3DOLA 5DZ6A 4A8XA 4ANEA 4K4YA 2QX0A 3QIPA 3Q89A 2L48A 1X9MA 1R8AA 2BV3A 2VC0A 2J0QD 1UFLA 2OMLA 4ES2A 4MIAA 1W2IA 2OPQA 2HFVA 1QAIA 1DLOB 3K2YA 1RXOB 1ZM9A 1TKXA 1JKHA 4DQIA 4HL9A 1TTHB 2ZDPA 5LL6d 2N7CA 3WIVA 5IM0A 2VONA 3E51A 1N5VA 1MLAA 2W2NP 4RWWA 2KT2A 3WX8A 3NAHA 3TO8A 1RAGB 2FJXA 1TUGB 3NEKA 4X62J 1W7WA 1H2VZ 3JSBA 4N8OA 3SDEA 4PKDB 4X62F 2XMTA 2Y3YA 2NXJA 4NI2B 1RT1A 5D6GA 2UXDF 1FD2A 2UXDJ 1LWCB 2GCFA 1FJ7A 3ELHA 1AFIA 2ZOGA 1YJWS 1DURA 4LF2A 3C6UA 3MAQA 4ECSA 4NMXA 3GIMA 3CGIA 1RTDB 4DL7A 1VI7A 3MR3A 1SPBP 1RT2B 4PABA 4FYWB 4C6AA 2B9XA 3BPDA 3JS9A 2HNZA 1NSKL 1VQLS 4UTGA 3DM2B 3SMZA 2RS2A 1VS3A 3VHQA 4R5PB 5EGYA 7FDRA 1UWBA 2ZC3A 2C2NA 1DRZA 2CQPA 2F63A 4LSLA 5JVHQ 4B9SA 3D67A 4C8OA 2R7VA 4GC6A 3K5PA 2OPPA 1UVIA 5ETPA 2J9EA 2C3UA 2VFRA 2AEFA 2NSCA 2YKOA 5ETMA 5T41A 4J9LA 4ZVTB 3QYYA 4TNOA 4WTYA 3R8YA 4NXMF 1FERA 2B43A 4TYBA 4ZPTR 1VMBA 2EPIA 2XI2A 3E3XA 3FSYA 3UD3P 2BJ8A 2ABYA 2IA0A 2HIYA 3T41A 3ZNUA 4B3RF 4B3RJ 2IYIA 1R6VA 4L6V3 3SCLE 3SQOP 4DI6A 1RWMB 1IBCB 2LXFA 3GMGA 3BJYA 2C22A 1KOHA 2XMUA 2JC0A 2YWEA 3WHIA 1NJXA 4EO6A 1Y5LB 1QVFR 3SBMA 1KS2A 3IBFB 4HTIA 2W8KA 1L5UA 2RRBA 1GXUA 2V8DA 3M9OB 1WORA 1CLFA 4ZP8A 1G7CB 1S6PB 1EX8A 3KG0A 3QT5A 3LAMA 1XWLA 2XMAA 2V94A 2FHJA 1XMQJ 1XMQF 5HP1A 2IBOA 2DD8S 4OX7A 4YB6A 3QIDA 2R7OA 3US5A 2LU2A 3HJFA 1LQ9A 1NKEA 1TV6B 4OYWA 1QTNB 3OVBA 3OT9A 2BYCA 2YKAA 3HVWA 4Q5VA 1KLNA 3AA8A 1RBOB 1IR0A 3N01A 1JLBB 3CTRA 2FVPA 3DLBA 4K50A 5LT5A 2YNFA 2ZUGA 3CDUA 4WYLA 1IJFB 4ZVUB 5KFIA 4EEYA 2KDOA 2VV5A 3PKYA 2V4RA 3ENQA 2DNNA 3MD1A 4LRAA 2RDJA 3BO4A 3AJ1A 1SL2A 2PN6A 4WK3A 4N41A 5JJBA 5J1EA 2P6TA 2RDIA 1JLAA 3EXYA 3ZZTA 1T05B 3DLJA 1I1GA 5KFJA 3CC7S 2X1BA 5IV4A 4O4RA 3AOBA 2MB0B 2EK6A 1U1PA 1S0OA 3DXSX 1S72S 1FE0A 2ASYA 1JLQA 4OYXA 2C3PA 4CCHA 1O6XA 2ACMA 3NBPB 2QZ8A 4OZ5A 3T1HJ 2FJDB 2BE7D 3C16A 2MKIA 2XTJP 2QMWA 3MAAA 2BXJA 3RAQA 3FUYA 2QA4G 2AU0A 4NCGA 4WFBQ 1QSYA 1HYSB 2DR8A 1ZPWX 3SI8A 1V3RA 3ZZZA 2AYGA 2X51A 3DXBA 1FKOB 2EFVA 1WSRA 1MMLA 4PAAA 2RB7A 5KG7A 2XMJA 2UU9J 2ZD1A 2UU9F 3QRQA 4FYDA 4TVAB 4R8UA 3FRYA 3QMQA 3ISZA 4LUBA 3GJQB 3V2UC 5KFEA 2IVFB 5KFGA 5L39A 4IFVA 4J7CA 2QT7A 3DM2A 3K89A 1AXQA 3QZ7A 4KFBB 4PPDA 3W2VB 4I67A 2B5JB 2QE5A 4PXBA 4ZCIA 2LEAA 1Q8LA 2ZBPA 3FC9A 3O6QA 4RW4B 3SCIE 3JB9k 2C28A 5G0RA 1NK4A 1X7VA 4E2FB 1S99A 4QJVA 3LP1A 2KB2A 4PG5A 1HWIA 4GRSA 2MQQA 3MUVP 4NXNJ 4NXNF 2JEJA 4X4UA 1WI8A 1X4GA 1S0VA 4P10A 4X84A 3FMBA 3D1OA 3JYTA 2R2UA 3R97A 1V5VA 4PPZA 1YJUA 3R5JB 1LXNA 5KT7A 1OY9A 4B9UA 3LTOA 1RZMA 3UR3C 5CAAA 5IT4A 4JV1A 2JFDA 2JC1A 4NYPA 2UVWA 3KK3B 4C4WA 1S1TB 3P4UB 4YS2A 4ZPDA 1I94J 5IM0B 3CC2S 3EE3A 1I94F 3AH6A 3R3TA 4C11A 4ED6A 3T1YJ 1PBUA 2C2KB 3T1YF 1XR7A 4CLYA 3E01A 2EFGA 1C4CA 3IG1B 4AYBD 3KLHB 1FRJA 1N48A 2ZOMA 1RHKB 4FXDA 4NLGA 1YX2A 4CLSA 2I0XA 3QO9A 3VZHA 1IR2A 3AOCA 1HHSA 3TJ9A 2X1FA 4DSEA 4USIA 2JJ4D 2IAJA 5HL7Q 5KFWA 4NCBA 3N6MA 5BYRA 2ZZNA 5F9LA 2KXHA 5DQIA 1UA1A 3C19A 2ALYB 5LSOA 1Q8KA 3G8SA 1VYAA 3CULA 4ANCA 1H0HB 3F44A 1RTIA 2HZCA 5KFAA 1WG1A 3UDLA 3LO3A 4YEAA 3BO2A 4OI0A 2DY1A 3QRRA 4DCJB 2CNKB 1TL7A 2D74B 4QPTA 1RWKB 4MFBA 3AD8C 2HRTA 2DR9A 1JWWA 4ZCKA 4I7FA 4QQBA 5HBMB 4X4RA 5U47A 4ED1A 2CPXA 4TYAA 3W61A 5LM7E 4ZCLA 4DCPB 3H5YA 4Q0BA 4NCAA 4OI6A 2Y8YA 4ES3A 3KJVB 4R0EA 2YKMA 1XC9A 2ZNYA 3CMAS 4OYAA 4O3NA 4PXEA 3RYLA 1NJIT 3GE9A 3IS9B 3MMCB 1RT5B 4YN3B 3BQ1A 4JOUA 4ZDNA 3CEDA 1L3SA 1HBNA 1H38A 2B4VA 3FNNA 2EFNA 2F3JA 4N5SA 1X4FA 1YBUA 2ZD1B 1JLAB 3B8HA 1P6TA 2GHVC 2MKYA 3RB4A 2BR0A 2KN4A 5ETOA 1VQSA 4ERDA 3E01B 1SIZA 1VQPS 3EICA 5GAEU 2FVRA 1VC5A 4QR0A 3NBPA 1WDDA 3HHEA 2H3EB 1URRA 5FD1A 4Q43A 1BY9A 1CJKB 1Q4RA 3BSNA 4DSJA 4JV2A 1O5JA 4OHXA 4QYZK 4ZVOB 5ETKA 2V68A 4FKXA 1Y3KA 2DEIA 3ILJA 5KG0A 1X9SA 1RAIB 3U02A 4J9NA 1IUJA 3GIRA 3ETMA 3HHKA 3V6KA 5AXMA 4I2PA 4NLOA 3HK2A 3MXHP 2MEWA 3ITHB 3N5BA 4DPTA 2XGPA 2IDLA 1KQKA 5AJ3F 5E3PA 4C98A 4NRUA 4YR3A 3FFIA 3L09A 1U8WA 1Y3JA 3NWGA 3Q2SC 4QZVB 2WVBA 4YB5A 2W2QP 3ZZPA 3JYTB 1GTEA 4QWBA 1UZHA 1KC8T 3GJRB 3PX0A 4ZHRA 3HFZB 1RT3B 4W4MA 3KK1B 2XSFA 5IT9U 4Y2KA 4LSNA 2YX1A 3NCPA 1FXRA 1KTQA 1SJQA 5A0YB 1X5TA 1Y7PA 1FRIA 1NUEA 1X0PA 1A7GE 3DRSB 3G87A 3P5BP 1IWGA 3QT6A 4GVLA 1S10A 4DSKA 2XNRA 3BGLA 1PG5B 3PYEA 2DHSA 3BKTA 4MTPA 3W60A 3M30B 2X3DA 5CH7B 1LWXA 1IBMJ 1IBMF 4KKOA 1HKAA 4Q2MA 2VFUA 4ZPWR 2HHQA 2CJBA 5B0BA 4RNNA 1VK3A 4ZVHA 5H9FJ 3MUMP 1DARA 2XHCA 1C1BB 2OSQA 3HVRA 2Z0GA 4LVNP 4C0OC 2D3ZA 1F60B 3BN7A 4FN5A 3W66A 2QC3A 2MKKA 3V6HA 2J6UA 3KDOA 1VRTA 3MHYA 4WK1A 3OSNA 3HMJG 4FYVB 3IG1A 1L3VA 1RT3A 1FNMA 3DI6A 1IM6A 5KT3A 3GYNA 1CQMA 5KG4A 3JXOA 4I6YA 2AJFE 3QSIA 3T5HA 1RDRA 2LDYA 2XSJB 2DVIA 4RUHA 2Y9HA 2MLXA 4H4MB 4ZJOA 1DHMA 4P2FA 3MM7B 4HDGA 1NHUA 3KDNA 2JH3A 2MQ8A 3D68A 2FQQB 3BR8A 2MYFA 4C9DA 5THWA 2EC2A 3NNHA 4QWDA 2YWHA 4NE9C 3KLVA 2KT5A 2ZITA 1S6QB 3TZWA 3D6MB 3DDIA 3J7AN 4O4GA 3KUHA 3K5LA 4ALZA 1V6HA 3RTVA 2E7VA 2R42A 4O3SA 1R0CB 4I64A 2VOPA 5DDPC 2EBGA 1LWEA 2F7VA 4G1PA 4A46A 1ZA1B 2XYHB 3HI9A 3QFHA 3VAMA 2AEJA 1B3TA 1ACMB 3C6TB 5DDRC 3H4BA 1R31A 3AB4B 2BQ3A 4G3IA 1IQZA 1KVKA 2NYHA 1OSCA 3CIMA 3MCNA 4RLEA 3U1NA 2V4QA 1FWLA 1N0UA 4PG4A 3RRHA 4DR2J 4DR2F 1RTJA 3NAIA 1VQMS 1NO8A 3M05A 2PD1A 2D9PA 1WEYA 3QJPA 1HWKA 4ZLLA 1BD6A 1GNKA 4LR8A 5KOXA 4TY8A 3ZZ0A 3QJJA 3PM9A 2AJ4A 3C15A 3A3PB 3C16B 3IO1A 1KSPA 2KYZA 3MEDB 1HQEA 1NK5A 2QSWA 3ZZYA 1GMWA 2J8AA 4DUTA 5JUMA 3H8YA 5KG6A 2PDAA 3SQGB 3LP2B 4X4NA 1HI8A 2MDAA 4QBUA 3QT8A 3M1VA 2Y1LB 4ELVA 2DY9A 2LFVA 2BACA 4U7UK 3G6YA 3DHWC 4JV0A 4CLLA 5JVGQ 2BQUA 2FC8A 2Y0BB 1VCTA 1SUQA 1WC5A 2BM0A 4LSLB 3OFFA 2DNHA 4WFYA 2IRYA 2OPPB 4OZLA 3PJWA 4WXWA 4WCEQ 4N56A 3M9NB 4FS2A 2BZ2A 3CMES 1RKIA 4DR1J 3WBZA 5M2PA 2LXIA 3FCWA 3FRZA 3HX9A 4DR1F 1WUUA 1PYOB 2NPIA 4C0BA 1RTHA 1VFJA 5DZ7A 1T9XA 4Q7AA 1VISA 2QA4S 5CCLA 5BYQA 4OYPA 5DG8A 3MEGB 1X0FA 4B3OA 1FKPB 3FJ2A 1BWVA 1H6KX 4M5LA 2FY8A 2HS3A 2O01C 2OFHX 3CD5A 1FRXA 3CMQA 4MKAA 2V4JA 4ZP7A 2PMWA 3D9BA 8AT1B 1RWVB 3BEGB 4R0JA 5F8GA 3M8RA 8RUCA 4J9SA 2GV1A 4ECTA 1S6PA 1Q8IA 1I6JA 4M5NA 3OVAA 2M88A 2QEXS 4CWBA 2V8HA 4NLTA 1NPPA 3LP1B 5L1LA 1ZZNA 2KFZA 1FEHA 2OPRA 1MW7A 3BO3A 2K1RB 2A2CA 2QA2A 4KSEB 4Y2MA 2DISA 4F4ZA 4JBCA 2HG4A 3R6GB 4DDFA 3DDKA 4HT5A 3K5MA 2E5HA 2YNHA 3OL6A 4OJ1A 3THTA 1YI2S 1GEHA 2QLXA 1XEZA 3I31A 3ILOA 5KFKA 1LWEB 1Q81T 4RU2A 2E9ZA 4M8LA 2KKHA 4BS2A 3HZGA 3G6XA 4WU3A 3NMAA 1B4SA 5F8IA 2W7PA 3THVA 3C14B 5I3QA 4R5PA 4B9MA 1NK8A 1YRXA 2DNPA 2W01A 4AL5A 5D15A 2BBEA 3OPKA 2ZKUA 3POTB 4F67A 1K44A 4YDXA 2HQCA 2HBZB 1WOPA 3ZTQA 1YZ6A 4Z37A 3CDEA 1U26A 2CQ3A 3CJ3A 2ZKTA 1ZAXA 1H74A 2CQHA 4DEZA 3KUGA 2AJQA 1HI1A 2AIRB 3WIUA 2DJWA 2YNHB 4TU7A 3EYZA 4C48A 1EIYB 2M7SA 4JI3J 4JI3F 1N5SA 2YQ3A 3MTKA 4IUFA 4V19X 3L7OA 4P52A 3UDVA 1T8EA 2CPFA 3TQ1A 2GAHC 4WP3A 1D0EA 2FTRA 1TK0A 1RWNB 4NEYA 2FJWA 3P6YC 4GVBB 3V4IA 3K59A 2GJ2A 4UOHA 4F8RA 5KFCA 2B6AA 2ZM6F 2ZM6J 1X4AA 2HURA 2FJVA 1FWKA 2HGNA 1RA7A 5B0FA 5J2NA 4F2SA 4HH0A 4OYBA 2N7YA 3MF5A 3H5XA 4LF4F 4LF4J 3NNAA 2DNGA 4B02A 2HMIA 3B78A 3RR8A 1XERA 3LGHA 2E5LJ 3UO0A 1OY8A 2E5LF 4EO8A 1FFWB 3IXQA 2X1GA 1OQ6A 1FNOA 3FKBA 2XZDB 3PFOA 4HI1A 4RW8B 1GXLA 2M9KA 2Q6BA 3M2VA 5FDLA 4DBQA 4ZHRB 4U95A 2V8GA 2AD9A 2HS4A 5D0RA 4DX7A 2RQ4A 4CH0S 4DV2J 1WACA 4DV2F 1SVDA 2HVZA 3W2WB 2CJ9A 4G1QB 2AJ0A 1N32J 1N32F 2VG6B 3LP0B 3MUTP 3SV4A 1JLEA 4K0KJ 4F3QA 4K0KF 1F3FA 1MWYA 1T9VA 5IWAF 4GO7X 5IWAJ 4V19J 5D4OA 2F5GA 1F5BA 4CLZA 2IAJB 1MN9A 3GIIA 2IYGA 4M5JA 2D69A 1UWBB 2MY8A 4C7QA 4IH7A 4FF2A 1OIAA 2J5AA 1KTVA 4LT6A 5D0HA 1RHJB 2KU7A 1QUPA 3MTJA 4K4XA 5FJ4A 1CPZA 2VQEJ 4RBUA 2VQEF 4BHQA 1FDNA 2HVIA 5KFTA 1KP6A 4GVBA 1KBRA 2LQBA 3V4IB 1UP1A 1N88A 2E66A 1U0HA 3BGRA 4P7TA 4DZDA 1IBKF 1IBKJ 3AXMA 2I6WA 1ELOA 3TARA 4D3GA 3EPGA 3K57A 2VB6A 1QM9A 2R8JA 4HKQA 1UL3A 2J9DA 4K4TA 1AZSA 1R43A 3DLGA 3KLGB 4DR5J 4DR5F 2H4WB 4J91A 3QGHA 1QD1A 4ED0A 4WZMA 2BMBA 2I2YA 1FRMA 2DGWA 4ED4A 2EKNA 3CCZA 3R6LB 4I2QA 3ENWA 2BJ1A 1Q82T 3MEEB 3G6VA 4DL0C 1NK9A 3CCQS 2DIVA 4RU9A 1LW0B 3GV7B 2AQ4A 2B0GA 2OLWA 3R7SB 1NDCA 1S6QA 2OJ3A 3H25A 4JP8A 5T14A 3ADAC 3H40A 3G6ES 1T9YA 2OUGA 4UZCA 4G65A 3TVYA 1L3TA 1RCXB 5KFUA 1G6BA 1UCNA 2DB1A 1DBDA 2DH8A 4ZJQA 1NU4A 3UCUP 3X3UA 2WHOA 3ZTSA 2AGQA 4I68A 4XO0A 4A8KA 2CQGA 1WHVA 1QAYA 4NYOA 2CJYB 5HLFB 2HBYB 1NDPA 1RAAB 1SB6A 2AV5A 2GMLA 2OD4A 3KYLA 4CH1A 2LEBA 2WRMA 3KLFA 2DPJA 3HO1A 1S57A 2WTFA 3D0HE 4DPYA 2C3OA 3ZNJ1 1XIQA 2R3VA 2ERRA 4PWWA 5GMEA 4BWJA 3T9NA 1U1OA 1SJ4P 2HRYA 2QO3A 4DZ6A 5GADU 2XMMA 3HSJA 2MLYA 4DG1B 4OMFG 2FYXA 1LK7A 1WG4A 1RSCA 1VIOA 2BJ3A 2HFUA 3G2XA 4Y34A 1K0VA 4A8YA 4S0MA 2XWYA 3DGPA 3C6TA 3UDCA 5KG5A 3NRBA 3TANA 4LFCJ 4LFCF 2CQBA 4K2XA 3CJ8A 2W9AA 2CFXA 2YNIA 4B08A 3PJ9A 1FDBA 4OX9F 4OX9J 1JJHA 1HMVA 1YRTA 3GFHA 4CT9A 5KFHA 4U8YA 4ZP9A 4RNOA 4ETXA 1OYDA 3MAHA 3CUNA 4MIBA 2QN6B 2E1CA 1S0NA 1NCLA 3D7SB 5EUHA 3I0SA 1UAWA 1YRUA 1JLCA 2PA3A 3HM9A 4EZ9A 1RJJA 2W24A 1M1KT 1U6BA 2OP5A 1R6YA 3CD6S 4DU7A 2MJUA 2PA8D 3TZYA 1S1VA 5HO4A 2M8DB 1LFWA 1WDTA 2KZZA 3GQCA 5HVHA 2R7TA 1WF0A 4HVZA 1SUQB 3VAJA 2F1FA 3QFWA 1RT7B 4RL1A 3ZO7A 3DGPB 5KFDA 1FRLA 3AOAA 1VRUB 2HVDA 4NLDA 4C8ZA 2VG5B 2YWKA 3A4TA 2B8QA 5B0EA 2AYBA 2HHWA 1U1RA 1RBAA 3D4JA 1OMSA 3G71S 2IM0A 5A6PA 2A18A 3S01A 3WDOA 4M5HA 4DX6A 4AL6A 3QAEA 3QGGA 2FGCA 4IH5A 4MK9A 5K5MA 1T05A 3MR5A 4MMOA 3RZAA 1S9EA 2V2VA 1XBWA 3IAS9 5I42A 3DU6A 2EW9A 4PZVA 1ZH5A 1IKVA 1QAXA 2RQKA 3JSYA 2GFFA 4ZVFA 4IRKA 1TELA 2Q66A 1JLFA 1HNIB 5KFOA 3LH2S 3LOUA 4LREA 3TJ8A 3MD3A 4BC7A 2R4FA 2LYVA 5F8HA 5HI7A 3PZPA 2NXEA 3CO0P 1YGYA 3LPYA 1TVRA 3TX0A 4IOBA 5HSPA 3KK1A 3OXGA 1VQYA 3W8GA 3B4MA 1WI6A 4ZVQB 2QGFB 3VQTA 5FLXU 1NSPA 5J2NB 4ZJLA 1JXEA 4U8VA 1R0BG 1T0TV 2QL5B 2XULA 3ULHA 2RUSA 3MDFA 1S9FA 4TKTA 1BQNB 5AXNA 1CJTB 3G4SS 1F9FA 2IM2A 2V0NA 1Q5VA 2WVDA 3I32A 1NXIA 4DPXA 2GJIA 4KAIA 5HATA 1TUVA 3QNWB 4FKYA 2R9LA 5IT9Y 2ZBQA 4TLRA 5DJBA 3RUBL 3WQPA 2HZVA 2UVVA 5C25B 1HW9A 4EBEA 1JIHA 1S5ZA 2C3YA 4PYAA 1QDUB 4NYZA 4J9KA 5MLCV 2ZWPA 4NI2A 4K4WA 5M2RA 1HQ2A 4AD6A 3J81j 3O3LA 3FQKA 4NMLA 1PJ7A 2DR6A 1GMUA 1JNZB 4RW7B 6AT1B 1NKCA 4HTJA 4F3OA 4F04B 5DLGA 2HEKA 2I5JA 3AAWB 3MM9B 2H5EA 1VK8A 2JNJA 4O44A 4BWMA 3CB4A 4TXSA 2DRBA 3TVZA 2GNKA 4ELUA 4WBFA 1V9OA 3LGMA 4M5DA 3D66A 3M8PB 3CCSS 3EGZA 3DOKA 2P9EA 3EUNA 2AZ1A 1F6TA 4NWBA 3PXGa 2MZSA 5KG1A 1HD1A 3I5AA 4ZLNA 2ZHAA 3RAXA 2FLLA 1TKTA 5DQHA 3C2PA 2R8IA 3OLBA 4C8YA 1GMWD 2PMHA 1HYSA 2D3O1 1O8BA 3T6JA 3IWXA 1D9AA 3PG9A 1FDDA 1IKXA 4L75A 1KFSA 3OTBA 2VPYB 4I69A 3MR2A 3RB0A 1NJYA 2VFSA 5A2QU 3N6LA 4XK8C 3AB2B 4O3PA 1HARA 1IWAA 3OL7A 4QIGA 2VPXB 4A8MP 4KHRA 1VC0A 3P8BB 1IVZA 2HQIA 3DFEA 3EGWB 4FNIA 5LJ3Y 1YBTA 2CDRB 4RW8A 4X64F 3OR2B 4X64J 2MZTA 5IC6B 4WP8A 4DS5A 1ZETA 2XCPA 3J81U 4ZOSA 3TUPA 2YNGA 1SJ3P 5D3GA 2P9GA 3TVKA 4PUOA 3PY8A 1C0UB 1N6QB 2J6SA 1SQGA 4RX6A 2Z2LA 3AXKA 3MWBA 2DXDA 2Y0SD 1VQOS 1UVMA 4NASA 2HVHA 2DNQA 3GP9A 3M6UA 2FUG9 4NA2A 3C3LA 4OQJA 3W5YA 1EJ7L 2YWFA 3UN3A 5F8LA 1B99A 2A0FB 4EK2A 4ZLJA 1MU2B 2MPUA 2RS8A 4F0KA 2Z57B 1S7IA 3MFIA 3ENAA 4NL5A 1NZAA 2FVCA 4X65J 4X65F 3JTOA 4ZVSB 4KQZA 3CD7A 4TU8A 1HLWA 4AL7A 4M94A 1YWXA 3NGSA 3ZTRA 4F0HA 2EXUA 4ECXA 1UW4A 2DGSA 5ITHA 3AFGA 4RWXA 1U0HB 5AXLA 2M2BA 4CI0B 3EX7B 1XNQF 1XNQJ 5C24A 2FLPA 2IM1A 3JSMA 1M5HA 2V8PA 1AUSL 3GB0A 1FKAF 1EP4B 2KVIA 2DGOA 3W1YC 3U7JA 2ROEA 2HNDB 1BQMB 1EARA 3GR0A 1BHNA 4OV1A 5CYMA 1ICEB 2XO7A 3V6DB 2GIQA 2FLNA 2V5HG 4OZ0A 1X4DA 3C15B 3GV8B 4OJHA 4KB7A 1M5KC 1CS4B 4M5IA 3HF5A 2HRUA 2HHTA 1FX2A 5CCMA 4DV5J 2HFNA 4OHZA 4DV5F 4O3RA 1B0PA 2KHCA 1HNWF 1HNWJ 3I9ZA 1S4FA 3VAIA 2YPZA 4KR0B 2ZH4A 3FQLA 2HMIB 3FEYB 2ZHBA 1RTJB 2WOMA 1Q16B 1UMJA 4WFNQ 3KJFB 4IO1A 5B0GA 1PILA 2F65A 2J7UA 2YKNA 2VFVA 1MN7A 4X4VA 2CXEA 3OW2R 1OSDA 2FHKA 4QOTA 2B9WA 4U9RA 2RIJA 4L73A 2KJWA 5L8RC 2G13A 4LQ9A 1B64A 3PIOQ 1KD1T 2Q43A 3PR4A 2D3OR 2VDHA 2BVZA 2YKPA 1WHXA 5HVFA 4RBVA 1QE1A 4WXOA 3CXCR 1HIYA 2YXLA 2BRLA 3HHLD 3K58A 4ED2A 2JZ5A 3Q0AA 1SV5A 2W25A 1LEOA 5DETA 5IXUA 1BUXA 5EWGA 3Q8SB 1UFKA 4PXCA 5CD4H 2KFYA 2VUGA 3IR5B 4H4MA 4J9QA 2VJVA 4MH8A 2O3DA 1ULRA 2L41A 4FBUA 4N77A 4DS4A 4UUXA 1RACB 2MZQA 2Z2YB 4M1KA 4ZPAA 5DS7A 1VBYA 3M8QA 3UVJB 5KFYA 2CYYA 2ZH8A 3CIZA 1RGVA 4ILMA 3FBCA 4LFBJ 1ZPVA 3DN9A 3IR7B 4GMKA 5E5NA 4JV5F 1WD6A 3CJRA 4JV5J 2M8HA 4F4YA 2HFOA 2FB0A 3B82A 1CJVA 1D8ZA 2PEBA 1NNDA 3KKFA 2HKEA 2G0IA 2NCKL 1TL5A 3AA9A 1TFYA 2CADA 3MMJA 5KFRA 5DGBA 1EQMA 2CQ4A 3K5OA 1ZZFA 4ZVEA 2FY1A 3K7RA 3BGOP 5H9EK 2BOAA 1N8RT 3DRRB 4OHWA 2Y8WA 2WSCC 2F4VF 2KRRA 2DHHA 3M4XA 2F4VJ 3E8OA 2F8HA 1OWXA 5J1NA 3EPIA 2AGPA 4A8FA 2HQ3A 2EK1A 2OKQA 4X4TA 1U25A 1TUWA 5KAKA 2L9WA 3JTPA 2DH9A 2LXUA 3Q8RB 3T5JA 4KC5A 4KO0A 4KHPF 4KHPJ 4UY8T 4DF4A 2QRRA 2X1AA 4IG3A 5B08A 1RE1B 3NOCA 2R7UA 5M2UA 4OJGA 2F9JA 3G8TA 3ILLA 4NZ7A 5EX0A 2W2MP 3NLCA 3D0GE 1IQTA 4KGKA 4DPWA 1PIEA 2DHAA 2HLUA 5FDLB 2ZH2A 1VQNS 3J80Y 1FFSB 2CQ0A 4YB1P 4L74A 5ETLA 3CDWA 4P74A 4YOEA 1E6YB 3BH7B 3AT1B 3EVOA 3PW0A 3OFEA 4N8NA 4TY9A 4CO4A 1SIWB 2WOMB 4LIRA 2YPYA 4B17A 1W26A 1F9HA 1FTCA 3TR5A 4PG6A 2NQPA 1N6QA 1Y5NB 3CPWR 2LVWA 1NDKA 3JAMY 2KI2A 2ATLA 3OSPA 2P6SA 4GKJF 4RUCA 2XI3A 4OZ2A 1N52B 1M5OC 3M8ZA 1PJ6A 5C2CA 3KHHA 2RRAA 1SJRA 4EYHB 1RAFB 2DNYA 5EN1A 4YR2A 3A8EA 1DQ8A 1U1NA 2HQGA 1SC4B 4CLKA 3L9ZA 1HD0A 2GMHA 3OUYA 2IIHA 2VHGA 1YJTA 2YQ0A 3M32A 1K1QA 3FZBA 5CD4A 1F2HA 3BREA 1K8AT 2CUYA 4BCAA 5E3AA 4Q8EA 1KQFB 1TK8A 2ZBIA 5C2GA 3C66A 4CO2A 5L1KA 3R9LA 1VJWA 1HBOB 2MQOA 3K5NA 4TY8B 3PFEA 3H0PA 4ILLA 4B9LA 3VF0B 1MU2A 1VLOA 3T1HF 5HMXA 5KFLA 2PC6A 1WSVA 2B3TB 2GA7A 2H65B 2I5JB 2PGCA 1PCAA 3GG1A 4I1TA 4FBTA 2WK4A 4KE5A 1YVFA 2CQDA 3IRXA 1V5IB 3AJ2A 1HHQA 1Y0HA 2UZAA 2I1RA 2OFGX 4ED8A 2R8GA 3NGDA 2EFPA 3ETOA 4Z7CA 1E6VB 4O3QA 1YIJS 5HANA 4DV6F 4DV6J 4K4UA 4DL3A 1SL0A 3I55S 3OR2A 1JLGA 1TL1B 2ACYA 2VBYA 1FEEA 1IJEB 2QYGA 3AQOA 3DGVA 3PYGA 4ZITA 3DRYA 3CDBA 3CO9A 2GW8A 3MM7A 4ID5B 4IG3B 3OL9A 3UE2A 1IKXB 1RP5A 2VC1A 2MZRA 4WFAQ 3OTOJ 3OTOF 1A9NB 4UOFA 4JI8F 4JI8J 3UI3A 1L3UA 5KFSA 2AKWB 2ZH5A 4ED5A 1Y4ZB 3CF5Q 2G2OA 1VBKA 4U96A 5K9FA 3ISNC 5AE1A 5E7OB 1VQ8S 4YQWA 4DR6F 1Q1KA 3I5CA 4DR6J 4F3MA 4NA1A 2MMYA 4HDHA 5HMYA 3OBIA 4ECZA 2I38A 5CHCB 3Q86A 2LEPA 4EZ6A 4DFPA 2CNNB 4WJBA 2XM3A 1JJ4A 2HLTA 2FLOA 2YNGB 4HHHA 5J1PA 5D3GB 3HHNB 5BYSA 3TZXA 1P27B 4DF8A 1ITPA 4A47A 1S76D 2GVDA 2DXEA 2Z30B 3H42A 1PYTA 4WIIA 3UFCX 4OYIA 4CLFA 2XQCA 3CCRS 4R8UB 3OFHA 2QTWA 1WC6A 2EI5A 2K7JA 2HHSA 2HQFA 2WW8A 5CZVA 3W5XA 4DR4F 1P8GA 2G2YA 5D78A 3RJMB 2J0SD 4EYIB 3LWMA 2V67A 3GILA 1M5PC 4KJIA 2PMZD 1U1QA 5G4DA 4F36A 1K73T 2WB1D 2Y1RI 1JB0C 2VZ9A 4UQTA 4RW9B 1B0VA 2LKZA 2XMVA 3KHGA 1D9DA 3PKMA 3M2UB 4KGZB 1RT6B 5AE3A 2ILZA 3N0VA 1NSAA 3MPUB 2A10A 1QJHA 3PX6A 2CZ9A 3T3FA 1Y10A 2CIMA 3P96A 3TX8A 4ECRA 4WWSA 4JYAF 1NB2A 3SFGA 3HZEA 3LW5C 4JYAJ 1VJQA 1IM4A 4L3NA 2ZE2B 2JEGA 1EQ0A 4IDKA 4P9SA 2C1EB 4ILRA 4CTAB 1VOMA 2PEHA 3DI6B 5CYJA 1LK5A 2CPHA 4PRFA 2RU9A 3I96A 2V6AA 4RUBA 1U48A 4LBPA 1JXVA 2GS8A 2OIHA 3MZIA 2IMOA 2O67A 1BWEA 2GGPA 4LR9A 2KH9A 2BX6A 3UPFA 1ZOTA 1T03B 1E6VA 2CWKA 1UWAA 2QV6A 3GZ7A 4PEOA 4OZJA 5CYQB 4UT4A 3VQSA 2Q3PA 4OX6A 3HKWA 5J2QB 4NPOA 3NMRA 3F41A 2EWHA 2NXUA 3DOMA 1KLMB 2BE9B 3W62A 4ZN1A 3C46A 3Q23A 2DHXA 4J90A 3DHXA 3DRXA 3MGJA 3CVKA 4O23A 3H59A 3MMBB 2UV8G 5IQQA 4ICLA 3VCDA 3CCMS 3ET6A 4OHYA 1BC6A 3I4HX 4RZRA 4FVCA 1OPZA 3ZFVA 4UOCA 4DN0A 5KFPA 4KGXB 1J27A 2P5VA 2M3DA 1TL7B 2C42A 2CPJA 4KHMA 1KDNA 2JOQA 3S7RA 2QMXA 1U2RA 1KWMA 3RRKA 3KLHA 1KN6A 2MZJA 2KO1A 4I7FB 3UW1A 3W2VA 5EWEA 5GAHU 1TZ0A 4Q8FA 2HW3A 3WZ0A 4QIEA 4ELTA 1JLFB 1RHMB 2BABA 3EZ5A 3MPDA 1GTHA 2LLZA 4F2RA 3I0RA 3OV7A 3RBDA 5GMDA 5E0OA 3QWPA 3MM6A 3L4BC 3OL8A 3Q8PB 4LF7F 4LF7J 2ZBCA 4ECYA 2EFOA 2HGMA 2APOA 3O1LA 1Q78A 2IM3A 1KLMA 1V3ZA 1RLCL 1AW0A 2G2ZA 3UNGC 4C8LA 2HWTA 1RCOB 2V2ZA 5HAOA 5F3ZA 4J9OA 4DV3J 4DV3F 1S1TA 5LMNJ 3KLIA 5LMNF 3TWZA 2ZJRQ 4CIOA 3PV8A 4AUKA 4F26A 5ADZA 3I6PA 3VTIA 2W4PA 2YNIB 1TV6A 5GADI 2YBVA 4NZ0A 2Q1LA 1Y00A 1XMBA 3CSKA 3QZ8A 4ZVGA 3KOAA 2OMOA 3GIKA 1U47A 3BM7A 2FPHX 2XY6A 2DGQA 1CJUB 2RHSB 2WONB 3BBFA 2MQPA 5AXKA 1W2BR 1UVJA 3KHRA 4C3MA 1G3OA 3MECA 2LECA 1N36J 1N36F 5KFBA 2F4FA 1JK9B 4LRFA 2W7AA 1D9FA 2V9KA 1SC3B 2Z4PA 2E1AA 3BSOA 1H7WA 2MQNA 4H54A 1RT6A 4WZQA 3DRSA 2VA3A 2XY7A 4J9VA 4A8OA 3OJUA 3UCZP 3UR0A 2YKQA 1HWUA 3W7BA 4QR1A 1SC1B 1Q53A 2N82B 3MOJB 2ZHOA 1RT7A 3FK4A 2KFNA 3N28A 2O1PA 1VLYA 1Z2LA 3B4DA 2XCAA 4OI2A 5E3QA 5IQ6A 2H5JB 2MJNA 5HLFA 4NCGB 1XN9A 1UZDA 2IY5B 1WC1A 1FKOA 3IC1A 4A4JA 4W98A 3JSMB 1MMNA 2YX4A 4NLWA 3VR1A 4C2MA 4UZBA 3KTQA 2UVRA 3KUEA 3UVJA 4AQYF 4AQYJ 3V6JA 1OO0B 3D3BJ 5SZTA 1EZZB 2H51B 2R7SA 2Q79A 1IKYA 3D1HA 3HSGA 1PGZA 1UEUA 3NCRA 2GAGC 2B4PA 1SKRA 5HN0A 3KK2B 2HWHA 2HK3A 1CC8A 3NG8A 1NHVA 1GMVA 1KNZA 1KRPA 2OEKA 1K9MT 5L9NA 1CQNA 2DH7A 3JAMU 4B9VA 3VVUA 4NX9A 1YJRA 2ZFHA 3G96A 3L7UA 1RBLA 5CZXA 1AFJA 1FF2A 2FHOB 2DCUB 2DR5A 1Y5IB 2Z8QA 8ATCB 1F5AA 2LA4A 3IAM9 5L1IA 1YITS 1JLGB 1TL1A 4J9UE 4KGMA 3MURP 3RR7A 3H2UB 2VBWA 3RU0A 3O8WA 4RUAA 3QGIA 3PRDA 3WC0A 4KRWA 1RADB 3MM5A 1VIXA 3A8IA 2UV8A 3P3DA 3RRGA 3N5FA 3C8YA 3LF0A 2LA6A 5K20B 5T7LA 4Y2IA 2E5JA 4J9RA 1K1SA 1RWPB 1U24A 2HAIA 2PIIA 4C3KA 1MG7A 1ZTTA 3GJTB 1Q79A 2Z2MA 3AY0A 2RDDA 1DTQB 4HACB 4PG8A 4WKRA 4NLRA 1T3OA 2DO0A 3RB6A 1X60A 1ROFA 1J5EJ 1J5EF 1KR4A 1RUSA 3PYFA 2DK2A 3LGNA 2DRDA 1MWZA 3H2LA 3ET6B 4QIWD 4K4VA 2HK2A 5K8NA 5DM6Q 3HULA 1CSJA 2U1AA 1UJ4A 3RBXA 3M8QB 1DY3A 3CE8A 4O0NA 4U67Q 1SKSA 4NLXA 5I4MA 4USUA 2EG2A 2MLZA 3Q8YA 2HS0A 3W2WA 5CYQA 3AQPA 3VGUA 3SZ2A 4K5RA 5B7WA 5I3UA 1YJ9S 2DT9A 3HHLB 3JQJA 3VAGA 2EG1A 4EBDA 2DIUA 4DXLA 2M70A 2JVRA 3D1QA 4MJKA 3UD4P 1S1UB 2D7SA 2NZCA 4DN9A 2BM1A 3KHLA 1GFWB 4DQQA 4MYTA 1HA1A 3KLGA 1JXLA 5IFMA 1FXLA 1TU0B 3AD9C 2ZH7A 3DRPA 3GSIA 4LQ3A 3HJVA 4KYZA 1SV5B 1UPMB 1X5SA 2YKNB 2XO6A 1REVB 4LF6J 4LF6F 4DL2A 1KKHA 2KTQA 1NM2A 4E8UA 1APSA 2K2PA 3OQ2A 4DOZA 2CJKA 1GK8A 1YLXA 2E29A 3H7HB 3IGVA 3NGRA 1CVJA 3V5RA 2R7RA 4I0WA 3TEGA 4QW9A 3MMAA 4FXWA 3TAMA 1T3NA 2R2SA 1LWFA 4W90B 2ZBRA 1I3OB 3HPOA 4Y28C 4X2BA 4IRCA 4BLGA 3TI0A 2H48B 1DFDA 4YY3J 4YY3F 5CA5A 2W9BB 1IR1A 1NLKL 3QQCD 5IOLA 5D77A 4ZPCA 2ZZMA 5C7PA 3CJSA 3LAKA 3GPAA 1T02A 2EVZA 2MKSA 2AX0A 2G1HA 2XG8A 3R7NB 5HQMA 3H5UA 1F0XA 2NUUG 1JNRB 1M5SA 1YJ7A 2VG7A 2HBQB 3EDQB 5FIIA 4DMZA 5GAGU 5LXRA 2IA6A 4ER8A 4W92B 2DITA 2UVUA 3IGNA 1VR6A 1FO1A 1ZM4A 1SQFA 1SQEA 2ZH3A 3QT7A 2YWGA 4J9MA 2LQ9A 3M7VA 9RUBA 3CD0A 3TA0A 5HVGA 4DSIA 1LWCA 4CRJA 2ZZTA 1JLBA 2R7WA 3PW2A 3BS9A 1AT1B 2IMWP 3J7YU 1TMMA 4X4QA 2QLFB 3MM5B 1T94A 1RKJA 4LJMA 1LWFB 1AA1B 3HVAA 1C4AA 1NRKA 3MM8A 4OZ3A 4C8NA 4QU6A 2LCWA 3B6BA 4ZLPA 5KOWA 1CJKA 2J76E 2R2TA 3BQ2A 2BJ9A 1U0SA 4LR7A 1ZS6A 4ATNA 4AE5A 4CP5A 5BJRA 5K14B 5IZHA 2AMCB 1TAQA 2CDQA 2EBEA 3J7YI 1TK5A 4IH6A 2CG4A 2RF2A 2CNLB 2RVJA 2W1BA 3O2IA 4ZK7M 2FZKB 4QWCA 1WC0A 2MKHA 1M0SA 3QPIA 4KO0B 4XIUA 4KBIA 1B7YB 5KG2A 2CJAA 1FNXH 3W9HA 3AHPA 2K3IA 1WKKA 3F73A 4JI7F 4OI1A 4OZ1A 2G9OA 3I0RB 5L9XA 4ZMMA 3EM1A 5D0EA 2GHPA 3TZZA 1C1CB 1ZAVA 2OELA 3PRBA 7FD1A 1B7FA 4IFYB 2CJQA 3MEGA 2HAFA 1H2UX 1FK9A 3UCGA 1T9TA 4AT1B 2XLJA 4I6AA 4FNHA 4HHJA 1EETA 2W9CA 1XJWB 2C2EA 4HH1A 4J5OA 3T6BA 4PG7A 3BQ0A 3DMJA 2IRUA 4HHUA 4LVOP 2J9CA 3LQVA 5ETQA 3M2VB 4FYXB 3GYXB 1A6LA 4NRTA 3QATA 1VBZA 3G9CA 1Y11A 2HFSA 1X8DA 2ASDA 1UVLA 2AW0A 3KG1A 2GJFA 5J2QA 1U6FA 3DLEB 2MXYA 2YH0A 4RW7A 4PR6A 3D0IE 3TEHB 1KHWA 2QJ3A 4WYWA 4BDPA 2E7XA 2GVZA 2XEXA 3EVMA 1XTZA 2C2MB 1RTHB 3SSRA 3OJSA 2DGVA 1S9GB 3G82B 1DAXA 2VPWB 2E1RA 2E44A 3PEJA 5EDWA 5F8NA 4EBCA 5DGAA 1EKRA 1TL3A 2ASLA 5L1JA 2OHDA 2RHQB 2E1MC 2IBKA 4RW6B 4RNHA 1EAYC 1SCJB 2BUNA 1B70B 4QR2A 4UQGA 2JHEA 3KK2A 1AZSB 3DLGB 1HQUB 1S0MA 4LSZB 5CABA 5IV3A 1WEZA 3Q22A 4J9PA 1S1UA 3KG4A 4B3MF 3I9V9 2MSSA 2UXCF 3BGRB 2UXCJ 1Z4UA 2DHGA 5D4LA 3OVSA 2PFDA 2UUWA 4Y0FA 3BSCA 2XS5A 4MKBA 2D41A 2GVZB 2J0XA 1BE4A 2KXNB 5ETSA 4USVA 5B0DA 4Z7YA 2PI4A 2NYIA 1VQ7S 1LKZA 2CVIA 2DGUA 2FJAB 1MNEA 4K8RA 3R5AA 3ZZOA 4DJBA 2KG0A 3D5MA 4ECVA 1BGXT 3M1VB 1W25A 3J7Z5 1QUVA 5LSRA 3M30A 4JI1F 4M63A 4JI1J 3EZUA 3NXZA 4K4SA 4Q2LA 2BW2A 4Y65A 4WP9A 3VAFA 1RQ0A 4WE1A 4OL8A 2EEYA 4M95A 2MSTA 1TKTB 2KRBA 4MFBB 1H72C 3KLFB 4NLUA 3IRWP 4Y6IA 4E0DA 2HBRB 1C1BA 3IWLA 4DSLA 3D54A 5D4NA 3DKDA 4RPFA 2CQIA 4PCQA 1U1KA 1GT8A 2MKCA 1CS4A 4XDCA 3QGPA 2FIUA 1Q95G 3MCOA 2P9CA 3WC2A 4AFFA 3DOMB 3MR7A 4XAKA 2FJEB 4CO3A 4CDIA 4A8SA 5J2PA 3TUJC 3IN5A 3FEXB 1S97A
chains in the Genus database with same CATH topology
2W4DA 2NS1B 3QO9B 2NR0A 4HEA9 2YNFB 2MQLA 1SL1A 2BJEA 3FEZA 2RT3A 1S6OA 2FHMA 5LMUF 5HROA 1KQSR 1S77D 1IN0A 3GSDA 2M52A 1G2EA 4KV8B 3U27A 3M6VA 4QCLA 3N79A 3SCJE 3EGNA 3IRXB 1KVIA 4QYRA 3U1LA 4AXIA 3Q2TC 2B51A 1AUDA 4G1IA 2DGTA 4C8MA 1FVSA 3TW0A 4Y3CA 3X1LB 1H7XA 1HNVB 2CPEA 4H4OA 2RRNA 5IT0A 3JTNA 4TLQA 3FGVA 1D3WA 3NKYA 5KT6A 2VKRA 3BDEA 4F25A 3TAPA 2J6TA 3HVTA 3MMBA 3N9UC 1WTFA 2JL9A 1HNZF 5KT2A 1GX6A 5CYMB 3V6DA 3NL0A 1U4BA 4RNFA 2J0WA 1HR0F 3H4DA 4JI4F 2KM8B 1YG0A 5I42B 2HHVA 3GR1A 4ECUA 1GAOA 2GQ2A 1TL4A 2IJNA 3OXLA 2YKMB 4WFZA 3CJKA 4DR3F 5D8HB 1WEXA 5HROB 2HHUA 3T5LA 4QU7A 3NCQA 1RT4A 2C2DA 1O0PA 1TQLA 5KT4A 1Q8BA 2HNYA 2ZC4A 4WKYA 4FS1A 2OTJS 1HFEL 4ZKAA 5A8WA 4F4KA 3CCUS 3KWMA 3CJ2A 3RW6A 3SYZA 3TYTA 3K0JA 2F40A 2XSJA 1RYSA 1UJ5A 4ECQA 4DQRA 2JRSA 1R8CA 5GAGI 4XPCA 3L95X 2RNEA 5KFFA 1IKYB 3FVYA 2MY7A 3UWTA 4I56A 1N0VC 1RWUA 5K8PA 2KXFA 2WBMA 3CJKB 2KG1A 2DO4A 2N3OA 5GAHI 1U8SA 3L3CA 2ADBA 1SXLA 4DWIA 1WF1A 3DLEA 6FD1A 2GIRA 1VQ6S 3OR1A 4IOAQ 1RTIB 3R27A 2ZH1A 3SV3A 2V2KA 1MMDA 3BZQA 2CQCA 1T7PA 1FESA 1D8YA 2DR7A 4NZ6A 2KM8C 2HVHA 2UUCF 2AJ1A 3QWUA 4FXVA 2QSFA 4GC7A 1MSWD 4OIXA 2CPDA 2ZJPQ 1SH2A 5F3TA 2RUGA 1U49A 3I87A 2D9OA 5KFQA 4PQAA 4YB7A 1S48A 4ZA1A 2HHXA 3I4PA 3HLUA 2VASA 2KHDA 1TR0A 3I82A 2HHPA 3M8QB 3M32B 1S49A 2WONA 2VG5A 3PNIA 4RW4A 3PIOQ 1VQ9S 4DUYF 3MECB 4WFAQ 2GMJA 3D28A 3SFUA 4CQ1A 3H5SA 4YQWA 2NSBA 1S1WB 4CZCA 4GKJF 4B3MF 4CO1A 1S6UA 1C1CA 3PJXA 1FRHA 5DO2A 2J7KA 3MPVA 3ZZUA 1XK8A 4OHVA 2QYCA 2CQ2A 3H2VE 3ICLA 4C0HA 2CZ4A 2OSRA 5B0CA 4DX8H 3I0SB 3QLHB 1C0TA 5EWFA 2VODA 1RA6A 3BN4A 3RB3A 3BGUA 4IQXA 2RKIB 3SSQA 1LW0A 1R0AA 3M2UA 4IRDA 2YTCA 1RAJA 2W4CA 5J2PB 2AP6A 3NNCA 4Q45A 1U7LA 2BQRA 2HWIA 4MIWA 1KHVA 3MM6B 1WHYA 1X4HA 2A3JA 4PWUA 2ZE2A 3K8VA 4N47A 2FD2A 4CTAA 5GAEI 1V3SA 4ID5A 2FVSA 3WX4A 1LW2A 4UUWA 1J5OA 2JEIA 2ZNZA 1S9GA 2JLGA 3OTEA 3KMQA 2L3MA 4Q44A 2VPZB 3PACA 1HW8A 2G1DA 2F8MA 3H20A 5HMWA 1WNEA 4B3SF 1T95A 3RAMA 3HT3A 4LFAF 2ZJQQ 4EGLA 1VRUA 1UETA 5DM7Q 4FF3A 4LF8F 1SI9A 4ED7A 1U09A 3HDSA 4I6WA 3CJ5A 2B4UA 1NK7A 1G1XA 1NK0A 3MEDA 2YH1A 3MMAB 2KT3A 4G6VB 2PI5A 1FVQA 4ZCMA 1IXKA 1HBOA 4K59A 4KV8A 4NOHA 4IR1A 1UA0A 3Q24A 2XLKA 2ROGA 3G8QA 5KFXA 1N5YB 1BLUA 3FMWA 4WE1B 2BE2A 3DYAB 4JI0F 4CNZA 3R1HA 4DV0F 1VC6A 1JMTA 4ITSA 5H9EJ 2QA1A 5F9NA 2AF6A 5J2MB 2CVEA 4C3LA 1JLQB 5C42A 5A2QY 2FHJD 4JI7F 1OQ3A 1FT8A 5FLXY 1URNA 4URQU 1NB7A 3M6XA 4IO9Q 2K1RA 4N76A 2RILA 3OTDA 3D2WA 2B6AB 1F2GA 5HQ8A 1JLCB 4O4GB 2HNYB 4XDDA 1TP7A 2DNRA 2CPYA 5A8WB 3OHBA 2ZH6A 1DQAA 2N3LA 4USJC 5E3RA 1IKWA 1CG2A 2L9DA 2ZOFA 3MM8B 1DJ0A 4IYQA 4RW9A 1GQEA 4OLPA 1N5TA 1NH7A 2MHNA 3CT9A 2OPSB 4H4KC 3S8SA 3VZIA 3L7PA 1KOOA 3LWLA 3DLKB 3KLEA 1NKBA 4DUZF 2DNMA 2FGOA 2EKYA 4JI5F 2XY5A 3GIJA 3GFYA 3MR6A 5DLFA 1N5YA 3TP2A 2XS7A 3OTCA 4OI4A 4CNYA 3T5KA 3PW5A 2DPIA 3M8SA 4MK7A 1TKXB 2ZVSA 2JX2A 3J7A1 1R89A 3BF4A 1N4LA 1H2TZ 3NS6A 2E9RX 2KFZA 3DC2A 3TA2A 3MM9A 3T1AA 4E98A 3RBEA 4K4ZA 1SC6A 2W9CB 2DNLA 1JX4A 1QY7A 5MAOA 2CQ1A 3CDAA 3J7ZT 4DL6A 1YJNS 1P9QC 3PHEA 3SDEB 5F0WA 3TAMB 2OPSA 4WF9Q 2E5IA 3TAQA 4YFUA 4ID8A 3MFHA 4DQSA 4C8KA 2E7WA 2KJVA 4PQUA 1LW2B 2MHEA 4L72B 1KEKA 2X3GA 1J5OB 2IHR1 2IVMA 1VHFA 5JXSA 3THPA 1U1LA 2OPRB 4QYZJ 1ZBTA 2ALZA 1MROB 1QE1B 3IA0A 4JI6F 4FPRA 1FJGF 3BGFA 4AXJA 2JDJA 4JI2F 1HMVB 2RMLA 1YQHA 1S1XA 4ZPVR 3OLAA 1R0AB 1YBAA 4PUOB 2BA9A 4A8QA 2VOOA 3NS5A 5A8RB 2RE1A 1N34F 3UQSA 3TUZC 3M9MB 1ZM2A 5C5JA 2ADCA 3N6NA 3PDNA 4O0IA 1X4CA 3QIPB 1KONA 4JUZA 2RSQA 2HNDA 1UFWA 3M2RB 4DL4A 2IRXA 3OUYB 1FHTA 4IKAA 2FC9A 2BANA 1VQ4S 2VFTA 3QJLA 4H4KA 4NLQA 1SKWA 1LFPA 4HYKA 2UP1A 5E41A 4DFKA 5SUHA 4A48A 2FVQA 5K8OA 1CEZA 3TNVA 1RK8A 2ZH9A 1DTQA 1FK9B 3PVXA 3NGKA 1NEEA 3BSAA 5KFVA 1HHTP 2V9WA 4PWDA 2RD5C 3MPWA 3W3SA 4I2QB 3MI7X 1O51A 1FE4A 2WSFC 4QWAA 1S1XB 1J2VA 1NJWA 4HLBA 4A8WA 3CCJS 2GO9A 5A0YA 3PW7A 4X66F 2B56A 1N5QA 3N4WA 2GHWA 5KFMA 4ES1A 4TQSA 1VGYA 4OLOA 2NLWA 4HI2A 3NP5A 2RH3A 4QWEA 1TFWA 2NUHA 3GFZA 3FFIB 2CPZA 4KIAA 4U6PA 1HL6A 4J37A 3CCLS 1U6ZA 2JLEA 1HNXF 4X4SA 2POKA 3CJ4A 2HIQA 1SH3A 1UJ6A 4TQRA 4Y00A 2N4DA 2XHWA 1B0TA 2AX1A 2J9DE 3DRPB 2F9DA 5KFZA 2BANB 3SEOA 4BC9A 3Q8QB 2UXBF 2M0GB 2LMIA 3TOQA 4WFXA 4DFJA 4LF5F 1RI7A 1HBMB 1WG5A 2GQCA 4TU9A 5C24B 2DRAA 1S7HA 4Q0BB 3RW7A 3BB5A 4DLGA 2WB4A 4ETZA 4YHHF 3R5DA 5T7LB 3SCKE 3ENVA 1HWJA 2PSZA 3DOKB 1XMOF 4ICLB 2NPFA 3VWSA 1QLNA 5AE2A 4B9TA 5F8MA 4EUVA 1FD8A 5A8KA 1QSLA 3IWNC 2K7KA 3PO4A 3H98A 2B7BB 4IQMA 2W7OA 1IKWB 3V81B 2GC8A 2O66A 2BOPA 1RISA 2JSXA 2LDIA 1P1TA 5IS2A 2HNZB 3BR9A 4NLPA 4DHVA 4DL5A 2OH2A 1GXTA 1WELA 2ZDOA 2VD3A 4DV4F 2A2DA 2F8EX 3OXFA 3VAKA 3ITHA 1FXDA 3JSRA 1FJEB 5C42B 1WTBA 2OO4A 4PXDA 1FKPA 4LMZA 5KFNA 5CQGA 3U1MA 4MK8A 1WF2A 2VBXA 1LOUA 2A1BA 1HPZB 1TKZA 4CT8A 2WAQD 3SQGA 4P7VA 2JWNA 1FJ7A 1C0UA 2BE2B 2D3UA 2MKJA 3DYAA 2PE8A 2XMWA 4Y2AA 5C25A 3BDPA 3MOZA 3V81A 1FJCA 3F56A 4XPEA 3QLHA 4DSFA 3M8PA 4R25A 1LV5A 4IG0A 2H9ZA 4KFBA 5GVQA 2IFXA 2B4OA 4QW8A 3S6EA 3HKZD 1QTMA 5EX3A 1FRKA 5DDOC 2M4MA 3T9ZA 1HBNB 1H3DA 3DLKA 4C97A 1EP4A 2U2FA 4DLEA 2RQCA 4FF1A 1UKUA 4IR9A 2K8GA 3HHDA 4M5DB 4X4PA 2V8VA 2UUBF 1QVGR 1FCAA 4DQPA 2KZMA 2HHHF 2BDPA 1HBMA 1SBRA 3TRGA 4QIVA 3DLHA 2CRLA 3KK3A 1X9WA 1DTTB 3CJ0A 2UUAF 1Z2ZA 3KLEB 3R1LA 1S1VB 1ZTWA 1C2PA 1VQKS 1XR5A 4DPOA 2ROPA 4I2PB 4IG0B 1PC5A 3GWCA 3OR1B 3VAHA 1S79A 4F4XA 1VQ5S 2GX8A 1WHWA 2IC3B 1GX5A 1H98A 4CO0A 4FVMA 2I8EA 1PO6A 3MEKA 2CPIA 2JFKA 4LSNB 4BBYA 1BQNA 3DU5A 3KLIB 4RBTA 4NLSA 2R7QA 3PX4A 5KTQA 2MZ1A 2QFJA 1LXJA 1TL3B 5F41A 2B9YA 3MCSA 3PIPQ 4RW6A 2QLWA 1S1WA 1N33F 2Q6CA 5J2MA 4KKOB 3KJVA 3QAUA 1U45A 4CO5A 5E2QA 4U7CA 2BJDA 4OFZA 1DLOA 3LALA 2OPQB 2LQ5A 1HQEB 1R8HA 1U1MA 2Y1JA 1TVRB 2RKIA 3GG0A 2B5JA 2QIFA 5HP1B 1FA0A 3PW4A 2JVOA 4O44B 2AYMA 2RJZA 2RQMA 4DR7F 2UUTA 3DOLB 2DGXA 2COLA 1GH8A 3ZZRA 4G1QA 4URGA 3HFKA 2XGQA 1IKVB 4DV7F 5L38A 1D1UA 4UY85 4URSA 5HMZA 1HNIA 2GO8A 4NLYA 2XLIA 3DMJB 3I56S 1L3KA 2HFZA 4HT7A 5EHHA 1RT5A 1HI0P 5CXTA 1F5CA 5H1SV 2XWXA 1HNVA 2AYEA 2R2RA 3VALA 2DNOA 2YY3A 4X4OA 4GKKF 1TAUA 3MPYA 1FTRA 1P1LA 3TARA 1KFDA 2DCLA 4CH7A 1KVJA 1HPZA 1PSDA 1TKZB 2J7WA 4IFYA 1Q86T 2EFQA 1RTDA 1R27B 5GMKa 3ZC4A 4C11B 4MKYA 1SH0A 1HBUA 4IDKB 3OHAA 4EWTA 4UW2A 3HHLC 3FSXA 4GO5X 3R5BA 4B9NA 1CC7A 1Q7LB 1R7IA 5LSLA 3SXLA 4QIFA 5LXYA 4YR0A 1AROP 3IR6B 2VA2A 1T03A 2OTLS 1RT4B 4EFAC 4P2SA 3IBWA 2MQMA 4LF9F 4RKUC 2EC0A 3TUIC 3OFGA 1Z1ZA 1FDAA 3I5BA 2RU3A 5E33A 5BR8F 4K5SA 5E3CA 2YVSA 4YMEA 5DG7A 2NZ4A 2R7XA 4Y2CA 1OS5A 2LU1A 3DCAA 3LANA 1ZYQA 4TN2A 3LP2A 5DDQC 4YP3A 3DRRA 2VG6A 3LP0A 1PC4A 3G86A 1UVKA 1JJ2R 1YTYA 1QAJA 1KQGB 3T19A 1HWLA 1X4BA 1M5VC 2K3KA 4H4OB 2C3MA 1WWHA 2DTJA 2YX7A 4OX8A 1YHQS 3M6WA 1EETB 1RYRA 2W9BA 1YJVA 2XNQA 2CZVC 2L08A 1X5PA 2CKWA 1QSSA 1N54B 2MGZB 3O5TB 1XNRF 4D3HA 2GQQA 2O5DA 2SXLA 3M2RA 5D4PA 2W8LA 2FDNA 1NJZA 2KYXA 4FF4A 3CCES 2XC9A 3PO5A 3KMSA 5KG3A 2GGPB 1R8BA 2HPUA 5B0AA 2E9TA 5A6WA 1NH8A 2G0CA 3P49B 2HYIB 3MEEA 3J81Y 1X5OA 3S1TA 2IC3A 1UEVA 2XBPA 4KT0C 5A8KB 1E6YA 1HQUA 3EXCX 2R8HA 3CCWA 2NREA 2PT0A 4NLVA 4ZPBA 1YSJA 1SJFA 1HBUB 5I3UB 1MROA 3FDSA 1R3NA 3HHLA 2G4BA 1ZAWA 1DTTA 4ECWA 4KTQA 4F02A 5LJ5Y 4MYUA 1OPIA 4F4WA 2C2RA 5B09A 3GFXA 4DV1F 1VBXA 3FSIA 4LIWA 4KPYA 2IJFA 5K8MA 1JLEB 3CCMS 2MGZA 2OD6A 3FZ2A 3PR5B 3E2EA 4IFVB 4WKRA 1BQMA 1BQXA 4DFMA 2FJBB 3DDNA 1S9EB 4USHA 1U2FA 3IFEA 4OJ3A 4WU2A 5J1EB 3HVTB 2XS2A 1RT2A 2ASJA 2JEFA 2L9NA 5DQGA 2VH7A 5DG9A 2VG7B 5HBMA 2WSEC 3O44A 3KFWX 2JLFA 3P5TL 5F8JA 3PEHA 1DZ5A 2PFFB 1RT1B 2XZWA 3ONQA 2R8KA 3HP6A 4QPXA 4O3OA 3CCTA 2VBZA 4FZVA 1NK6A 3LUYA 4Z2XA 2XB2D 2B7CB 1K0TA 4F50A 1DQ9A 3HXMA 4NA3A 2VKZG 4B3TF 4EU0A 3DLLQ 2OAUA 4FP9A 4B3OB 2DNKA 2D1CA 4ED3A 4PWDB 4MAKA 1Q7YT 1UVNA 2E5GA 1Y9OA 1C0TB 1JKHB 4YDDB 1REVA 5K14A 2IVYA 4OI3A 2DBBA 2RF2B 5KT5A 2PO4A 5F0UA 5G0RB 4LFBF 2DNZA 2I9SA 2VQFF 1N56A 2WCXA 4PQUB 4I4BA 2VL1A 3GV5B 1NAQA 5DRKA 1R8PA 2XMKA 2Y1IA 5I3PA 3KNGA 3KNAA 3IS9A 3MMCA 1SJ1A 3K8WA 6FDRA 1M90T 3CWJA 2ILYA 2WBRA 3POTA 1VRTB 1XR6A 3TA1A 3R5CA 1IBLF 3FCHA 4ZS6A 4DG1A 1X4EA 2BRKA 2AWZA 3A1YG 4IOCQ 3ISND 4OZNA 4YUDA 4P6QA 5A8RA 3DNCA 1ZM3A 4ZP6A 2N4CA 2LQJA 4RNMA 2V4JB 3C6UB 3CC4S 2M5YA 2HGLA 3DOLA 4A8XA 4K4YA 3QIPA 2L48A 1X9MA 1R8AA 2BV3A 2VC0A 2J0QD 1UFLA 2OMLA 4ES2A 4MIAA 1W2IA 2OPQA 1QAIA 1DLOB 3K2YA 1ZM9A 1TKXA 1JKHA 4DQIA 4HL9A 2ZDPA 5LL6d 2N7CA 5IM0A 2VONA 3E51A 1N5VA 4RWWA 2KT2A 3NAHA 3TO8A 2FJXA 4X62F 3SDEA 1H2VZ 3JSBA 4N8OA 4PKDB 2XMTA 5D6GA 1RT1A 2UXDF 1FD2A 1LWCB 2GCFA 1AFIA 2ZOGA 1YJWS 1DURA 4ECSA 3C6UA 3MAQA 3GIMA 3CGIA 1RTDB 4DL7A 1VI7A 3MR3A 1RT2B 2B9XA 2HNZA 1VQLS 3DM2B 3SMZA 2RS2A 1VS3A 4R5PB 5EGYA 7FDRA 1UWBA 2ZC3A 1DRZA 2CQPA 4LSLA 4B9SA 5JVHQ 4C8OA 2R7VA 4GC6A 3K5PA 2OPPA 1UVIA 2J9EA 2C3UA 2VFRA