4G70B

Structure of recombinant cytochrome ba3 oxidase mutant v236t from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant V236T from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 51
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4g70B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4g70B02
2GB2A 2KSAA 2LLNA 1J5DA 3UTVA 1J9RA 1AT9A 4HCIA 3QJVB 3FSWA 2IH9A 3MBVA 2PCYA 4E9SA 1MDAA 4DPCX 1CYWA 4PCYA 3ERXA 2WO3B 1KBVA 1OF0A 2VW4A 3NSCA 1GY1A 4Y9HA 4RH4A 1JGJA 2YCWA 5B1AB 4PXKA 4DJHA 3PWHA 1OE1A 1RZPA 1XMEB 3EMLA 1PZCA 3FSZA 2HRHA 3PAVA 5E9NA 1A4BA 4HHWA 3WKPA 1KCBA 3D4SA 5H2MA 1PLCA 1L0MA 1JZGA 1ILSA 2YDVA 2B08A 2GC7C 2N0MA 2EIJB 3FQ2A 4BDVA 2QT6A 1KYAA 4A4MA 1E5ZA 3QBGA 3AYNA 3BQVA 4HIPA 1CYXA 1TKWA 2XXFA 5A7EA 2VMJA 1BYOA 3WQJA 1NWPA 2UX7A 2I7OA 3DDLA 2I7SA 3NY8A 2YAQA 4GP4B 1X9RA 3OE9A 1X9UA 3V2WA 3DKHA 3ZX1A 4NERA 2GC4C 4AKOA 1E5YA 1GS8A 2PPDA 2JAGA 1BQ5A 4QIDA 3S3CB 4IB4A 1L9QA 3OMAB 2IWEA 2GI0A 2VM3A 1IW6A 4AX3A 2FQGA 3TBCA 3X1EA 3FU7B 2F95A 5ETZA 3AG4B 5J7AA 7PCYA 4L35A 4A2HA 2TSBA 2PPEA 3MX0B 1NTDA 1KMEA 2J5WA 4IAQA 1NICA 2PP7A 3T6XA 3QJSB 4IARA 5B7EA 1NIFA 2HX9A 7PAZA 1KBWA 4YVNA 1L9RA 4F7KA 4F2FA 4WW3A 1ETJA 1JZFA 1RKRA 2IDQA 4DP5X 2BRDA 1MG2C 2Y03A 1JVLA 4GYBA 1AANA 2JXMA 4E9YA 3OE6A 5KKHA 1OCOB 2UXTA 3IN0A 4A2EA 3CDZA 3PAZA 5B7FA 4UANA 2DWTA 4P5SA 2XU9A 5AHZA 2YCYA 3NSYA 1T5KA 3AG3B 5PAZA 5G2DA 3ABKB 3T71A 1GU8A 4AMIA 2XYBA 3NJKA 1FFTB 4XTNA 5LDUA 4LDOA 4YSDA 4BXVA 3X1GA 3HB3B 2UXFA 3TASA 2IWFA 1AZCA 1PMYA 2EILB 1BEXA 1M0LA 5B6YA 4Q89A 4JR8A 4J4QA 1DZEA 4GP5B 1HFUA 3QBIA 1V54B 2OV0A 1R1CA 1BQKA 5BR2A 4E9XA 3FQYA 3UZAA 3NJHA 3PCYA 2Y04A 3T9WA 4JQ6A 2XUWA 3QQXA 2ZFEA 4DP0X 1CUOA 4E9QA 2AZUA 2MRYA 1L9TA 3QJRB 2R7EA 3EHBB 1MGYA 3NJGA 4BEYA 4E9TA 5C1MA 3HARA 3CG8A 5A45A 3VG9A 2GIMA 3KW8A 1AG6A 3QJQB 2XWZA 4KOCA 4LDLA 2CUAA 3IBOA 3SBRA 4G72B 2W88A 2KSBA 4XTLA 5FC9A 3QDCA 1WAEA 6PCYA 3TBBA 9PCYA 1M9WA 5PCYA 1NWOA 5AFAA 1KGYE 5I6OA 2TSAA 5I5JA 3NSBA 3DQBA 1AACA 1NPNA 1W6LA 1ZDSA 3UG9A 2BP8B 1EZLA 1S52A 2YQBA 4FBZA 2QPDB 1GS7A 2JFCA 3NJFA 3TA4D 3WI9A 2Z55A 1GR7A 2A3TA 4X32A 5I28A 2GSMB 2AZAA 3ZDWA 1OE2A 1GYCA 4BV0A 1VGOA 2I1XA 1VLXA 4G7QB 5H2JA 4NAJA 2HZHA 1BXUA 4KO6A 3GXUB 3ZEVA 1FWXA 1SF5A 1WA1X 2NRDA 3UAEA 5B6WA 4A68A 4JHUA 3UABA 3PBLA 3OM3B 2JAFA 5B3SB 5DYSA 4KNTA 5G2CA 1P8IA 4KO7A 2WJKA 4GBRA 3GDCA 4HCFA 4K5YA 5B34A 3FU8A 1X0K1 4E9VA 2X88A 3FQ1A 4AI7A 3V2YA 1M56B 3HEIB 3GYRA 1ID2A 4CSPA 2FT8A 4FPDA 3PAUA 1AAJA 1SJMA 2FQDA 2ZXWB 4QI1A 1CC3A 1F4ZA 3AYMA 4JHVA 4DPAX 3C9LA 1C3WA 5EN0A 5B1JC 4G70B 4YSSA 1E67A 1IC0A 5H2OA 2PPAA 4YSRA 3NJJA 1L9SA 3FSVA 3FYEB 2UX6A 1PXSA 1JFPA 1CURA 4UG2A 2HXAA 3ABMB 1QKOA 1TEGA 1S8LA 1EHKB 1E30A 4AMJA 1AZRA 2PPFA 4A2FA 3WKQA 5B1BB 3CVBA 5IY5B 1DYZA 2FQEA 4G7RB 4DP9X 1M57B 2GBAA 4TL3A 1ZIBA 4L0PB 3RZEA 3FU7A 1AOZA 5I6LA 2DYSB 1URIA 4HALA 3UTYA 1NIEA 4QKTA 4XTOA 3FYIB 4DP4X 1SFHA 3NP4A 2L6XA 3UACA 4DP2X 1X0I1 5B1KA 4F2EA 4YSCA 3X1FA 2HLEB 5G36A 4A67A 1FBKA 3QBLA 2FTAA 2BWDA 3AZUA 1H68A 3S8GB 1UAZA 1TEFA 2VW7A 1QM8A 2YAFA 3EH5B 2YAPA 4UAHA 1JOIA 4YSQA 4E9WA 5TK2A 4CSZA 2BZ7A 2B3IA 1S53A 1AIZA 2WO2B 2AANA 3CZUB 4N8UA 3SQRA 4QLWA 1AS6A 4EA3A 2XV0A 2VW6A 1Q5JA 3CVDA 4BWTA 2XV3A 2XX1A 4MD1A 4A2GA 1M0MA 2M3GA 3CODA 2XVBA 2ZZLA 3ZPQA 5TK4A 5AZDA 3SN6R 2VT4A 1F50A 4YVUA 1NINA 3UZCA 5JJEA 3G5WA 3VW7A 3REYA 4MD2A 1ZPUA 3X3BA 2QPEB 1PZBA 1SDDA 4MFHA 5I6PA 1YLBB 1OCZB 1PY6A 3COCA 2IDUA 4DKLA 1AS8A 4EIYA 1OCCB 2LNLA 1SHWA 2BP0B 2YCXA 4M3HA 4YSOA 4UHRA 1W8EA 5G2AA 4N6HA 2EINB 2PLTA 2EIMB 3C9MA 3UONA 3FU9A 1A3ZA 2WSDA 1IKOP 1OE3A 4HYJA 3FT0A 4A66A 2BO0A 2YAHA 3EH3B 1GUEA 5H2IA 2DWSA 1S54A 2XLLA 3TU6A 4W1TA 5JJJA 1AQ8A 1JVOA 4G7SB 1ZV2A 4X31A 4M4RB 2KSYA 1AG0A 1OCRB 4W9ZA 5F7AA 4KO9A 1P8HA 3CDZB 4PAZA 4NC3A 1AZUA 2FT6A 2BHFA 2CBPA 3AG2B 1J9SA 3ASNB 3JT2A 1BM1A 1TN5A 1RZQA 1BAWA 3NJLA 4BUOA 5I26A 1IBZA 1UATA 3DIVA 1S51A 1A4CA 1AZBA 3X1NA 1JXGA 5ITCA 1PXRA 5B6VA 3P0GA 1E0PA 3UTXA 1PCSA 1WA2X 4YSPA 6PAZA 1NDTA 3OMIB 2XX0A 1A65A 1BXVA 1AP9A 3ODUA 2CJ3A 3VHZA 5AWZA 1HAUA 2DV6A 3SBPA 2NTWA 3WNJA 3ABWA 4JKVA 1JV6A 5TGZA 1KDJA 3RYMA 2YCZA 1V55B 4GYCA 5B35A 3C75A 3NP3A 5A44A 1F56A 4GP8B 2HX7A 1SNRA 3IN2A 1ET5A 2CALA 4NB7A 4N4YB 5G54A 2R7EB 1NPJA 1BRDA 1DZ0A 3V9EA 2Q9OA 3AG1B 2BW4A 1WS7A 3FPYA 1NZRA 5I6NA 1RCYA 4YSEA 5BR5A 1F88A 1PNCA 4YSUA 1BXAA 3X1BA 1JZIA 3KJ6A 4BWWA 2YAEA 4WKXA 1O0AA 3OD3A 1JZEA 3S3DB 4AZUA 2EIKB 2PP8A 4DP6X 1PNDA 3PXLA 4QRYA 2P80D 5ITEA 2GHZA 2XV2A 1FBBA 5G53A 4DP8X 2AT9A 3V9CA 1N68A 5H2NA 2UXVA 3ABLB 1E12A 3PPSA 5I6KA 3SBQA 2YAMA 1QHJA 5LWEA 1ET7A 3CAPA 3OQRA 5EHFA 2IDSA 1IXFA 1A8ZA 1ET8A 3AY2A 2PP9A 4HCGA 3OE0A 2IDTA 4LDEA 3A7KA 1PF3A 3PLYA 5B6ZA 1JERA 4UF7C 4TXVB 2HPYA 1BYPA 3PDSA 2ZOOA 2XXGA 1XB3A 4N4WA 4ZK8A 2Y02A 3NSFA 4HZ1A 1L9OA 2I85A 4K9JA 2RH1A 1J9QA 2JKWA 5B1JA 3N2JA 3FSAA 5B7MA 5B6XA 5G28A 4X4KA 2FQFA 3MBWB 1JXFA 3NJMA 1KV7A 1N70A 4GRVA 4FAAB 5AZUA 2BZCA 1NIBA 4BXSV 2H47C 1KCWA 3RFMA 1KDIA 3CVCA 3ASOB 4MQSA 1ASPA 1GY2A 2YXWA 1C8RA 1KG8A 4KNSA 4PXFA 2FNWA 2Y01A 1I53A 2Y00A 5AX1A 3S8FB 1J9TA 2ZONA 4Q8BA 1HZXA 1IUZA 1QLEB 1B3IA 3L45A 1L9HA 1ADWA 4GY4A 4KOBA 4EF3A 3X2QB 3T6ZA 4BDVB 1PY0A 2PEDA 1FA4A 3VI0A 1M0KA 2DYRB 3JTBA 3QPKA 2BW5A 2QDWA 2HRGA 2KS9A 2H3XC 4YSAA 3UGEA 4FA7B 1C8SA 2IH8A 3UTWA 5I5MA 4GPOA 2HX8A 2J55A 3D12B 1AS7A 4BEZA 2VM4A 1P8UA 2VSMB 4A2DA 4XXJA 1A4AA 1PZAA 2MTAA 3VGAA 1IBYA 3U25A 4BWBA 1Q5IA 2YDOA 2Y69B 2VSKB 1WA0X 3HAPA 3QAPA 2IAAC 2YAOA 3S3BB 2X87A 5B2NA 1ASOA 8PAZA 4G71B 4EJ4A 1PLBA 1HAWA 3HAOA 2IDFA 3ZIYA 1ZIAA 4ENZA 1SFDA 5D4JA 2EI4A 2BP0A 2F93A 1WS8A 5B0WA 1OV8A 2J56A 4WTQA 2ZWNA 4MQTA 1QKPA 3AM6A 2FT7A 2J57A 2I35A 4DAJA 1SHXA 4WAVA 3NY9A 1UCQA 2AVFA 1BRXA 1BQRA 1SF3A 5AKRA 2R4RA 3WIAA 4X1HA 3NYKA 2G87A 4KNFA 3OMNB 2OJ1A 5F8UA 2AFNA 3QBKA 2R4SA 1ILUA 1AZNA 1U19A 1R84A 3WG7B 1MG3C 3ZBMA 2IWKA 4DP7X 4KO5A 2ZIYA 3FPXA 3H4FA 1NIAA 5F7BA 4HWLA 4BVNA 5DHGA 2I20A 3FS9A 1X0SA 2WJLA 2UXGA 1TN0A 1SDDB 4P5RA 4JKNA 4DP1X 1VJMA 2DY2A 4YSTA 1AR1B 3QAKA 5AHYA 1ZDQA 5H2PA 3VVKA 2P80A 4OV0A 2J4YA 1LN6A 1S8JA 4XT3A 1GS6X 4YL4A 2H5UA 1JZHA 5DHHA 3HASA 4L6RA 5D4IA 2Y1AA 1W6WA 4MBSA 1PAZA 2OCCB 3ABGA 2BP8A 2QDVA 1L9PA 5H2LA 1J5CA 2FWLB 3HANA 3H4HA 1E65A 5JJNA 2Z73A 3T45A 3OE8A 1XB6A 1TU2A 3IE9A 4HHGA 5ANHA 2VN3A 3NT0A 1IW9A 3X3CA 3KW7A 3QJTB 3EH4B 1JXDA 1KG9A 3PQRA 5H2KA 4BK5C 1BRRA 3DTUB 2I21A 1V10A 5FJGA 1NIDA 3N55A 5D4HA 1PLAA 1R2NA 2YXVA 3H56A 2Q5BA 3NJNA 4AKPA 3IEAA 4AKQA 3BVDB 1JZJA 4KLYA 2YARA 3OAXA 5H2HA 2PCFA 1XB8A 1CWQA 1GSKA 3PXOA 4GXFA 1H2SA 1QHQA 2BWIA 1JV7A 4HAKA 2FJSA 4HYXA 1KGBA 3EF4A 3T6VA 2E86A 3UAAA 4BWUA 2NTUA 3WNIA 3NSDA 1XJIA 3ZPRA 5A8EA 2RACA 3NJIA 3NYAA 3HAQA 4XT1A 1ASQA 2CAKA 3QJUB 1XIOA 1QNIA 3T6WA 5I6MA 5AX0A 2X72A 1GW0A 2W8CA 4E9RA 3AW5A 3UADA 1MZYA 4KNUA 2CCWA 3NS0A 1GZMA 2PPCA 4DPBX 5I5IA 1OOWA 1MZZA
chains in the Genus database with same CATH superfamily
2KSAA 5E5RB 4B97A 3FRPA 1I7RB 1IEAB 2NY6D 2PO6C 3QA3A 4U31A 5EOTA 4KKBC 3EFDH 5DJCA 5F3HA 4PCYA 3ZW3A 2NY3C 1S9YA 1V5JA 5ICXB 3K0YA 3LQZB 4X6BA 4DJHA 2CQVA 3G04A 2EXYC 1A4BA 2R0LH 4U0RC 5DYOA 2ARJB 5E94A 4CW1A 2FH6A 2CRIA 2FJFB 2ORBH 4G43A 3PV6A 1MJUL 1S7UB 2GC7C 1B3JA 4W4OA 4XN8A 2KDYA 1MLCB 4A4MA 1LQBC 4KZCA 1HESA 2OLDA 2P26A 3QZWG 3WMSA 4A2LA 1T20B 3QVAA 5IVXF 1BX2B 2OMTA 4CDGC 1YSOA 4OH2A 3SE6A 3LZLA 5LB1A 3RWFB 5F93C 4NKIH 1HQRB 4XXWC 1CLOH 5DO2C 1BGXH 3J8F7 4I9WE 3QIWC 3WOVA 2H6PA 4FQLL 3A4DA 3K4DA 5D1XA 3F5WB 2VQTA 1G1YA 2IWEA 4LT7A 2GI0A 1UT1A 3MNZA 2FQGA 5EORL 2DEXX 4KZ0A 4G8AC 5E99L 1OPGH 1A6VL 2X42A 4LBAA 5DS2A 4H40A 1P6AB 2Z7ZA 3L9EA 5CWSA 3HIZA 3FFCB 3RLSA 4KI5E 3KDMB 1KGJA 7PAZA 5IHHA 4B96A 4QRRB 5ECJE 2JF1A 3WL9B 5EEXA 2E7HA 5I0ZA 3BPLB 3LV3B 4YEFA 1GA2A 3E8UH 3NA9L 4F91B 3LIZL 4PJ8A 5IMOB 4DP5X 1RU9H 2A0LD 4DGVH 4PV1C 4K3HA 1R17A 5DRXB 1F6FB 1B0RB 3U6XS 4P2AA 1AGFB 1NFDF 1E9PB 3BHBA 2XU9A 1JSYA 2R23A 4OZHE 3T65B 2IPKA 4QHLB 3SD5A 4IIQA 5LCVH 3TOPA 1GIGH 1LEKB 1MNUL 1PKQA 5G2DA 2HFFA 2X6UA 2VDKB 1I9EA 1Z5YD 2X4OA 1DJIA 3SPIA 3T4YB 1QKZL 4M8UA 3ZMEA 5IFAL 1CFNB 1XIWD 3E6HA 1KN4H 2UXFA 4AJVA 4E41D 3HVDA 4NENA 1OP5H 3B2VH 1BEXA 5LAXA 2ZWKA 3C8DA 3CPLA 3D2UB 1V54B 1DR9A 1EXGA 4KTDL 4Y4KC 2OV0A 2Y07H 4HXBL 1TZHB 3QUHA 4QGYA 3AS3A 2O6PA 1OPOA 4HIEA 5KSAB 4GUQA 1ZTXL 2MRYA 3NIGB 2R7EA 4X9YA 3MNVB 4FCAA 4DTGL 1NDMB 1DANT 2A74A 3Q43A 1SLWA 3RBGA 4PTUA 3FU3A 4NP4L 4UDUA 5E8PA 4M8VA 4KMQA 2FIKA 4G72B 1AQKH 2J6EA 3WFCH 4K8RD 2ZIDA 1JFQL 2ADGB 3TBBA 1L6PA 2CA4A 4YDNA 1OW0C 3FBKA 3H1ZA 3VH8G 4L18A 1G6VK 2OTWA 1MWAA 2C4FU 1ROWA 4YNYB 5IJVB 3RIFF 2Z93B 3T1FB 3MNMA 3CXHJ 5BZWA 3UTTA 1MRDH 1BAGA 3PHQA 2AQ1A 2A9DA 4Y16A 2RCSH 1XWVA 2F53E 3QDME 3KJ4B 1SVBA 5ISZE 4JFDA 5IOPB 2NW3B 5I1GL 4WHYH 4BZ1H 4NBXB 4FQCL 3KS0H 3N3EA 1U8NB 4UT9A 1I7RA 2P5PA 3OM3B 3WFEH 4YQXL 3TBTB 2V3FA 2J8UF 2V5TA 4UNUA 1E43A 4Y5XA 5ICXA 3LQZA 2VXQA 1YQVH 4P23B 3MPCA 2FUQA 1AAJA 2YXFA 1MJ7H 4WF7A 4P2QB 1NSNH 1WRFA 2ARJA 1ZK9A 4ODBD 2HH0H 2YD5A 2FJFA 5F7DB 3BZEA 3RVXD 4JHVA 1AOHA 4LXFA 4WEUD 2QQKH 4YSSA 1RZ8A 1YMME 1UD2A 1L0YA 1T20A 4UDTB 5ID0A 3HBGA 4AYEC 1E6JL 4XGZA 2F2HA 3GT6A 2JK5B 5F7NC 3RWFA 1HQRA 2VLME 1U3JA 3K72B 4Y5VC 5B1BB 5I6XB 2A2QT 3P77B 4L4TB 4QXVA 4Q56A 4PJ9B 1JDAA 2WK2A 3ZDYE 1U95A 3SDYH 4LZKA 1S5HA 1CXHA 1FORL 1FI8C 1HNFA 5IT2L 5F9OL 5GJSL 2WCSA 3D85B 4QRPA 5IB1B 4O5LL 2FEEI 5IV2B 1EZUA 1UGKA 3RWIB 5EUOF 1KGCE 2EQDA 3KDMA 3DHMA 2BWDA 4M7JL 1FL5B 1H5BC 1CDGA 3NIFF 1QM8A 1OARH 2YAFA 4LSSL 1U8IB 4P9ML 1EXUB 3WL9A 4DEPC 3LZFL 4NZ8A 1GKEA 1PTZA 1CL7L 1I9JH 2AJZA 1MAMH 4KK9C 3VRLF 5D7IE 4MS6A 2QBWA 1OOAA 5K9JH 3DV6A 4FTVD 4MHHI 3ULUL 1AGFA 1E9PA 4KDVA 2AXFB 4PJGF 2HFTA 3T65A 4QHLA 3IFLL 2FECL 2DL2A 1EJ8A 4L4VD 1LEKA 5A43C 1FE8H 2D7OA 3QUMH 4CU8A 1D6VH 1L7IL 1TMCB 3I3DA 4Q2ZB 4TUJA 3T0VA 3T4YA 4F9PA 4GW5B 4YSOA 2F54E 2LNLA 4PBVC 3BUDA 4UHRA 5G2AA 2OK0L 5J7CC 3EADA 2I69A 4PN6A 4ACPA 1SPDA 4I0KA 1EZVY 3OR7B 1J48A 1RURL 2XLLA 1TZHA 3PNWB 3AS0A 2EYSB 5KSAA 4RSYA 1AQ8A 4W9ZA 3MDJA 2G60H 2R2BB 1P8HA 4EEEA 3P73A 4HJJH 5DD0L 3HNSH 1MJUH 3IJ9A 4HWEL 1KIQB 4TF4A 5JA9A 3I50L 3B7YA 4IBSA 1B9KA 3WE6A 4KRMB 2AJVL 3G5XB 3NIDE 3WNKA 4YSPA 5GRVK 2ADGA 4JN2B 4M61B 1F58L 1NDTA 4V1DA 3MCYA 6PAZA 2WWMC 4TSCH 3MI6A 3WNJA 5FKPB 3B2UC 2JCCE 1PZSA 4TS6A 3NP3A 4OZGB 2Z93A 2X44D 3T1FA 4FLQA 2UY7A 1ACYL 4A37A 5EORH 3MV7D 1EDYA 2PR4L 4PJBB 2Z8SA 5E7FA 2IOIA 3SE3A 3LNDA 5E99H 5DRZB 1A6VH 2M83A 4BFRA 5IOPA 2JIXB 2NW3A 5HTSA 5I18L 1E4WL 3TH4T 1PNCA 2GYSA 2VDNB 3KL3A 2CHWA 3ZVVA 3ULUF 1G7QB 3NMEA 2W80C 4QKXB 1MY5A 4NRYB 3S3DB 5F7UA 5DMYA 2F68X 3HR6A 3CDCA 3FK3A 3PQYD 3NA9H 4R7XA 5GZND 1ZLUH 3OKDB 3ARSA 2WQXA 1EEZB 4HQQH 3VM5A 5EFIB 2UXVA 3HI1B 3HE6C 3LN5B 3FO0L 2PTTB 4P23A 5HHME 3ASWA 3OLIA 3V0VA 4P2QA 3FU6A 3VB8A 2KL6A 2UVFA 4QMEA 2IDSA 3GXFA 3KPOB 3L4TA 5LGKA 3AY2A 1LGVA 3OE0A 4ODXB 1XF1A 2VDPH 1MNUH 4QAWA 1KYOJ 4X5WB 3PLYA 3ZZSA 2F18A 2IF7A 1C16B 2ZKXA 3PDSA 4NYLB 4UDTA 5IFAH 2RH1A 2R15A 3QZOA 1YN6A 4XNBA 2JK5A 3G6JB 5DEFA 4L4TA 4UQCA 4KTDH 4GRVA 4GKSB 4PJ9A 4HXBH 2XN9B 4N90D 1X5LA 2XVGA 3RFMA 4L0ZA 1ZTXH 3QPQC 1OZUA 4X6EB 4DTGH 5L2KD 4HEME 1TZOA 5IB1A 2FNWA 5EA0L 1J9TA 4NP4H 1B3IA 2MCG1 1T1WB 1L9HA 4M3JA 4M8QA 5EBWA 4EF3A 1FL5A 5I76B 1FLTX 4PJFB 3T6ZA 1EXUA 1FA4A 4R3SB 1JFQH 3CBRA 4M7ZC 3QPKA 4PRBB 1DANU 1N6VA 4YSAA 4Y4FD 1GPOL 3CSYA 4MMXB 4Y5VB 2QV4A 3KXFE 2ETWA 4XXJA 2K6ZA 1DO6A 2A9BA 1JNLL 3HZMB 2YDOA 3MV9D 4F7EB 2WB1A 3PHAA 3HAPA 3MN8A 4YJZL 2XPZA 1YEEL 4Q2ZA 4X8XA 3RJDA 5I1GH 4D9LL 1ZIAA 2YD6A 2IQAB 4GW5A 4OIIL 2JB6B 1UQSA 5BNXD 3RWDA 2F93A 5JORB 2ZNWA 3B4NA 4FQCH 5B0WA 4WTQA 4YQXH 1EBAA 1QKPA 2VH5L 3RZCD 2I35A 3VFMA 1WISA 3ZKMC 2E7LA 3LRMA 2YKKA 4OY9A 3OR7A 1G7MB 1MCKA 4HAGA 5CGTA 4LPWA 5L4FA 5AW3B 3QARA 5D1ZA 1NL0L 1OHQA 2R2BA 3S98A 3GSXB 1QLEL 1U19A 1SHMA 4DP7X 3WUWB 5F3BA 1ZV9A 3ZKXB 4GS7C 1KIQA 2V9UA 2VLRD 2ZX9A 4B0MM 5C0JB 3KCPB 3T3PE 1KSRA 3T0WA 5GS1B 1ETZB 1HL9A 3G5XA 5E6IA 2DWEB 3ZKSD 2YQ2A 4M61A 5AHYA 4OR1A 1E6JH 2AF2A 2DMGA 4UYPA 4RFOL 1XBRA 1EO8L 3OKOB 3LQAL 2UY6B 1JYXA 1GS6X 4ELMF 3GJEA 1JZHA 5FKPA 4XRCB 4OZGA 1XX9C 1LM8V 4KV5F 4NO2B 1A1OA 3TEYA 2CR0A 5IT2H 1AD9B 5F9OH 3B56A 2XWCA 5GJSH 2JIXA 2AGJL 3KJ6H 5I0YA 4XNQB 3BLBA 1UKSA 5CD5D 4OT1H 1M7IB 1G7QA 1FH2A 4M7JH 4P9MH 4ZOCA 4LSSH 1EIBA 4NRYA 2LE9A 5CINH 2EAEA 2OS7A 3LZFH 1QLFB 3P0GB 4RAUA 3NCFB 4DW2L 1CL7H 2EYRB 4BKLA 3CXDL 3IKCA 3OKDA 1INEL 4XC1H 1EEZA 4K4KA 5EFIA 3LN5A 3ULUH 1H2SA 2PTTA 2Y3AA 4EAEA 1IAII 5IFJB 1XD1A 4LAQL 4EI5C 4F9LC 1U3HD 4M43L 3A4EA 5FFOA 1TCRB 3IFLH 4NN7C 1AJ7H 2PWHA 3PRZA 5A8EA 4X5WA 3Q6GL 1UG9A 2D9CA 2R69L 3VWKC 1UOKA 2EDYA 1L7IH 3T6WA 5AB9A 4NYLA 3UADA 4YDLC 5GRWA 3RGVB 3SYCA 4EDWL 5I73B 2YXMA 4MXWL 3VA2C 5D93B 3AREA 2OK0H 4WW2F 4Z3TA 1Q1JL 4N9GB 1U92A 2FATL 3EDJA 3QIUD 4OF6A 4OUUB 4QY8B 4PWHA 3VDCA 5HYJE 3G5VB 3ENEA 4NRZA 1KZYA 1RURH 3EJZC 4NLHA 5DZJA 1D7DA 1OM9A 4XB3A 4OQTL 5FGSA 1XGTB 3RB7A 1WAPA 1J18A 4X6EA 2DQTL 1UADC 1UA7A 3HE6B 5KSBA 2VITB 1XMEB 1TCMA 3IPEA 2EIEA 4R8WH 1PD1A 1FVCA 3PP4H 3I50H 4FNSA 1T1WA 5I76A 4NPKA 3VDBA 2AJVH 1G9ML 4PJFA 1CS6A 1E5ZA 3WBDA 2HLAB 5HPMB 2CU9A 1F58H 1MEXL 1EANA 3B9KD 5D1QC 2I7SA 4PRBA 2JQZA 3F85A 4OLEA 3V2WA 4KJPC 1CN4A 3UYPB 5I1JL 4S2SA 1U2YA 4MMXA 1X6LA 4QXTA 4GAJL 1A1NB 2P49B 3WLBA 2V8LA 1ACYH 2I26N 4GUPA 4LSRL 3QEQB 4QIRA 1Z2KA 3ZE2E 1XXFC 2YLHA 3VXOA 2HJKB 3HZMA 3MRHA 5EH1A 1DDTA 1QRNB 3RX7A 4F7EA 5DJXB 3HG2A 1K4CA 4Y1AE 5HDBF 5J7AA 1CD9B 1E4WH 5JORA 2JB6A 1I8KB 4M00A 4JQVC 1DJGA 1G6RH 4IS6A 3NA4A 4P9HH 4H7VA 3BVNB 4HUCA 3BX7C 1GTNA 1PJ9A 5JYLA 4ONHB 4XCYB 1PU0A 5FKAB 5CBEB 2ZX7A 4CNIB 1OT4A 2E6PA 1G7MA 1MVUB 4M7ZB 3AM8A 2BSSA 4MMZA 1WZMA 4FXKB 1L5GB 5JHDB 1HHIA 1ZXQA 2BIPA 4PLNC 4W9HC 3VXRD 3FO0H 3VXMD 1AANA 1ZAGA 1A3RH 3GSXA 4Q9RH 4MSWA 3E38A 1ETB1 4LLWA 3WUWA 5B7FA 2B1HL 3TEZA 3GXDA 2XYCA 5C0JA 3KCPA 3S88L 4KNQA 1JHKL 4Z3HA 4N26A 4O00A 1GU8A 2DWEA 5BS0E 2ED8A 3WIFB 4AUYA 3CVHH 4JZNB 4OIFA 4MA3B 1AO7E 5ENWB 1NCJA 5B3JF 1YJDC 3MUGB 3I6LD 3MOAL 4JR8A 1TNMA 5JHDA 5HVHC 4A7UA 4FQXA 3L1EA 3PCYA 4OBSA 4DP0X 2Y04A 5I6NA 1FZMA 1AD9A 4G59C 1IZKA 4GQPH 1GGUA 3PWJB 5FR3A 3MRKB 4XNQA 3NPSC 5D5MB 3MXVL 1IC1A 5A45A 1M7IA 3C2AL 4S0HA 1KTDB 4OCRL 5JMRA 2PTVA 1ZHKB 2WQUA 5E23A 1H9DA 1QLFA 4RAHA 3KS0J 3LKSA 4F93B 2OFQA 4MCMA 1LE9A 3QDCA 1CD8A 2EYRA 4IQHA 1LJMA 5CGYC 2H9GB 2G3MA 2KBGA 1G43A 2M2DA 3LEYL 2TSAA 1NUNB 5G4NA 1AACA 4D0DB 5IFJA 1WFJA 5JW4R 4HFWB 3DXAE 2VO5A 1JNLH 5I28A 1AQHA 3S8WA 5LGJB 4BFFA 1YEEH 3CZFB 4AYBA 1E4XL 2GUOB 3VMPA 3B8SA 4OIIH 2GK0B 4ONFH 4N9GA 4QTIL 4OUUA 3PBLA 4QY8A 3G5VA 2IMMA 4WHYG 4HUWB 3F65A 1UXSB 2DI9A 1SJHB 4ODTL 1XGTA 5KOVC 2GBTA 3IS1X 5GGRB 3T0EB 3ZHNA 2ICEB 1FO0B 2X12A 3CU1A 4IRSC 1NL0H 3HEIB 3GYRA 4HW6A 4L5FE 4AL8L 4CSPA 3QE5A 1QLEH 2GFBA 4AIOA 2VITA 1D3CA 1RSYA 2FBJL 5CN1A 1Z66A 5KS9F 3T08A 2P5EB 2WBWB 2WUCL 4GAYB 3CMGA 3U0TA 3QUXD 5HPMA 3JWOL 1EAPB 1FG2B 5F0LB 1WVZA 1IAOB 5IBUG 1WUZA 3KG5A 4RFOH 1NC4D 1EO8H 1YEFL 3GSQA 3LQAH 3WFBL 2JJVA 4OB5L 2CWRA 5AVVB 2IMNA 1A1NA 1NGXB 3PABA 4YXHL 5AW8B 4DUXA 3QEQA 3BKJL 4LRIC 4JG5A 4NT6B 3QAQA 1M57B 2ICWI 32C2B 1QRNA 5G55A 1CFVL 1ZIBA 1RQ5A 3IXAB 5DJXA 5I17A 2AGJH 4J3SA 1HI6B 3JSSA 5C6TL 4HALA 1I8KA 3FUNA 3EAKA 1EHLH 4YSCA 4I3SL 2VLKB 2QV2A 2EDEA 2MOQA 4JKWA 4ONHA 5FKAA 5CBEA 2CRZA 4Q89A 4CMMB 4CNIA 2IAMC 4DW2H 1XIWB 4E9XA 4LSDA 3CXDH 3KPPA 4JY5H 3H7LA 1L5GA 4TNGA 1INEH 2B3IA 1S53A 2B9AA 2OR9H 1A7BA 1CLYH 2XRAL 2AANA 3HS0A 3QW9A 4JRFA 3QJOA 4KTGA 1DSFH 2XV0A 5F88B 5CEZE 1HL5A 4G82A 2JKLA 4LAQH 2ZUUA 4N28A 3EDEA 1F97A 4IK6A 4M43H 2VAAB 3NTCL 4I9WD 5AB0A 2XWJA 5EU6B 2VT4A 1USQA 2E6QA 1QZNA 1JTOA 3Q6GH 3A47A 4NC2B 4PJEE 2R69H 1M6OB 3DX7A 2BY1A 4LP8A 5TFSL 1NCHA 3IDIA 3PUCA 1OEZW 1T7ZA 3MKKA 4MXWH 5DHYB 1X4YA 1AGDB 3MCLL 4FTDA 4UYQA 2YCXA 4JW3A 4JZNA 2CIIB 4HD9A 1I82A 4K73A 3A0OA 2XBZA 3ZDXE 3MUGA 4KI5D 4ZNEE 1ERNA 5FIEA 4NX0A 2VERA 5H2IA 1QFWI 2VAJA 2V2WB 4KHXL 1WE5A 2DQTH 4Z7OE 1QFUL 1E4KA 2BS71 3VWJB 3BN3B 1W0YT 4OFQA 4NZRL 2AEQL 1GJIA 2PNDA 1HYSD 1RZQA 3AS2A 3SDCB 2VWEC 1G9MH 5FHBL 1ZHKA 2CE6A 2X05A 1MEXH 4AW4A 4OJEH 4PJCE 4EMZA 1PCSA 2WQRA 2H9GA 2MSPA 1BA9A 5TDPB 3WIHA 5IEHB 1N0XH 5F2FA 4NBZB 2OULB 4GAJH 4KJWD 3P30L 3FH7A 4WJKB 2OBGA 1QEWA 4HFWA 3RYMA 2AJSL 4XX5A 2V7HA 3DC0A 3QJZA 1LP9B 4NB7A 2W07B 5JO5B 5FECA 4BYHA 3WTUA 3CZFA 5CU5A 3FHQA 1A7PL 1E6OL 2GK0A 5JUEL 3BWAB 4FFYA 1BPVA 5HP5A 3U7WL 4ORGB 3AQXA 3I75B 3GTVA 5K1NA 4JRLA 4WW1B 1S3KL 4XH2A 3HI6L 2GIXA 4MASA 1TYEB 2NUTB 1UXSA 1J86A 1I4FB 3ULVL 1T5XB 1FBBA 1E7VA 1FO0A 2L04A 3IGAA 4LHUG 3IMRA 3EBGA 3JYBA 1CI3M 5FUCC 3R7QA 2B1HH 2DMCA 3AGWA 4H2CA 2IWGA 3C6LB 2P5EA 1YNLL 1HSAB 4GAYA 4KKLD 2ZCLL 3S88H 3FXIC 2HTLD 2G9HA 1JHKH 1FG2A 4B0MB 2WTRB 3TCTA 1IAOA 5MHSD 1D9KB 3NZSA 3LVEA 4UM9D 1QSEB 4YBLB 3QDMD 1HOCB 2O72A 3RQ3A 5ISZD 2FQFA 3HUJB 1LXMA 2DQUL 3DGDA 3D08A 4TQIA 2IO5A 1NGXA 3MOAH 2EVFA 2BLFA 3C60C 4HISA 3OR6B 4MX7B 4NT6A 2GJZB 1QASA 32C2A 5LXGL 2HT2D 3IXAA 3FSOA 1EEYA 1F11B 5EC2B 1RHHB 3EOYG 4MJHA 1HI6A 4MQSA 1TUPA 1TO5A 4H2AA 2B14A 1TO4A 4RX4D 1OGTB 1OD7A 4OCRH 5DJYB 3NAAL 1HZXA 5AYQA 5A6MA 3SDXE 4TTDD 3Q2NA 4CMMA 5CKGA 5BVJB 4GMTL 1XIWA 3OJ2C 3ZDZF 3BAXA 4N2KA 3O8XC 3M6DA 2WBJC 4E41A 1MWAL 1YMMD 1ES0B 3HAEG 1XGRB 4OGAD 5JDJA 2A9CA 2BM3A 3SGEH 3LEYH 4PGCB 5F88A 2WIMA 1C8SA 2X28A 2KZ1B 3GMRB 2PO6D 4WHCA 4ZO7A 2VAAA 2VLMD 1E8XA 4KKBD 1A4AA 2NXZB 1O0VA 1KPUB 2WLYA 1Q5IA 1M6OA 3FFOA 1E4XH 4N25A 4JJ5B 4PJHB 4PW4A 3U9PH 3KLQA 5B2NA 3ULVF 3MA7B 2IDFA 1SFDA 1AGDA 2EXYD 4PRHE 3FQRB 4QTIH 4HHAA 1MI5E 3MXWL 1XR8B 3I74A 4ZDHB 5MEPB 4HIXH 5E00B 1KGCD 4K5OA 3BAYA 4ODTH 5JXAH 2VXQL 2D03L 1IGJB 2V2WA 1BQRA 3KYMB 3LKOA 3QUYC 5CAYB 5TDOB 4AL8H 3EYSH 2YBRB 4WSKA 3D5OF 2AFNA 3VWJA 2DRUA 3QIWD 2FBJH 1E40A 2AK4E 2WUCH 5DVKA 3FT9A 3GBNL 3IGKA 2E59A 3SDCA 3JWOH 2WJLA 5HY9B 2P9RA 3RWJA 4ZAKC 3RKDD 4C56B 1YEFH 3JVFC 2YPLB 5TDPA 3QWOB 3WFBH 5IEHA 4OB5H 5IJKC 4G9FB 2K45A 3GZQA 3JV5A 4QWWD 4X5PA 2F54D 3PQYB 4MB4A 4TQ8A 1RAMA 3QNZA 1TSRA 3BKJH 5F6HI 1H6UA 1P5VA 4Y1TA 3CHXA 1LP9A 1CFVH 4PWEA 2W07A 3WELA 5JO5A 1XB6A 1XMWA 1RLBA 1GC1L 1NUDA 1THCA 1UCBL 2XCMC 4HDIB 5C6TH 3SCMC 3T2QA 2VN3A 2OXGA 2Y2TA 2RBLA 3BWAA 4Y19E 4I3SH 2I5YH 1TQTA 1C5DA 4FZ8L 1P6WA 3BPCB 3BSZA 3I75A 4O51A 4WW1A 1R19A 2FJUB 1V10A 4HG4K 5FJGA 3SGKC 4YE0A 2MNWA 4GBXD 5JPNC 1I4FA 5J12B 3BVDB 1QBLL 3PREA 4M5ZL 1DJYA 5JHLL 4GRWF 1LWJA 4FJYA 4S10A 3T6VA 3C6LA 4KK5C 5C2BL 2E86A 3MLUL 1GYVA 1HSAA 4Y4KD 1R9FA 3WNIA 1LMKA 1XJIA 3NSDA 5L2KB 4CAGA 4OFVA 2F7PA 3RWCB 3S3PA 2WTRA 4K5PA 1D9KA 3MCLH 1QSEA 1JPTH 3IVKA 5FA3B 1SN2A 5I5RA 1F6AA 4FMKA 1XH3B 3KYOA 3VA6A 1VGKA 2WN3A 4H20L 1INDL 4RQQB 2F9BT 3RUGB 4DFHA 3WO4C 4HCIA 4IJ3B 3MBVA 2GJ6E 3OR6A 4KHXH 2GJZA 1U8LA 1X5AA 4KJYA 3CFIC 4FTVA 1T7YA 5EC2A 4IRJD 1QFUH 1RHHA 2VW4A 4U6VL 1GY1A 5FUCE 4E68A 1UKQA 2FBOJ 3TPKA 4ZMAT 1OE1A 2JJSC 4NZRH 2AEQH 1C5BL 1IIIA 1N18A 1OGTA 4HHWA 4YK4C 1TIUA 5IKCB 5FHBH 1MFUA 1L0MA 1JZGA 3VI4F 4AQ8A 2CDFB 2FL5B 3UGXA 2BSBA 2ZOWA 5J4MA 3HMXL 4YPGB 2B2XL 4QTHB 3TZVB 3RZCB 1XGRA 1KYFA 3QHZL 5HI4D 3ECUA 4PGCA 1X9RA 4DZBB 3T0BA 2Z7YA 3GMRA 5LBVA 2AJSH 1VERA 5DZLA 2PPDA 3F64A 4UM8B 1H6TA 3TNMA 3P9LB 1Z1WA 1KPUA 1J7VR 4PJHA 3D4GA 1A7PH 1E6OH 3C5JB 5SWSB 3HPJA 2HRPL 3K6SB 3BUYB 3LKNB 5HYSG 5CCHE 4ZXBB 2WP3T 3U7WH 3FQRA 3R06A 1S3KH 5H4YA 1XR8A 1DVUA 2PP7A 3Q01A 4ZDHA 1QI3A 5MEPA 3W5NA 4PFEA 1T04A 4IGBB 5I66B 4BCYA 1IGJA 2UYLB 3TS8A 3KYMA 4LVNB 1EJOL 2FE0A 5DYFA 5TDOA 4TYUA 4RZKA 2JKIS 1ETJA 2CLZA 2R1YB 3MV7A 2B5IC 1JK8B 1QAWA 1LLAA 2EDOA 4HS8L 4V2BA 3RNQA 1YNLH 5IBTL 4JO1L 2ZCLH 3KXFD 5IVXE 3ORJA 1F0LA 3H2WA 3NIGF 3NBNA 5DO8A 1Z5LB 3OBAA 4HJGA 3H8NA 1FAKT 3AY4C 3QWOA 1ZV5A 1U93B 1TDQA 1UXWB 1FPTL 3ZL1A 3PQYA 1MCBA 4WI4A 1BBJB 2YPVH 4K23L 2J71A 4PJ7B 5LXGH 5ESQA 1QOKA 5DZAA 2VXTL 2OMUB 5BR2A 5DGRA 5DRWB 5EO1B 2PWEA 4KK9D 1HXKA 4MNQE 3O6FB 4HDIA 3VE0A 3P9WB 2AZUA 5FYJL 1ZTMA 3H55A 1XZWA 4I4WB 3RFRA 3BPCA 4N5EC 4QXGH 5JIPA 4J1UB 3TF7C 1AG6A 4GMTH 5DTFB 1RUQL 3MRNA 3WN5C 3NCXA 4IRZL 3V4PB 1TTGA 5EULV 3BGFC 4LK4A 3UEZA 4WQOA 3NCEB 3MRIB 4MXQC 5EF3A 1JHLL 3AQDA 4ABQA 2Y9RT 2XVLA 3MBED 4B9YA 4N2AA 1ML0A 3M45A 1VZHA 3COOA 1KUMA 2JJTC 5L2KA 2DM4A 5EBLB 3RWCA 1P4LB 4FNPA 3QDJB 1XT5A 2Q3AA 1VFAA 2K7PA 4L8DB 4GG8A 5KYXA 4FL4B 2RHEA 4WKZB 4ZUSB 4BQ8A 3Q1SL 3PIQB 3RUGA 2RD0A 2VZVA 3O6LL 1XV8A 2A9AA 1UWGL 3CSGA 4XP6L 3M7FB 1OGAE 2D03H 3VDAA 4OLWL 4WENB 5IQ7L 4JPSA 2DJSA 4AI7A 3WHXB 4OGYH 5DCCA 1ID2A 1CICC 1AGEB 2GHWB 1E9OA 3EJYC 3MV9A 1T0MB 3RVTD 1XHHA 3GBNH 1TPXB 2DTSA 2H8PA 4Y2OB 3TH2T 2CDFA 5SX5K 4L9LA 1U8JB 3TZVA 3RZCA 2I32A 5M95B 1TITA 2VC2L 3ESOA 1TEGA 5GIRA 5I8EA 2GQHA 3NFPB 3A21A 4MS8C 2BFVL 1LWRA 3E6FB 2AAVA 3HG4A 3VXRB 4AQ1A 3P9LA 5HYJD 4TNFA 4Z7WF 2Y1ZA 4BA0A 3V0WL 1GC1H 3UERA 2APSA 3C5JA 4XP9L 3PU7A 5GQBA 5SWSA 3K6SA 3LKNA 5JQHC 3KM2A 6FABL 4FZ8H 3NVQA 2CO7B 2YJQA 1JZDC 3NP4A 4RRPM 3WGVB 4IU3A 4NZUL 5G36A 1QUNB 1FBKA 2OZ4L 1N3NB 4PRDB 3VXPB 4IGBA 3U4KA 5I66A 2UYLA 3PDOA 1SXSA 2OA9A 3SE4A 1QBLH 2NQCA 4M5ZH 1S46A 1NH6A 3CHOA 3N40F 4LLAA 5JHLH 3LH8A 5KYWA 3G6AB 3KM1A 4M7LL 2BY2A 3UTSE 5LGHL 3F83A 4NKMB 5C2BH 5AG9A 4PHZA 3B9EA 3BYTA 1FFPB 1JPGB 3VGAB 1JTTA 1ZTXE 5DK2A 4S1SH 4A7SA 1HXMB 3MJ7A 4LB8A 5DDHB 4A7TA 1M05B 4NPJA 3SZKC 4ZD3L 4Y1AD 4M1GL 4Q6YA 3X3FL 5LDSA 4GNKB 3ATFA 2EINB 1B0IA 4JRYD 1BF5A 1BBJA 2EKJA 1N8OE 1G7LB 1A3ZA 3GS4A 3L8QA 5D71L 1LNUA 4F24A 5GGUB 5IHLB 2OMUA 3NCJL 2XA8L 4N2GA 2Z4TA 2XA3A 3KAAA 2FAUA 3ARGD 4AH2B 3PJLA 1FVDA 1C5BH 4P07A 4I4WA 4P99A 3NIFE 3MRCA 4GH7B 1AZUA 2R8SH 4AOFA 2X38A 2QPFA 2ZUSA 4U6YB 4F58L 4JANB 3HZVB 4MZRA 5DTFA 3HMXH 1EHXA 5FEBA 2B2XH 2ZOKB 4AGMA 2O4EA 3VRLE 3V4PA 3WN6A 2MQGA 4QOKE 3UDWC 1P7HL 2ICCA 3ETTA 3QHZH 2EEBA 3QIUA 5BS0D 4TQHA 3T3MB 2AQRA 3DDGA 5DFAA 5IUCA 4FG6C 4GUCA 2XY2A 4G9DA 1XF4A 2A1WH 5GGTH 2AQPA 5B35A 1AO7D 2MQ0A 2HX7A 5DHVH 2WNWA 5EBLA 3K0WA 1H15A 3HN5A 1JIBA 2HRPH 4ZO9A 3ZYJA 4L8DA 2HCZX 3ZKND 1D5MB 4JREC 4B41A 5GPRA 3VVVA 5CUSL 3CZSA 1T0NB 4ZFFB 3EFOA 3GQFA 2OL3H 2CHNA 5DS8B 1CF8L 3LDBC 1EJOH 1IE5A 3DTXA 2D7QA 5C2UB 3WHXA 2AT9A 3G08B 5KYYA 3OJDB 4ZG1A 2Q1EA 1DJHA 2FEJA 4HS8H 4AEIH 5ITBL 2D7MA 5IBTH 4JO1H 4DFIA 3BWSA 3FCTB 3CAPA 2YQ3A 3WFHA 1ET8A 1UJ3C 3EKCA 4MJ6B 5KSBF 3A67L 1X5MA 3WY4A 4KKQA 2WWOA 2XXGA 4ZK8A 4HIHB 4U1HA 1NFIB 4RWHA 1PCXA 1FPTH 3FSAA 2C1PB 3HVNA 4I88A 4WAFA 4PJFF 4K23H 1K8DB 2BNRE 2X9ZA 3E6FA 3VXRA 4BELD 3VXMA 4G8EB 1ZT7A 1VDGA 2W65A 1NKRA 1TVBB 4HXAL 3CUPB 4RDQG 1CICB 3CVCA 3PGDB 5FYJH 2MNJB 4L1HA 1ASPA 3SKOB 1ZLVK 2CO7A 5EDSA 4IM8A 3ULSB 2Y1YA 1RUQH 1QUNA 3GPEA 4IRZH 3GEFA 1N3NA 3US0A 3I6KA 3OG6B 4ZW5A 3VI0A 3L3JB 3VXNB 1KELL 1NBVL 2DYRB 2XSKA 4OW6A 4UB0L 4M7LT 5TDNA 2ODIA 1CXKA 2XZCL 1D2PA 1FN4A 4IBQA 5JQ6H 3G6AA 3V6OC 2DM7A 8FABB 1X5JA 4KGLA 1ZE3H 2W95A 3D18B 3EJZD 1FFPA 1JPGA 3OKKB 3VGAA 3QFJE 3UBFA 4PHXA 2VSKB 3FH5A 4NLAA 2HN7A 4HH9A 1G7HB 5DDHA 5FF6B 1BQSA 1M05A 3H42L 1PLBA 2YQGA 5D7LE 2V5YA 4WWKD 4Q6IC 4WY7H 3ZIYA 4OI8A 5DXWA 3II3A 4OZHB 4I48A 1SMOA 3IWUA 2ZWNA 2BVQB 2GI7A 1HCVA 3O6LH 4KQ0A 3GSWB 4W9GC 4XP6H 2O6EA 5F89B 3O0LA 3RNKB 3C6SB 2M8XA 4DAJA 1SHXA 4OLWH 4WAVA 2XNAA 5IQ7H 3B2DC 3S4SG 2NY2C 2ZAHA 3MCKB 4ODUB 5E0FA 3QQ9C 4GKOA 4JRXD 5KBMA 4KNFA 1QFWM 1E2ZA 5E9DE 2EDLA 2R4SA 5CEZD 1EUUA 2X7LA 2QEJA 3VO0A 3A6BL 3WNPA 4U6YA 5B39G 5LG1A 4JANA 3KGSA 5AW6B 2I20A 4WHDA 2AMGA 1QABA 4GXVL 4BD4A 3V6FB 3DI3B 3DRQA 3KR3L 4JKNA 3E2HB 4BCZA 3GKWL 2VC2H 5AW2B 4Q52A 3DX2A 3ZR6A 4FG0A 2ITEA 2PW2B 1T3FB 1TYRA 1CTNA 5AYTA 4HLJA 2DH2A 1ZS2A 6CGTA 1BOGB 3QRLA 3ZMRA 4XP9H 3O41A 1E65A 1UWEL 5FM8A 1BVKB 1BQHA 3SO3C 3QUXA 4JBSA 4ZFFA 4QHKJ 2E7BA 3KH4A 1ZGLP 4JGMA 3L4ZA 5H2KA 3DPBB 2OZ4H 2F53B 3QDMB 3D25B 5DS8A 3H56A 4MD4B 4GINA 5HDOA 1SEQH 2APWA 3GLAA 3OAXA 2GUYA 3G08A 4GAAA 5FS5A 3OJDA 4M7LH 2Y7NA 4IBWA 4GXFA 5LGHH 2VDMB 2NY5L 1MN4A 1X5FA 2DQCL 3FCTA 3HBZA 3I9GL 1ZD6A 2AXGB 4OUOA 3BCFA 3SPVB 4MJ6A 1I8UA 5CIPB 1NMAL 5F9WB 4ANWA 4ZD3H 3AW5A 4JREB 1NFIA 4R5TA 1G7PB 3NS0A 2IH1A 2C1PA 4LSQL 3VXUE 3X3FH 2BVOB 4HF5L 4MDJB 1DQTA 1SYSB 2ADIB 1YMMB 1K8DA 1DCLA 4QNPF 3FSWA 4UI2A 3BUQA 5H4ZA 3NCJH 2XA8H 3DIFA 1QRKA 1CLCA 4MQXD 5CGYD 4HIJB 4KRPB 2DTML 5AENA 1TVBA 3QNFA 4Y9HA 3RX5A 3FULA 5IJDC 5TQ2L 3SKOA 2YUXA 2E46A 4RGNC 4HU2A 1HZLA 4UTBA 4FFWC 2NZ9C 3JT0A 3ET9F 3STLB 2QKIC 4K2UL 4W9LC 4X5XA 3GSVB 4EKJA 4F2MB 3FQ2A 5FYJU 1G9EA 4WGWB 4KVPA 3IS0X 3L3JA 3VXNA 2G3ZA 5A7EA 1VEPA 1ADQL 2AEWA 1UJTA 2K70A 3ZHFA 3FCSA 2YJLA 4NZTH 5F7HA 3ZX1A 3NRFA 8FABA 1EWHA 4QI3A 3U30C 1JG9A 3SDDD 2A4ZA 1E5YA 4LEBA 2FLRT 1X4ZA 3D18A 3OKKA 4TRPL 4WJ5B 1WFNA 3PE9A 4IB4A 3MSPA 4MQ7B 4FFYL 5D7IB 4WO4B 4IRSD 4NRXA 1G7HA 3KZ8A 5FF6A 1DBBL 3HG5A 1D5BB 2QQNL 3N1PC 3AG4B 4JCMA 2PMZA 3E3QC 4YHYB 4OZHA 3ZYZA 4WHTB 1EZSA 2BC4B 3BQUC 1KCKA 3OF6D 5CZXD 4ZMXA 1UXLA 3GSWA 3RNKA 1LEGB 2X4RA 4NEHB 3C6SA 1DVTA 1CF8H 4N8PA 4BZ2L 4PJXF 2F54B 4PRPE 4JM2C 3MCKA 2W38A 4ODUA 2HT3C 3V6OE 4F2FA 1JZFA 2IDQA 4G8IA 1IGFH 2WD0A 2ADJB 5GS2H 5ITBH 2O26U 1VIWA 2VMCA 1J0YA 4A2EA 1AGCB 2LABA 1DVXA 3NJVA 4WFFE 3VFVB 4P5SA 3GI8L 1VEOA 2RH0A 3A67H 3V6FA 4GI8A 5F44A 3D39E 3OLDA 1C9SA 4J27A 1BECA 4XPAH 4R5XA 4X9FA 3FQUA 4I8DA 1BEYL 2AXJA 5IHZB 4GBXB 3CSFA 4PRHD 1WYJA 2QFPA 2HUEA 3ZE0F 1MI5D 2WUBL 2EILB 3NIDB 5DGQA 3HBQA 4M5YL 4HKXB 4YXLL 1BOGA 3BCDA 2K6WA 3TNNA 2VR9A 5CD3B 2J21A 4E9QA 1JYWA 5J3HC 2JCCB 1BVKA 4K5NA 4YXKL 4PEEA 5C0IB 4ESKA 4G6MH 4W9DC 1J0JA 1UWFA 2AK4D 2F53A 3IFOA 4NSKB 1GKOA 2XWZA 4UM9A 3QDMA 1L3NA 5ISZA 3D25A 1KELH 3NQIA 1HE7A 1NBVH 1ZJBA 2KSBA 3QUGA 4LCWB 4MD4A 5FOBA 1YDPA 2XZCH 3P4NB 1MAJA 5TH2B 2AAAA 1AKJB 5CP7B 5ACMA 4ZFQA 1K9TA 3UL4A 4UIMA 3LXUX 4CL7A 43C9A 4IRJB 3BVVA 3UMTA 4BQCA 1OSYA 2VR5A 1C8PA 1TTBA 5D7JB 4RA3A 4R4ND 1E3FA 1VZGA 3ZDWA 4RX4A 3ZQWA 1KCVL 2W81C 4K07A 1A7NL 1GYCA 3H42H 5HHMB 5F7YC 3MJ9A 4K8RL 3TONA 1U9KA 1FWXA 4NUPA 2CDGB 3CN0A 1IE4A 3RTQD 5E1QA 3QULB 1XF3B 2BVOA 3PF2A 4MDJA 3AXLB 4G42A 4HSAC 4Y19D 1SYSA 2ADIA 4A68A 1U2HA 1YMMA 2ZG1A 3VSUA 1F90L 3N44B 4PV8B 4UUJB 4BINA 5CFHA 4X80L 3OPUA 1C5CL 4HMCA 4LGSB 3TLRA 3IDGB 5B1CA 4G83A 1A7OH 2PO6A 1DN2A 2BCKA 4JKMA 4PRIB 4AMXA 1F4XL 1SXNA 3EBIA 4L3ED 3A6BH 2XZQH 3U7YL 3UP6A 2B1OA 2L0DA 4QI1A 4B53A 2D3VA 3STLA 4GXVH 1DBML 7FABL 3KR3H 5AAMC 1MHCB 3GKWH 2L8AA 3O4LE 3KLHD 5IJCC 1R6VA 2K78A 1TQBB 3S35X 4DN4L 3K6IA 4HJUA 3O2DL 3T2OA 3WKQA 1S7TA 2WXJA 3NACH 2P44B 4LFHG 5IUSA 1VCBC 3P40A 1UWEH 5D7IA 3PL6C 4OGZA 4X9HA 3BSZL 4YR6B 1D5BA 1AOZA 3OKLB 2I24N 3QAZC 4OM0L 3NOIA 4QKTA 2X10A 4CC4A 2VR6A 1PEWA 2VE6B 2IGTA 5IWLA 5CP3A 4JGNA 4I77L 3ZTDC 1JNJA 3QJHA 3THML 4UAHA 2F54A 3S48A 3DX9B 3I84A 5JOPE 5F1OB 2ZPKL 4R84A 5KS9E 3UJJL 3W9EA 2NY5H 1B4LA 3WEAA 3CVDA 2Q8AL 2DQCH 2XHNA 2LLGA 1AGCA 3I9GH 3O6ML 3C60D 2GJRA 2ZZLA 3VFVA 4EXKA 2HG0A 3F7PC 2IOOA 5DJ8B 1NMAH 1YCSA 1LQSR 2F7OA 3E3QE 3IDJB 2MTPA 4ZW6A 1ZPLA 4JB9L 1SOXA 3NRQA 4LSQH 5DD6A 2BP0B 5IHZA 3UZQA 4GBXA 3T3PB 4LESA 4M4PA 1IC5H 1RSFA 5J6SA 4HKXA 5FUZL 2A73B 3O8XD 2AABL 4D7PA 4APQC 2WBJD 3GHEL 1GUEA 2O5XH 4FLOA 3MBEB 1LEIB 5CD3A 2DTMH 2LTQB 1YECL 4WK4B 1E90A 1KEML 2JCCA 1NLDH 3DX3A 4DZ8B 1FVEB 1QA9B 4PAZA 2CK2A 4XXCA 5CJ5A 1LP9F 3VGEA 1OL0A 2CBPA 2X4SB 4K2UH 4PU2A 2GT9B 3O0RH 4RRPA 2WO4A 4NSKA 1BIIB 3Q1EA 4YBHA 1ADQH 1BPLB 2WQVA 2WM0A 2ZUWA 3P4NA 5JPMC 5TH2A 4PWIA 3MR9B 1MFAL 5CP7A 2CJ3A 1QI5A 4YDJB 3FB8B 3ABWA 3VGFA 1JV6A 5CJOL 3RVUC 4IRJA 3MLSH 3F7RA 3QFDA 3B7UX 5D7JA 3QUYD 4XPHL 2DQEL 1DBBH 3Q13A 4JUTA 2OMBA 2QQNH 4ALAC 2JI1A 2Q9OA 4NCC2 1JDCA 2BIMA 2Z9TA 4MNQD 4QF1A 4N0CC 5DZPA 1XF3A 4YSEA 3LSOB 5LHDA 1BWMA 4QD2E 2L7UA 3UZEC 3OD3A 4BZ2H 4UIKL 3OZKA 4ZAKD 2PP8A 4J3OG 2XWBB 1AD0B 1Z9SB 1TTUA 4POZC 2I9LB 2P80D 1NAMH 3AXIA 3GMPB 4WFGE 4AQEB 1PL3A 4YX2L 3TIEB 1AP2B 5DHXB 3RZWA 2YAMA 4H8WC 5C0GA 5C8JB 2ED7A 3BC9A 4XB8A 5L88L 2WYZA 3CBJB 3UJIH 2X3CA 5BW7C 4JE4B 2QGDA 4J7RA 2ZXAA 5IQ9B 4HEMA 3SCMD 1MHCA 4OJFL 5AVUB 5CXPA 1ZLDA 4F15C 1GGIH 4CC1A 4HZ1A 1RK7A 4WUUE 5DJ2A 5AOIA 3C5ZC 1BEYH 4UWQB 3N2JA 5DJ0A 3AQZA 3QXTA 5LGYA 5B6XA 3AXHA 1XTMA 2WUBH 1A3QA 3X3GL 4M5YH 4YXLH 1KV7A 3CMOL 1N70A 1OAZL 2ENQA 3DUHA 5HHOB 3KDPB 4B95C 1XR9A 4IJTA 5C0FA 1OGAD 2IFFL 3A6CH 4YR6A 1OHZA 1DDHB 1SGKA 3ARPA 3GK8H 3KXFA 4QRUA 4MRCA 5DLML 3FN0L 3ZE2B 3IB4A 4NOBA 4PJHF 4HLZG 4JY6B 3KVDD 5FUOL 3PAYA 4GT0A 3QZWA 4LPTA 3UTZB 4JHBA 4PI2A 3DX9A 2WIIB 4E42A 3HFMH 1GZQB 1SBBA 1FFRA 1EGJA 3GD1C 2KS9A 1S7WA 1T2JA 2BSCA 2DQMA 4RMSA 3VRIB 3UTWA 4LHUD 5DHDA 3ILDA 5E1GA 3CQFA 4EUPH 3ARGB 3EDDA 4EIGB 1NPUA 1UUNA 3MVSA 5DJ8A 2J5LB 3V0DA 1ETA1 1A7NH 5LO7A 4AT6B 3BEVA 4NN6C 4K8RH 1I3RB 2NY4C 4KKZA 3QAZB 4R5VA 4QO1B 3UGUA 3ZO9A 4MA8L 2BP0A 4KROB 4PS3A 2X0UA 4KPHH 4QUOA 5DFWH 4Z9KB 5EOCL 2R1XB 3ILPB 2FYYB 1F90H 5T1LD 2FT7A 3BT0A 1C5CH 2ROYA 1O6SA 2A73A 3JTSB 2P46B 2WTPA 4JFEE 4OCNC 3MBEA 1LEIA 2HKHH 4JPKL 3ATAA 2AITA 3UBXI 5FOJA 2IGFL 2G87A 2FX9L 1AO7B 4XTRD 1S7VB 1VFBB 4DZ8A 2VUKA 1FVEA 1S5IL 3U7YH 3ZDZE 3FRUA 5A2LH 2ICWA 3REWB 1S9KC 1MG3C 4A7QA 2X4SA 4JM4H 2ZYHA 3FPXA 3H4FA 3TA3C 3UTSD 2GT9A 4BVNA 5DHGA 3H9HA 2OW6A 3RGBA 1BIIA 4HUKB 2UXGA 3S37L 4TQEL 1I8IA 1BG1A 5EEWA 4Z3EA 1BXXA 2JQMA 1TT6A 4PLKC 4XOBA 4GI9A 2H7WA 2LU3A 5IESL 4DN4H 3TEWA 3FB8A 3RIKA 3BDYL 3O2DH 5DHHA 3PXJA 3T4AB 2ZUXA 1VJSA 3CCHB 3N43F 5JIDA 1UM5L 1WIOA 2XN2A 2AKRB 2CG9X 1AY1H 1ZA6B 3DBXA 3GRGA 2NUPB 5H2LA 2B3RA 1CFSB 2P28B 4BKTC 3C5SB 4EN3B 1A9EA 4OM0H 4ANUA 3HG3A 1WBZB 1H3VA 3DXAB 3EDFA 2EEDA 2X53A 3LSOA 4G2AA 3AABA 5CLXA 1JXDA 3VYNA 5CCJA 2BZDA 2UUDH 1ODUA 2Q7YA 2I21A 3TN0B 4LDLB 4BK5A 1AR1D 1NCBL 1K72A 2B4CC 1AD0A 3C5XA 1Z9SA 1FHGA 3NJNA 4QTFA 2WXLA 2I9LA 4BZYA 2ZPKH 4AKPA 3VH8A 4AKQA 3POCA 5EZIL 3RUGF 4QOKD 1A25A 4QRFA 3TIEA 4Z23A 4UZGA 1SBSH 3LXCA 5HYJA 4PY7B 3E7JA 1AP2A 2CH8A 1YNKL 1OTTC 3IF1B 5GGVY 1KGBA 3RWHA 3DO7B 5DUBB 3S97C 4LCCB 2EVIA 2WVTA 1YC8A 3ARYA 4XO9A 3TEUA 2OKMA 2J8HA 3INUL 4JB9H 4UTAA 5JIKA 3QFGA 1DLFL 1XBDA 4B3EA 1LO0L 4Z5RA 3UG3A 5I1KH 2G9KA 2HJLB 1IKNA 4J3OC 5DI8A 4XNAA 2O6FA 1HH6B 2JMRA 3W38A 1OAJA 5FUZH 3QJVB 1HINL 1YECH 5E8DL 4UU9B 5CNHA 5FW6A 4ECNA 1KEMH 1AZZC 3PWLB 2YC1A 1QR4A 1UT2A 1DDHA 1JWUB 3NGBB 4JJOA 5HI5D 5ALCL 3SGJC 1MWOA 1A5FH 4PRNB 5E9NA 1N8ZB 3V4PL 2XIDA 4GLRH 4JY6A 5DFTA 4WWKB 4RISL 4Y1AA 3C08H 3AU1B 1HZHL 3UTZA 4TLUA 5EZPA 4XNZB 3JV6B 2WIIA 1MFAH 1PFCA 3WQJA 2WB7A 2EVJA 1GZQA 1MCIA 3FOMB 2ZUQC 5CJOH 1MCWM 1EFQA 1RUML 1NJ9B 2XXMB 3ARGA 3N0PB 2WVVB 1HILB 1JV2B 3I9AA 4XPHH 3Q3GA 2EUZA 3S3CB 1DVSA 3V0AC 3OMAB 4XBEL 4RMUA 4GKZB 1I3RA 2NNFA 1MCNA 4JZJA 2WLKA 3SPHA 5DA4A 3BMVA 4WCYL 4QO1A 5F6IB 3SBWC 1CF1A 3ZTCC 2AS5M 1KJ2L 2FB4L 5ABZA 4PJEB 2R1XA 3ILPA 3MX0B 3IDMA 4AJ0A 3NFNB 4NNYB 4JHAL 4UIKH 2I27N 5BS0A 4JQIL 4IBYA 4YHNB 1WPCA 2BPBA 2CJSA 5EOQH 3WMPA 4YX2H 4FD0A 1S78D 2CLVA 1AO7A 3VI4E 1S7VA 4FRWA 1MG2C 1P84J 4HK3N 3ZDXB 2QKSA 1V7MH 4WU5B 3OE6A 1ED3A 3REWA 1WF5A 3TO2B 4DHLA 2D3LA 4X4YA 1ZVSA 3BI9X 3B7TA 3UCQA 3HHSB 2WC7A 5E5LA 4Z7OB 4OJFH 3ILQD 3QFJD 1UZGA 3EJCA 4YHIB 2VL5A 1KJMB 1W0WA 4NNXB 5D7LD 3HBPA 5F1IA 4CUCA 2VT0A 3CMOH 1OAZH 2IWFA 3T4AA 5KVEH 4L8CB 4FC3E 1BWWA 5C0CE 1MW3A 4QT5B 4RDBA 3VXSE 1WH0A 1MY7A 2AEPH 1CFSA 2IFFH 4WDIB 1EAQA 3UZAA 2MEJB 4Y5YB 1EJ6A 3QQXA 5EO0A 1AYRA 2WPGA 3FN0H 4AGOA 1WBZA 3V79C 3DXAA 4L9DA 3ARVA 5E9DD 3TA3B 5AAWA 1JGDB 2GIMA 3WEMA 3GUTA 4N6RB 2ITCB 3WY3A 3PWUB 5FUOH 4HSCX 4LDLA 1H8OA 1BOYA 3TN0A 5C92A 5J5EA 3HJEA 4M93C 4F33A 4DCQB 2E27H 5FC9A 4NDMB 4JO8A 4HUUB 6PCYA 1IGYA 1M9WA 1Q0XL 4CA4A 1N5AB 3W0WD 4PY7A 1SXBA 3IJHB 1COBA 3DQBA 2KZWA 3L4CA 4NFDA 4G8FA 3DO7A 3TA4D 3TT1H 2JFCA 1PSKL 5DUBA 3NJFA 4LCCA 3RA7L 2VZ1A 2GSMB 1BQUA 5GRJH 1YEKL 1NGWB 2I1XA 3IT8D 1BFTA 1GCFA 5A2JH 3FO2B 3ARWA 4AG4L 3H85A 1X4XA 5EOCH 1A6PA 1ZT1B 3LN4B 5AWNL 5GS0C 5A2BA 3MV11 4MTMA 1HH6A 4NQSA 3UTPE 4AC2A 5FGCB 3AFLA 2YIHA 5E8OB 1FNHA 3WE1A 1U41A 3QYNA 4UU9A 2R4SL 3NCYP 4K5YA 2IGFH 3PWLA 2FX9H 5DMJB 2AJUL 1JWUA 1S5IH 4PRNA 1RXLA 2FT8A 1N8ZA 3HC4H 1NOFA 1G1OA 1VHPA 2JH2A 2FEEL 4H1LB 3F84A 4WWKA 3S37H 4OLZL 4TQEH 3VFOB 4DSYA 3R18A 2J8OA 3AU1A 2Y24A 4CVZB 2O5YH 4FJ6A 4YHPB 4WEEA 3EUDA 4PH8A 3ABMB 5IESH 3SDXB 2VDQB 2OMZA 3BDYH 2BOBB 3FOMA 3VXUD 1E30A 3DVNB 3DO4A 3L16A 4AMJA 1AZRA 1QBML 1UM5H 2VDOB 2VRKA 3ZUCA 3H9SE 2WVVA 2NPLX 2H0JA 4AMKL 1KEGH 4E5XB 1HCZA 2G0LA 3KPTA 3QCTL 1URIA 5AZ2L 2F74B 4QDGA 4X6FA 4PJEA 2FEDD 3UYRL 1SFHA 3MX0A 3N42B 3UACA 3CSPA 2BK8A 3T0AA 2K3HA 4MMYB 1YY9C 4YHNA 1H68A 3FO1B 1BIHA 2YEVB 35C8L 1JOIA 5JOFB 1TFPA 5EZIH 3S5LG 1MI5B 1AIZA 2CBMA 2WO2B 4OFIA 5GS3A 1AS6A 1U6AL 1E42A 5AOZA 4ZNEA 5BZDB 2ZSVB 4WU5A 3TO2A 4QCIA 4FXLA 4FQ2L 4U6XB 1W72L 3IDYC 1FQ9C 5TK4A 3DYMA 4ZS7L 3U48A 4NQEE 5FYJE 3RY6A 2MNUA 3INUH 4PYHA 1NINA 4YVUA 5C9KA 1X5GA 1LK2B 1DLFH 1EJFA 5C08E 1YZZA 1LO0H 2N3JA 1SDDA 1KJMA 1PY6A 1AS8A 4NNXA 1HL8A 4DVRH 2R0WL 1E8WA 3SKNB 4Z7WE 4EIBA 2EC9T 2C3VB 5JIIA 3BKMH 1SXCA 4Z78B 1HINH 4BGDA 2KLRA 4L8CA 2AJ3A 4OLXL 4NP9A 4GO8A 2FYVA 4QT5A 2J72A 2DWSA 1IT9L 4WDIA 4Y5YA 4FNQA 1WFUA 4PRPD 2NLJB 4FNRA 5ALCH 4Z7NB 4PJ6A 4ZTPH 5TD4A 5F7AA 3BH4A 4NC3A 1YHPA 3K5RA 3QRFM 2BHFA 4N3TA 4OCSL 1UTDA 3GB7A 3ES6A 4RGMC 4WFFD 2ITCA 3RTQB 3MRDB 3FDWA 1A7RL 1IC4L 2GTZB 4ODVL 3WJJA 4Y19B 5E2TL 1RFDL 1I1AD 3O45B 3D39D 3UTXA 2JKNA 4HUUA 4DO6A 4ILDA 1KIUB 1N5AA 2IANE 3VHZA 2DV6A 1Z3RA 1RUMH 1UWYA 3HRZC 3UJTH 5DJZB 3LRKA 5BRZE 4ONGL 5DZNA 4XBEH 2NY2D 5SWZB 1RK0A 5INDB 1NBYB 5G54A 5I15L 5SV3A 4BFBD 1DZ0A 5BMFL 5LWYL 1KJ2H 2FB4H 5HGBB 5KZCD 4U4IA 4I1PA 2GVYA 1ZT1A 3MRJB 1T2XA 4QRSB 1ULVA 3T77B 4DS7E 1WSST 4GJTB 4JHAH 2ERJC 4KKAC 1OAQL 2BSDA 4JQIH 5E8OA 2WGNB 4XMPL 1KXQE 2DLGA 1EEQA 2EIKB 2C9SA 5L2JA 3EUUA 4DEWA 5LLIC 3SDDA 2XZAL 2UZXA 3S0PA 4DP8X 2BWQA 3KPSE 4Y2DD 4G7VH 3RHWK 3HZKB 5FB8B 1H3PL 4QHNB 2Z7UA 2GJ6B 3QNXB 3VFRB 5I6KA 1J8KA 2QL1A 3F7QA 5JIMA 1NCDL 3VFOA 4ZS6C 2PP9A 2YGOA 4XVOA 4K3EL 2FD6L 2C9XA 5IQMA 3N1GC 4R96A 3UO8B 5IZ7A 2WCPA 3UX9B 1P7QD 1INQB 3LPPA 3OF6A 4YHPA 3NFSH 4N9OB 3DI2B 4POUB 3SDXA 3MRLB 3VXTA 2BOBA 5HSFA 5DC2A 2CZNA 3DVNA 3GLDA 1Q38A 2EKSB 4FXTA 4WV1C 1JXFA 3WU1A 1IAKB 3TV8A 3EO1B 4TSAL 1UWXH 1H9VA 2LT9A 4KI5F 5CF3A 1NIBA 3NEXA 1DVYA 1QWUA 2HRLA 5DVLA 4BFEA 1KDIA 4DQOL 1EAOA 2VLLB 3RL2B 1QFPA 4FP8L 1H3XA 2VXSH 2F74A 4NO0D 3ETBF 1T89A 1GOFA 3N41B 4Y4HB 4DAGH 2FGZA 1IC7L 4L3CB 3J27A 3KPRE 1J10A 4OZHF 5IBUB 4PRHA 4C4KO 2QDWA 1MI5A 1ZCRA 4IMKC 5HVGB 3O4LD 3QEGL 1BDYA 4KKNA 1IX2A 1MCHA 5A16B 4P5TC 1F3DH 3CD4A 2ZSVA 1I9RL 3ARDD 1F3RB 2J55A 1UEYA 4O2EA 4U6XA 1PSKH 1ZSHA 2OYMA 2VSMB 2OMYA 3D0VB 1SMDA 4OFKA 3BYYA 4ORZC 3RA7H 1ND0B 3TVMB 12E8H 1YEKH 2AXWA 3U25A 5BCAA 4KX7A 4PBXA 1LK2A 3S3BB 1ASOA 1U2CA 2AK4A 4PJ5E 4AG4H 4EUPG 4PJDE 4RGND 5AWNH 4F57L 1MREL 3P69A 5IVXB 1WS8A 3SKNA 1XL6A 2NZ9D 1OAYL 4JDEB 1Q90A 1DVQA 4LLYA 4Z78A 4XNYL 5C86A 5E1HB 2R4SH 4AZ8B 2AVFA 2DOCA 5C3LD 3L3OC 2QVFB 4X1HA 2AJUH 4TV3A 4XOAA 5JOPD 1B0GB 2KQNA 3DV4B 1XSJA 2W60B 1RIHL 5CR8A 3GPSA 5F7BA 1NIAA 2FCBA 5C0BD 4OLZH 5TJWK 3B7SA 4M7KL 2BXYA 4MNQB 1ZRUA 3RTQA 3MRDA 1MPAL 3MNWB 1JCVA 2GTZA 2NR6A 1GZHC 4Y19A 4MCNA 5FX3A 2QVIA 3ZY7A 4FS0A 5LCVA 4X6DE 1JE6A 1KIUA 1RJYB 3IJEA 1JZ6A 3QUMB 3W3BA 1QBMH 4YL4A 3D30A 5TPWL 4EDXB 5DJZA 2YMOA 4I85A 4IOSD 4X9IA 4OU3A 3IJ8A 2BP8A 3LRSB 4JM2D 4MJJA 4TQPA 4AMKH 1G4MA 3BRGC 3FL7A 4UV7L 3QCTH 5JJNA 3FMGL 3OE8A 5ANHA 5AZ2H 2B9BA 2DD8H 3Q9PA 5HGBA 3FQXB 3BFWA 5I2IB 3UYRH 1KMGA 3RI5K 3T77A 4QRSA 5AUMB 3BLPX 4C54A 3QJTB 2XWTB 2VDLL 35C8H 4DN3L 2HP4A 4CGTA 2DDQL 3N55A 3DX8A 1ZVNA 5CJXC 2CJUL 2FWUA 5IM7B 3N04A 3NESA 1U6AH 2F5AH 4U7MA 1AYOA 1T1ZB 1OANA 3CIAA 2PCFA 4CGUB 1CWQA 2CNYA 3HZKA 5IHBA 3AWGA 1T66C 3VFRA 2GJ6A 2Y7SA 3HRZB 3QNXA 4XWOD 1W72H 3A6OA 1BZ9B 1WHPA 3BN9C 1EERB 3EF4A 4ZS7H 4HP5A 3CFQA 3L5WB 1EFXB 1QFHA 3S9DB 2C9AA 1XIOA 1INQA 2WAQA 5HGGS 3K1DA 5AX0A 3ZDYF 3GSRB 5B22A 5DHMC 4M1DL 2B77A 2R0WH 4NJAL 5J6HB 2X4PA 2PPCA 4WTXA 1IGTB 5KBLA 5E6YA 3MRLA 4P2OC 3MUHL 2YFOA 1HL4A 5I1CL 2D4DA 4OLXH 1AT9A 4PGEA 5IB4B 3NZHH 5FGBA 4BZ1A 4AXWB 2D4FA 3FB6A 4LHUB 4RMBA 1N0LB 1NGQH 4W9KC 3IXTB 1BMGA 3DYPA 3C9NB 4WFGD 5HHXH 1TQSA 4HWZA 5B1AB 1E5UI 4HC1L 2E76C 4OCSH 2G30A 3OXSB 5DWUL 2ZWSA 4Y4HA 4BH8A 4JHWL 4MAYC 4LPVA 5F72S 1A7RH 4ODVH 1ZGLM 5E6UB 4L3CA 4WSGA 2F8XC 4UNVA 2ALWA 4UT6L 3B8YA 5BPPA 4LU5H 3BZ5A 1SVCP 1URLA 1RZFH 3EGDB 4WIQA 2I7OA 2QGBA 3NY8A 4U1NB 4WUUD 4I3GA 4D9QE 1YAZA 1CD1A 5DT1L 4WV1B 3TT3L 2MFNA 3D0VA 4OD1L 4ONGH 2KZBA 4PLOB 4FG4A 4PGDB 1II4E 1ND0A 1MLBB 3EJTA 4ZPVA 5LBSL 4BUHA 1LE5B 1KENL 5I15H 2VDKH 3BKYL 3FO9B 1MHPL 3UTSB 4X4XB 3NABL 3QDGD 3KWWA 5IVXA 4RMQA 1JMXA 2Z31B 4XVTL 1OAQH 4JDEA 4UMGA 3BAJA 4XMPH 4IDJL 1MUJB 2D3NA 1IFGA 2OYKA 4X5RA 3OHXB 4AZ8A 2XZAH 1L9RA 4CU6A 4FABL 5ICZB 1X5XA 5BO0D 3DV4A 1R24B 2ZG3A 3ZE1F 2ATKB 2W60A 2BNQB 4IOFD 4P5TB 3KVPA 2RIKA 1IBDA 3BDBA 1F4HA 5DQ9B 1JUFA 1NCDH 3CDZA 1NQBA 3D6GA 2ID5A 4UANA 5AHZA 2FD6H 4K3EH 4MNQA 5EBGA 1W0VB 3BP6B 3MNWA 3PL6D 3TP4A 1XCXA 2M1KA 4KK6D 2IIJA 1DUYB 3NIFB 1S9WB 3HPLB 5LAPA 2BHZA 4KQ3L 2NNRA 1RJYA 3DSNB 4ZAKA 1J8RA 2AQ2A 3QUMA 4XP5H 2F8VA 4EDXA 1TSHA 3MRQB 4MAZA 1CCZA 4QOKB 1ZXKA 4PJGB 1KBGL 4JFED 4J8RB 4DQOH 3IYLW 2CKBL 4GQ9H 4ZMWA 1ZLEA 3UFIA 3WD5L 4JG9A 4PCKA 4A6YL 5GSRB 3QJRB 3EHBB 3VG0H 5I2IA 3LB6C 3MREB 3WEOA 4PJXE 4Z7QF 2XWTA 1IC7H 5EOCJ 4FXGB 2NNAB 3D3VB 3SBRA 4LCUA 5D2LE 5FYKU 4G5ZL 5DS1A 3WJMB 4IDLA 3DOSB 5GRYA 2J44A 1PFOA 2WJ5A 3QEGH 3S3SA 2WNXA 4N0RA 4IKLA 5H94B 2EECA 1I9RH 1KGYE 2YN3A 4ABWA 1OGAA 4BV1A 4PBWD 1BZ9A 4APQD 1O75A 5BV7C 3L5WA 4WNQB 2WXKA 4KBPA 3VSVA 3K74B 4LMQI 4F57H 1P5UC 3NSXA 5MI0C 1MREH 3BEWB 3F7YB 1IGTA 1OAYH 3OAUL 2C7FA 3UAJC 3EJJX 5IBLC 5IB4A 2YOCA 4YDVB 5GZOD 2WZ5A 4B9CA 4LHUA 4HCFA 3U36B 5DD1L 3SO5A 4JCLA 4FA6A 3C9NA 1RIHH 1DVZA 2BNRB 4XN1A 5DFVC 2IG2L 2ADFL 3RVUD 1GYAA 3ECBB 3OXSA 4O4YL 5IF0B 4M7KH 4HBCL 4AW7A 1MPAH 5B21A 4G70B 2TRHA 5CSZB 3AITA 1OP3K 5H2OA 2EICA 4YSRA 3BZ4A 4PPTA 5A40E 5D2NC 2GEQA 4P59L 4U1NA 1IJNA 5TPWH 1WTLA 3BW9B 2O30A 1CDUA 1IAIH 2E56A 1RZKH 2ZXQA 5CCKL 3SE9H 3FUEA 3LEVH 4JMNA 2YK1L 1MLBA 5T1MB 3J7HA 3OLGA 3PWPE 2X3AA 4NJ9L 4JFZL 4UV7H 1IIKA 3FMGH 2DQ6A 3FT4B 4L0PB 3FO9A 3RZEA 3UTSA 4H0HB 1TENA 1ZOXA 3QI9D 1A6AB 2ZP9A 1QATA 4JPVH 5DSCB 3ZLQC 3BXNB 3Q8EA 3QFJB 3NQKA 1GOHA 2VDLH 5ETUA 4DN3H 1MUJA 5D7LB 1A6ZB 2CJUH 2IXQB 3OHXA 3HAEA 3AWEA 4M6ML 5IGXL 3GRWL 4P3CL 3C5ZD 4CSZA 1QFWL 2FZ3B 4MRBA 1R24A 4K71B 2V5SA 3QIBB 3EW3B 3SEPA 4L05A 4BSVB 4A2GA 4NUGL 5DQ9A 4N0FB 4N2IA 2F1EA 3ME0A 1W0VA 3BP6A 3H7BB 3AMLA 4PV9B 1IVLA 1ZPUA 4M1DH 1KB9J 1S9WA 3HPLA 4NJAH 3CN3A 1OCZB 1SHSA 3DSNA 3MJ8B 4N2CA 1EVUA 5D6DC 3LNHA 2PWGA 2ZCHH 3D2TA 3A24A 3MRQA 4QOKA 1J1OL 2HLFC 2X1PA 2CD0A 4GKLA 4PJGA 4YHLL 2IOMA 2WZPA 2FHBA 4OCMC 3LNIA 2VRAA 4OV5B 4XC3L 4G7SB 4HC1H 3MREA 5DWUH 5IVOA 5IREA 3ATBA 4JHWH 2V17L 3JT2A 4XCEA 3F6IA 3L54A 1G9NC 4FXGA 1QG3A 2NNAA 4UT6H 4TKWA 2UZIH 4M6OL 1UATA 2NY4D 3U4EB 1A4CA 3DOSA 2ENPA 2VLJD 1WBYA 5ITCA 4X42A 1U58B 2IBZY 3NG5A 5H94A 2IPUK 1DEDA 5DT1H 2BP3A 1F00I 3TT3H 4WEBL 1FP5A 4YFEA 5CLZA 3C75A 5LBSH 1TJHH 1KENH 3W57A 4EN2A 3S3JA 1OIOA 2XG5B 2EH8H 5IR1B 3CC1A 3EO0B 3H53A 1MHPH 5TTRA 5C0CD 1FH5L 1AQMA 3VXSD 4WU7A 1KZQA 4M5TA 5CILL 3BEWA 7TAAA 3F7YA 3MV8B 3LZNA 2XTJC 1FYTE 1KF9B 3OKEB 5T8IA 4IDJH 1MJJA 5G4OA 3VD2A 2ZOTA 3KJ6A 4ELMB 2AHIA 4XXDB 3NCWA 1UGNA 2RFXB 3BVUA 4FABH 3VXUB 2G4GA 4PLKD 4WFEE 1PBYA 1R3IL 5BQDA 2BNRA 3SDAB 3X13B 4F3FB 1KTCA 1E12A 1DFBL 2NXYC 3SBQA 1N6UA 5I9QC 5TE7L 3HRPA 3OQRA 3BD4A 4JFFE 5CSZA 5IG7A 1JK9B 2D9QB 3ARFD 3B34A 4KQ3H 4WJG3 2HTKC 2Z4QB 2XDHA 4X7TB 2YMXH 3MC0A 5D70H 1P9MA 2Y5EA 3SB3A 4YDKL 4U1MA 5T5FL 5HPOA 4AYGA 2B20A 1F1GA 3UTPD 3MGTB 1AHMA 3GLEA 1KBGH 4R7VA 3V2AR 1F3DJ 1MFCL 2Q76B 4FMFA 2XC8A 1R4XA 1BSIA 2CKBH 2DWDB 3HA0A 3FT4A 3MAWA 3OJVC 3O3BB 3BP5A 3R4RA 4M5SA 3IMSA 3WD5H 4A6YH 4I18A 2Y2WA 3CXHK 2PXYC 4JCWA 1J05B 4NO3B 4AYID 4YDZA 1A6AA 5DSCA 3AGVA 3BXNA 3SGDI 1A6UH 3QFJA 3TTYA 4J3BA 3S8FB 1IV8A 3GXMA 4I2XE 1FNEB 1YG9A 1IUZA 4L8SC 4WW2B 1QLEB 3OX8B 2HUHA 1XAKA 4G5ZH 3OC8A 5D7LA 1SMAA 4ICXA 1A6ZA 3B3IB 2E8YA 2IXQA 2JI2A 4MD5B 4AC4A 4FNUA 3WCYA 4J3OD 3GMMA 5KJ7E 1CQYA 4OTXL 1PDKA 2B59B 3C6EA 3MO1B 4L5FL 4L4VE 4PRPB 3MYJB 4KHTL 2RTTA 2LHAA 5I16B 3H9SD 3H7BA 3BP7B 1IBYA 3MOQA 1DVFC 3QORC 4PV9A 3VNZA 5E9DA 2EC8A 1N12A 4QHUB 5I0VA 8PAZA 1S4IA 4G71B 1YEDA 5HYSA 1SXAA 3HAOA 3D87B 2QADB 4KKCC 4IKKA 4N8VG 2IVFC 2VTFA 1PD6A 2WXMA 1I1AB 2O6DA 3D39B 3LAFA 2OPCA 3VGGA 3BWUC 2QHLA 1G6RA 1EK3A 1T83A 5L0QB 1ZANL 5DD1H 4YHOL 2JE8A 4JO3L 3D4ZA 3W82A 4BFGA 4OV5A 1CE6B 4YLQT 2IG2H 2ADFH 3OMNB 1CXFA 2H26B 3KCWA 4LSVL 4ZT1A 5HDBB 3ZBMA 4O4YH 4FADA 3GGWA 2XWRA 1NGYB 4HBCH 3IBEA 4HS6A 1FCGA 5AVWB 2X4TA 5I1EL 1NOAA 3D48R 3U4EA 4HYTB 1CGVA 5KBKA 5HJ3A 5FYJD 3E0GA 1U58A 4P59H 5T5NG 5C08D 1EPFA 2ZP8A 3JUYA 3BJLA 1A3LL 3JZ7