4G70B

Structure of recombinant cytochrome ba3 oxidase mutant v236t from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
source organism Thermus thermophilus
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant V236T from Thermus thermophilus
rcsb
total genus 51
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4g70B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4g70B02
3NSBA 4DAJA 2CUAA 4ENZA 3CAPA 4EA3A 2YARA 3GYRA 5B7FA 3UONA 3VI0A 2QDVA 1SHWA 4KOBA 5I6NA 4GP4B 2YAPA 3WNJA 1KBVA 3HAQA 2BO0A 1ETJA 1CC3A 1L9SA 2IH9A 3T9WA 1PXRA 2UXGA 3VG9A 1ZIBA 2GI0A 2HXAA 5PCYA 5F7BA 1X0SA 1JZHA 1M56B 1ASPA 1TN5A 4FPDA 2NRDA 3IN0A 3ERXA 2ZZLA 1BQ5A 1AOZA 3UTYA 2J57A 4UANA 1L9HA 2L6XA 4DP5X 2PP8A 2DWTA 4QI1A 5A7EA 5B6ZA 4IAQA 3KW8A 4P5SA 2QPEB 3FYIB 4HHGA 4NAJA 1IUZA 4MQTA 1NICA 1GSKA 4BDVA 1JZGA 2IWFA 1N70A 1QM8A 1E65A 3QBLA 5LDUA 1ASOA 3EH3B 4GYCA 3QJVB 2DYRB 4A2FA 2FQGA 1A4BA 4K5YA 3PCYA 4BDVB 1L9OA 1BEXA 5I6OA 2I7OA 4HWLA 2PCYA 4NB7A 1GS8A 1NIEA 5D4HA 3ASNB 3QAKA 4DP9X 1JZFA 1EHKB 4QKTA 2FQEA 3QPKA 4TL3A 1M0LA 2GIMA 5B1AB 1KV7A 2GC4C 1X9UA 5G28A 3OM3B 4JHVA 1X9RA 2ZONA 3FQ2A 4UAHA 4YVNA 2LNLA 3GXUB 4N4WA 5B6VA 2IDSA 3H56A 4F2FA 3COCA 3AG1B 1JXFA 1ASQA 3S3CB 2OCCB 3DQBA 4MBSA 2PCFA 3PAVA 1T5KA 4M4RB 4ZK8A 1AANA 1L0MA 1RZQA 3NJLA 3FPYA 3ZIYA 4K9JA 4AKPA 4GRVA 4FAAB 2EILB 3X1NA 2YDVA 4PCYA 5AFAA 1ET8A 4LDLA 2M3GA 4QRYA 3REYA 2ZFEA 1JFPA 4HAKA 2YAQA 4YSAA 2H5UA 3WKPA 3VGAA 3TBCA 3NY9A 1A4AA 3S8GB 3P0GA 2BHFA 2R4RA 2Z73A 5G36A 1XB8A 1HAWA 1PCSA 5B1JA 4YVUA 3C9MA 1MDAA 4A2GA 1PY6A 4XTOA 1PZBA 1A3ZA 3CG8A 1L9RA 3NSDA 1TEFA 2HX9A 4PXFA 4BV0A 1NINA 1NZRA 1XB3A 1WA2X 3WQJA 2Y00A 2WSDA 3WKQA 1SFDA 1KG9A 2EIMB 3DKHA 2R4SA 3EMLA 3EF4A 5B6YA 3UZCA 1AS7A 1S52A 2B08A 2UXVA 2FT8A 1PY0A 5ANHA 2Y1AA 2EIJB 2GSMB 1ID2A 2XX0A 5TK2A 2YAHA 3V2YA 1RZPA 1M9WA 1NIFA 5H2OA 3ASOB 3PBLA 5H2NA 2YXWA 3ZBMA 4YSDA 2HX7A 5D4IA 3RFMA 1RCYA 2VM4A 3FU7B 4E9YA 4G70B 3FU9A 1L9PA 3BVDB 1RKRA 3HANA 1ZV2A 4MFHA 2KSYA 4W1TA 4YSCA 5BR5A 3PDSA 5A8EA 2RH1A 4EIYA 5IY5B 4UG2A 2P80A 5I6KA 5H2MA 1NPNA 5ITEA 3OE6A 5A45A 2Q9OA 5TGZA 3ABKB 3AW5A 1VGOA 3CDZB 4AKQA 3OE0A 1WA0X 4XT3A 4YSRA 2YCZA 4FA7B 3X3CA 2MTAA 2JKWA 1Q5IA 3DIVA 2F93A 2XVBA 2TSBA 2AFNA 1ILSA 1WS8A 2W88A 3UABA 1AG0A 1BXAA 4N4YB 1TKWA 5G53A 3QJUB 4HYJA 1GUEA 1HZXA 2HPYA 1JGJA 3QBKA 2DV6A 4BXSV 2VMJA 3N2JA 3X1BA 4JKNA 1JOIA 2DWSA 3C75A 4AKOA 1AZNA 3NP3A 2HX8A 1R2NA 4KOCA 1J9QA 4HCFA 4YSQA 4YSEA 3NY8A 1NIDA 3KW7A 3L45A 4WAVA 1IBYA 1URIA 3NJGA 2FQFA 1MG3C 2PPEA 1FBKA 3JT2A 1JVLA 5AHZA 3HARA 4AMIA 1AAJA 3QJTB 3S3DB 1PLBA 2PP9A 3ABMB 3FPXA 4HCIA 1E67A 4W9ZA 4DP4X 4G7QB 4NERA 3AYMA 7PCYA 1NWOA 7PAZA 2J5WA 4JR8A 5AKRA 1SDDB 1PMYA 2IWKA 3VHZA 3CVDA 3KJ6A 2XLLA 1SFHA 4QIDA 5DHHA 3RYMA 3T6VA 1L9QA 4L6RA 3V2WA 4UF7C 2Y02A 4BVNA 1A65A 4GP8B 2IDUA 4BXVA 5B1JC 3NT0A 4CSPA 2MRYA 1BXVA 5I5JA 3ABGA 4GXFA 1QHQA 1V54B 2VW4A 2OV0A 3HASA 3V9CA 1W6WA 2XU9A 4A66A 4GP5B 3GDCA 3T6WA 2RACA 1NIAA 1BXUA 3D12B 2XXGA 1OV8A 1WAEA 5I6MA 3UGEA 3FSWA 3PLYA 3TU6A 2X87A 2HZHA 2F95A 4PAZA 1JV7A 2VT4A 4E9RA 1KGBA 3OE8A 1VJMA 2AZAA 2GBAA 2PPAA 1UATA 3FSZA 3UZAA 4X4KA 2ZOOA 5TK4A 3DTUB 1MZZA 1QNIA 2BP8B 5H2LA 1P8HA 1JERA 1FFTB 4TXVB 1M0MA 2H47C 1UAZA 5B0WA 3T45A 5LWEA 1GR7A 1ZIAA 2XV0A 1BRDA 2BW4A 4UHRA 4G7SB 1KDIA 2JXMA 5I6LA 3PXLA 1OCRB 2VM3A 1E5ZA 3UACA 1ET5A 1GW0A 1MZYA 1NPJA 2BW5A 1AIZA 5DYSA 5JJEA 3UTWA 4GBRA 2I21A 1W6LA 4M3HA 1F50A 1AS6A 3CVCA 3NYKA 5B2NA 4AI7A 3NJHA 1IW6A 2R7EB 3FS9A 3T6ZA 2YXVA 5B7EA 4BWUA 2UX7A 3FQ1A 3AM6A 4AX3A 4DP0X 2AANA 2YCXA 4KNTA 4KNUA 2XV2A 1PZCA 2YAFA 2PPDA 3IBOA 2BP0B 3NJMA 1KMEA 1P8IA 2VSMB 2FJSA 3QJRB 2VW6A 2X88A 3WI9A 1E0PA 3N55A 5G54A 9PCYA 3AY2A 1TEGA 4AZUA 4QLWA 1TU2A 1GS7A 3SN6R 2XV3A 1KDJA 1OE2A 1UCQA 1R1CA 4KNFA 3CODA 1BYOA 1M57B 2YAOA 2QPDB 4E9SA 2TSAA 1JXGA 2XWZA 4BWWA 4OV0A 4BK5C 2YCWA 2W8CA 3OE9A 1A4CA 2PP7A 2JFCA 4HHWA 4LDEA 1C3WA 1BRRA 1P8UA 1F4ZA 1PAZA 1ADWA 1JZEA 4AMJA 2FT6A 2HLEB 1XMEB 1N68A 2G87A 3D4SA 1S8LA 4A2HA 1A8ZA 1SNRA 1KBWA 3DDLA 3PQRA 3MBVA 5H2IA 1X0K1 1O0AA 2YDOA 3OMNB 3OQRA 1QKOA 2IDFA 3H4FA 4DJHA 5F8UA 1OOWA 6PCYA 5AX1A 1KG8A 1ZDQA 4DP2X 3S3BB 1EZLA 3IEAA 4JQ6A 3X1FA 3EH4B 3UTXA 2XX1A 3ABLB 3CDZA 4HCGA 3SBPA 1KCBA 4EF3A 4E9TA 1SHXA 3QQXA 5I5MA 1L9TA 2UX6A 4EJ4A 5G2CA 3S8FB 2IDQA 5B1BB 1LN6A 1J5DA 2R7EA 3G5WA 2GC7C 3NJIA 1PLCA 2BP0A 3NYAA 3OMAB 4L0PB 4YSPA 2YAEA 2N0MA 5I26A 5AZUA 4X31A 1JZJA 2CJ3A 5H2PA 2I1XA 3OAXA 3EH5B 2FTAA 2UXFA 1KYAA 3MBWB 4KO9A 4DKLA 2DY2A 3TBBA 1JVOA 2FNWA 5ETZA 5I28A 4G72B 5KKHA 1J9TA 1MGYA 1WA1X 2X72A 4DPCX 1VLXA 1XB6A 1BYPA 4E9XA 5EHFA 3U25A 5FC9A 5FJGA 4JKVA 4MD2A 3QJQB 2IH8A 1NIBA 2XXFA 1QKPA 3NJFA 5D4JA 3V9EA 3X1EA 1C8SA 4N8UA 2E86A 4RH4A 1S53A 1CUOA 3SBQA 3AYNA 3X3BA 3ZPRA 3FSVA 3NJKA 3X1GA 3WNIA 4DPAX 4E9WA 4YSOA 1X0I1 5J7AA 1SF5A 6PAZA 2YAMA 1ET7A 3ZPQA 3NSCA 5BR2A 1R84A 3NJNA 3MX0B 1BAWA 2P80D 1SF3A 1BQRA 5F7AA 2PEDA 5B35A 1HAUA 4A67A 2WJKA 5AHYA 5B7MA 4MQSA 3ZEVA 4Y9HA 2KSAA 3RZEA 4DP8X 4F2EA 4BWBA 3ODUA 5G2DA 5C1MA 5I5IA 8PAZA 3AG4B 4HZ1A 3NSYA 4E9QA 1HFUA 1TN0A 2QT6A 3PWHA 1AQ8A 1CURA 5H2HA 2BWDA 1QHJA 4DP6X 1DZ0A 2BZ7A 3CVBA 5G2AA 5AWZA 1WS7A 3HB3B 3H4HA 2ZXWB 3IE9A 3EHBB 5B34A 4GPOA 1JV6A 1AACA 1B3IA 1PF3A 2GHZA 3OMIB 3PAUA 4WTQA 1CWQA 5JJJA 3AZUA 3QAPA 2NTUA 2I85A 4Q8BA 2I35A 1PXSA 1XJIA 1W8EA 4DP1X 1FBBA 5A44A 1OF0A 2BP8A 2UXTA 2B3IA 1BQKA 2J55A 4BWTA 2Y03A 4XTNA 4YL4A 1IKOP 2IAAC 5DHGA 2FT7A 2WO3B 5AZDA 1FA4A 2CALA 1E5YA 1F88A 2I7SA 4KO6A 2KSBA 4XXJA 2GB2A 1ZDSA 3CZUB 3JTBA 3IN2A 4HYXA 1PZAA 4WKXA 3ZDWA 1BRXA 2KS9A 1OCOB 1AT9A 3PAZA 1S54A 4KO5A 4L35A 4DPBX 2Q5BA 2FQDA 1KGYE 2CBPA 2BZCA 5JJNA 2Y69B 2ZIYA 2EINB 3QDCA 2LLNA 1I53A 4KNSA 4XTLA 4Q89A 1NDTA 4MD1A 1OCCB 2CAKA 2IDTA 1GS6X 1XIOA 2J56A 2VSKB 2IWEA 5ITCA 1SJMA 2Z55A 4FBZA 1V55B 1J9RA 3AG2B 1AS8A 1U19A 1GZMA 4XT1A 4YSUA 4X32A 3FQYA 3WIAA 1OE1A 3PPSA 1S8JA 1AZBA 4KLYA 2I20A 1AZRA 1ZPUA 3FU8A 3HAPA 1J5CA 4GY4A 4GYBA 4N6HA 1S51A 5B6WA 1IBZA 2PLTA 2BRDA 2NTWA 2A3TA 2PPFA 3NJJA 2OJ1A 4X1HA 5B6XA 4PXKA 1OE3A 1OCZB 1DZEA 2CCWA 5B1KA 3QBIA 3SQRA 3ZX1A 4NC3A 1F56A 5B3SB 4BEZA 1AZCA 3UADA 3FSAA 4E9VA 1IW9A 4A2EA 1PNCA 3A7KA 3NS0A 2ZWNA 2BWIA 4LDOA 1GY2A 3UTVA 1IC0A 2VW7A 1C8RA 1ILUA 1DYZA 2XUWA 1NTDA 2PPCA 2VN3A 3HEIB 3WG7B 2JAGA 1GY1A 3BQVA 3UAEA 3UG9A 3FT0A 5I6PA 3ABWA 3QJSB 1YLBB 3VW7A 5H2JA 4YSSA 2YQBA 1MG2C 4G71B 1PNDA 2HRGA 1H2SA 2JAFA 2Y01A 3SBRA 4BEYA 2QDWA 3T71A 2J4YA 4IARA 2AZUA 2WO2B 1J9SA 3FU7A 1FWXA 3NP4A 4CSZA 4F7KA 3C9LA 4BUOA 3T6XA 5AX0A 1KCWA 5PAZA 3FYEB 1CYWA 1E12A 3TA4D 3X2QB 1IXFA 2EIKB 2XYBA 3AG3B 1H68A 4G7RB 4HALA 1AG6A 3TASA 1JZIA 1PLAA 2AVFA 2EI4A 4IB4A 2HRHA 3OD3A 3UAAA 3HAOA 2AT9A 1JXDA 4YSTA 3NSFA 1GU8A 1E30A 2Y04A 4KO7A 4A2DA 1SDDA 1AZUA 5E9NA 4HIPA 2YCYA 3PXOA 1NWPA 1QLEB 1BM1A 1AR1B 3QBGA 1AP9A 2FWLB 1M0KA 1Q5JA 2WJLA 4P5RA 1V10A 3VVKA 4JHUA 4DP7X 4A4MA 5H2KA 2H3XC 5EN0A 1GYCA 1CYXA 4J4QA 4A68A 2DYSB 4WW3A
chains in the Genus database with same CATH superfamily
1I1FB 1K8IA 3RFZB 4FA8A 2GBVA 5IW6B 4OCYH 3MGOA 1QD0A 3BLKA 2R1YB 3H9SB 5TD4A 1YY8B 4NPYA 1XAKA 4JGUA 4PJGE 4JZNB 3T4YA 4JZJA 3BYTA 4XAWL 4NRYA 2CHXA 5EWIH 1PZDA 3OHMB 1KPRA 1DVFA 2I07B 4WCYH 4LRNL 1LK3H 4DP5X 4WRLA 2BJMH 1IARB 2MPAL 1XL6A 1FZKB 4BSWB 2MPVA 2HLFD 4PTUA 1Z9SA 4PU2A 3BQUC 4W68A 4PRBA 3W2DL 4NQEA 1Y18A 3WNNA 4JG9A 5EU4B 1ADQA 3FL7A 5FYJD 3UGUA 3GTVA 3VI4B 2X70B 3G6JA 4JM4L 5DQ9A 5SWZD 4XVUD 1NKRA 1M7DA 1XH1A 2MTPA 2YUXA 4CW1A 2XA3A 3SGDI 1PZ3A 4QHUA 3QHFL 2GC4C 2VXVL 2AHIA 1IC5H 4GSQA 4F7EA 1WUNT 4OF3A 3WLBB 1XCTA 4HSQA 4XP9H 4DVRH 1AKJD 4Y8AA 1KIPB 1F4XH 3U30B 3GS4A 4FYQA 2YO3A 2ZG2A 4KU1A 4CVXA 1DHKA 2XWEA 2ZOWA 4NKIH 4P5TC 5HI3D 1E5BA 3R1GL 3OSKA 2Y25A 1IGTB 3NA9L 3F84A 1N6VA 4HS3B 3VGAA 2CGYA 2OAAA 1UZ8B 2Z4TA 3H85A 2V17L 5B4MD 5G36A 2G5BA 3VB8A 3GEWB 4UQCA 1T66C 4N2DA 3QG7L 3B9VA 4J4PD 1AO7A 4J3SA 3OMZA 1MW0A 3PV7A 2WN2A 3IMVA 3NH7H 3BX7C 2EIMB 5ISZB 3QHTC 2VDRB 2ZWLT 4XBPB 2IG2L 3EF4A 1NFDB 4QNPF 3ISYA 4NO0B 5HDBF 4NAMA 2ED6A 5TQ2H 5GHWL 3WLBA 4M6MH 3RZCB 4AEFA 2XBZA 5IB5A 1NCBL 4LLYA 1Z0NA 4PFEA 1FG2B 4EIGB 2ZCHL 5GGSA 1OTSD 1UEYA 2VTFA 4GXUM 3GI8H 2CKBA 2J1WA 3RWJA 3VGGA 3QZBA 2VR4A 2A74A 5DZLA 1CYGA 4G5ZL 4JO3L 1V3KA 3BVDB 2R2EB 3V52L 1N5AB 2WKOF 3SO3B 4NQEB 4W1TA 4XPAL 3ARGD 2HMID 3FQUA 1I8IB 3PDSA 1SDYA 5D1XC 4EIYA 2WVTA 5JMRA 1KYOJ 2IFFH 4ZAKC 5I18L 5E6UB 4IK6A 2AJUH 3H9SA 3KS0H 1VGOA 4OVVA 2FNBA 3OE0A 4XHJD 5HP5A 1I7RB 4JN1L 4MDJB 2XVBA 3HE7D 5JORB 3ARQA 3O6LH 1OP4A 4P5MB 2OMTA 3UABA 1DQLL 1E4KC 2CDGB 4ZOCA 5CD3A 3QJUB 3CD4A 1FGVH 3KYMB 4FLOA 4G8FB 4H1LG 2KBGA 2QLYA 1P7HL 3TFBA 1U8OA 4W6YB 1JGJA 3O6MH 3MUY1 5FR3A 1HSBB 4BCYA 3W56A 1ES0A 2YR3A 3ARGA 5IQ7H 4N0YH 1P4LB 2Z31C 4PGZA 3ZDXB 1NIDA 3G6DL 1LE9B 1LO0L 2OQJA 1T2QH 3LN5A 2XRAH 1AAJA 2NY2C 5KTEH 1I9JH 2FO8A 3ABMB 4TOYL 4J6RL 4Q0XH 4QUOA 4EI5D 5HGAB 1KIRA 1NWOA 1HYRC 1B0WA 2OSLB 5BV7C 2VLMD 3F7PC 3PL6C 4GMTL 4I0CC 4MJ5B 4P23D 1E4WH 3ARUA 4EXKA 4FP8H 4HWZA 4NZRH 1ROCA 1QHPA 1UM6L 2EEAA 1B0IA 3LH8A 1IAIL 3RDTB 1ES0B 3ARGB 3E7JA 4MD5B 2MRYA 2OI9B 1A4JB 3IFNL 3MLSL 5KUMA 1X5ZA 1AQKL 4GXFA 4C54A 4D2NA 1HZHL 2WMPB 1A5FL 2Q3AA 1HWGB 4GP5B 1TZIA 3DOIA 3RGVB 4Y4KD 2VDQB 5E00B 3DYPA 3T2PA 1NBCA 3EFDH 1QFWM 4K5LA 4PAZA 1BOYA 4V2CB 3FQRA 3H9HB 1WFMA 1BBDL 2X89A 2PPAA 4BUQA 4WGKA 2MQ3A 5BRZA 3U1QA 3ATBA 2HG0A 3N0AA 4FLHA 1ZV9A 4U1LA 1F18A 1K72A 4LBEB 3ARFC 1SY6L 2XN9E 3S34L 3G7TA 5E8NB 5GQBA 4JFUA 4L1LA 2FH6A 3QO0B 5BO1H 5L4MA 1LWJA 2FJGA 2F54A 3QUXB 5G4MA 2R29A 1WZKA 2UZYA 1NEUA 1IL1B 1UCBL 4MSWB 5J4MA 4JJ5B 2I21A 2KS0A 4I3SL 1YJDL 4JZOA 4IOSD 4AI7A 5IB3B 3GRGA 1CDYA 3US0A 2NCEA 3B34A 1ZANL 1KB9K 2CIKB 2NR6C 2O4EA 4M5YL 5AZEH 3ESUF 4XAKD 4ZMLA 3EJTA 4MCYA 3LH2H 3D06A 5FHBH 2H6OA 2FJUB 3E3QE 5G54A 4HYTB 4WI6A 2A1WL 1G43A 3MODH 4HJSA 4P2OC 4ETYA 4ZPTA 2Z1KA 4JFZH 3AABA 4ODVH 1U3HB 1EZUA 3B83A 2DQIH 1P4BL 4WVRA 1FJ1A 2F54D 1IV8A 3HNVL 3WIHL 3UJIH 1MHCB 1PAMA 4BWWA 1RJZB 3L3KA 3U9WA 1EAQA 3DJ9A 4G7VH 3GK8L 5CLTA 5HHPB 1JTTA 2PTTA 4DGUA 1BOGA 4ODWB 4Z5RB 5I24A 4HOZA 4FCHA 4X6DA 1FZJB 3PABB 2ESVD 2MSPA 4K23H 4L5FL 1A8ZA 3MJ8B 1OB0A 4P48A 5DHVB 1O0AA 4ODTH 2F8IA 4MMXC 4YHPB 4M5YH 1MUJB 2JSFA 4RFOH 2FSEA 2KZKA 5CJXC 1G6RA 2J3SA 2DTML 3UTXA 4M61B 1IAIH 4M8UA 2IBBA 2YUVA 2Q86B 3V0EA 2NX5B 2PYEA 4CGUB 3A4EA 4N0CC 1CBVH 3APMA 3HHMA 5FKPA 4CL7A 1I7TA 4OI9A 2R7EA 1DBBL 4TVPE 5L9DL 2BSSA 4JRYA 1X4ZA 1CFVL 3MLZL 1KGXA 4QOKB 3CN2A 4JFED 2CJ3A 1A14H 4ICXA 2E76C 2FTAA 4IGBA 3MBWB 1TENA 2YS4A 4BD4A 3G5ZB 4YXHL 1RD6A 2NY5C 2PTTB 3TT3H 1W15A 2JCCF 4PJHB 1U41A 1U6AH 2WD0A 5F0MB 4F9LC 3BUDA 1P7KA 1ED3A 5G5DA 2B39A 2H3KA 3RTQD 3O6FB 4P05A 2ZKHL 2C7FA 4ZAKD 3OKDB 4BZ2A 1ZGLM 3U25A 4GAYA 4NBYB 4JFOB 3UC0L 1GIGL 4HS8H 3MGOB 5AG9A 1TFPA 2WBXA 5D7IE 3X3BA 2WZ6A 4JFXA 5BZDA 4OIIL 1GH7A 1INQB 2QADB 2X28A 3QRGL 5E2VL 1NAMA 3MJ6A 4RQQB 3D3VE 2J1YA 4ANXA 5CJ5A 2JELL 2WKGA 4ZMQA 1AGCA 5I8KH 4BFKA 4H8WH 4MXWH 4U2YA 5AL0A 5ESQA 5FKAB 2KSAA 1E43A 2JKRM 3EYSH 3ULVL 2EABA 1PL3A 1E7VA 4NQDE 2HTKC 1NOLA 4PB0L 2EYSA 3VJ6A 5IHHA 3BJ91 1LO0H 1KIRB 2X1WL 5DJ2A 3GLAA 3WNMA 1P1VA 1M05B 3DX7A 5I76B 5JOPD 3QAPA 1H3GA 1A6TB 4A2MA 4YIQA 5GRVL 3LQZA 1PTZA 3TTSA 3WKYA 3G9VA 2I7SA 3L3OA 1FPTH 5DZOA 2WXOA 2VL5A 4HG4K 4UQ3A 3ULAB 1QYGH 1CDBA 2ZUSA 1WO2A 5DVLA 1XZ0A 1SDAB 5LBSH 5ECGA 2DWDB 1A4KB 3DTDA 3D6GA 1EMTL 4MAYB 4ACPA 4JM2A 2UWEE 4P4KA 5F97E 4NQCE 4YLCA 2ICWJ 3BVUA 5D5MF 2YKLH 2XZCH 2OJZL 1KULA 4PV8A 2BSED 1Z5YD 1GS6X 3L9EA 4GO8A 2VSKB 5ITCA 1OP5H 3NPSB 1BIIB 3AG2B 5JXEC 3RBGA 4L8BB 1GZMA 3HUJA 4NPJA 1NGPL 5CMAB 4DW2L 1Z3GH 2YPVL 5DWPA 1OGAD 4QXGL 3FU8A 1KWGA 2I60L 4GRMA 1CIUA 2J8UF 2J1XA 2HJLB 1PIGA 3GM0A 4NRZA 4RGOH 2XN0A 3QJFA 4BZ2H 4LLUB 2PPFA 1NGZB 5FM8A 3GI9L 3DOSA 1OCZB 3TP4A 3QBIA 4WJ5A 2PW1B 2VZUA 2A5UA 1ZANH 2HT3C 2OZ4A 1R3LA 3RPIB 2OMWB 4LSQH 2R56H 3CFKA 3TT1H 5JW5B 1DJSA 4RWYH 3GMQB 4CU7A 3ETBJ 1NLDH 3HS0A 2SEBA 1ILUA 4WI8A 2A4CA 4HUMB 1I7RA 1QHOA 4UU9B 2CGRL 3P11L 3AT0A 3PV6B 1T20B 3NN8B 4Y5XB 4AV0A 4LLWA 1NH6A 4WDIA 4MRCA 1F4WH 1MG2C 1LO3L 1W72L 3STZA 3H53A 2MQ0A 3QJOA 5J56B 4WI0A 3WS3A 3WU1A 3STZB 2ADIA 5BUPA 4JDVB 3S37L 4CVUA 1H3PL 1NFIA 4I48A 4F7KA 2VO8A 3C09C 1NC2D 1CIDA 4RAHA 1KCWA 2XTLA 1MFBH 3LXBA 4IMKC 5DZJA 1WVZA 4GAGL 1D9KD 2Q86A 3EBHA 4QXWA 4TNGA 1AJ7H 3CVHB 2VDML 2JF1A 2HVJB 4MTMA 3VXMD 3WXWL 5I19L 2XFXA 3BHBB 5E9NA 1F4AA 2LFEA 5BRPA 3RWFB 2AAAA 2WYHA 1UGKA 4YDZA 3SGKC 4JPWH 1NWPA 1QLEB 4MMZC 4OIBA 3WMPA 3CX5K 2WBJD 4WW2F 4JFYA 3NA4A 3QBGA 4D3CH 3II3A 5HGHA 1N6UA 4HJJH 4N5ED 4R0LC 1V10A 1A7BA 2W0KA 1TFHA 4JANB 1T1YA 3OAWA 3QDGB 4GT0A 4JDVA 4F37F 3NSBA 4AYGA 5DJXB 5LWYH 2J21A 3CAPA 5I6NA 2DYPA 2FGZA 2NNAB 3LMJL 5EN2B 4PJIA 3L5WA 3WN5C 1H3PH 1L9SA 3T9WA 2FVNA 1KCRL 1PXRA 1NGYB 4W9HC 5KS9A 2GEQA 2GJ6B 3DV4A 3LHPL 3F2LA 1EIBA 1EEZB 1XCTB 4FPDA 2ICWA 5IFHH 4MCZA 3HZVB 2K7QA 1CGUA 2PO6A 3KEHA 4AC2A 3SDCD 2VZ1A 2EH8L 4IAQA 1DQDL 2C9XA 4B9PA 1RZJL 3ARWA 4LCIL 1L0QA 1NMCB 4U1IB 1I82A 4N9GA 1QM8A 1E65A 3MTRA 2PWHA 3QWOA 4LSTL 1OEZW 4N24A 4LLUA 1TLMA 1WD9A 4UT6A 2ZX5A 4OCXL 3DX8B 4UMSA 4GRLC 5LCVL 1TQBB 2C9QA 4NQED 5AVTB 1ND0B 5LCVA 4NNXB 5I76A 2Q7NA 4NWTL 2LTQB 4Y5YC 3AAZB 1GCYA 5E5MA 4M8QB 2EZ0D 1JXFA 2PO6D 4BK8A 2DQFB 1BV8A 2AJXH 3UZVB 5I30H 1BZDA 12E8L 4K9JA 4Y19D 2O5NA 3PWUA 4N9GB 4AKPA 5TFSH 3EDFA 3F6LA 3IVKB 2P3YA 3E9UA 2J4WH 1S9XB 5GRJH 2CDGA 1R24A 3P0GA 4I18C 1MCJA 1K5WA 1MDAA 3VFVB 1Z0MA 4BH7A 2EIBA 5C0DB 1ZPLA 2EYRB 2XXMB 3BWUF 1XB3A 2P8LA 3WQJA 5G55A 3QJXA 3F7VB 1DEDA 3IGLA 5TH2B 4L4VE 3GXFA 4MA1C 5KVGL 1FDLL 2NNRA 3V2YA 4ZUSA 1RVFL 1NCDH 1MN4A 5INCB 4I3RH 3HC3L 3NGBC 2Y7QB 3LKRB 3UL4A 4AJYV 2XI9A 1UFGA 1QRND 4GQ9H 4UI2A 1IM3B 3DROA 3QXTA 4MFHA 3RVUC 2XWTB 1FNEA 5I74C 4J23A 4NFDA 3LS5L 4OZFB 3R4RA 5ITEA 2E9JA 2FJFA 3QS2A 4AKQA 4OZIB 2ERJB 4BQBA 4H8WC 5ERWB 3RGVD 4XT3A 1I8AA 4S1SH 2GCYA 1VFAA 2J43A 1EEZA 2GSGA 3ILPB 5F2FA 1CE6A 2QPFA 1FZOB 1IC4H 4R7XA 1EV2E 3S4SA 3L1EA 3H9SD 3RUGF 2PABA 4EDXA 3ZYIA 4FZEH 3MJ9A 4U0QB 3B2MA 4QD2E 4ZYKA 4FX5A 4CDGC 3BGMB 3FQXA 4OTXL 4JFHD 4UAOB 4YGAB 3N2JA 3H54A 4F91B 3C75A 4AXWA 3L3KB 2X4OB 1MH5B 1O5DT 3QQ9D 5DD6B 2ZX7A 5E1AA 2CK0L 5C0BA 4F7TB 1YNLL 1AH1A 4YHNA 3O2DL 4M6NH 1SJHB 3ZQWA 2IV8A 3FJTA 5C0CA 2R1WA 2LVEA 4QOKA 4HCIA 4HIJB 2AITA 1O9ZA 1OALA 2QMJA 5CKGA 4Z7WA 3RVVC 4PJ5B 4WY7H 2MCPL 2KZBA 3QIUD 4JR9L 3WFEL 1UCTA 1QFHA 3HZMA 3CMOL 2EXWC 4QRSA 3MJ9L 4Z7NB 5IQ7L 4ELMA 4I0PD 1P5UC 1R33A 2BS8A 1OGTB 2BCKA 3HNSL 1AD9B 3V2WA 1NGWA 1T80A 4M5SA 4ZW8A 4F7CB 1JF1B 3K1KC 1E8YA 3IMSA 1A6AB 1MJJA 5D7SL 2W9DH 4PW9A 1MFCL 4NX0A 1FL3B 1WRFA 3ABGA 1IGYB 4CBZA 2FEEL 4Y2DC 5LLIC 3L8QA 5HJGA 4YDJB 5CCHE 1BIIA 1KYDA 5C0CD 1EJOL 5J6HA 3F7YB 3SDYH 4PJCB 1Z5HA 2XXGA 3VG0H 2Y36H 4K23L 1FAKT 5D7HA 2VWEE 5JHLL 4K3DL 2VT4A 4I9WD 3GXIA 1UATA 4OSUH 3OX8B 4M3JA 5HGBB 3RFRA 2XZAH 3ETSA 2MOGA 5E6ID 1IX2A 1DVTA 3GXMA 2IQAB 4PBDA 3PXLA 3MV7E 4FHJA 4K71B 3RI5K 1LP9A 1OB1A 1O7SA 3T2QA 4YHML 4OV5A 2OI9C 1HTYA 2VNCA 1AIZA 3ALPA 4PG2C 3HNSH 1DTUA 4LEOB 4A55A 4TNVK 3H7LA 2D7TH 2GJZA 2WGXA 4UDUB 2Q87A 5DJ6A 4PUBL 1ZE3C 2E7BA 3C60A 1MNUL 2C1OA 3HC2A 4WHTA 2C9PA 1YN7B 2DMKA 1L9NA 3UFIA 5K5YA 5B38B 4ZUVA 3ZKSD 1L7TL 1HDMB 1TU2A 5FCUH 4QJ5B 3BGFB 1V8HA 4A39A 1CFNA 3MLXH 4M6AA 5I16A 4GXVL 1AFVH 1UJ3B 3HI5L 4FFWD 4JHZA 1EBPA 1EFXB 3F12A 4ANVA 4R4BA 1N26A 3S2CA 43CAB 5EV7A 2XWZA 3D0VB 4I0KA 2R2BB 3JTTA 5DU7A 4PY7A 3PJLA 4NO5B 3C6EA 2HVKA 3LOWA 4X99A 4XCYB 2UV3A 3K3QA 3QIBD 5C08E 1ADWA 2BMKB 4WNQA 4PVLA 2LV4A 4KXDA 1JP5A 4W4NA 2C3HA 4XCYA 3VD1A 3V0DA 4JFEB 3JVGA 1MAML 3DHPA 1VF5C 2AK4E 3QNZB 2ZOKB 3NCXA 3FTGB 3OHXB 5IMLB 1W8OA 1E5AA 3BISA 3DV6A 3Q44A 4KHXL 4XWGH 4OFIA 5HYJB 4IHOB 3QQXA 4H40A 4JCMA 5KJRL 1ND0A 3FN3A 3VFOB 2YFNA 2G3ZA 1BWMA 2D3JA 3QXAB 4L3ED 2IDQA 1I1AA 4L8CB 5D9SA 3DX4A 2AEPH 1YMME 3MLXL 1OAYL 1IGFH 5DRNA 5AZUA 1FVEB 1JV2B 5L2KB 2Z35B 5E8DH 1RIUH 4X6BB 4YAQB 1JVOA 4JO1H 4KKZA 5ETZA 5HXMA 2VC2L 3VD2A 3KHOA 1Z9PA 5AVRB 3VXUE 1MWAL 1NIBA 4OLWH 1IAKB 3AWGA 1TZOA 3QNXB 1O9WA 4L3FA 4IJ3B 4ENED 1AIFA 1KB3A 4ODWA 3WIHH 1T1ZB 1S7RB 3HJEA 4I85A 4OLYH 4XBGB 4I13B 4YFLF 5EDXA 1BAWA 4A6YB 3QUMB 1SF3A 1HCVA 4WFFE 4Z18A 3VGAB 2B20A 2N1TE 4HWBL 3VCLB 4MQSA 5DMKB 4ILDA 2R23A 5EEWA 2OTUA 1QLRB 4FNUA 3IJ9A 1CPUA 3QI9A 5I5IA 1SLXA 4JFHE 1OM3L 3V9FA 2HA1A 3NCCB 5DD5L 4E9QA 3H3PL 4EUPG 1CURA 4L9DA 1OD9A 4DP6X 1HL4A 5F9JA 1BQSA 1L9MA 4U4IA 1I7TB 1XH0A 2XPZA 3ATEA 8CGTA 2CDEA 4ATWA 2C9SA 5GGSB 2ZX6A 1FV1B 4IRJA 1YEFL 2HT2C 1Y6MR 2I85A 3MLWH 4Q8BA 1PLGL 4DP1X 5A44A 1A3LL 1N7MH 1TYRA 1UCBH 2CIKA 4F2ME 2Y72A 2NMSA 5D96C 3S5YA 5SWQA 3SKMB 4H88L 1GMEA 5LNEA 2CALA 5IFHL 2B0SH 3BIKB 2NY2D 1TSHA 5CP7B 5IVZA 4OM1H 2N0KA 3IU3B 4OF0A 4IKKA 3DX6A 3IE4A 2F7RA 2VZVA 1XBDA 5F88A 3ZW3A 2VH5L 4E68A 1N0XL 3G9AB 3WY2A 2RD0A 1UH3A 5IHZA 3BKCL 1U2HA 4MYWB 2BINA 3VGDA 2XCMC 5ID1A 4YNYB 2EINB 1J7VR 4JNXA 4XTLA 3FTVA 5D1QE 4Q89A 4K55A 3HS9A 4QAMB 1UOKA 1X4XA 2QQKH 4XCFH 2NXZD 5F0JB 2CRYA 3DMMC 3ELAT 4AM0A 4P4KC 1MLCA 5IESL 2BOBA 4X83A 5B39G 3FQTB 5FW8A 1GTFA 4NM8H 3L08A 4LOFA 2GBTA 3P2BA 3QUKB 3MYJA 1S51A 5B6WA 4GYBA 4L1SA 5A16B 1KGCE 1ZHKB 3CN1A 3PJSA 4P3CL 3ZOAA 1KELL 1FYHB 3MX0A 4RZCB 5K39B 3SQRA 4ETQA 4J8RB 4PJAB 2UZYB 3SYAA 4HH9A 1QFOA 1OT1A 2E6PA 1JK8B 2P5PA 1R46A 3KGUA 3VG9B 2HTLD 4JFQB 4UT9H 2X6UA 1F86A 3P73A 5EZJB 1HXYA 5EDSA 4I3RL 5DD3H 2OQJB 3PE9A 2EQDA 4RGNE 3TO4D 1GY1A 4KI5F 5I1JL 3O6ML 3L48A 4LB8A 1M9SA 5AD0B 1FNFA 1Z3RA 4UNVA 4LPVA 2AK1L 4PRPD 3APDA 4PG2A 1MEXH 1MW3A 3DXAE 4G71B 2F5BH 4RFOL 3WY1A 3U0WH 4JW3A 2AJZA 3ESPA 2R69A 2XBTA 2G9HB 5EZLB 1AR1D 1RV6X 4GIPD 4EIUA 5IM7A 4Q74A 1IT9H 5FK9A 1XHHA 3TA4D 1XTMA 4P49A 4X9FA 4JREC 4YX2H 1T22B 4MQ7A 1TNNA 2OXGB 3E8UH 3CCHB 5C07E 3S4SG 3KS0J 4KK6D 5JUEL 4Y5VB 4K94H 4TL5A 5D7KE 2PWFA 3HAOA 2TRYA 3VA2C 3L95B 2LFGA 3T77A 2ZPKL 3E6FB 2PYFB 1P4BH 2JELH 1YN7A 12E8H 1FZMB 2PWGA 2GK2A 3BZFA 5I30L 5L4FA 4PRPA 1TCMA 2BRQA 3ORJA 3LN5B 4UM9B 2N1KA 3MV11 3IMUA 2WLNA 3V0VA 2YMTA 1AHWB 4MNQD 3QRFM 4N25A 2HFGH 3WJJC 1MHPL 4AC4A 3I75B 4BIKA 3BWAB 1FO0L 4M48L 1CYXA 3KWVA 2EIDA 2X3BA 5D2NE 3H55A 3V4PL 4OZ4A 3V95A 1KF9B 3ARZA 4M5ZL 4N87A 5EEXA 4NO0A 4NQEE 1SHWA 3ML8A 3Q1SL 1SYVB 4S0HA 4LP5A 4DN4H 2HFFA 4MAYD 4N2AA 3VG9A 4TTGA 5EH1A 2HXAA 4PRHB 3RWGA 2DYPD 3V4UH 3P11H 5CJQH 5IF0A 3PFUA 1J1PL 4G5AA 1CFQA 1ZKAA 4H5SB 1ZHLA 2XQYG 4HV8B 5D72H 4KV5E 3L1GA 3CGTA 1PEWA 1FL5A 1DR9A 5E2WL 2FLMA 1I8IA 2V2TB 4GIOA 1QFWI 5JOEA 5JIKA 2DLIA 3A4FA 3EJPA 3HI6L 1RLWA 3I84A 4XVTL 2VLRE 2DYRB 2CO2A 4GKLA 4UDTA 5C0AA 4ZUTB 2J6EL 4MAZA 4X8CA 4MJ4A 2CKBB 2ZCKH 3AFLA 3JSSA 3RWJB 4V1DD 4GKZB 1E0OB 4J3TA 3TGXA 2PXYD 3U0PA 3ULVH 4PJBB 3KH4A 4A37A 2JIXD 1TVDA 1NGPH 4HUWB 4U05A 3X12B 1MFNA 2C9UA 1PFCA 3OXSA 2DLFH 3UJIL 1F6AA 5D5MB 1VSCA 5ITFB 2CLRA 1TQSA 3ELQA 4FAAB 5JR1H 2F7PA 5FYLE 1J8HB 1X5IA 3IJEB 2DQUL 4PTUB 5CIPB 1FNAA 3P0VH 3QDME 5MENB 2M3GA 3UAJC 4TQPA 1HCZA 3TO2A 2PYEE 3CLFL 4Y4HB 3WL9A 1F3DH 3W11D 3ZTEA 2OBGA 3GSOA 5DFVD 5E08H 1ONQA 1PBYA 2P5EE 3HZ3A 4PJFE 5L6YL 3OF6D 5F7EL 4XE0A 2ZUQB 5IVXB 2XN9D 4AK2A 3FB8B 1VFAB 3HFML 4ABWA 2QSTA 3QO1A 3AQDA 1PY0A 2OMXB 5KVDE 5EC2A 1KTKE 3WTXA 1KLGB 3MV7D 1JWSA 4XNBA 3SYQA 5IEHA 4Z3TA 2ZIDA 4ABVA 1LO5A 1DL7H 3LQMA 3INUH 3O6KL 2MCAA 3FU9A 5I8OH 4G8GE 4LRIA 3I9GL 4QXTB 3MPCA 5INCA 2J25A 4L8SC 4P5TA 3WEXB 4FN0A 5K9KB 1FFRA 3RJQB 1YN6B 3ARDA 1P7QD 3MLPA 5C0JB 1GGUA 3HG1D 3LQAH 1YECL 2BRRH 2I07A 1KXHA 5TGZA 4WO4C 1MCEA 1TNMA 3GWJA 3LNIA 5I17A 4FA7B 3A23A 5C92A 1RPQA 2MTAA 2JKWA 3DIVA 2XA8H 2X3AA 5AOKA 3US9A 1HXMA 2WQVA 4PP2B 1QACA 2W88A 1AG0A 4G8AC 1XF2A 5TQ2L 1MRCH 5DRXB 3MXVL 3ZL4H 1XR8A 4AWJC 2IG2H 5EBMA 5BVJA 1HZXA 1AC6A 1J1XL 2DIEA 3LN4B 4HJ0C 2DV6A 4N8PA 2XZQL 2EE3A 2GT9A 1DUYB 1K5NA 1Z5LB 1I1FA 4I89A 3KJ4C 25C8H 4OV6F 2F74B 3DUSB 5FA3A 1TITA 3BP7B 4HDIA 4YSEA 3BW9A 5F3FA 4KRMB 4OFYD 1E5CA 1K3IA 3BPCB 5AHZA 1BVLA 3FPXA 4FKHA 3S3DB 3OKMA 3TN0A 5E5UB 3WAKA 4Z7UA 3TEWA 2P46B 5EZPA 2VE6B 1O6SA 3AYMA 2AQSA 5C0BD 4Z76A 2B0SL 4RBPH 1HHIB 1T3FA 3H6AA 3VDCA 1A9BB 1O6SB 1PMYA 3I3EA 1SMOA 2XLLA 4QOKD 5BO1L 1S8DA 4WO0A 1R3HB 5H35B 3FN0L 3U2IA 1C16B 2UZXA 1MCIA 2JKJA 3BFWA 4AG4L 4XN9A 3SGEI 3KYKL 2F74A 2GABA 1MRCL 3CHOA 1HYSC 3QR2A 1CICB 2JLPA 4F7MA 2XZAL 2UYLA 1V54B 4HPYL 1D9KA 3EJYC 3UYRH 2ENQA 4ABUA 5SWSD 4Z7QE 3LVTA 3OAYK 1BVKA 4OFYA 3QXWA 1QSVA 1OKEA 2C3XA 3EAKA 4POUB 1U8JB 3C5ZA 4UQ2A 3RFZC 3FSWA 4YO0A 1JV7A 3DBSA 3IJ7A 2EC9U 1D2PA 3QDJD 1G5AA 1RUPL 1K8DA 3JTSB 4K2UH 1U95A 2H47C 4CC1A 4WTWA 1HEJC 1XF4A 2PETA 2XJLA 4DK5A 2BVEA 3GKWL 4X4ME 3UG4A 2F61A 4XAWH 1OGPA 4D0CB 2RB8A 2ZAIA 4P2RE 1P84K 1RZFH 4M03A 1OP9A 1LDPH 2CLZB 2I32A 4UQEA 5G5DB 2R2EA 4WHCA 2LU3A 1SEQH 4MHHG 4UV7L 1LP9B 5KSBF 2JB5L 5DUBA 5FX3A 4WI2A 1OK8A 1ZS8A 5FYKD 4MQXD 4OJEH 3CH8A 1JNHB 5D6CA 2CPUA 5CHNA 1GGBL 3TVMC 2QVFB 1BAFH 2PPDA 1T2JA 1KMEA 1EGJL 3ARBB 4OW6A 1JF6A 2H26B 3FMGH 4N2BA 1USQA 2AMGA 3LSOB 2NT0A 3C60D 4M7LT 4PREB 3TIDB 3LCYA 5C86A 3F7KA 1UOVA 3V4PB 2MKLC 2R39A 2VQUA 4G6KL 5GJTL 1XCWA 1H3UA 4KRNA 4XI5D 5J89A 4URTB 4X4XA 3GRWH 1EFQA 2QPSA 1MAJA 2Y5TB 4LDEB 1FFPA 2ODIA 1QVOA 2EYTA 2TAAA 3CFBA 3G5XB 3EYQD 8FABA 5B8CC 1M6OB 1AOHA 1AQMA 3CFBB 2CHZA 5EF3A 3M88A 2X6BA 4DZ8A 3IU3A 4OLVL 4P2QA 3FO9A 2YPKA 1CG9B 5F88B 5HTSA 5IVXF 5DXWA 5I82A 2WUBL 3SDYL 5F9DC 2DQJL 2QELA 3ETBF 3MBVA 3OMNB 3FCTA 3BMWA 3K6SA 3K80A 5DUPH 3CVHH 5GJSL 4AJ0A 2P5WD 5AX1A 1PS3A 2E5EA 1KJMB 4LCWA 4RMWA 5MEPB 3FOLA 3ARBA 4U6HA 5FUZL 3X1FA 3IDIB 5DK0B 2BNUA 2NT1A 3PQYE 1PX4A 3R19A 4BKTC 4NP4H 5IMOB 1GAFL 4QRPD 2F5AH 3LVEA 4OFPA 3QZWG 3AXHA 2B5IB 3S8FB 2CDEB 5A2CA 1X5HA 1R3LB 3U2JA 1YUHB 1MAKA 4PJGA 3STBA 3WUWA 4WJKB 2RMNA 4I0PB 3ZVVA 1D7FA 1ORQA 1FBIH 2NZ9C 4PQXA 4D7BA 3V4VB 4KO9A 3HBPA 2FX8L 4YPGA 3AY4C 1DQQB 1FFQA 2LVCA 5IVOA 5HYSB 2VLJE 3QDAA 4G72B 4AQ1C 3VXQA 3EO0A 3O45A 2HN7B 1ACYL 1VLXA 3GFUA 1CFMA 3L17A 5AVXB 1N4XH 1SQMA 4WO4D 3SO5A 3QO0A 3OG4B 4X7SH 1MHHB 4JZJB 3DHMA 1PSKH 4JM0A 3NJFA 2XZQH 4E0RA 4KRPC 1NBZB 2HAZA 3I2CH 4AGLA 2DQHL 5IG7B 1V7ML 3R8BB 1RZKL 4MMXA 4XWOC 3C5JA 2A74C 4GSDL 4S1RH 1BQRA 1QAWA 2PEDA 1G4RA 3HPJB 1KUMA 5FYKE 2G2NA 3RGVA 3ZQXA 1P0SE 5IBUB 1MJUL 2W60B 5DT1H 3WO4C 2UVFA 3EADA 4L3CB 5CP3A 1AQ8A 2PNDA 4CNIA 2P8MB 3SY0B 3VW3L 1BFVL 1QZ1A 2Z8VC 5ITBL 1HL9A 1HHIA 1T3FB 2WM0A 3L3HB 3NFSH 3EHBB 1JV6A 4JFSA 1IGML 4LHUB 1N6QL 1U36A 2NXZC 2G9KA 5DD1H 5LBVA 3I6GA 3NZ8B 5C0DA 3W2DH 3BP4B 5EUOE 1QABA 2QSCL 1IKOP 3QNYA 1MF2H 1MEXL 4Z7AA 2JLLA 3QDGD 1E4WL 4I5BA 4KGLA 4AYFA 1CLVA 4QDGA 3LKNA 3FH7A 4WCYL 1EHLH 3B3BA 1MFAH 2WB7A 4G59C 2BOCB 1JGDB 2FR4B 3OLIA 2C1PB 4RETB 1W2KT 4X5RA 1XR8B 4LGSB 5A2AA 2JI1A 4ZS6D 3TNNA 3MYZA 4Y1SA 5E5MB 3OLDA 3NA9H 2NDFA 5A7BA 2EEDA 3DXAB 4ALAL 5CD3B 4I9WE 2V5MA 3AM8A 2NY3C 2E4FA 4MD1A 3VXPA 3ZRCC 4HVBA 3DO7B 3EYUL 4P3CH 1E3ZA 4OCRL 5H37A 5E8OB 2L3BA 2XIBA 5FECB 2A6JA 4P5TB 3R7RA 4M93C 1DQLH 2ZXDA 5ICYA 1ETB1 2WWKT 1HEZB 1CZ8H 1FVCB 2Y2TA 1QA9A 3UG3A 1DLHA 5FLVA 3L4YA 3PXHA 5EO1A 4NJ9L 2UY6B 3TV3H 1F4YH 3BCFA 1IBZA 3FQTA 4XVSL 2UUDH 1QR1A 4KITB 5B6XA 4Y0GA 4GNKB 2MQGA 1WYJA 2KQMA 3BPNB 1RUAL 5TGBB 3EJQA 4ZX5A 1RIVL 4A2EA 2BP3A 5IB4A 2WJ7A 5C07A 4LMQI 4PW3A 1G87A 3KM2A 2E7LC 4XMLH 4FI6A 1R47A 4FXKA 2R0LH 3LNEA 4QPEA 4DNLA 4JG1H 3CFJA 2X4PB 4LLQB 4QHMA 4X8GA 5D72L 5IHZB 5T1KB 1PY9A 4M6ML 4WLCA 4PJCA 1K4CA 2XG5B 4N6QA 5JQ6H 1PNDA 2WTPA 3AY4A 4F8PA 4OCYL 4BEYA 5HDLA 3VWJD 1BQLH 3QCVH 2AZUA 5E6ZA 1T04A 3D2UA 4RMTA 2X89D 3NPZB 1FHGA 2V37A 5JLZB 2P45B 2ROYA 3FT2A 3FYEB 4H1LA 1ZLWK 3TO4B 3FQWB 1OAQL 2BLFA 3ARYA 4X0KA 2ID5A 4NI3A 1ZLSL 4AQEB 4C56D 1YG9A 4I77H 1T1XA 2WB1A 1D5BA 1JNHA 4L1HA 2SODB 3KWUA 4HSCX 2WLJA 4XCCH 2XOTA 4DWHA 5EU3A 3RIFK 1I3RA 4OAWB 1G7LA 4ZUTA 3RB5A 4O00A 3DRTA 2EVJA 1J11A 1R3KA 1F4XL 4OM0H 2R1WB 4UILH 1AP9A 1RPUA 4ZMVA 4GKOA 4HUUA 4AIXA 4NQSB 2VQ1B 3BVXA 4P06A 3GMMB 5FO7A 2NZIA 2YUZA 1KLFA 3QC5X 3D2UD 5JIPA 3SODB 4FA6A 1SEBA 5ELIA 2CUAA 4PRBB 3WKNA 3S8WA 2M8XA 5E94B 3ZKXC 4QRTB 1EK3A 2BC4A 3V4LA 3VD5A 3FCSB 4P57A 3JWDH 3BKYL 4F3FB 4JRFA 2VLJD 3ZMNA 1H19A 1KCSL 2IQ9L 1YNTA 4HEMA 1ASPA 1M6UA 3I9AA 3X12A 1CGVA 4U1GB 3OJDA 2NRDA 4JZNA 3T4YB 4KH2A 3T0WA 4C4KT 4J27A 1NGZA 4NQQA 2R1YA 4XBMA 5FHAH 3VWJB 5AYUL 4C83A 3V6ZB 4AVIA 1FNEB 2HJLA 1NC4A 2XQBH 3V7MA 1QLFA 2H7WA 1GSKA 2WMPA 3HN8A 1VADB 2D0FA 2ESVA 2JCCE 3IS1X 3BLBA 4R7NB 5C0FA 4U1SB 1OP3K 3RX5A 1QR1B 4F7MB 3WLWD 1TQTA 2XTJD 4BE5A 2A0LD 1U8IA 2IADA 1A7PH 2IMMA 3I74A 3L13A 3KDMA 1ZT7A 1MWOA 1YNKL 1NDMA 4X6FA 1RUQH 4QLRA 1JG9A 1FFNB 4L9LC 3LV3A 2I5YH 4N8VG 4JRYD 1J12A 3FQ4A 4C59B 1R24B 5E4EB 1G9NH 5FYJU 1YZZA 3IWVA 2NTFA 3WEOA 4DSYA 3NCFB 1PG7L 2ZP9A 2Q20A 3VFVA 4Y2OB 1VIWA 1JPEA 2D3NA 4PJBE 4X42A 3EO9L 2H9GB 1JE6A 2E56A 1Y1DA 1H15B 2H5UA 2YAQA 4XVJL 3WIFA 4IRJD 2FAUA 3QUZC 4FABL 3WN6A 1OSPL 5KN5B 1HXMB 3QCTL 2VDKH 3QPXL 3V7AG 4L4VB 5A6LA 3CSPA 4DN3L 5HHOB 1JZDC 1WK0A 4H2AA 4BHUI 1L0YA 3GO1H 1N0XH 4BV0A 2AJVL 5DA0B 3D0AA 5ABAA 3D39A 2BIIA 4IOIA 3X3FL 4TSAH 2GFBA 5CEYA 3PUUA 1PDKB 1XWVA 1C5DA 2UXVA 4GW1A 2FT8A 2P43B 5JW3L 5FO9A 3PL6A 5BCAA 2NY0D 3T0DA 5T5FH 3ULVD 3CXFA 5H2OA 1YPZA 4ORZC 1KPUA 4J3OF 4P2RD 3WKMH 1KJVB 1U92B 3EFOB 3Q0HA 3MCKB 1MREH 2AV1B 4QRUA 5GZOC 1JWSB 5IEHB 3QW9A 5D71H 4O51A 1INEH 5GGTL 1TTCA 5EULV 3BPNC 2D3VA 4Y9FA 5HY9B 3ZDYF 3X3GH 2P80A 4S0TD 3VD7A 3U1PA 2OMNA 4FQ2L 3EGDB 1I8MA 2ICWB 4GSDH 4EN3B 2R59A 1P7QA 3TJEH 1UGNA 3RU8H 2DM7A 3EHBD 2BNQD 4F93B 5I1LB 4KVCH 4XH2A 2O5YH 4Q9RL 4PJ7B 2HPYA 3T04D 1UEMA 15C8H 4X7SL 3VI3E 1T7ZA 3UC0H 1OPGL 5DQDH 1H5BC 3G6JE 2PW2A 1ETZA 1J9QA 1QO3B 4X6EA 1ERNA 3P4MA 4IRSB 4H0HB 2IBGA 4TSCH 1CXEA 2YPLD 4D9LL 1S7TB 4PJ7E 2Z31B 2PP9A 3KPNA 4L48A 1INEL 4JRXA 4G7QB 4AM0B 3HS0C 3ZO0A 3VI3A 3Q9PA 4APQC 3T8VA 3T8XA 1WEJL 1MIML 2D0GA 4TVPH 1IBGH 2CD0A 2Q0ZX 2ZKWA 1A02N 4M7LL 3VO0A 4DQOH 5DHHA 4FQQA 4HA1A 4AEHL 1WFUA 5DEJA 5IFAL 4M00A 5DQJA 4KK9D 4IBUA 3CFUA 3HLAB 1X5MA 3B1UA 2NXYD 3IFLL 4FZEL 1SXSA 1JPGA 3JV4B 1KACB 3CFJB 1J0KA 3LDBC 3HASA 1T4KB 5HYQB 1CLZL 1T7YA 5C6PB 4B97A 1ZAGA 5EIIB 3BAEL 3QFJA 3B8SA 3KVQA 3AB0B 3GBEA 4NNYA 3PGFH 1NSNL 4UINL 5T1LB 5DT1L 4FLQA 1OCWH 2YBRB 2VR9A 3A6BH 3B6SA 4UU9A 2HUEA 2E7CA 5CWSA 4HWEH 3CSFA 3D4YA 4NRYB 1P2CB 1A3QA 4Z8FH 3S96B 4OZ4B 4Z3HA 1MY5A 1UAZA 3MRPA 5B0WA 4YXKL 3QEQD 5B22A 4E2OA 4JKWA 2VLKB 4DO5A 3GNMH 4MX7A 3EYQC 5LXVA 4NO0D 4U1KB 1ET5A 3KVDD 1CICC 3O4OC 4YQXH 3NAAH 1USZA 1KGWA 2WPGA 1V27A 2ZXEB 4XN5A 1AXIB 5E4AA 5KSAC 1LEKB 3ESVF 4KTDH 1ZV5A 3HG1E 2V3EA 5C08B 2L7EA 3HE6A 5LNGA 1I1AB 5F7EH 3QFJD 5EO1B 2R2CA 4AX3A 5T8IA 4AGQA 4RIRA 4DP0X 4G8GD 2DLTA 3GM8A 3NRPA 1BREA 3CCHA 3EOTL 1KGIA 3QFGA 5ANMB 3I6LE 3F7VA 1P8IA 2Z7UA 5E6SB 5ABZA 2VW6A 2D2OA 1SN0A 4O02H 1BQUA 3P69A 4JGNA 5AW5B 2QGDA 1DUYA 3AY2A 3IRZA 3WIIL 1JNJA 1WQVT 3O6FD 3MGTA 4ZUWA 15C8L 1TQBC 4N90E 5GRJL 3HLKA 4YDIL 2NTSP 5CGYD 5BS0B 3OGOE 2B5IC 2QPDB 1JYVA 5D93C 4IRJC 4NCC1 5D7LA 4ZQKA 1WCBB 3KJ4B 1CD8A 4W9DC 5JIIA 4I5BB 4AYFB 2AJXL 4M43L 4EKJA 3FT4A 4X4MA 1SXZA 5LGHH 1TPXB 5DUJA 5AKSA 4ZFQA 3KLHD 2YXFA 2FR4A 2QVIA 4LSSH 4AEEA 1SN2A 3MA9L 5AVZB 4H0IA 1X0K1 3P73B 3US1A 3MZGB 4DO6A 3IS0X 1QFPA 2X4TA 5FEBA 3S3BB 4AUUA 4JQ6A 2P4AB 4OKVB 3VQLA 1U8LB 4PTTB 3D52A 4RMBA 3VH8A 4CNIB 4ONFL 5J6GA 1ZD6A 2UX6A 3NEOA 5HHXH 3PDOB 2DD8H 1ZLEA 3DARA 5D7LD 1FHNA 4EN2A 3OPUA 2XETA 1AKJA 4HX1A 3O8XC 2FSDA 5CGBA 2D7MA 4QRPA 4G6KH 5E24E 4U1IA 5I1EL 1G9NC 2IOMA 2V2WB 1KYAA 4K3GA 2BMKA 4KMTH 3BEWB 4U1HA 1NLBL 1DJXA 3Q1SH 3U2SB 1HOCB 1EDQA 1KLGA 2OMUB 4BE6A 2X72A 2W59A 3QO1B 4RDQF 3KPOA 3QCVL 4MA7H 1GZPB 2CUHA 5HVHB 5FJGA 1UZ6F 1B0RB 2V7HB 3BAWA 3O45B 2FL5A 2XN2A 5KZCB 1U58B 4A7QA 3S3PA 1MHHA 1MCOL 3SB3A 1UWEH 4YNYA 3GBML 4WFGE 1BFOA 4PJ5E 5J7AA 3HE6C 1RP9A 1C8PA 4IHBA 1R84A 1A7OH 1IGYA 2F53E 3OKLB 1HHHB 2D2CC 4JN1H 4R7DB 3TO2B 4JRYB 4Y9HA 3UPCA 2COQA 1FUNA 4R4FH 4UDUA 3V4VL 1MDTA 2FH8A 2CHWA 1A1MB 2NY7H 4HLZG 1PQZA 4EXPX 4KKNA 2QT6A 3CXDH 1LE5A 1FC1A 1HILA 1ZWIA 1OWRM 5GJSH 4FXGA 4POZD 1YEHL 2XQYK 5G2AA 1UZ6E 1WIPA 4P4RA 1ZHBA 1YC7A 2WXMA 1PCXA 3EOBA 4HHAA 4WU5A 2A6DA 3UYRL 4PRAA 2CNZA 3PAUA 4F57L 1E4HA 1MQKH 4H0GA 1G7MB 4M61A 1YA5A 4PWHA 5EORH 2B3IA 4X4YA 4ZNEA 2UZIL 2G5BB 5I73C 2FT7A 1CTOA 5CJ8A 4ABQA 1D6VL 4MDIA 3VXNA 1RJZA 3QUMA 2XFGB 4D9RD 1PZAA 5JYLA 1BRXA 2DN7A 4E42A 5J9PA 2C7UB 4XXWC 5FIEA 4R9HA 1A47A 4KO5A 3RVTC 5K9OB 2YD2A 3MCYA 3DJRA 4XB8A 1QZNA 4QRPE 3MRRB 1I53A 2H41A 2OX5A 1GZPA 4IBLT 3AREB 2P26A 2A77L 5ALCH 1KBGL 1CTNA 2NUPA 1LD9A 5GGVY 2CAKA 2NY6D 2XWBA 4IKLA 3OXRA 2IWEA 2J5LB 2Z55A 1M7DB 3TJEL 2DBJA 1ZA3B 4OM0L 1U19A 3OKOB 4UILL 1EHXA 4X32A 5K93A 5T5FA 3L4XA 5SWSB 3U6RA 1QG3A 4XTRD 3C5ZD 2X6CA 3PPSA 3GZQA 4JJ5A 4FQXA 3LKRA 5BXFB 5HJDA 3HAPA 3TNMB 1J5CA 2LE9A 1KPUB 4F92B 4YR6A 5FPIA 3ZE2B 4G83A 2PCXA 1RI8A 4OJFH 2DL9A 4PRPB 1T7WA 2YGNA 4L8SB 1HIMH 2YD6A 4C56E 4ZFOA 1AD0A 3FTGA 3OHXA 2FECI 1PNCA 2ZZUT 2JKLA 4LFHG 2DJ4A 4OJDH 1LL1A 4X6DE 2FL5B 1MCPH 2H1PH 3SPVB 1TT6A 4Q9QH 2C34A 5L8KB 3LKPB 1J10A 5E51A 5BRZB 2YN3A 4FGMA 5E2UL 3BSZL 1JGUL 2ZUYA 3D08A 4JBSA 5TDOB 5AW2B 4AEHH 2GG1A 2RQ8A 3BPOB 5CXPA 3RY5A 2X4RB 3LRKA 2BDNL 5FGCE 3UZEA 4Z0BH 2OW6A 4ZMNA 3FBKA 4PP1C 1IBDA 2AQ3A 1HT6A 4U7SA 3AB0C 4MD0A 2P44B 4L1TA 2XWJA 4M8RA 4MA8L 4NZJA 4W9EC 1J9SA 2ZUTA 4DGIH 3Q1EA 3PDGA 2H9GA 1BW8A 1HVXA 5E6IA 4HFUH 3LYRA 3RVWC 1BJ8A 1EVUA 3ME0B 1XCXA 5AAWC 1OPGH 5HYIA 4OCLC 2XZZA 3SPJA 4NZFA 1HINH 4DFHA 2AXJA 1E9PA 1UD4A 4PJ9A 2VXQH 4KDWA 5MERB 1S7XB 5KSBB 3IGFA 1ZT1B 2P5WA 3CZEA 5FGRA 3W5NA 3QDGE 4OF5A 4ZT1A 1Z9MA 4PMEA 1MWAH 5EN0A 1ZY9A 3Q8EA 3ZKMC 1JHTA 4HP5A 5BW7C 1NAMB 2P8PB 1FH5L 5I8EB 1UUNA 3QBTB 2X7LA 3BH8B 2CHDA 4M1GL 4U0RB 2YAPA 3TYFB 1P1ZB 3P9LB 2IH9A 3O2WL 1A6UH 4UTAH 2OSXA 1YEIH 2VKXA 4NS0A 4KK8D 1H3XA 5CAYB 1NGXA 2EEFA 4RMVA 2OTWA 4Z7VA 2WLLB 2IH1B 2XY1A 4PJ9D 2OL3A 1N5AA 3GGWA 1BQ5A 4XC3H 5KBNC 4BRJA 3BDXA 1FNSL 2CGRH 1IAOA 3M1BB 3RVVD 3RWCB 3SCMB 4TM9A 3AUVA 3VXUB 4PLKD 3STLA 5HGHB 1H8OA 3VXTA 2R0KL 5IVZB 5D5ME 1YEFH 5FLUA 2BPBA 5LGKA 4K5YA 1R0AH 2WYIA 1NC4D 3MO1B 4KTEH 5JPNA 5IHWA 4FLRA 1LO5B 5C0ND 1AE6H 4E41D 3KCPB 1FF5A 3V4PH 1EHKB 1LVEA 3W82A 3NAAL 1URZA 1X9UA 1SEQL 3KPNB 3SDAC 4LLVB 3S7GA 4YVNA 1XQ4A 4UAHA 1U8QB 4XVJH 1P7BA 4MA3A 1HNFA 3PGCA 2XT1B 4X5WB 1E8WA 4JFDD 1JNNH 1G0XA 3FPYA 5GGRB 3Q7JA 2HPTA 2J2ZB 5TTRA 4KVCL 4LU5H 1MIEL 4XHJC 2FBJH 4QF1B 1VENA 5GRUH 4DEUA 1T21B 3WKPA 3VMOA 5C6TL 4R97B 1MFEL 1IGTA 1JXKA 1J1OH 3VRLF 3NIDE 5AAWA 4L9LA 5FFOA 1EA9C 5IK3A 3REVA 1PZBA 2VH5H 2VR3A 1T6VN 3IF1B 4FTVE 5AAMC 4MVBC 1QSEA 1VACB 2FIKB 2C8NA 4NQXA 3PGCB 1IAKA 4RISL 1CXIA 1SFDA 1XL4A 3EMLA 2E9BA 3KGTA 1F3DJ 2HVJA 4KKAD 4QCIB 1CF8H 4KRPD 3G6JB 5DQ9B 1YYMH 1DSFH 1AP2B 4WJ5B 2Y6SD 3QUZA 5TK2A 3RG1C 4CW1B 1D6EA 3UZEC 3JV5A 3WTVA 4GG8A 2AXFB 1WZ1H 1HKLH 2GJ6E 5J1SC 2O61A 3Q5YA 2NY5L 1GPOH 2HX7A 1N19A 3KBEA 4MNQE 4YDVB 3TWCL 4JMXA 4AEIH 2CH8A 4FFYL 4LSPH 5DMJB 4P23C 3B2DC 5EF2A 4JQIA 2KSYA 2ATPB 2Y7QA 3QUYB 4GW1B 4HCRA 5C8JB 4UM8A 4E5XB 1GZQA 4FFZL 5GSVA 4Z3FA 5IQ9B 2FGWH 2YA0A 2RH1A 5T33H 1S7WA 4KKLC 1J1OL 5IWLC 2HFFB 5G4NA 4M7ZC 4HIHB 3ABKB 3RWDB 1IFHL 3ZE1B 4ZW5A 4FDWA 2L8AA 4DKTA 4PPTA 7FABL 3K2UL 3POHA 5D7SH 1J8HD 1NEZA 4N2NA 4GAFB 5KVFH 3GNML 3MLSH 4X80H 1TKWA 1XGPB 5TQ0L 2BS71 3O41B 2R0ZL 2NW3B 4D8PB 1P6FA 2JCCB 4J4PC 3BJLA 4PLNC 3L16A 1I3UA 4YL9A 4TYUA 1IEBB 2BNQA 4FLSA 2OW7A 4RMSA 4HWEL 5M94B 1S9XA 1KFAH 4IBZA 4FZ8L 5FWRA 2DPKA 3I75A 1MELA 5SWZE 2C9RA 2OMBA 4LCUA 4XNMB 1FE8H 2D03L 3NJGA 5EZOL 5IJKA 4HUKB 3NIDF 4QRPB 2QQLH 2VOTA 1UOWA 4YC2B 4ZS7L 2QL1A 2DICA 1D7BA 2HT3D 4Y5YB 5MEOB 4J12A 2YPLA 5CSZB 4KWUA 3VE0A 1MFDL 3VSVA 3VH8B 3IDNA 3IGKA 1XEUA 4DVBA 2OFQA 3GMPB 3GLZA 4LSUH 2OULB 3NT0A 2X12A 4Z7VF 4F8LA 5HSFA 4HD5A 3MRKA 4Y7OC 2PO6B 3V79C 5AW0B 1CB4A 4JJOA 5DS1A 4TNVF 4UTAL 1H8NA 4RAUA 4WUUB 3HZVA 4A66A 4XAKE 4OI8A 3T6WA 2Z1PA 4PGDA 5MI0C 3SDXE 1QNZL 1WAEA 2JQZA 5H94B 3SPGA 2FHFA 1Y6KR 1CD1B 4EBQH 2F95A 1MCNA 5KBLA 2V0AA 4ZQKB 3CHQA 1PKQA 3UZAA 5K1NA 4Z3JA 3VXSA 3OKNA 4TXVB 4XXDB 1SEBB 4KZ0A 4ZUWB 1IKNA 2YWZA 1ZVNA 4H26B 1CZ8L 4U3HA 5DJZA 5AENA 2WV3A 1DZBA 4XOAA 2ISDA 4JO2H 5DJ2B 2F15A 4M93B 4FFVD 4MNGB 1WFJA 5IROC 3TM6A 3D33A 4JFEE 3IJYA 4QGTA 4F1SA 4OZIE 3VXQB 4N1CA 4WEMB 4P59H 1AS6A 3TA3C 5AZ2H 1MJJB 2UWEF 3FS9A 4MCNA 4PH8A 4AL8H 1RH8A 2AV7A 1NDGA 4B27A 3QORC 5LG1A 4DAGL 3O2DA 2OKMA 5FYJE 4C83B 5L2KD 3DNKA 4ZXBB 4R26L 3ZDZE 4NC1C 3WE1A 4U1KA 4ZO6A 2Z3FA 1DANT 3VXSD 1UKQA 5DRZA 2GBUA 5BV7L 1XR9A 2XIDA 1X7SA 2NNXA 1TEGA 3OR6B 1IGFL 2CO6A 4HKZB 1GJWA 3B5GA 4XOCA 4OUOA 2CHNA 4HAFA 4LF3A 2NCMA 2XIIA 2YPKB 1FRGH 3DX0A 4PWIA 4QXUH 4RDQG 5HGDA 3W9EA 3S34H 2W92A 3O6FA 4NKIL 5TJWK 4WI3A 5IJKC 4HFWB 4KKRA 3M07A 3WUZA 4QHPA 1MHCA 3RTLA 1BFOB 1T5XB 4ZNEE 5L4JA 3D51A 1L7IL 2G87A 1EJOH 2DIBA 1U58A 4MDIB 1IQDB 3VXNB 1CBJA 4M5ZH 2NQCA 4Z3EA 2GJPA 4NRXB 5AOZA 4Y9CA 1KG8A 4HU2A 4GSRA 1GZHA 2WINA 5DJAB 2NDGA 3EFFB 4K0OA 1IGCH 1MW1A 4K9EL 1II4E 1G6RB 4P4RB 4RGMC 4LVEA 1UJ3C 4TLUA 1JGVL 3VI4A 4YSPA 3DK0A 2I27N 3UTZA 3V6OC 4MBRA 4P9HH 5JA8B 1F90L 4K94L 3CN3A 3IJYB 4Y19A 1RIHL 3WEBA 3E8UL 3D39D 4JKKA 3BUQA 1E6JH 4U7MA 4MQSB 5DMKA 5HVGB 3U7WH 3ZU8A 4AQOA 1EEQA 1I4FB 2BSDA 2V7NA 2ZJSH 1U95B 4MXVE 4QRRD 2ZOLB 1VFUA 1IBHA 1U8NB 5HVFB 3ARPA 1E28A 3PP4H 4JG0L 4IIZA 5J11B 2I9LB 1KNOA 5HHNA 5CGMA 3UAFA 3S4SB 4N8UA 4KUCF 2DB8A 4UV4H 3TNNB 2VDOL 3PHAA 1VERA 1X5XA 1U8CA 2IGLA 4KBPA 3WNIA 3O9WC 1ZSDA 1MXDA 4ODSL 3JWDC 3SZKC 1L6XA 1UZGA 2R0LL 3MRNB 2IBZX 2UYLB 4ODXA 4U1JA 3LZNA 3O2WH 3JQOB 4LP8A 4ZFGH 3UH8A 3H9SE 3TA3B 3MTXA 3AC0A 4LLMB 2Q2EB 3SDXA 5KJRH 3H0TA 2FYYB 5GGSY 3RVTD 2BY1A 2V8LA 3TC9A 5D1XE 1CT8B 3RA7L 4IKIA 4AGPA 4TPRL 3IFPA 4KKBC 5ICZA 1BP3B 3TH3T 1D9KB 2L7JA 1D3CA 3BN9C 5EU7E 2DQFA 3MREA 4U1MA 1QHJA 1C5DB 2YK1L 2BZ7A 4GW5A 5LGJB 3DYOA 3L3IB 4K7PH 4Y5YA 2CR3A 3PUCA 4GPOA 1IKNC 2VE6A 1MFCH 5H35A 2H1XA 4XNZC 2A9NL 3ROLA 1FBBA 2HRPH 4J3XA 2BP8A 3UTTE 3SOTA 3JXAA 4ANUA 1LE9A 2ZOKA 2XJKA 4URKA 1RFDL 5I1HH 1NCBH 3H3BC 1QEWA 3MJ7A 4HGKC 1OPOA 1S9VA 1F88A 2BNRB 2IJ0C 2KSBA 4KKPA 4KO6A 3N1PC 3BUPA 1RZKH 2WOBA 4Q2ZB 4Y9BA 4WKZA 1X9QA 4P5TD 3ZDWA 5EU5B 4FJYA 3QPQC 4WNQB 3HC4H 4XP6L 5BVPH 5CD5D 5KSUB 3O9WA 3TBSA 4MA8H 3WEAA 2Q5BA 3UJJH 2HFTA 2ZCLL 4N2OA 1EAPB 1U4FA 5I8CB 4ELDA 4GB9A 3MRBA 4IM8A 3TH4T 3UDWC 3KBPA 2L04A 3VWKC 3EXLA 1WE5A 3CDCA 1NDTA 1WTGT 3IMBA 1KNOB 1C8QA 4LDOB 4PP2A 2A73B 3GMRB 1SJMA 3QZOA 3DA0A 4B7IA 4ZUVB 5GSVB 3HRZB 1AS8A 4M1DL 3DBXB 5HYQA 5MHSD 4Y5XC 3ZN6A 3NDYE 4I0PA 2APFA 3FOMA 1AZBA 4B9ZA 4JO2L 3MLWL 3G5YA 3UTSA 1G9MH 4O02A 4L3EB 1CDUA 2VXUL 3UYOD 4DUVA 4X5XA 5HHVL 4JFYB 3VQMA 4PXKA 1IAMA 5F9OL 1HESA 4JL2A 4BQ8A 4CSTA 1KN4H 4E9VA 3FSAA 3ZTNL 1IW9A 4K3DH 1NFDA 3TF4A 3VNZA 1XGUA 3AUWB 2H32A 4NM4H 1BG1A 4KY2A 2X1XR 1IC0A 2FD6L 1A7QL 4XX1G 2XUWA 1NTDA 4IRZL 4U2ZA 4MJIB 5F89B 1XGTB 1GXEA 3S98A 2FO1A 2CU9A 3OVUB 5EA0H 5FYLH 2FUTA 5IK3B 3WS6A 4LPUA 2AEOA 2YD8A 1W0VB 1WFTA 5DZVA 3QJSB 3HFMH 3HBZA 1CFTA 1CK0L 2GSIB 4KK9C 3R06A 3BRFA 4FRWA 3IXTB 2H0EA 3GTTA 3AMLA 2EYTB 1T83A 2HUHA 3FQUB 1T5XA 3TWYA 3N85L 3ZJAA 6TAAA 1Y0LB 4OCWL 3PQYB 3UYPA 5GGRA 4X9YA 3O4LD 4B41A 4YMPA 4K3HA 4WY7L 4QF1A 2IGTA 1UWXK 4GINA 4TNWK 5I75C 1UB5B 3LAFA 4YEFA 1A64A 3OD3A 5E8DL 1NEZG 2P5EA 4PJFA 3RPBA 3P4LA 4DGYH 2HLAA 4JQXC 3MLRH 1BXXA 1J5OL 2ICCA 3FOLB 4U6HB 4HUNB 4KO7A 1GU8A 1VDGA 2KPNA 3EYFB 4OQTA 4YSTA 3UERA 5BW7A 3D18A 2DLFL 4KKBD 4PJHE 2ZKXA 1TTFA 5IESH 5ALBL 1IM3D 5DMYA 3BWZA 4P8QA 4H8VA 4JDZA 4LCVA 9CGTA 3CDGB 2WJLA 3P4MB 4IRSA 2VUOA 2W0PA 35C8L 1FL5B 2ZX8A 4YFLI 2JI2A 2CSPA 1M71B 2H3XC 1HHGB 1NM4A 3FH8A 5DRWB 4K8RL 3APFA 4ZSOE 4ENZA 3QIBA 5D7IF 2EDWA 4JHWL 3BGMA 3FQXB 5GZOA 1G7IA 3WNJA 1KBVA 4TMPA 1BYNA 1AXTH 1OAUH 3DVNB 4ZO9A 3NN8A 4Y5XA 4AGMA 4HKBA 3SDAB 1X0SA 5FB8A 3N1GC 4X8JB 4KZEH 3AQYA 3FSOA 1NBQA 3L2LA 4KTYA 4L4VA 3M45A 1L4IA 4LBAA 1RZ8B 2B2XH 5CD5C 2Y2YA 1IM3A 5K1VA 1CI3M 2O26U 3IDJB 2NY5H 2ATAA 4NZUH 1D7CA 5AW6B 4F58L 3TYFA 2WLIA 1JPST 3E1ZA 4Y9GA 4GEJA 2UY6A 1DFBL 3RIAF 2ILLA 3VNYA 3V0VB 5BOJA 1BAFL 1VKXB 4RRPM 3WD5H 1B2YA 5C0RH 2CMRH 4NN6B 4ZTPH 2Q7AA 2XXCB 4YZFE 3RDTC 2ARJA 4ISVA 3LV3B 3DDFA 3MRJA 1O0VA 3ASNB 3PDOA 3ILQD 2HFGL 3QEHB 5C0GA 1BVNT 1E2WA 3VXPB 1HYSD 3L3GB 1T22A 3JTSA 4LK4A 3OR7A 2KQNA 5IB2B 4L4VD 4XHQA 2F19L 3WNPA 4LVOC 3RX7A 5TE6L 4FCAA 5LG6A 2OYLA 1UG9A 3MBXH 4BFNA 5GS0D 3RX8A 1KB5A 3KJ6L 4G6FB 2GIXA 2IH3B 2R0ZH 3IU4H 3OKKB 5TQ0H 1JFQH 3K5RA 4IU3B 5AFAA 1FL6B 1NC4B 4LDLA 1PFOA 4XRCB 3OKKA 2OJZH 2ZFEA 2DMGA 1J8SA 4J4PA 1KTLB 4B0MB 2GUYA 1R5WB 2R8SH 2YXMA 2A6IA 3DJTA 1TEYA 4A2GA 4M62L 4KJYB 3NJXA 1KBPA 3O41A 5TPWL 3DX1A 3NSDA 2HX9A 1AGBA 4IDJL 5C0GB 2BP5M 3M17B 3H1ZA 1BMGA 1YN6A 2CUIA 3ARDB 3D3VB 4HH9B 1QUNB 5I8OL 1DVFC 1NBYB 3C9NA 3DX8A 5DO8A 2B08A 3QIWC 2Z93A 3C2AL 5D2NB 1RK0B 2VABB 1FQ9C 1RZPA 5IOPA 3FW6A 3OV6A 5F7NC 5F71A 3B2UC 3OQ3B 5BZXA 2Z65C 4RAVA 5AWNL 3N9GL 3QUZD 1HX0A 4ONGL 2VR6A 2JKSA 1WPCA 5I71C 4NZDA 5HDRA 4GG8B 4LZKA 2GQHA 4OCMC 1U9KA 3GJFA 3QEUA 5K33A 1U3HD 2WHVA 4G43A 3ESNA 5F1NB 4YSRA 5KBDA 4PI0A 1P4IH 1Q5IA 2CRIA 2HH0L 1KCKA 2FO4B 4ZMWA 5DMGC 5DZNA 4YBHA 2DQDL 4FI7A 3QUXC 5JR1L 1NKOA 1KCVH 3F3HA 3KHQA 1F3JA 1CU4L 5EEYA 1F42A 3D25B 1J8HA 3MUGA 5SX5H 2O5ZL 3CBRA 3X1BA 1HH9B 1EZVY 2BIHA 2DWSA 4NSKA 1P7KB 3PGFL 5HHPA 1M53A 4MZ2A 1GHFL 3LD8B 4DGYL 4ELMF 4M4RA 2VQ1A 3CIQA 4JPKL 4EQ3A 1J88A 1T4WA 3SE3C 3UJTL 5A1AA 1A66A 3KW7A 5F6IB 4QY8A 4OZFG 5T1JA 4YXHH 5F96H 4AMIA 3HARA 3Q8BA 4A63A 2P5EB 4PJFB 4ZD3L 3BIKA 3VFMA 1I8KA 2BIPA 2ZOUA 4G1MA 1V5JA 4NRXA 1KCUL 3QYMA 1SDDB 1UACL 4GMSL 2IAMA 4JQVC 5B38G 1D5BB 3CUPA 4OB5H 3KXFA 4PJAE 4GW4B 2A9AA 2WO4A 3MC0A 4PJEB 1KT2A 4Y89A 4U6VL 5DHVH 4AIZA 1H6EA 4NKDB 1QI3A 2DMBA 3RYMA 5E6RB 2Y02A 3ECQA 1EO7A 4XTRC 1FLRH 4OCNC 2R69L 1HWHB 5B1JC 3U4EB 1PY4A 2W0FA 1DE4B 4Z7WF 4WQOA 1BVOA 4Y16D 1QHQA 1T1WA 3KPMB 2VW4A 1G7JB 4R0LA 5CJQL 2OV0A 5GGUB 5IF0B 3BAYA 3GDCA 1S5IH 5IHBA 1NIAA 2E6QA 2IPKB 4B60A 5F9WB 1JHKL 1QQDA 4JEGB 3TU6A 3UJTH 5IR1B 3NEEA 2H45A 2M26A 5EOTA 3SQOH 1T20A 2ZAHA 8PAZA 4NKOA 3WN5A 3S88H 1C7TA 1P53A 1F2QA 1QNIA 3KXFD 3MRCB 1QPPA 5H2LA 1YQVH 2VLRB 1P8HA 3SDXF 3JBG7 1UVQA 5T3XH 1M0MA 1COBA 3CHXA 3RKDC 3HBQA 2ZNWA 2X10A 2C26A 4TVSa 3GIVB 2OL3H 1MCWM 3IAGC 3BEWA 4OGAD 1GC1C 5AYQA 1YEEL 1KN2L 1N59A 4LCCB 2OSYA 4FG2A 5IW1B 2HYMA 3D1MC 1F50A 2DKMA 3TTYA 3HB3D 2EUWA 1RZJC 4PJXA 4BWUA 3OB8A 2G60L 5FUOH 1S9YA 2QSQA 4WUUE 4HSAC 1DBJL 3FB6B 4Q0XL 3BESR 1U8MA 1KXQA 2IALA 1WFNA 4PCKA 5ESAA 1TXKA 1E0PA 1EAPA 4ZZKA 5E8OA 4HJTA 3QORD 3MZTA 5E8NA 2NY2B 2E8ZA 1J8KA 1PVHA 1UADC 3DMMB 2VXQA 2BDNH 1BYOA 4QTFA 4RGMB 4TQEL 2F5BL 4R5TA 4O2CB 3WFDH 4MZ3A 4KTGA 4EI5C 3JV0A 1J8RA 4HGMA 5H37H 3PWLB 4B3EA 5HYFA 2V3DA 3VTAA 1KTLA 4AMXA 3OE9A 3RIKA 2DTMH 4BELD 3FT1A 4HKJB 4IRZH 2IPTH 1XZ0B 4CGTA 3EYVA 3FHQA 3L1OL 4JMNA 1UJ3A 4N85A 3DPDA 1AHKA 2HVKB 1A5FH 3QZWA 1RPKA 5J57B 2BK8A 3OQRA 1N2RA 2PYED 4JQIL 3D0VA 4PJEF 3BRGC 1B2WL 3QWNA 4X6DF 2AJYL 3CLFH 3MRFB 6PCYA 4DP2X 4XP5L 2Q7YA 3CZSA 3EH4B 2XX1A 4HW6A 3CJJA 2DEWX 3MREB 3HC3H 4G9DA 4ZFGL 2ADGB 3MOQA 3MGTB 3V52H 3QEHA 4IKJA 1CDHA 4HXBH 4LCUB 4XNMA 3VMNA 5B1BB 4YJZL 3NJIA 4ODUA 1AD0B 3HRZC 2YD4A 4ZZFA 4GBXA 4G9FA 5ESQB 5KVGH 3AXLB 2N0MA 5CEZD 4X31A 4TQIA 2WBJC 2EDTA 5EUKB 3WNOA 4MJIE 4JY4B 3VFRB 3AGWA 3MROB 4JY6B 5IJDC 3HG2A 1ESOA 1WA1X 3QORB 2DLHA 3COOA 5TF0A 2ZTBA 4CVWA 3UTQA 2IPTL 2BY2A 1ICTA 2XVGA 1P2CA 4JQVA 2VERN 3KBFA 2IH8A 5L7XL 5AYUH 2YN5A 4RH4A 2FLBT 3HI1B 1EAJA 3UBXI 2CKBL 1A6ZB 1OGAE 4GBXD 1C5BH 3CC1A 4JDTH 1HJCA 1X0I1 1SF5A 1TQVA 2ATPA 3QUYA 5C8JA 2V5YA 3GHBL 1WP6A 3PDDA 3ZDZB 4EDWL 2ZF8A 5AB0A 1M2VA 2QKIC 1J0JA 1QMUA 4AQAB 5KANI 5KSAB 4FFTA 4RDBA 5ADPH 4QHLA 5F9OH 4D9QE 3AG4B 5HHVH 4YC2C 1F1AA 1KN4L 4OGZA 2ZSWB 4JPIB 2ZWZA 4LEBA 4PGEB 5BUAA 1F97A 4PY8I 4OGAC 3H4HA 3F7RA 3RZWA 4LL9A 1RZIA 2ZSWA 4JPIA 5EPMB 5F3HB 1SYSB 1UASA 1UHVA 1CWQA 3IFNH 2KYIA 3OMIB 4LARH 4OIFA 3QUMH 5F9JB 5DVOA 5GISL 3Q43A 4QHUB 3BRDA 4GIAA 2Q10A 2XWDA 5LDSA 4YHNB 3BO8B 1O6VA 1NM9A 4KY1H 3QQDB 4WJG3 1NFAA 4F9PA 3MJ9H 1CVSC 1U3JA 1XO8A 3O2VH 3T4AA 4Y1AD 4YGVA 1G6RH 5HYEA 3AS0A 4D0CA 5A6MA 4YHOL 3MV7B 2KS9A 1EHNA 5CF3A 1QBLH 4UNTA 1ETZB 3BFQG 3W57A 4A7VA 1YYLH 3KPQB 2NSQA 3TIEB 1T2QL 2QR0B 1DBKL 1JCVA 2JCWA 2GCYB 4CN1A 3TH2T 2BERA 2Y1VA 1ADQH 1QTPA 3BKMH 1KEGH 4AM0Q 1AGEB 3JT0A 4MD4A 5AW1B 3FONB 3M7FB 4P59L 1CGSL 1NCCH 1P7QB 4K3JL 3WFBH 4DEWA 3DGGA 3BEVB 2H26A 3MUHL 5IW6A 4WK0B 4EI0A 3D5OF 3H9ZA 3I02B 1EO8H 4K71C 2H0FA 3BT0A 2X1QA 1H5BB 2FD6H 3OC8A 4GAJL 4DGVH 3L81A 5E99H 4NQVA 1C16A 1X7TA 2A3TA 2FLRT 2UZXB 1IBFA 3MFGB 3QEGH 5GS2D 4F9PC 4IHOA 4O4YL 4XBGA 5DURD 1NUNB 1B90A 3DBXA 1F56A 3RA7H 4P07A 2YK1H 1Z9SB 5KYXA 1WBYA 2YOCA 3NCMA 4Q4IA 4IJ3C 2XPYA 1WFOA 1NGQH 2ZUXA 3HEIB 2ATKA 2APVA 5I8EA 3QDJA 3LIZH 1CGSH 1NCCL 2BIQA 2ZUWA 4K3JH 5I6PA 3WFBL 4LLDA 3MSP