4G70B

Structure of recombinant cytochrome ba3 oxidase mutant v236t from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant V236T from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 51
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4g70B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4g70B02
2YCXA 1ET5A 1BXAA 2HRGA 1AAJA 2UXGA 2XU9A 1QHJA 2I20A 1MG3C 4GP4B 2FTAA 1BEXA 1PNCA 2BZCA 1L9TA 1NWPA 1X0K1 4MD1A 3UACA 5DYSA 4DP0X 2OJ1A 4GPOA 1A4AA 1ET7A 2BP0B 3CODA 2EIKB 3NJGA 5A45A 1E30A 3NY8A 2W88A 4BV0A 3NSDA 1BXUA 1AZUA 3AG1B 1P8HA 4X31A 1B3IA 3RZEA 1F88A 2YAFA 2R4RA 1BYOA 1V10A 2LNLA 4XT1A 1GS7A 1KG8A 5G2AA 3VI0A 1M0MA 2E86A 3QBLA 1EZLA 5G2CA 2FT6A 3UTXA 1GS6X 2IWFA 3FPXA 2QPDB 1MDAA 4MFHA 4DJHA 4KO7A 4YSQA 2HLEB 1NWOA 4TL3A 2HPYA 3OE0A 4J4QA 2EI4A 3NP4A 1L9QA 5B6VA 4FA7B 1R1CA 4JHVA 5B7FA 3ABWA 3UZAA 2PP9A 1OF0A 4YVNA 3NSYA 1PCSA 8PAZA 3S3DB 5B1AB 3X1BA 5B7EA 3MBVA 2PP8A 1AR1B 2Q5BA 1NTDA 5JJNA 4A2EA 5B6YA 4AX3A 1S51A 2KSYA 3PDSA 1L9SA 1OE3A 2IAAC 1NPJA 5F8UA 2PEDA 3NJIA 3FQ1A 3CDZB 4BWBA 1PMYA 4L35A 5H2LA 1ZIAA 4W9ZA 5B34A 4FBZA 2XX0A 3PXLA 1A65A 3AYMA 1VJMA 1MZYA 2J55A 1AT9A 3UTVA 4P5RA 4DP1X 1ZPUA 4E9TA 3EHBB 3TASA 4AZUA 4E9YA 1WAEA 3PAUA 1SFDA 3C9LA 1CYXA 4E9SA 5G2DA 4KLYA 2QDWA 5ITEA 3RFMA 2J56A 1KCWA 3CDZA 4GYBA 2EILB 3FSZA 1WA1X 4X4KA 2Y03A 1VGOA 2YCZA 4E9WA 5IY5B 3ZBMA 2PPDA 3JT2A 4XXJA 1E0PA 1ASPA 3NYKA 1NICA 3UGEA 1PF3A 2J57A 3UABA 1P8IA 1TN0A 2VSMB 1QLEB 4KO6A 3UTYA 5TK2A 2YXVA 1GY2A 4YVUA 1BRXA 1W8EA 3QJRB 1KBWA 4A2DA 2X87A 4MQSA 2BO0A 5B1JC 4YSCA 5I6KA 3OM3B 2YAEA 2UXTA 1E67A 1OE2A 1PAZA 3QJSB 3WKPA 2Y01A 2BZ7A 2JKWA 1KDJA 4UHRA 3ZIYA 3QPKA 4XTOA 5G54A 4WTQA 3X1FA 5H2OA 1J5CA 3BQVA 1ZV2A 4QRYA 4A2GA 1FBBA 2HX9A 3T9WA 3T6XA 3NYAA 4F7KA 5B6WA 1AZCA 4G7RB 5AKRA 1P8UA 3NT0A 4XTLA 4WKXA 4QLWA 3OMNB 4AKOA 3IN2A 4G70B 2IH8A 1BQRA 2XX1A 4CSPA 2PCFA 3OE8A 5B1JA 3X3CA 3UAAA 2Y69B 2CAKA 2VW4A 3OD3A 2AVFA 3NJMA 1NDTA 1QHQA 2QDVA 4CSZA 1KDIA 4F2FA 3HAPA 4LDLA 4UANA 5C1MA 4UAHA 1HZXA 2AZUA 1OOWA 2F93A 4JR8A 2B08A 5H2KA 5D4JA 1F56A 1O0AA 1NIBA 4A2HA 2FNWA 2OCCB 5B7MA 2ZWNA 2YDOA 2CUAA 3EF4A 4N4WA 1X9RA 1W6WA 1GR7A 5B3SB 2GSMB 1FWXA 5I26A 4YSOA 1URIA 5I28A 3FYEB 3H56A 4PCYA 1X0I1 3QBGA 1XJIA 1N70A 5AHZA 2QPEB 1L9RA 1SNRA 2KSBA 2JFCA 4AMJA 1CURA 1ASOA 5I6LA 1QM8A 3NY9A 3OE6A 2XV3A 3TBBA 1BXVA 4BUOA 1KMEA 2NRDA 2UX6A 2R7EB 2GHZA 5AZDA 1AOZA 4YSRA 1E12A 1XMEB 4NAJA 5G28A 3NP3A 3HASA 4RH4A 4DPCX 1J9RA 2LLNA 3ABGA 1SF5A 3P0GA 5B2NA 3N2JA 1S8JA 3NJFA 1IKOP 3WG7B 3ABKB 4BWUA 2BP8B 2XVBA 3GYRA 5TGZA 2I85A 3S8FB 3QAKA 1OCZB 4UF7C 1A4BA 4M4RB 5B0WA 2VW6A 4BXVA 3DIVA 3NJNA 1GY1A 2CJ3A 1BM1A 2P80A 2IDSA 2PPCA 4YSUA 3SQRA 2JAFA 4TXVB 2R7EA 2XV2A 3TBCA 1PLBA 1BAWA 4KOCA 1JZIA 1JV7A 2JAGA 2DWSA 4HYXA 3EH5B 4N4YB 1AS6A 1NIFA 5DHGA 1V54B 3VW7A 5KKHA 2FT7A 1PNDA 5DHHA 3SBQA 2F95A 2DWTA 1JXGA 1XB8A 1HAUA 1FA4A 1A8ZA 2YAQA 3DQBA 2WJLA 1ZIBA 2BP8A 2PPFA 1XB3A 3S8GB 2Z73A 4IB4A 1L0MA 2BWIA 2YCYA 1NIEA 4HCIA 3VGAA 4G71B 3KW7A 1SHXA 5B6XA 3CG8A 1GS8A 2I1XA 4E9QA 3OQRA 4GRVA 3EMLA 1A4CA 1ZDSA 4DP6X 5AX0A 3NSBA 4IAQA 5AWZA 4HIPA 1S52A 3PWHA 4X1HA 2HX8A 3X1EA 4AKQA 5F7AA 3S3CB 1IBYA 1RZQA 5BR2A 3WKQA 5AHYA 1SDDA 2FQGA 2A3TA 4EA3A 1KCBA 2HRHA 2AFNA 2PP7A 2ZZLA 1IW6A 4MBSA 2BRDA 4HALA 1S54A 3ZPRA 2I7SA 3IE9A 3OMIB 5AZUA 1ZDQA 1ASQA 3AW5A 3H4FA 1YLBB 3BVDB 2WO2B 1PZAA 3D4SA 2X88A 3L45A 5I6MA 2XV0A 1BQ5A 2VSKB 4BDVB 1F4ZA 3OAXA 1AZNA 5D4IA 4IARA 4NC3A 1JOIA 2NTUA 1E5ZA 1PZBA 4X32A 4HCGA 4HHWA 4MD2A 1JZFA 2RACA 2HX7A 3AZUA 5EN0A 3T6ZA 4MQTA 5JJJA 2R4SA 4NB7A 1SDDB 3QAPA 4GYCA 4G7SB 3GDCA 2M3GA 2WJKA 2VT4A 2Y04A 1KBVA 1OCRB 2FQEA 1JVOA 3WI9A 2GI0A 3WNJA 1OCCB 3NJKA 3DKHA 4Y9HA 4E9VA 5TK4A 1AS7A 5J7AA 4DP5X 2CCWA 5I5JA 4E9XA 5EHFA 3PAVA 2IDTA 1UATA 2AT9A 2MRYA 4BWTA 1BQKA 4DKLA 5H2JA 1BYPA 2FWLB 3QBKA 5ANHA 5H2IA 1AG6A 5B6ZA 1TU2A 3U25A 3NSCA 4BDVA 3VHZA 2VW7A 1NIAA 4KOBA 4QKTA 1ILSA 5JJEA 2AANA 1S53A 1UAZA 2YAPA 3ASOB 4OV0A 3QDCA 4DAJA 4BK5C 1C8SA 2ZIYA 4YSSA 3UONA 1WS8A 3QJQB 1CYWA 1N68A 1AQ8A 4YL4A 4JQ6A 2IDQA 4JKNA 1PXSA 3PPSA 2GBAA 2J5WA 2GIMA 1IXFA 1BRDA 1JV6A 3MX0B 2DV6A 1RCYA 4KNFA 1H2SA 3NSFA 5I6OA 1JZGA 1RZPA 1WA2X 2H3XC 5F7BA 2PPAA 3AG3B 4KO9A 4HYJA 2I7OA 2IDUA 2P80D 2VM4A 3WNIA 2YARA 5G53A 3EH3B 4N6HA 1M9WA 3NJJA 4JHUA 4JKVA 4Q89A 3TA4D 3FT0A 4AKPA 4M3HA 2YDVA 1AANA 2NTWA 4A67A 3UZCA 2ZXWB 9PCYA 2KS9A 3WQJA 3FU9A 4A68A 4P5SA 4KNUA 5I5MA 2YQBA 1I53A 3QJVB 1JZHA 3ABMB 2PPEA 1UCQA 2DY2A 1GUEA 4GP8B 3AYNA 5B1KA 3AG2B 2TSAA 2VN3A 1PZCA 1FFTB 4BXSV 3FSWA 1Q5JA 1CUOA 4XT3A 1SFHA 5I6NA 1F50A 1C8RA 2BW5A 5LDUA 3T71A 4FPDA 1GSKA 1SHWA 4QI1A 2GC7C 3FQYA 4GXFA 1JZJA 2AZAA 1ETJA 3ZPQA 3HEIB 3AG4B 3CAPA 1PY0A 3RYMA 4XTNA 3N55A 2I21A 1M0LA 4A4MA 1TEFA 3SBRA 1X0SA 2DYRB 5PCYA 3X3BA 1KYAA 1GZMA 1KV7A 1MG2C 3X1GA 5I5IA 4PXFA 2ZONA 1GU8A 1KG9A 5FJGA 2XLLA 3OMAB 1AACA 3ABLB 4ZK8A 1M0KA 2GC4C 5B1BB 3ERXA 1J9SA 5H2NA 2EIMB 1QNIA 2HXAA 4HWLA 4Q8BA 3COCA 1DZ0A 4BEZA 1OCOB 2B3IA 2OV0A 3REYA 4WAVA 1SJMA 2G87A 1E5YA 4W1TA 1L9OA 2Z55A 3PXOA 5A7EA 5BR5A 2TSBA 1ILUA 1QKOA 4DP7X 2XXGA 4YSTA 3ZX1A 4PAZA 7PCYA 3QJUB 5AX1A 1TN5A 3UTWA 1ET8A 3S3BB 1MGYA 3HARA 1WA0X 1W6LA 4F2EA 4K9JA 3UAEA 1RKRA 4E9RA 2QT6A 2ZFEA 1CWQA 3FU7A 3X2QB 3C9MA 1NPNA 4NERA 4DP8X 5H2HA 3V2WA 1C3WA 2XYBA 3A7KA 1IC0A 3HB3B 2J4YA 1FBKA 4YSAA 3FPYA 1DZEA 3V9CA 3NJLA 4EF3A 1XB6A 2UXVA 1AP9A 3KJ6A 3C75A 1OV8A 2BWDA 2IDFA 2IWEA 3IBOA 3MBWB 4KNTA 1J9TA 4AMIA 1PXRA 2BHFA 1J5DA 1S8LA 2CBPA 3UG9A 5A8EA 2HZHA 2L6XA 4GP5B 1KGYE 2IWKA 3AM6A 1U19A 2DYSB 4HZ1A 1E65A 3FU7B 4HAKA 3CVBA 4UG2A 1NIDA 5E9NA 4DPBX 1OE1A 1JXFA 1XIOA 4BVNA 4YSDA 1J9QA 5FC9A 1AZBA 5G36A 4A2FA 2FJSA 1R84A 1HFUA 4BEYA 1MZZA 3ASNB 4KNSA 4DPAX 4EJ4A 4PXKA 3IEAA 5D4HA 5H2MA 1JFPA 2PCYA 4HCFA 2XWZA 1IBZA 3QBIA 1AZRA 1PLCA 4KO5A 1SF3A 2EIJB 2VMJA 3T6VA 7PAZA 2WSDA 1QKPA 4G72B 3QJTB 3ZEVA 3G5WA 4HHGA 3V9EA 4AI7A 1CC3A 1VLXA 2YAMA 4K5YA 5ITCA 5PAZA 1PY6A 3PLYA 3FS9A 2W8CA 2YAOA 2WO3B 2Q9OA 1LN6A 1A3ZA 1H68A 4YSPA 3GXUB 3CVDA 1IUZA 1L9PA 3V2YA 3EH4B 3FQ2A 2EINB 2H47C 2MTAA 6PAZA 2JXMA 4LDEA 3FSVA 3FYIB 4DP2X 4QIDA 2YXWA 3T6WA 3NS0A 1M57B 3FU8A 2YAHA 1AG0A 1JVLA 4FAAB 4A66A 4EIYA 2Y00A 3HAQA 3PQRA 1DYZA 3D12B 2XUWA 1GW0A 1Q5IA 4GBRA 4WW3A 3VVKA 1JZEA 3H4HA 3PAZA 3SBPA 2BW4A 5B35A 6PCYA 1ID2A 3PCYA 4L0PB 3FSAA 4N8UA 2PLTA 1X9UA 5A44A 1NINA 1JERA 2XXFA 3ZDWA 2RH1A 1PLAA 3SN6R 1EHKB 4L6RA 2FQDA 3HAOA 3UADA 2H5UA 1NZRA 2IH9A 2ZOOA 1HAWA 2CALA 1TKWA 3ODUA 1TEGA 1T5KA 3CZUB 2I35A 4LDOA 1R2NA 1AS8A 2VM3A 3CVCA 3OE9A 2GB2A 3T45A 4BWWA 4G7QB 1WS7A 4YSEA 5AFAA 3PBLA 1AIZA 3QQXA 3KW8A 4DP9X 3X1NA 1L9HA 5H2PA 4ENZA 2YCWA 2UXFA 2N0MA 3DDLA 3IN0A 5LWEA 2FT8A 1GYCA 1V55B 1IW9A 5I6PA 4GY4A 3JTBA 2BP0A 3AY2A 2Y1AA 1M56B 5ETZA 2KSAA 3VG9A 3WIAA 4DP4X 2UX7A 1BRRA 2FQFA 3HANA 2Y02A 1ADWA 2X72A 1KGBA 1JXDA 1JGJA 3NJHA 3TU6A 3DTUB
chains in the Genus database with same CATH superfamily
3MJ9A 1WBZA 4Z3TA 4EIUA 2F19L 4M93C 1UFUA 2G3NA 3CSFA 2FYVA 2A9BA 1FVDB 3PNWA 4MB4A 2CO7B 4NKDB 1JYVA 3C08L 2BP0B 3Q9PA 4H2CA 2IAMB 5T1KA 1N7ML 3OHXA 2NYKA 2NT0A 2ZWSA 5D1QC 2YAFA 1AMXA 1BYOA 1R3JB 4M7KL 3RDJA 2XVGA 2LNLA 1HNYA 4JREB 3VI0A 4ZW5A 4JFDB 5EWIH 2FT6A 4XWOD 1PG7H 1TO4A 3Q3GB 4R2GC 3VAEA 1A9BA 3MRNA 2ERJC 1GCFA 1ADQL 1DJGA 1UEMA 2XZAL 4MFHA 1T83A 2AV1B 2B20A 2BSRB 3HG3A 2EZ0D 3O3UN 1AHKA 4W9HC 5TF1L 2CRIA 3ET9F 3PJSA 5K59E 2WY3B 3BDYL 2X4OB 1OGSA 1CXIA 3OKLA 3GZQA 3UBFA 3ZL2A 5ANME 4HJGA 3ZE2F 2CKBB 2XPGA 1FG2B 4FN0A 4X4MA 4EUPB 4ZNEE 2ZD0A 3U7YL 2QJDA 1IFGA 4NO2B 4BSWA 3AM8A 4LRIC 4AEHL 4IOFD 4GQRA 2JKIS 4Y89A 5I1IH 5BXFA 2CHWA 4RQQB 2W0FB 1G7PA 3D4ZA 4ZO6A 4AJ0A 4KJYB 4PJAA 3AYMA 4GB9A 4UQBA 1HQ4B 3MYZA 3PWJA 1PEZA 3AMKA 3TASA 1IC7H 2BSTB 4BA8A 3DJZA 4JGMA 5IHZB 3S7GA 5G2DA 4C56E 4GLRI 1D5MB 5CFHA 2XSKA 3REWA 4N87A 3C8KA 3QNZB 2ZOKB 1I3UA 4KGLA 2YCZA 43CAB 5AVQB 3C5XA 1R5WA 1SXCA 5B3JE 5ICXB 4U1HA 1SUJA 4KKAC 1XGRA 4DERA 3S37L 3VW3H 3U2IA 1NBVL 1TPXB 1JGEA 2AJUL 4YHMH 4TTDC 3IPEA 4A2DA 4Z3JA 2G3ZA 1QRKA 1I8LA 2OULB 4XVSL 4KFZC 5D7IE 1SYVA 2PYFA 1PAZA 2IPUK 2JKWA 4QUOA 5C1MB 2EDMA 2NY6B 4OZHA 5G54A 2ENSA 3OKKB 4KKBC 4CGTA 2WCPA 4NOBA 5B4MD 4AIZB 4QO1B 5KYXB 1AZCA 1IGJB 3TBWA 2QVFB 2Q8BL 2D4FA 3OMNB 3OBAA 2IH8A 4PSPA 4DJMA 4TNWF 5C6TL 2N7BA 5DR5L 4B96A 1BZQK 4H1LA 1YMME 2R0ZH 4LDLA 4PJ9B 5KVMC 3PGCB 3K2UH 5JA8B 4OZHE 2D0HA 3TL5A 1JNLL 2GFBB 4UU9A 3CVHB 4EI5B 2E27L 1F42A 2E75C 2EO7A 1SXAA 3N44F 3MGOB 1QRNE 4QCIB 2FJGB 4Z18A 1U36A 5FFLA 3ZO9A 4CRPA 3NIFB 3D85B 3CH8A 3BPOC 3FH7A 2IH1B 4M8UA 4TLSA 3H3KA 5F9WB 2NQDA 5IB4A 2EIZA 3A4AA 1CK0H 1CF1A 2Z8SA 2A7BA 1M4KA 3GSVA 3QJFA 1J0ZA 1MRDL 4FI8A 5E2UL 3TBBA 3TPUB 4Z7WA 4MCZA 4MD0B 4LCVA 3B7TA 3OLEA 1AKJD 2GHZA 3T3MF 2JE8A 3OHMB 1YNTB 2H2PD 5T5FL 1TLKA 3HFML 3RTQB 1SY6L 1GIGH 1EUTA 3IKCA 4NO0B 4CU7A 5IBLD 4NQXB 1WFJA 4IYKA 3AWFA 3NFPB 2PWFA 1QLFA 1T04A 4RX4A 4DT2A 5K9OA 5HJ3B 4ZMQA 1S7VA 1KTJA 4FG6C 5DZOA 1MLBB 2BINA 4ATWA 5I71C 4ZAKA 4QAWA 2RB8A 1A14H 3ESNA 3L48A 3LH8A 3PWNB 1CTNA 3NCMA 1QI3A 1CE6A 3FT1A 4RGNC 3QIBA 2JSFA 1IGFL 3NDYE 4BSJA 5KKHA 3K1DA 1HKFA 4FTVE 1I8LC 2XZCL 1G43A 4F15C 5SWSD 4GRWH 5E8EB 2KUTA 2UZYB 1LP9B 4P3DB 4GSRA 4DVBB 4WCYH 4UNVA 2GUYA 5ICZA 4X8GA 1HHGA 2X4SB 3IFPA 4WFHE 3PNRB 3IJSB 1UXLA 1WVZA 3D2UA 3FTSA 3IJHA 3OKEA 3VU1A 2XFXA 4N8CL 4K2UH 3O6KL 4E9QA 4I18B 2WLIA 2EICA 4OH2A 1I9IL 4B6ZA 3ZKXB 4HIPA 4ABUA 5T5NG 4QXUH 3FUIA 3MLUH 4MQTB 1D5IL 2J73A 5CUSH 3V6OC 1RJZB 2AEIT 4PRIB 5INCB 1GGIL 2QMKA 4TL5A 2QBWA 1NAKH 5DURD 5T3ZH 3OMIB 1KG0A 5AAWC 3IXAA 2X3BA 3QNXA 3VGAC 2E0PA 1GL4B 1ZS2A 3D4SA 2WWOA 1VFMA 3LZQA 1YPZF 1VZGA 2FDBP 2P5WE 3OVUB 3W5NA 3O8XC 4WI9A 2AAAA 3C09B 1HINH 4JO3L 4N6QA 4RZKA 1TFPA 2JF1A 4A6YA 1VSCA 2OK0L 3LKRB 2FQEA 5CGMA 1MRCL 3CFEA 2NTFB 5J7AA 1PD0A 2Z64C 2ZYHA 5TDNA 1BQKA 5E95B 1DVQA 3NA4A 4H8PA 4N0FA 4OGAC 3RWEB 4XP1H 3M86A 1MCCA 2NZIA 1TYEB 2VDMH 1BAFL 2WGNB 1S53A 3BHBA 2YAPA 3F84A 4NYLB 3VTAA 1CE1H 3FTUA 2X28A 2CD0A 2DJUA 4CADA 2ORBL 4Y4KA 4NKOA 2LQRA 5CP3H 1QFUH 3QC6X 4BQ8A 1MELA 4PLKD 4QRPD 1D5XA 1XGPA 3QNYA 1BRDA 3F6JA 1LNUA 3QQ4B 4IRSA 5CU5A 2AV7B 4R4FH 1H3WM 1JTPA 1EIBA 3WL9B 5IBTL 2E46A 3L7EB 2VH5H 4NPJA 4P5TB 3IFOB 4FYTA 3ATAA 5IVXE 5C0CB 4L3CA 4Q89A 5GS3A 1YUKB 3IYLW 1R47A 1DQLH 4WGVB 5JDSA 4MMZA 2XN0A 4XC1L 4ESKA 3WQJA 5F44A 1JMXA 1ORQB 3CFKA 4YHLL 4U1LB 2R69A 5HI5D 1UKSA 1B9ZA 4JGNA 5FYKU 4L9LC 1NCDH 3FB8B 5FHAL 1CFQB 2Z93A 2NY1C 3P9MB 3ARBB 5JHDE 2NTSP 2YJQA 2BH0A 5IVOA 4UQCA 2DWYA 4U1SA 4YDJA 5F93C 5I6NA 3IETA 1GZQB 2KC0A 4XZUA 2AKRB 5C0RH 1AP2A 4JJHA 2AJSL 3MLWL 5DYFA 2VC2L 2AXWA 4IJ3C 4H0HB 1FH5H 5ISZA 4O5LH 4OZHF 4ZMTA 1MWAL 2OL3L 2Y07L 3IJ7A 3KWWB 3JYBA 3PU7A 3G6AB 1ZT7B 2C5DC 4J39A 4MHHI 4MYPA 1GU8A 2HKAA 3KBFA 1FYTB 1OAKH 1U8KB 3HZKA 5HHPA 1CG9A 3B7UX 3RKPA 2Y3AA 4H20H 5C6TH 1FZOB 1K5WA 1KXVA 2Z7YA 5E2WH 2BY0A 4QRTB 3QJZA 4U6XB 4Z7VF 5CZKA 3VXUA 3FCGA 5DEGA 4N8PA 2TSBA 3U1PA 5B8CA 3DRQB 3ME0B 3UTQB 3CVIH 4AG4L 3QJUB 2X1XR 4WJ5A 3SOBL 3UPAA 1KELL 1KB9J 3EYFB 4JFUA 1ZLWK 1U3HB 4K3HA 2QT6A 4NQQA 1CWQA 1NUFA 3U30B 5TDPA 4J4PD 4QTIH 3V2WA 2R1XA 4OTXL 3A7KA 4GG6F 2BNRD 4XN4A 2J4YA 4RMRA 1FL5B 5DJ8A 4JFEB 3VFOA 3FPYA 4AV5A 2DQFB 5HHOD 3EJQA 1GHFH 1T20B 2UXVA 2VXUL 2WSPA 5INDA 3KJ6A 4AQ8C 2SODB 5EF0A 4HC1H 2X7LB 5AENA 1KLGB 3X3GL 5F8QC 2WB1A 3AQDA 2HZHA 4FFYH 4GP5B 3DTXB 2IPKB 4IW4C 1KGIA 2CO1A 4TYUA 4L9LA 1J9QA 2VRKA 4A2FA 1MJ7L 3QJHB 4DPAX 1MZZA 1FZJB 4FXGA 2FSEA 2WXJA 4BINA 2ITEA 5CEXB 1AFVL 3WJLC 4IHBA 5LDSA 1H15B 3QBIA 5A16B 2LU4A 4KK6D 2H32A 4LEEA 2OMNA 5HTSA 1V5JA 3QZMA 4BGDA 3HBZA 2FLBT 3VSQA 5E2TL 3RUGF 5FEBA 3VFNB 3VXNB 2YAMA 2EXYD 1Q1JH 2Q7AA 1H8LA 3KLLA 1XH3A 3QDHA 4Y5XA 4J3VA 1ZEAH 2A9ML 3GMPA 1HC1A 1F90L 1QA9A 3GXUB 4PJBA 4WI2A 2H0PA 3AFLA 1QSFD 5CEZD 1L9PA 3GMNA 3ARWA 4PW4A 4XMTA 3T77B 4QIDA 4Q0XH 3GJFA 4JPQA 4HT1H 5CJQL 1M57B 2H1PH 5E0QA 3QUZD 2F1AA 3ISRA 2OJEB 2YFNA 2YN5A 3GB7A 3TO4B 1LDSA 1D5BA 1AHWA 4TQPA 3PAZA 1BJ8A 3S2AA 1T22B 1B2WH 3L81A 2G60L 4G42B 5D1ZC 2QHLA 5C0FA 4PRAB 5AZ2H 2BVQB 3H42H 4IMKC 2M83A 3C8HA 3HPJB 4MMXB 2V37A 1PDKB 1UKQA 4LAQH 5FOBA 4NCDA 2JKXA 2ZPKH 4JVPA 3S3JA 1CFTB 2J88H 4LBEA 1FNGB 3MA9H 5CLYA 5HHOE 1AS8A 5J1AB 3N9GL 4P2OD 3WSQH 3NCXA 1IC4H 2CA3A 4KHTH 3BRDA 1A22B 1HE7A 3L3JB 4YDIL 5H37G 5IVXA 1CN4A 1P6FA 2DEYX 1THAA 4R96B 5LWEA 1YPZA 1IAIM 4QNPF 1Q4NX 3QI9D 4M6NH 3EDKA 4X5PA 5BS0E 1FFNB 1ML0A 2DEWX 3VGEA 4Z77B 3NA9L 5BUGA 3EFFA 3QG6A 3M6DA 2MQCA 2WXHA 4R4BB 4XVTL 2NR6A 1UCTA 5T3XE 5EF3A 2HTKD 4QD2E 1J8HB 1TTCA 4PVMA 1P84K 3GRGA 2I20A 3O3AA 2G2RA 2APSA 4M93B 4NM8H 1L9TA 1NWPA 2GTWB 4B9ZA 3MV9A 5KVDE 4AL8L 2KKQA 1F11A 3CU7A 1DLHA 3NJGA 4BSVA 5I24A 2J6EH 1KOAA 4RMUA 3MRQA 2IAMC 2P5PA 5ACMA 5C7XH 4I1PA 1OAZH 4P23B 4N3TA 1V10A 1FNFA 1WP6A 3ISWA 4D9RD 4ODXB 5L2KA 3UBXG 1P4LA 2LTQB 3V6BR 4HUVB 4Z1PA 1CB4A 1UM6H 3LS4L 3ARGD 2HLEB 5J0BA 1GGUA 1HSBB 1DUYB 3F7LA 5D70L 5KZCB 3QCUH 5FYKD 3HZMB 1YEIH 1Y6NR 1H8NA 2XN9D 4QRUB 2AMGA 4OZGE 2F8OA 4XBPA 4BH7A 1PIFA 4Z7AA 1OF0A 3LSOA 4R3SA 4NXKA 1VEPA 4LLMB 2ROXA 3TF7C 3L1GA 1LO5A 5B1AB 3C60C 5BNXD 5HI3C 2BIMA 2Z35A 1FH5L 4HS8L 2V2XA 4I85A 2BNQA 4QRQA 5DVMA 1NC2A 4ZW6A 3VD3A 1NPJA 1RIVL 3EHBD 4TUJB 3EG9B 2AV1A 2PEDA 1OAYH 4G7VH 1CT8B 3BMWA 3PV6A 1J05B 1OB1A 2PN5A 3MA7B 4XWGL 2ZUTA 4P4RA 4MDRA 3ILPB 3N06B 4KQ4L 2XX0A 1PGRB 1RU9L 1A65A 2Y3NA 1PZ3A 1RSFA 1YECL 2AQ1A 1IGCL 3EYOB 4FD0A 3GZPA 2P8LA 1O7DC 4AQ1C 4AZUA 4HH8A 2XPGB 4Y19A 4MVBD 2KZBA 3FO9A 1WSST 4E9SA 2N4IA 4UAOB 4XGZA 4Z78B 2E9GA 4L3FA 4DEPB 1TZIA 2W1NA 2CGYA 4R7DA 4UWQB 4XI5D 4DEPC 1F1AA 1TQCC 2C3VB 3I6LD 3MNWA 4P2OC 1RUPL 1UD3A 1X6LA 3LS5L 4LOFA 1F1DA 4DOHE 2B39A 4QLRA 4KJYA 1JWMB 1M3JA 2DJMA 1TMCB 4UOZA 3RHWK 1BQHG 4JCLA 5FXCH 2BNQD 4BKTC 3UTYA 4OD1L 3U0TB 3BRFA 5A2JH 2ADGA 4K73A 1BRXA 4J4PA 2OTPA 5I6KA 4N8VG 2CDEB 4XP5L 3QNZA 2P24B 5EZPA 4Z7UB 5DRXB 1KBKA 2HH0H 3CSPA 3X12A 3QHFL 4IHOA 1UXWA 1XF5A 4QRRB 3E0GA 4JDEB 4YHNA 3KYOB 1QBLL 2MNJB 3MLPA 3LNIA 4FQXD 4AQ1A 1HJBC 2PCFA 3QDMB 3RGVB 2Z91A 4PJXA 3UAAA 2UYLA 2E9JA 4HIHA 2VJXA 5JW5A 2ZE0A 3HG1D 2J7LA 3HAPA 5C1MA 4DO5A 2F93A 1EK3A 5D7IB 2AQPA 3P11L 3Q0HA 4KJQC 5DVOA 2YHGA 4JFHD 2CNYA 5I76B 4Y4HD 3CC1A 5CBEB 5B7MA 2ZWNA 3DSNA 4WFHD 4TSAH 1A4KA 2MWCA 4G1MB 3M1BB 4L1DA 4N1HB 1LK2B 2APWA 3MCG1 4NNYB 5I1KL 1HNGA 1N70A 1Z9LA 4ORGB 1XHHA 3FULA 3GXPA 3KPOB 5I6LA 3X14A 3SE4C 1OKEA 1KEMH 1P9MA 3LIZH 3CVHL 3KPSA 1FAKT 1E4XH 3D85A 1AGBB 3L9RA 1MNUL 4ANVA 2DH2A 2XPYA 5K9KB 4P2OA 2UVFA 4JKMA 3CHOA 1U2HA 3RTLA 3V9FA 25C8L 1LD9B 4BWUA 1IC7L 1RZKC 3ARFB 4GKOA 5DYOB 4EPSA 4G8EA 3JTSB 2CJ3A 1VERA 4P8QA 1ZLEA 2JQMA 1T0OA 3MLYL 4ODTH 2XV2A 5EZJB 3TJHD 1V3KA 4Y4HA 2R2EA 2ESVA 1QSFB 1NFIB 2IQAB 3F7YB 3EH5B 5EZOH 5EIVA 2VYRE 2QFRA 3GHEL 3DQBA 5L4JA 3FO2A 1OM9A 3HHRB 5KOMC 3MRCB 3QUZA 4EXKA 4Z7NB 1L0MA 5F9AC 2NW3A 3K2KA 4G7YH 5IIEA 5DK0B 5AALA 3ZDYF 1J0YA 3GT6A 3N1FC 4G8GE 4M7LL 4NN6C 5KW9H 3NCEB 3QARA 3P3TA 3V0WL 5C97A 4G8FB 2ZOLB 1JI2A 2D7PA 3WBDA 4LKXA 5MERB 5HYEA 4OZIB 4V1DD 2WXPA 5CLZA 2C9QA 2HX8A 1SVCP 2R8SH 1DL7H 1BQUA 3GRBA 4ZO9A 5J11B 3HNVL 1BV8A 4CILA 1IW6A 4IMLA 1X5LA 4L1LA 3X11A 1HHGB 1I3GL 4LLWA 2V7HB 3N40P 1C5CL 4K3DH 3IJHB 2FYYA 2XFXB 4NJ9L 1EO8L 4RGNE 5FWRA 3BUIA 1KFAH 1TU2B 4M1DH 1ZK5A 4XT1C 3WFHA 3WTSA 2VZ1A 5H94A 1CF8H 3I3BA 4JY6B 1KB5B 3AZUA 3VI4F 4X4XB 1A7PL 1FVEB 4AWJC 3P4MA 5D7EA 2CBMA 5JW4N 2Y04A 5JOPD 1OCRB 2JJVA 3NJKA 4HIJA 4JZOB 4O9HH 3UZVB 4DP5X 3KPMB 4WDIA 5L8KB 1UATA 3MRLB 2Q3ZA 4LPYA 5KVGH 4BDVA 1ZK9A 4GQ9H 3ZTJG 1WH0A 4BQBA 3VD2A 1QOKA 3L3KB 1XH1A 2X9ZA 3UMNA 1RFDH 3FCSB 5I74B 4OV0A 1G9ML 4M7ZB 2ZIYA 3CX2A 4DAGL 3IDGA 3FFDB 4M1CD 5E4AA 4ZXBB 4GXVL 1ZVSA 5I15L 1RPUA 1A3QA 3GBML 4O51B 3JYCA 3DRTA 4N0FB 5I6OA 3PGDB 2FR4A 3CC5B 1CD8A 1KIQB 2WNWA 4KO9A 4UQEA 4NQCE 1AJ7H 4RAVA 4OLWL 4AQEA 3EH3B 1F6AA 1M71B 3RUGB 2FBOJ 2B59B 1A6VH 1E9OB 2J6EA 2VSDA 4ELDA 3IU4H 1FNLA 1K72A 3WKNA 1Z9SB 3BWUF 5KEZA 4P2QB 1NMCB 1I8IB 1WLHA 1H9DA 3QXDA 4KRPC 4O2CB 4FQCH 1RUKH 2TSAA 5CSGA 4JFHE 4Q4EA 2Q6WB 1Q5JA 4OB5L 1AI1H 3P9LB 4PEEA 4JGUA 4L4TA 3WFEL 3HE6B 4JR9H 4DTGH 3OZLA 2N1KA 4L3CB 2BS8A 2G3XA 5ESVA 3TV3H 5ACLA 1J18A 3QDAA 5BZDA 4QI1A 4HQQL 4BD4A 3WNNA 1DJXA 2JB6B 5FUOL 1IVLA 5I8EA 3SDCD 3SBRA 2F15A 1CXFA 1BM3L 2QGDA 3QXUA 3X3BA 3IMRA 5E51A 4BFIA 4WEBL 4HLJA 3QUYC 4TSBL 1A0QH 3GTVA 4LESA 5EIIG 5ELIA 1U8MA 5HVGB 5D7IF 1RHFA 4NQDA 3RURA 3JWNH 3MNMA 2L7EA 2O6PA 4XNQB 3CH1A 1A2YA 4X42A 3V2AR 3LZOA 2NPLX 3QZNA 5HJDA 4LRNH 1EWHA 1ZCRA 4A2LA 3QRGH 3OKYA 5F1IB 4FQHA 2VERN 2YPKA 2B1AH 3IMTA 3QIBC 4OCYL 2N7AA 2I07B 4Z5RA 4OM1L 4L2LA 3VXQA 2BCMA 2HUHA 3SKNB 3E38A 4BRJA 2AJ3B 1ZMYA 2N1TE 4M1GH 4YLQT 3SDAC 1CG9B 4D9QE 1MCWM 3LX9A 5HYJD 1P53A 4F2EA 4I0PD 1RK0B 1PX3A 1DE4A 1HHHB 5H2HA 2FECI 1JXJA 2ED9A 3HB3B 4QRTA 4U6XA 3N0AA 5HHMB 3TFKC 3TJPA 2R0KL 2O5YL 2AITA 3UPRA 3NJLA 3P4NA 4TOYH 2Y2YA 3K0WA 4V1DE 2BY1A 5EEXA 3MRGA 4IKJA 1OF2B 3MBWB 4G5ZL 3H85A 1Q0YH 4G80B 1ACXA 1IAOA 4X6BA 2CBPA 1OTSD 1VCBC 1HZKA 1S7UA 3DX7A 1RL1A 1U19A 2NLJA 3W56A 1MREL 3PJLA 2CBTA 4FXKC 4MNQA 3I9GL 3RY5A 3ZK0A 5DF0A 3Q5YA 3UTPE 2BSCA 3S3PA 1S9YB 1GSMA 1JPTH 4HCFA 5DD0H 3PUUA 1IBZA 4OCXH 3G08B 4G2AA 3QUKA 3VSVA 1IE5A 2IPKA 3UP1A 1VJSA 4EXPX 2NYYC 2XVKA 4IIQB 4PJHB 3UTZA 1LM8V 1HH9B 3MBXH 4JB9H 1F4WH 3CZFB 3SY0B 1J8RA 4FGMA 4JHZA 5DJ2B 2H2SD 1YN6B 2NY6D 3SBWA 1UB6B 5A16A 4P4KC 6PAZA 3SO5A 3Q2NA 1NCCH 2K6ZA 4W9IC 2B3RA 4MJIA 4U31A 3FN3A 3ULSB 1U41A 5B4MC 4H26B 1OWWA 3L8QA 3V0HA 5ICUA 1F3RB 3QBTB 5C0DB 4E2OA 5EU5A 2ERJB 5HVWA 5IF0A 2YD3A 2JI3A 4JVUA 2HG5B 3ZQXA 4TTDD 3BYYA 4KHXL 2JIXA 1KNOA 2BIPA 1Z1WA 2YPLE 4YX2L 3VFGL 4BYHA 1R3KA 5HGBB 1U8OB 4D7BA 4ONGL 1INEL 3H3BC 3WTUA 1CFSB 1BZOA 1RZJC 2ZOOA 3QHTC 1T21B 2MOGA 2C4FU 2R29A 3CFNA 4PJAF 1R2NA 5DQJA 2NXZC 3CVCA 2XKUA 4JCMA 1AY1L 3M07A 5GZOC 3PHQB 3T45A 3H9SE 3LKPB 4PI0A 2ADJA 2YC1B 1YYLL 4F7CB 5FK9B 2P4AB 2DIAA 3RX8A 5DD6A 5ERWA 3KR3L 1PZSA 5E99H 4HWEH 1O9VA 1MOEA 5AB9A 1IL1A 4CC0A 1YEFL 4DAGH 3CFIC 5SX4H 1ZSDB 1JF1A 2ED8A 3UBXB 3NK3A 3K0YA 2Y02A 1F00I 1JXDA 1IBBA 3BFWA 2ZAIA 4MA7H 3Q3GA 4MA3A 5BPPA 2PTVA 1M2VB 2Y1VA 2XNAA 4Z7VE 4L0ZA 1FNSH 2Y36L 3GIVA 3GRWA 3QDMD 1DJSA 2QADD 5DHDA 4ECNA 4HX1B 3E1ZA 3BEVA 4KXZI 4WHTA 2C9PA 3STBA 2Q3AA 3AG1B 1E7UA 4LLVA 2V7NA 4PGCA 1B4JH 3I6LE 3OKLB 4LVNB 2OMXA 2QQNH 5E1QA 4LVNC 4NQUA 3P3YA 1EZLA 2X6MA 3DC0A 3TBYB 5JHLH 3EXLA 3FPXA 1CICA 4OJEH 5DMGD 3T2OA 1T66D 3BE1L 1EJOL 4I0PA 3IGLA 3VGBA 2ZUYA 3ABWA 1FNHA 2R4RL 2YOCA 3HLAB 5GGVL 1VEOA 1HQ4A 4UTBA 5B39A 3JTTB 4U1GB 3EH1A 5B7EA 3UTSB 1CVSC 1L6ZA 4W9EC 5T1DL 2OXHA 1OE3A 1MLCA 4YN3A 5CGYD 1IQWL 2XRAL 2XA8L 3MV9D 2F9BT 3QQ3B 1ZIAA 5HHNA 2OP4L 4W9ZA 3KMDA 4NI3A 4WUKH 4FBZA 3SKOB 2DQHL 3LSOB 1DQLL 5IM7B 1KB5L 5ICXA 3GSXB 2YRBA 5F9WC 1FG2A 1GCYA 1MCLA 4XNBA 1S6NA 2NY3D 1SFDA 4KI5C 4U6VL 4JY4B 3T2NL 1LWHA 4OCWH 3C60D 3U83A 4K7PY 1ZLUH 1T1ZA 4F9LA 3ZZ1A 5CM1A 5AW4B 5JIMA 1WA1X 4HOXA 2AK1L 4Q6IB 2VR5A 2Q10A 5G5DB 3ZBMA 2V3DA 1RJCA 1U92B 1BVNP 3MV7D 5HGAA 4Y1SA 3RFZA 2WLMA 1S5HB 4N26A 1IFHL 4NGHH 3G9AB 2P28B 3BJLA 3V95A 5E08H 2GSGB 5LXVA 4XNXL 4WJG3 1CZ8H 1N67A 2YXVA 2VDPH 3MRRA 4E36A 5JXEA 3EO0B 3SDCB 2VAAA 2C3VA 1R46A 2CK0L 2CCVA 2J12B 1TQVA 3IJ8A 1XAKA 4RGMB 3VXOA 4HMEA 2F54E 2EDOA 3EFOA 3I85A 3IPFA 5LGHH 3UTTA 3X1FA 3TURA 1H3GA 1BFOA 4XPFL 4LEXH 3T6XA 1RPQA 3ZIMA 1I7ZB 4F15B 2WXGA 1RIUH 4HXBL 1U58B 3NT0A 1QFUL 3ARRA 5EC1A 2XX1A 1CI3M 4XCYB 4YBLC 3N1QC 5IB4B 4PBVC 4I0PC 4L5FE 3UGUA 3PHSA 3O4LB 1SYVB 4YBQC 4ZS6C 3UJIL 4F2FA 1IM9B 3A6OA 2EECA 5C9JA 5DHVB 4Z7UA 5DRXA 3U7WH 5MEOA 2ADFL 5IHHA 4ZOCA 4G9FD 4MD0A 4MCZB 5KYXA 3U82B 3MCKB 1HOCB 2E7CA 2ESVE 4P2RB 2CUAA 3UIYA 3DYOA 3MO1A 4GW5B 1GR7A 5EIIB 1UA6H 3IKCB 4JB9L 4XMWA 1BWWA 1MNNA 3U36A 4G6AD 2ZOUA 4Y19D 1A3LH 2VDKL 2ZT9C 4RVBA 1TJHH 3VDAA 2VC2B 5LJYH 4WUUD 4NWUH 1JHKL 1AE6H 1S5IH 2OXGA 2YKLL 3ARQA 4ZS7H 3PWNA 2UX6A 3O8XB 4CNIA 5GS1A 3JWOC 5AZDA 3JWNC 1KTLB 3NIGF 4CSSA 2FJGA 5J8OA 5EEUA 2DI9A 4HUXB 3LZFH 4PRPB 5IB2B 3B1TA 3S88L 4JN2A 1W2KT 4W4OC 1D3CA 4HGKC 2BP5M 3V4PB 4HU2A 3NGBC 3GSRA 1WICA 1TPXC 4MNQD 4PG9A 4Z9KB 1ZTXH 1H3PH 1QHPA 4XN5A 4XOEA 5ENWB 2VW6A 3X14B 4ADIA 2P80A 4KUZH 4YSUA 4UZUA 4B7LA 5C0GA 1OAKL 3MCYA 4J28A 1G1CA 1X7QB 1IKNC 2NY0B 4KKPA 2NY0C 3KEDA 5EU6B 2DQUL 1YQVL 3HLKA 2WAHA 3JV0A 2UY6B 1KPVA 1KPUA 3BLPX 2F58H 3HC0B 2V4LA 35C8L 1LD9A 3DLQR 3MRDA 4NRYA 3IF1B 4KI5F 3CIQA 3QO0B 4I2XB 2J44A 4RSYA 1NIEA 3JTSA 2WYHA 4J3OG 5CZVH 2DYPD 5HYFA 1U8JB 1YDPB 4C83B 4DF9A 2I1XA 2LE9A 2X9XA 5FW8A 3ZTNH 4PRPE 3MLZL 2YXFA 4NZ8A 3QPXL 5JHDA 3S3CB 2WQWA 4MA7L 1ONQB 2P43B 2A3TA 3K8MA 3IJEB 1CXLA 1M2OA 5HHXH 3OZ9H 1NGPH 1UD6A 3IJSA 1S3KL 3L6FB 5AZUA 5FFOA 3AW5A 4M61B 2X88A 2GW5A 2YMTA 3IK2A 5E8PB 2VSKB 3FTYA 4FFYL 4CC1A 4EIGB 4DPRA 2ITFA 1DCEA 1SEQH 2NQCA 1FCCA 2IQ9L 1D2OA 5DHMC 5GGSA 2OMZA 1A21A 3OAYH 2D0FA 4N1EA 3MLVH 2Y9RT 4FG2A 4IJ3B 4HIEA 4CADB 4YHOH 3DKHA 3CX5J 4YHML 5DGQA 1KG0B 4ODSL 1MCHA 5GQBA 3CV5A 1EBPA 2I9LA 3VJ6B 5F88A 3LH9A 3QXVA 3MX0A 3RWHA 1CTMA 4AYMC 3U25A 2EKSB 3WN5A 4J3OD 4KOBA 3G5VB 4P5TA 3K4AA 1JZ5A 2IGFH 1KEML 3KPSE 3LIZL 4FFZH 1FVEA 4FHJA 4MJIE 5FLUA 4ZD3L 4GQZA 4PSRA 4FF9A 4DFIA 5FGBC 4HIJB 4JZOA 4HF5H 1X5YA 3RA7L 1NBQA 2QSCH 5ITBL 4ZFZB 4X7SH 3LKQB 1KLFA 4M8RA 1FBIL 3VFTA 5DA0B 3KYNA 3Q44A 1G5AA 1M6OB 2OMTB 2NZ9C 5JHDD 1PSKL 4PFEA 2I7OA 1XMWA 2QKIC 1RD6A 3FCSA 4FI7A 1IKFH 3DXAA 5C09E 1SM3H 2EE9A 4CC4C 3GKWL 2H7WA 3TA4D 3DHPA 5BW7A 3V79C 3OGCB 4JZJB 1WCBB 4PYHA 5A2AA 4LCIH 4A2MA 1LWJA 3ULAB 1YEIL 5E9DE 2BOLA 3EF7A 5FM8A 3E1F1 4JG1H 4WHDA 2XBTA 1F4XL 2FR4B 4QRBA 1ZT7A 4QXGL 4Z7QF 1QBBA 4KRLB 1F6AB 1M71A 3S35L 4JQVC 3ZMEA 4FPDA 2TRYA 3HFMH 5DUJA 2AVGA 4ELME 4JK0D 1F58L 4Y5YA 4OLUL 1J5HA 1BP3B 2ARJB 4PD4J 2Q76A 3C6LA 5J6GA 2WHVA 4L4TD 2X5PA 1VGEH 1FYTD 3ECVA 4FQ1L 4FNRA 5AVWB 4BCZA 2Z93B 2WB7A 3TWYA 4A7QA 3P3RA 2XQYG 4LASL 2V2WB 2GHWB 3S5LA 3JV4A 3WKML 5FJGA 3KS0H 1KEGH 1BYNA 1PJWA 2HJKB 4K7FA 4K15A 1AXTL 3ERXA 1IGFH 2Q86A 4K5OA 2ARWA 1BZDA 2YMXL 3QAZB 2PNDA 4HWZA 4P46C 3C60B 4DZ8B 5IKCA 2DI7A 4YXHL 1U8PA 2XETA 3F58L 5BR5A 1ILUA 1T20A 2WNXA 3VH8G 3NRQA 4ZZKA 2BHYA 4N25A 3VXUD 4QHKI 2WLHA 1M1XB 4L37B 2ZFEA 1UT2A 4PPTA 5E70A 5J56B 4ZTPH 4JO2L 1BXXA 3I6KA 4H40A 2VQUA 3BSGA 4DUVA 5IEHB 4Z7VB 4UM8B 2F7OA 5DZNA 1G5GA 4KK9C 3QI9B 3TWCL 3PDOB 4X83A 5AQ0A 4ZAKD 4RESB 2EUXA 12E8H 4PV9A 1FRGL 1J9TA 3BRGC 4JRYD 3QUXD 3DNKA 4YEFA 3HZVB 1GJUA 2ENJA 4IDLA 1RK0A 3GXTA 3HNSH 4NNPH 2W9EL 2JQAA 4B9FA 4NX0A 1UUSA 3RPKA 4PRBA 3LXCA 2GPZA 1AZBA 2QLVB 3D7PA 3M7FB 3IU4L 4WWKB 2ZCLH 2ZWZA 1DVYA 4F37F 1TYJA 4UQ9A 3NN8A 1ZLSL 4F37K 2L4OA 2AEQL 4KK8D 4G6JL 2Z4TA 1U8NB 2VLKB 3AREC 5GS0L 5FYJL 3RIFK 2XVLA 3D3VD 3O3BA 4FQCL 2B0SH 2FJUB 3N42F 4I77H 4X9HA 5AVSB 4XP1L 1VLXA 4N6RB 3VI4E 1OARL 1MFEH 2CRZA 3VWJA 2X09A 2OTWB 2XWJB 1N26A 2WZPD 4OD3H 1EGJH 3PLYA 3FS9A 1JPEA 1UYWL 4MVBC 3A5VA 2EXWC 3FCTA 1DFBL 3LS5H 2YLHA 2FCBA 4PGEA 1EPFA 5SV4A 2ENPA 1AR1C 4TULL 1E5CA 1KV3A 3AB0B 3MLZH 4PB0H 3UJTH 4DP2X 2YXWA 4P4KB 4BFBD 3ZYOA 3WTVA 4L8BB 4XCFH 2C9XA 1L7TL 5D2NC 1ZOXA 2NMSA 3VFNA 4CDHA 3IGAB 3D1MC 1WCQA 1JZEA 1T7WA 3DX8B 1NGPL 2BS71 5B35A 3H9SA 3BPCB 5C0CE 2AMUA 4J2QA 5IVXB 3GMNB 2AQ3A 3HC3L 1UB6A 1G6RL 5A2IH 2JXMB 3T77A 3SN6R 3DGCR 2JB5H 2NZ9D 2FQDA 3PGFL 3TN0C 1QR1B 1XSOA 5BQDA 2A73B 3LN4A 3OKOA 2H5UA 2IH9A 3NIDE 5CEZH 5DFWH 3EZJB 3AREA 3ODUA 2CJUH 1WRFA 3MRPA 4NO3B 2ENYA 2ZWKA 2ATPB 3PE9A 1DFXA 1MHCB 4M9PA 3CLFH 4MAYA 2X0WA 3FO1A 4G7QB 4DGVH 4HIIA 4GEJA 3QQXA 1J8HA 4DP9X 3IU3B 1F3DH 1Z6JT 2L3BA 3PWPA 3VXMA 2Y07H 4R5XA 4CN1A 4ZOEA 1T6VN 1XGTA 5DFVD 1CFTA 1UADC 4RBPH 1P5UA 4KMTL 4DGWC 3MI6A 1KY6A 4LDOB 2HFFB 1SEBA 4MB5A 4P23A 3V4PL 3ILDA 2BIOA 3W11D 5A1AA 3HG1E 4NHCL 3OKDB 3IDYB 4HUWA 4KVNH 3IS1X 2WM0A 3D3VE 4DUXA 4JHWL 2VQTA 3MLRH 4UZGA 4WK2B 2BX5A 4AM0A 1PSKH 1X0K1 4MQ7B 2NUPA 2XQBL 1ET7A 1A7PH 4QRUA 3V0DA 4BV0A 3IDJA 2BM3A 3TZVC 3BISA 4X31A 1IGTB 4OM0H 5DUPL 2J4WH 1F88A 4PLJC 4K94H 1TVDA 5DDHA 1C8QA 5HHOA 1G6RA 2IWFA 3FMGL 4QTIL 4JG1L 4P3WA 5C8JB 4MWFB 3PQYB 1JZ3A 2HPYA 1A5FH 5CF3A 1XSKA 4E0RA 4P4RB 1DLHB 3ZUNC 3EYOA 3KBPA 1PCSA 3WEAA 1Z7JA 2CMRH 5IOPB 2D2OA 3DYPA 3LN5A 4MMYB 2Q5BA 1HESA 4N0YH 4M7LT 3BAXA 1S4IA 4RMWA 1EJ6A 1CICB 2KT6A 1GA2A 5IVXF 3ROLB 2WTRB 2CHZA 2KL6A 4KXCA 3V4UH 1E8XA 4I0KA 2JNZA 3H0TA 4CKVX 1L6XA 3DOSA 3DECA 4R3SB 4HDIA 5E4EC 1NKRA 2X3CA 3R1GL 4Y8AA 5D6DC 3ATFA 4FQQB 2ZSWB 3PAUA 1J12A 3O3DB 3C9LA 1VB9A 2GCYA 3HHMA 1PLGL 4L8SC 4OZFH 4XMKL 5AOIA 3WS6C 3ZQWA 4GAJL 5DJ6A 5E2VL 5IY5B 1P5UC 4CVWA 3ARYA 2FSDA 4H13C 3AU1A 4JPWH 2BY2A 1MIMH 4LU5H 4IQHA 5EEZA 3PDDA 3BWAB 4GW4A 1A7RL 3GC3A 5KSUA 4FZEH 3NEEA 4Y5VB 1QLEB 1VACA 4G6AC 4PJXF 4XPGL 5D4QA 4M1CC 1KBWA 4OVUA 4UQ3B 3SBWC 2DMCA 1T1ZB 5CEYA 3T2PA 2ENQA 2WP3T 3DPBB 3MMEB 4K2UL 2ZZUT 2NXYB 3NIGE 2Y01A 4LDLB 5HGHB 5HYIA 4UHRA 3RGBA 4WTQA 4XTOA 1FGNL 1DO5A 4MRCA 4PJCA 1NM4A 1WV7T 4RRPM 3H42L 5IHLB 3HNSL 3ARGA 1JV5A 1J86A 1NDGB 2EH7L 5IEKB 3FQWA 5KBKA 3MGOA 3SGDH 3MZGB 5FYLL 1M42A 1HE8A 4J4PC 1H6TA 1RZ7H 1K8DA 2HN7A 2VAAB 5DUMH 2UZXA 1IC4L 4JO1L 1NDTA 2QQNL 4NI6A 1RULH 3HS8A 1HZXA 2AZUA 2G2NA 3GO1L 3P0YH 1B0GB 1TEYA 2F1BA 1OO2A 4QXTA 5H2KA 3SDDD 3CNKA 3WOVA 4K8RL 4DVRH 5DWUL 5DU7A 5FW7A 3DX9A 4AQ1B 5F1OB 2PCFB 3QDMA 1P1ZB 2F68X 4TOYL 4XVTH 3FYEB 4FNTA 2O5XH 3LNDA 3L7FA 3D87B 5AHZA 1SNRA 4XVJH 4PB0L 3UJTL 2VR4A 1OW0A 3RNQB 5J9PB 1ZA3B 5I1DA 1CIDA 3AMLA 1BXVA 2NY5L 2YD1A 1NGYB 4ZAKB 3ZDYB 1AOZA 4YDZA 2ICCA 4Y4HB 5KSBB 1NFIA 3F7YA 4BFGA 1T83C 3DO3A 3ES6B 4JHBA 3VSUA 5IGXH 1GZPB 1A4KB 2J6EL 2A1WH 2JJWA 1J9RA 2RIKA 3F12A 3MJ8A 5ID0B 2GJRA 2RALA 3ECUA 3WG7B 4XC3H 4PWKA 2EDQA 4DGIL 4P3DA 1A6TB 1QR4A 2R2BA 2I85A 4GAYA 4UF7C 1T4WA 3S5LG 4AEFA 4ATTA 3NJNA 1M7IA 3IFPB 4YWGH 1HHIB 4I7ZC 4OCWL 1S46A 4TXVB 3ILQD 4L4VB 3QCUL 4B53A 1RZJH 5DHGA 3DIFA 3RL2A 2BFVH 4E9LA 3FSOA 1A3RL 2UWEE 4TRPL 3G6JF 4R83A 3VA2C 4WKZA 3MQIA 4LSPL 3L95B 3VGHA 2RD0A 2WCSA 1T0MB 2KZWA 3GIZL 4R9HA 1CU4L 1NCCL 4PG2A 1MAML 1EFQA 1RIVH 1J9CT 2GITA 5F7YC 5MI0C 1UT9A 2ZUQB 1YEJL 3CG8A 2Z4QB 1KCRL 4RETB 1FV1B 4D0CB 1IRAY 4GRVA 4FYSA 5DFTA 3WUWA 3O6FA 1HZHL 4IAQA 2C34A 1QWNA 3FZUD 1YECH 2VLRB 1ND0B 1OCWH 2P7TB 4ZMOA 4A6YB 3Q1EA 5DC4B 4KHXH 2ISDA 3FO2B 4EBQL 4EN3D 2BRDA 2NTFA 1HEZB 5I6XC 5CCHE 3BCFA 1QEWB 2VR6A 2VUYA 4MB1A 4GBXB 4KV5E 4H5SB 4UT7L 4D3CH 3E9UA 4WUUA 2YJLA 2EO1A 1J48A 3HRZA 5D4IA 5I66B 4WGWB 1E5ZA 4MDJB 3BZEB 2D03L 3SJVD 6FABL 1X7SA 3MC0A 5IP4A 4PW3A 5E2WL 3RZCD 5JJJA 1YYLH 4KDTA 3CSGA 4GYCA 3LB6D 3TS8A 1GYUA 1FDLL 2WMPA 2Z7ZA 4M62L 2XWCA 4NKQB 4GIOA 4P2QE 5HHVL 3ULUC 4LL4A 3L6FA 2CDGA 2DF3A 4Z7IA 1LL1A 3QUYB 4OVVA 5B6ZA 2K78A 4N24A 5JTWA 3VRJB 4AYEC 5BOJA 1TJHL 2LU3A 3MLTB 4GT0A 4ELMF 4OIBA 4LKCB 4X9GA 1TTGA 2QVMA 3T09A 2AQ2A 3KJ4B 4FFTA 1C8SA 5MP6L 5T5FH 4BA0A 1CBVH 4TUOA 2VDPB 4LCWA 2IDQA 3MODL 3DETD 1C08B 2N59A 5AOZA 2XY2A 5HJGA 3P9MA 4DKTA 3B9KC 3MFGB 1MI5D 3FQRA 4U0RC 3DTDA 2WYTA 2WXNA 5JPNB 2C9AA 1SOKA 5DMIL 3ZSSA 1A1MB 1OGAA 1S7TA 2YEZB 3LRSB 2VQ1A 1U3HD 4KU1A 4WNQB 1MY5A 1PIGA 3C6EA 3OHXC 1T4KA 4PTTB 1I53A 5I8EB 2BSEA 3BP5B 3KPRB 1MN4A 2NY1B 1KY7A 3A23A 2VDOH 3MV8D 5I8OL 3L2LA 3MRBA 4N85A 5CZXC 3DX4A 3U6XA 2FL5B 1I7TB 2GABA 2X4UA 5HHQA 3FQXA 1F02I 1JL8A 5EIQA 5LWYL 5TDOA 3HJ0A 5C0NC 3HAEG 1WTGT 2QV4A 1CD0A 4L9DA 3MXWH 1MAJA 1MHPH 5C09B 2ATKB 1LP9F 4LSQH 3SY6A 4PGBA 3N55A 2DTML 3K7UA 3X13B 2O5ZL 4O2CA 4FLRA 1M6UA 2X12A 4DO4A 1MFNA 2XQYK 4YDNA 2FJFA 2Z3FA 1KYAA 3SPJA 1D5ZA 3WXWH 1KG9A 5I17A 4U6VH 4GINA 4IDJH 4M8VA 3THML 4Y5YB 5DJDA 2JB6A 1DE4B 5EG6C 4AENA 1ZJAA 2Q76B 3C6LB 4PGDA 3CHXA 1G7MA 4I9XA 3RY6A 1BLNA 3DOHA 2K7PA 2OX5A 4YHPA 1IKNA 4CJ1A 3RWGA 4TPRH 1PZ5A 2E9WA 3VI3E 3SE9H 3MRGB 3IMVA 4UQDA 2J1ZA 3IFLL 5TPWH 1YYMH 2O72A 4KHTL 3GDBA 1W6LA 4WSKA 5EWIL 2Q86B 4GKNB 4NRXB 4JFVA 5EBLB 2X4NB 5EULV 5E5RB 1HCZA 3M1CA 2VCOA 4FL4B 4WU7B 1KLUA 1NUNB 4FFYA 4DZBB 5LXGH 3BE1H 1EJOH 1NAMA 4XAKE 5L0QB 3WNMA 1J5DA 1FC1A 3QIBD 1HILA 2Q8AL 4AIOA 3BO8B 1BDYA 4TF4A 3L5XL 3HN5A 1CFMA 5TGBA 1WZ1L 5CS7A 4WEUD 4PJEE 3TBVB 3RAJL 4WV1B 3JWDH 4MMZC 3WV0A 5AAMC 1ZHBB 2FJSA 4KNSA 1I7UB 2I27N 3AAZB 4ABQA 4KZDL 3CXDH 4PV9B 2H0FA 1JMZA 1NCAL 3HI5L 3R7RA 2EQDA 2R9HC 4RDQG 1OM3H 5CBAB 1KCVL 3T6VA 4IGBC 2WSDA 5D71L 5FHAH 1XVSA 2C3XA 2VDLL 5B3JF 2AEPL 4DETA 1DVZA 2ZX8A 1H5BA 1RZIB 2NY4D 5I1JL 3BH9B 3DBXA 4GS7C 2HVKB 4NWUL 1SLUA 2R56L 4LVOB 4OFKA 4XPBL 5IF0B 3IWVA 4I0CC 3NEOA 3B5GA 3IRZA 1GJWA 7CGTA 5C0FB 2AQRA 4LOUD 3C5ZD 5CN2A 1MCDA 3FSVA 5AW7B 2I25N 3O2WH 2D7QA 4RZCB 3FN9A 3T6WA 4O2FB 1AG0A 3LKOB 4EI6B 3T2QA 3BGFC 3V0VA 3FB5B 2YEQA 2MHAB 3BGFB 4JUTA 1FNGA 1GW0A 4JVWA 2BW4A 3O6LL 4LP8A 5BRZA 4KQ4H 5DJ2A 4IRJD 2XXFA 4JFQB 3PF2A 1EAJA 4AYFA 1EHKB 2QPSA 2F7QA 3TN0B 3VG0H 4EEEA 2D73A 4EE2A 2OFQA 3QG6B 4YHKH 1ZSDA 2JWYA 4HEME 2V8LA 4QHUA 4Y1AE 4PGZA 2XZCH 5DR5H 3N3EA 3KH3A 5T3XD 5IQ9B 4LMQE 3SKUD 4MA3B 3K2UL 1MVFA 1KC5H 2CGZA 5F9OH 1R3IH 3B2XA 2G2RB 5KJRL 3UBGA 5CCKH 1GYCA 2A73A 3LN4B 1TZGH 1E8ZA 3FC8A 3BEVB 5DLMH 3GMRA 3T3ME 4N8CH 3MRQB 4OZGB 4NO3A 2ZX5A 3DROB 3BAWA 3B6SB 4GG8A 3UTSE 2Q3XA 3VFMB 3MUGA 2ADJB 2YC1A 3PP3K 4HH9A 3F3HA 2B4CC 5KSBE 2UXGA 2H8PA 4NUGL 4Q74A 4QKXB 3QRGL 5DS2A 3E2HB 3IDIA 3D39E 4O2EA 3VO0A 4MD1A 5DD6B 3D0AA 5C92A 4GPOA 4PRPD 3I9PA 1UCBH 5AYUH 1SY6H 3HC4H 5I19L 5I73B 3SJVB 1AZUA 5DMIH 4G6JH 1TG8A 1EXGA 2NQ3A 3FB7B 3IMWA 3HAEH 1VCAA 5KS9E 1OVZA 3UTSA 2R69H 4X99B 1BZ7B 5E2TH 2VRQA 1WG3A 3ZL1A 2PCXA 3UZQB 4A6YH 1Y07A 2XNAB 2H1XA 3Q8FA 3T3PB 4KO7A 5KTEL 3X3FL 3WCYA 4RGMC 5AB1A 5FO8A 2QADB 3PV6B 4J4QA 2EI4A 1XGYH 1U6AH 3B56A 5ALBH 5IK3B 2YD6A 1YQVH 3MOBL 4AYDC 1IGMH 4BK4A 3MROA 2C1PB 3ULVF 4XHJD 3EYVB 2NZ1A 5KSAA 4PJFF 4AX3A 1L9SA 4U6YA 3VVVA 3TNMA 3BZ4B 3CMOH 2EE6A 2NX5A 4IBQA 4Z7NF 3EZ8A 2Y7QB 1KZQA 3FFCB 3I6GA 1JPTL 3HLAA 3PWLB 3MGTA 1FL3A 4YZWA 1QQDA 5EFIA 4E9TA 4PJHE 4PJEF 1YMMD 5EV7A 3ZDXF 5IESH 1FHNA 2GSGA 3V7AE 2LLGA 2OXHB 4HYTB 3DA0A 4RFNC 1AQKL 5F6HJ 5LBGA 2J1XA 1FFPB 1DVTA 1F4WL 4TLKA 1VZHA 1VGOA 2DMGA 4ELMA 2ZUWA 4N0UB 1AQDB 2DYPB 5F97E 4XXJA 4U1IB 4JAMA 2ATAA 3EYQD 4B95C 3KYOA 3SPCA 2VSMB 4PS4H 3BT2L 3EDJA 1Q0EA 3VFWA 5GISH 3RDTA 2M8XA 5E8OA 3MRJA 4JY4A 4BK8A 4K23L 4ODSH 4KMTH 5B3NA 5IROD 4KAQL 3QIUC 1GGBL 4AE1A 1ETZA 2DLTA 3QIUB 4HIQA 3T4YA 3V4VB 4W9CC 4Y9FA 3FFOA 2JJTA 1WUNT 4S1DD 3TNNA 1NFDE 2XTJC 2IV9A 4HOMA 3ALXA 2A2QT 3S6CA 1EHNA 1OSYA 5EUOE 2YUWA 3MCKA 1K4CB 1QLEL 2YPLB 1CLVA 1U9KA 4PWJA 1RPKA 3AT9A 1P2CA 3CPLA 3T8XB 1I9EA 1TJMA 4OSUL 4XVUD 2Y69B 3OD3A 1UGKA 3RPIA 3O8XD 3NSXA 3KPOA 1ZANL 5AUMB 3Q7JA 1NFDA 4GKZA 1BFOB 2W5PA 3CN1A 4Y4FC 5F8RC 3T0WA 1F56A 1NDGA 2W80C 4ZTPL 3T0EC 2HG0A 3KR3H 4PVNA 1WJ3A 4OT1L 1KCUL 1CGWA 3VXRD 2B2XH 4YE0A 5HYQA 4QRSB 5I26A 4JFPA 1QPPA 2X4PB 1NGQL 2BMKB 5DXWA 3KNBA 1QX1A 4XR8C 1TTFA 3TOPA 4GMSL 2VDKB 3MRMB 5K9QI 3CFJB 4G8EB 2A38A 5F0PB 2Y36H 5BVJA 2GSIA 1H19A 3LNEA 1OPGH 2AK4B 1MCPH 5EZJA 1I3VA 4QJ4B 1HOCA 4P9ML 3CBJB 1S7SA 4PJIB 3RIKA 2IANA 3TCLB 2WZ6A 5I75C 4DPCX 4FMVA 4XP6L 1IM3B 3CXHJ 3VNZA 4EIBA 1B6UA 3O6LH 1JTTA 2K9FB 3PJNA 3R1GH 4JFZL 4UZSA 1G6VK 1VAHA 4BELD 3WFBH 3MRDB 3MTRA 4PJ6A 5FYJH 3RNQA 4F8NA 5J9PA 4R7LA 4RGND 3MRHB 3OR6A 3IAQA 5D7JA 3QXWA 4U1KB 2JAGA 1CD1A 4FQLL 1DQDL 3FJTA 3MBEA 3SGDI 3BYTA 1HAUA 3RU8H 3V4PA 3DUSB 4JKLA 3P0GB 5CJOL 4A7VA 2C9UA 1NLBH 5C0EA 1YVLA 5IROC 4GUPB 4EN3C 1DBJH 2HKHL 1S2EA 4GAYB 5F1NB 5F70A 4EN3B 2CM5A 3D18A 2YCYA 4HCIA 3WE1A 2H2PC 1I3RA 2WUBL 5D7LA 4EIZC 3CK0L 1IQWH 4OI7A 4WRLA 2PXYB 3EYQC 3AT8A 3QH3B 1KJ2H 4LSTH 1ROWA 1JYXA 2XWXA 1A4CA 5AX0A 4JFXB 2IBGA 3LV3A 3L4TA 3U0PA 4DFHA 5F7AA 2VXSH 4U33A 4PRNA 5LUMA 3JZ7A 3DX0A 2FLMA 2ZZLA 2KZ1B 2P42B 3O45B 4WI0A 2B4CH 5IVNA 3QCTL 3ARDD 2NNFA 5D6CA 2IAMD 4OFYA 3QUXB 2WBJB 5BZWB 2Z4QA 2HAZA 1J1PH 1BQ5A 2EKSA 3WN5B 5J13B 1KIPA 3UOAB 5D1ZA 3WUWB 5E4IA 1JCKA 3WO3B 4L8SA 4RGOH 5JHDB 1GYVA 3O81A 3IJEA 1KBVA 1MJ7H 4DUWA 1E4JA 3GS0A 4NP4L 4LDCA 1NEZB 5T3ZE 3LKQA 4BWTA 2M2DA 5J1TC 2LHAA 1L7IH 2NNCA 2FWLB 4O51A 5ANHA 3VFTB 2XI9A 3MCLL 5FFGA 4HHAA 5C0BD 3HRZB 3V4PH 4MDJA 4EZJA 4MXVE 3BZEA 2OMZB 3T3PE 4AT6B 3F85A 1WAPA 4KTEL 5CD5C 2UWEF 1AQ8A 1S9WB 1UM5L 1XSIA 4YL4A 5I1AA 1DFBH 1HCYA 3D2TA 2ZX9A 1BG1A 4L23A 3CSTA 4KRNA 2GBAA 4G5ZH 4JLRA 4MZ3A 2LAAA 3DVFA 1LILA 1K6QL 2DM4A 3MNDA 4ISVA 3BPLC 3MX0B 2LAGB 4YAQA 5IWLC 3MBEC 4DESA 3NSFA 1RZPA 3KG5A 3WU1A 3G5XB 1UKTA 1E43A 2Q6WA 5DUBB 2AC0A 5ALCH 2HT2C 4NQTA 5IMKA 5IFJA 4N5UA 1RZ8B 4JS7A 2BDNL 3VH8A 1XCXA 5F7WC 3VXSD 2ZXWB 4FDWA 4LFHG 4Q9RH 3VWKB 1UA6L 1T3FB 4LHUB 3QJVB 3O6FD 3ETTA 3QUZC 3P69A 4ZSOA 1NOAA 3MOAH 4AGOA 3QR2A 3BFOA 2PTTA 3BSZH 4J3SA 4JEGB 4BXSV 2ZPKL 3LQMA 3VB8A 2LVCA 1ZA6B 4IOFC 3K8LA 5JPNA 1L4IA 4UV4H 2E6JA 3S4SG 1GSKA 2XKSA 3L54A 1A1MA 1S7TB 3QFDA 3RFRA 3P0VL 4U2YA 4XNQA 3ZVVA 4IKLA 1JDCA 1CDJA 3K71B 1CXKA 2SEBB 1G4RA 4PTTA 5A6LA 1XIWD 4NZRL 4U3HA 3CN2A 3TGXA 4BCXA 2GIXA 2BVOA 5K5YA 1A02N 2QMJA 4NO5A 3ZPDA 5IQ7H 2QQLH 1K4DB 2G75A 2WNKA 5IB3A 2XIBA 2DQCH 3E6HB 4PXFA 2DLFH 4UUJB 4U6HB 2O6CA 2HSIA 4FULA 2AJ3A 3D69A 1DSWA 1IBDA 3TBSA 3TIDA 1BFTA 2ZKYA 5B1BB 4I13B 4G82A 4MLSA 1W8OA 4IRJC 4HWLA 1OAUH 4Y5YC 4AMWA 5T1JA 2O93L 4EZKA 2A9CA 4PGBB 2B3IA 5I1GL 2KPWA 3A67H 5D1QD 1X7TA 4GEIA 1EEQA 2XN9A 4WU5A 1TUPA 3STLA 3PDOA 3S5LB 5CZVL 4S2SA 3BCDA 4G80A 1KCUH 4X6BB 1AGCA 4K7FB 4L1BA 3WE6B 1MGYA 1S7UB 3DX7B 4H8UA 4AV0A 2YK1H 1AD0B 3BXNB 4JE0A 3IVKA 4ODVH 5J6HA 3U30C 5IB1A 5FO9A 1T80A 3LPGA 3LKNA 4E41A 1JF6A 1FBKA 1WBXB 5K9JL 3AADB 2C3HA 1A5FL 3OJDB 4UM9B 4UIKL 1TMQA 2ADIA 3MUHL 2O6DA 3PPEA 5JHBA 1T1WA 3IBOA 4KKQA 4AUUA 1OLZA 5A8EA 1WF5A 3QUKB 5D2LE 3BP4B 5EBLA 1BFVL 5E9NA 3BN9D 1ERNA 4OLWH 1DDHA 2A5UA 4PJHA 3UTZB 3I02B 3GO1H 4Z7VA 2EVGA 1HFUA 1QMUA 1A66A 5LCVL 4PXKA 2J8OA 3QI9A 1O6SB 2EYSA 4HFWA 4Y2OA 2PMZA 1RU9H 1YN6A 2CJTA 1EMTH 4HUMB 4W9KC 4G83A 2XWDA 4FQLH 5CHNA 1YY9C 2L0DA 1HCVA 5DMKB 3HJEA 2MCAA 4MJIB 3O0RL 3RWIB 1JGDB 3V9EA 2ZX7A 3EJTA 2HJLB 2AF2A 3CX5K 4KXDA 5DVNA 4ZFFB 2FX9L 4UV7L 1OD7A 2DBLL 5DRWA 2EDHA 1BHGA 4FQJL 1GMIA 4PJFB 5DJCA 4D0DB 1VFUA 5F7HA 1MJUL 2JELH 5JOFB 1KNOB 2W0PA 3IFNH 4BKSC 4LDEA 4WWPA 2W9DH 1S7WB 4ILDA 3C5JB 5KS9F 1W0VA 3FUDA 2FEDD 5B1CA 3VWJB 4MXWH 1BF5A 3VGDA 3JVGC 2A6JA 3PQRA 5AVTB 2LOEA 3D2UD 5SX4I 2FEEL 4KTDH 1RUQL 1TCRB 3EJJX 1ID2A 5DJZA 1L3WA 2HLAA 3Q6FB 4JM2F 3C9NA 1BD2E 1FPTL 2EE2A 4M56A 3SO3C 1T7YA 1KENL 1YMMA 4O2FA 3CZJA 1T7XA 3ZHKA 1HAWA 3T04D 1TEGA 4KV5F 4WW2C 2MHAA 2WJ5A 4YO0B 4MJHA 4NXSA 2I35A 4LDOA 1QFOA 2NXZB 4LOEA 5EZOL 5TPWL 1T2JA 2QQKH 4QPEA 3QSKB 1T2QH 1NLDL 4ZXBD 1DSFL 2IWGA 4FG4A 3VQMA 1RLWA 1OL0A 3UCRA 3D39A 3INOA 4XNXH 5DHEA 4Q58C 2Y1AA 5DD5L 3VG9A 7FABL 3U0WH 4WHTB 3GI8H 1D9KD 1HS6A 1J0IA 3ZU8A 4QJ5B 5HGDB 4HJSA 4M00A 4OLVH 3KWTA 4BZ1A 3K6SA 2PCPA 1BMWA 5HHOB 3LQAL 4CGUB 2WZAA 3EOTL 3VSTA 1QHJA 2EACA 2ORBH 2Z31A 2BCKB 4UNIA 2X1PA 1FO0A 3VXMB 3PDGA 4Z0BL 3UTSD 5GRUL 2WN2A 5DYSA 1SN5A 4E0RB 3IJYB 5JPMB 1KWKA 3GMRB 3NY8A 1CVRA 5JPMC 1S9XB 3F83A 4YR6B 5DJXB 4KK8C 4LARH 4PJ5B 4ANXA 5KSBF 2AJVL 3QRBA 1OP4A 3GUTA 4Q9RL 2P5EB 4QHMB 5AVYB 4HBCH 4NKIL 3OKDA 3QWRD 2VITA 1MLCB 4DJHA 2HYMA 5FIEA 2NDGA 2ZP8A 1F0LA 3SDDB 3ZL4L 3TX4A 2NUPB 5CZRA 4LGPB 4LEOB 2P45B 4GQ9L 3HG0A 3GHEH 5IM7A 3FRUA 2BNRE 2RCSL 4W9GC 4F57H 2F5BH 4AMKH 3H55A 5JJNA 3O3DA 4B0MB 1HSAA 2WTOA 1Z0MA 4DQOH 2QVKA 4H8WC 3NJIA 4GG6B 4NC1C 4PP2A 2GJJA 3ZYZA 3BKCH 3PJSB 3L3GB 2MEJB 2V17H 4TSCL 1KXVC 4OZFA 4V33A 2V33A 1T03L 4M48H 3MJ7A 1FG9C 1KYFA 5ILTL 5H4YA 2MPAL 1TJGH 3MRRB 4KUZL 4BZ2L 5K39B 1A4JA 4PYGA 2DQIH 1RAMA 4RFNB 2Y22A 3WNLA 1UYWH 3CDZA 3P3UA 4P2CG 3K2IA 1BBJA 2WTRA 4QRRE 2OYPA 1NAML 2CUMA 2HT4D 2KERA 4IRZA 4WWOA 1R6VA 1J5OL 2BC4B 1G7PB 4XPHL 3N43B 5DD3H 4IBUA 1FI8C 3Q1SH 4S11A 3O9WB 5F9OL 4LSQL 3CVIL 5IEKA 2BSTA 4WNSA 2PXYD 5D6DA 4ZDHB 4HJUA 3K6FA 2DLHA 3O2DA 4JR9L 1UOVA 4YVUA 1Q9LA 2GVYA 3ZKMD 2X87A 3QS3A 3QNFA 3MLXL 1N3NB 5I2IB 4KY1L 4TMPA 3AGVA 1HX0A 3NH7L 3REWB 1Q94A 4CN6A 4ZUVA 3O4LA 2YAEA 5D7SH 4MCYA 1OE2A 1WIPA 4PVLA 5FCSH 3ZIYA 4Z3GA 5DS1A 2XTJB 1G6RH 3BQVA 3D50A 1LEKB 1MKFA 5DS8B 2HB0A 1ZHKB 1KFGA 4J8QA 1EH9A 1NCIA 1E5BA 5EDSA 4UT9H 4UYQA 3D9AL 4JJ5B 1BQRA 4CSPA 3ULVE 2GBUA 2YA1A 4HJJH 3P4LA 1XIWA 2OBGA 5AOLA 1K8IB 1JDAA 3ULVH 3VFVB 3SQOH 1FLRL 3WY3A 1Z0NA 3RWJB 5KTEH 2B1AL 3FTZA 3HBQA 3O8XA 4YDKL 2XJKA 4CNIB 5GS1B 1N4XH 1IGJA 1MCJA 2FNWA 4ZTOL 4QRRD 3ES6A 5E4EB 3CHQA 1X9RA 1W6WA 2UWEB 2D3LA 2HRPH 5KG9A 5EUOB 1FWXA 1WT5A 5ID0A 1URIA 2DS4A 1A6TA 1G7QA 4GBXC 4KVNL 2Y4SA 4DW2H 4ZG1A 5KVEH 1N5YL 2YPVA 2GEEA 2DLGA 5EZLA 5IW6A 5GSVB 3UO8B 4FTDA 3RWDA 2Q20A 5IQMA 5EOTB 4LF3A 3SPVA 3L95A 2BP8B 4LVHB 3GYRA 5TGZA 2AHIA 1I1AD 3GSVB 4YHIB 5B0WA 4BXVA 4QNPE 3I9GH 3TPUA 1XGQA 1PX8A 2GSIB 2X2HA 4H25A 1V3JA 2NXYC 1LXMA 2R7EA 3ZE1E 4UT9A 1QSVA 3BUTA 1FV1A 2J3SA 2J8UB 4AITA 3MV7A 3F12B 1FA4A 3U9UB 2WZ5A 1A8ZA 2D2CC 4FMFA 3T0XA 5JO5B 3US0A 2CXGA 1T04B 5K9OB 1ZIBA 2X4TA 2X6CA 4XNYL 1DJIA 3ETBF 2VTFA 4ZUTB 3WTXA 1OQOA 1R33A 1TQBB 2M26A 3KW7A 4S0HA 2VLRD 4M61A 4KX7A 3D08A 2JKTM 1R19A 5D7KD 2WLNA 4XMXA 4WUUB 1FCGA 1UD5A 3VYPA 2VZUA 4EI5C 1WISA 1TETH 5B8CC 4MJ6B 3F6LA 1ZGLA 3GFUA 1VGKB 4ES8A 1LP9A 3B5TA 3F01A 1PKQB 1Y7VA 3RFZC 3D18B 2Q7NA 3ZGIA 2YOAA 3VA6A 1E4KA 4E41D 1G0YR 2F0CA 3H3PL 2J72A 3HHSA 4X98B 5F88B 3RWHB 2Q8AH 3OLDA 5BS0D 4IARA 3G5VA 4LKCA 4PJGE 1INEH 2ADFH 1MI5A 4OI9A 2OMBA 4MQTA 4GAAA 4P5MA 1J1OL 3JWDL 4QRFA 1EVTC 1MRFH 5INCA 2AQNA 3CFQA 4QYOB 4JQIL 4E9XA 5I0XA 3QEUA 1HJCA 4WQOA 2MRYA 4FQIH 5L9DH 2WBJA 5DLML 5BZWA 3QEQB 4K4KA 2HT2D 3PABA 2EDDA 4HUUA 2G0LA 2VDQB 3KYNB 1KBGL 5DRZB 4JPKH 2Z92A 3B9AA 3GBLA 2ICWJ 4K71C 1W15A 1T1XA 2VLKE 5DC0A 5D55A 1XQ4A 4R7VA 5T1MB 4HWEL 4NBZB 3W0WB 3W81A 4F57L 1G7JB 3V6OE 3QULA 4BK5C 5CP7B 4YZFE 1BA9A 3LKSA 5AKSA 1TCMA 4W4OA 4D7PA 3KLQA 5TD4A 2DZEA 1XH2A 2NOYA 1JGLH 4L8CB 3OMZA 4TQ8A 3W82A 5K1NA 2CDGB 4XBEL 3WLBB 4HV8B 1S78C 1TQSA 3IGKA 3RWEA 2DW5A 2WVVA 5MI0B 4UINL 2VAJA 5DZLA 4Z7UF 3QZWA 1TTRA 4WWKC 1ZXKA 2YARA 5G53A 4GG6E 1AC0A 4FC3E 4FHBD 2YDVA 2X42A 1B88A 1AANA 4HETA 3G3LA 1BMGA 2EDJA 2XTSA 3M7OA 5AWNL 4XNDA 1YEGH 43C9B 4A68A 1XGYL 1QNZH 1CGSH 2EYTA 2H26B 4G8IB 4X9BA 1GUEA 2F58L 4KXAA 1GC1C 4ZX5A 5IT2L 2WGXA 2HVJB 1PYWB 2ITDA 2WBJC 3FSWA 4B60A 2NY5H 3KE0A 1CUOA 4NQDE 3S37X 3SDXB 1UUNA 4MJ5B 2PABA 2PO6A 3CN3A 4D8PB 3VH8B 4LCWD 4MMZB 3OXRB 4WNQA 4XXDB 5IGXL 4Y9GA 5CLTA 4HWZB 4XTNA 2P49B 2FATL 1YMHA 2W60B 1E6OL 1EDYA 3BWUC 4ONHA 3V4VL 1GZMA 2HA1A 2IFFH 3SB3A 1KV7A 1N10A 5I5IA 2K4AA 1PZ5B 1ZA6A 3U4KA 3Q2LA 3OMAB 3TN0D 1GOGA 2QZ5A 4RLDA 5L8LB 4PV8B 3MGAA 4HJJL 1SEQL 4Q8BA 1R5IB 3VE0A 1QLRA 3I6KB 2EIEA 2MKWA 1E42A 3QAQA 1D9KA 4K07A 4LSRH 2QPFA 3D30A 5DGRA 1KJ3L 2YUXA 1RJYB 4NQSB 5D96C 3T2NH 5D7JC 1ED3A 2Z55A 4G6KH 2F7IA 2IXQA 2D7TL 2NW2B 2OI9B 3BKJH 7PCYA 4M43L 3R18A 1DBAL 3BO8A 3K8KA 3Q43A 1CXHA 5M94B 2P48B 2AABH 2WLLB 4FQXB 3K5SA 2KMWA 3TC9A 2ZX6A 4XPAH 4FFZL 3RPBA 4C54A 4D2NA 3TXAA 4OFYD 5G55A 1WBYA 2R23A 3V9CA 1UJ3C 4OGQC 4KKZA 2VT0A 2P5WB 3WLWC 3EYSH 4ODBD 4KNTA 5GGQL 4WJ5B 3G6JE 4TVPD 5DHVH 3LEVL 2EDWA 1RUAL 1T5XB 4L8DB 5CD3B 1UD2A 2J8UF 2AXFB 4HAKA 3CVBA 1OQXA 3HCVA 3IDNA 2X4NA 5L7XL 2FO1A 2WLZA 3MREA 5IB1B 2Y5TA 1D7DA 2DQGL 5ES4B 4YLBA 3DETC 1KLUB 4GKLA 5IMMB 1NAMB 2W91A 3CFDB 1AC6A 2W07B 2OCJA 1V7NH 2R27A 3SGEH 2X7LA 5GXBB 1QSEB 3QG7H 1D6EB 1XF4B 1M7XA 3EGSB 1SF3A 4M6AA 4NIYE 2QSTA 1QKPA 5I0YA 3QJTB 1SJEA 3FN0L 3LRKA 3VFSB 4X5LA 5LKNA 3GMMA 3IGAA 4XNYH 2G9HA 5CLXA 1NFAA 4J12A 1MFMA 5GRZA 2YRZA 4WFGE 3C6LC 1CBVL 5GRVK 2RQ8A 2ZCHH 3RGHA 1C8PA 1QFHA 3VXRE 4UMSA 1JHTB 5JXAL 3C5SB 4FQPA 2ILLA 1XO8A 1SXZA 5CHNB 2JXMA 4GRMB 4LPXA 2R0WL 4WO4B 5I73C 1BJ1J 1GIGL 3RWIA 3OKOB 2CPUA 1DQQA 2WAQA 1IEBB 3FQUB 3MRFB 1ESOA 1I85A 2DQCL 2XTJD 1EO5A 4JDZB 3T3MB 5T1LB 4JANA 3D12B 2WXKA 1EXUA 1TVBB 2HVKA 4XCEB 2K8QA 2UZIH 3P4OB 3VVKA 3QIUD 5BUPA 4IOSA 1WPCA 5IR1A 1OSPH 2PLTA 5A44A 3S48A 1DHKA 3BFQG 2H4EA 5SWZB 1DQDH 1UVQA 3SO3B 3HVDA 3RU8L 4ANKA 5BVPH 2F6AA 4BE6A 1NLBL 2QEJA 1SOQA 2OJEA 3GB7B 4M1DL 5E6IB 4GI8A 2CHNA 5E94B 5HYSB 1JZDC 2BVYA 5AFAA 4HIXH 1MXGA 4AJWA 1EEYA 4FA8A 2CLVB 4ODVL 5FF6B 3C9NB 2YCWA 2N0MA 3WO4B 3UL4A 4C56A 2Z34A 3WO4C 4AM0B 1YMMB 1FVDA 3PNWB 4ZT1A 1LE9A 4Q9QL 4UYPA 1XF1A 2K70A 5B22A 4MZIA 1M56B 4NUJB 4WEMB 5JQHC 3L5JA 3QC5X 3WIAA 2VO8A 1HQRA 1JK8A 4P4KD 5D1QA 3DK0A 4BFEA 2NY6C 2NY7H 3BAJA 4LXFA 1N64L 1JGJA 1NGQH 4GKSA 3LNHA 1ZTXE 4XN7A 3F7VB 2WV3A 2XXCB 4JDVB 3UZQA 2G5RA 4XN8A 4OGYH 4QT5A 2PWEA 2ZCLL 2B16A 5B38A 3TZVB 4Z8FL 4LFHD 4OZGA 1BX2A 2VQ4A 1HU8A 3LEYH 1EUUA 1W0WB 4GG8B 2E8YA 2FECL 1TYRA 1KN4H 3C5ZA 3FB6B 4TV3A 1HINL 4JO3H 5IHWA 2CKBA 3QBLA 3EJYC 1AXSB 5IOPA 3EYVA 1I7RB 4HH9B 1HCFX 3RIFF 1GS6X 1ITBB 2QPDB 4U4BA 3QFJB 4AK2A 4OD3L 4OZ4B 1FO0B 4AQOA 5JYLA 1L9QA 1SQMA 3KDMA 3DV4A 5BXFB 4HXAL 1IAIH 2H6PA