4G70B

Structure of recombinant cytochrome ba3 oxidase mutant v236t from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant V236T from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 51
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4g70B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4g70B02
1JV7A 2CAKA 1AS8A 1DZ0A 4XT1A 4HZ1A 3VI0A 3JTBA 2XVBA 3ZX1A 4AX3A 1S8LA 5BR5A 2H3XC 2Z55A 2YAEA 2XV2A 1AG0A 1AANA 3X1FA 3X3BA 5B6YA 3NJIA 1HZXA 1E12A 1JVOA 4KO6A 4WTQA 2QPDB 3AY2A 3EHBB 3NS0A 3QBLA 4A2HA 3REYA 1L9HA 2YQBA 4WAVA 3X2QB 3KW7A 5G2CA 3UAEA 4AKOA 1GY2A 3IN0A 3QBIA 3QJVB 3D4SA 1C8SA 3FU7A 5H2MA 4LDLA 1WA2X 4JQ6A 2FT7A 3VVKA 4E9QA 1MGYA 1PNDA 3FSAA 4YVNA 1OE1A 1AZRA 3N2JA 1KDIA 1OE2A 4JKVA 2AANA 3PAUA 4KNTA 2R7EA 3ZBMA 5H2OA 3IE9A 3ZDWA 1RZPA 1OOWA 3ZPQA 4BWWA 1QHQA 1TKWA 3FSZA 4BXSV 3DQBA 2FTAA 3OAXA 1ET8A 3T6VA 5B6XA 4AZUA 1QNIA 1QM8A 2PPAA 3ABWA 1AS7A 4N4YB 2XU9A 2HX7A 3CDZA 2XX1A 2FQFA 1V10A 2XWZA 4YSAA 1B3IA 1AIZA 2Q9OA 2YXVA 1R1CA 1M0MA 1A4CA 3H4HA 4DP2X 3H56A 4FPDA 1JZHA 1L9QA 1J5DA 3FSVA 5H2LA 3S8GB 3QAKA 3SBPA 3BVDB 1TU2A 3DTUB 3G5WA 4EA3A 1EZLA 1AT9A 2CCWA 2IH8A 2P80A 1O0AA 1ILUA 4YSTA 1BM1A 1NDTA 4UG2A 2DYRB 1UCQA 1MZZA 2EIKB 5AHZA 1XMEB 2HPYA 1R2NA 2FNWA 2HLEB 2NRDA 4DP1X 4MQTA 1E65A 1AZUA 2L6XA 3HAOA 1KV7A 7PAZA 2OJ1A 3CVDA 4KNUA 7PCYA 4CSPA 3U25A 1ADWA 1NWPA 3ERXA 1C3WA 2J57A 3IN2A 4X32A 5F7BA 4A2GA 5TGZA 1OCCB 5B35A 1M56B 4L35A 1IBYA 1S8JA 4DP4X 4BWUA 2YAFA 2I85A 1CWQA 3DDLA 3NSBA 1KCWA 3SQRA 3OE6A 4YSQA 1PZBA 4GXFA 1MG2C 5D4HA 3UONA 1ZDQA 5B1JA 4G7SB 2YDVA 4NERA 5PCYA 4HCIA 3PXOA 5H2NA 4JKNA 1KDJA 1MZYA 5F7AA 1X0I1 3AG4B 2XV3A 4F7KA 3QJRB 5B3SB 3WKQA 3ODUA 1WAEA 5I6LA 4BUOA 4GYCA 2NTWA 1Q5IA 2IDTA 2UXTA 4LDEA 4L0PB 9PCYA 5LDUA 4XTNA 4YSCA 2DY2A 2I35A 1ZIAA 1BXAA 1ID2A 3OE8A 1DYZA 3FQ1A 4WW3A 2XLLA 5D4JA 3PLYA 5G53A 3CVCA 3S8FB 1XB3A 1KGYE 2VM4A 3X1EA 3WKPA 4BK5C 2KS9A 1AZCA 2Q5BA 5DHHA 2H5UA 2BO0A 2R4RA 1OF0A 2AVFA 1BYPA 1JZIA 1PCSA 2JKWA 3IBOA 3NYKA 4BWBA 1BYOA 2PPCA 4F2FA 2B3IA 1AZNA 4YSRA 2IDQA 4GPOA 2FT8A 3PDSA 3SN6R 3ASOB 4X1HA 1OE3A 1JZFA 4BDVB 1WA0X 4PXKA 1VJMA 4Q89A 4MD1A 4QRYA 2PP8A 4E9RA 2DV6A 3HARA 1U19A 2F95A 1GW0A 1WA1X 3GXUB 2IDFA 1SHWA 3CG8A 1L9TA 4JHUA 2PCFA 1J5CA 2Y03A 3NP3A 2GI0A 3NSCA 1HFUA 4JHVA 3WNIA 3PXLA 1AOZA 4DPBX 3WI9A 3EMLA 5BR2A 2X72A 3QBGA 1GUEA 1L9OA 2QDWA 3T6ZA 5FJGA 1AG6A 1PMYA 3FS9A 3AYNA 5B2NA 4HYXA 1E5ZA 5AZDA 3AZUA 5H2PA 2YAQA 2RH1A 4XT3A 5ITCA 4MD2A 1PZCA 4UANA 2AT9A 3PAVA 3T45A 4NC3A 3AG3B 3HB3B 4DP0X 2Y00A 4GYBA 1V55B 2YCXA 3NSDA 1F4ZA 1BEXA 1XJIA 3UG9A 2GBAA 3OMIB 1PXRA 1S53A 2VW4A 3V9CA 2YAOA 3T9WA 1CURA 1NPNA 1X0K1 2EI4A 2XV0A 3HASA 1KG8A 4EIYA 1JZGA 1WS7A 4FAAB 3EF4A 3P0GA 2N0MA 1TEGA 4AI7A 1W8EA 2YCZA 6PCYA 1L0MA 5I28A 4LDOA 1FWXA 2R4SA 2QPEB 1SFDA 1URIA 3KJ6A 2NTUA 1CC3A 2AZAA 2OCCB 3AG1B 4IARA 2GC7C 2BZ7A 4ENZA 4EJ4A 1NTDA 4HWLA 4GP4B 2UXVA 1H68A 1GS6X 1ZDSA 4K5YA 1AS6A 5JJNA 3GYRA 4AKPA 2PPFA 2KSAA 1AZBA 4FA7B 3QJTB 1QHJA 4X4KA 5I6PA 2I20A 1L9SA 5I6NA 3VGAA 2EINB 4AMIA 4DAJA 5PAZA 2Y69B 1EHKB 4JR8A 2KSYA 2FJSA 3C9MA 1IXFA 5G54A 1F50A 4L6RA 4BXVA 3UADA 3MBVA 1NPJA 4UHRA 3N55A 4HIPA 3NP4A 1DZEA 1CYWA 4HHGA 2WJLA 1AQ8A 2YAMA 4AMJA 4EF3A 2BWIA 2W88A 4UF7C 1FA4A 1A4BA 2WO2B 4A67A 1SHXA 2I7OA 3GDCA 4A68A 4OV0A 4DP7X 4QLWA 4E9XA 1ET5A 1SDDA 1UATA 5DYSA 2A3TA 2R7EB 3D12B 4K9JA 2H47C 1BQKA 2J5WA 4BEZA 1JZEA 2DWTA 4KO9A 4N8UA 2TSBA 2UXGA 3V2YA 5D4IA 3UTXA 4UAHA 2VSKB 1N70A 2WO3B 1F88A 2BP8A 1SFHA 3X1NA 1IBZA 5F8UA 1PF3A 1BQRA 3PPSA 2J55A 1XIOA 4HYJA 3ZEVA 1MG3C 5B1JC 1VGOA 5G2AA 2FT6A 1JERA 1GSKA 1ZPUA 4YSEA 1TN0A 4G71B 4NAJA 1R84A 3ABKB 4YSDA 1CUOA 2LNLA 2QDVA 1GS7A 3NJKA 3WNJA 3ABLB 2BW5A 5I5MA 1BRRA 1IC0A 1IUZA 4DPCX 3C9LA 4Y9HA 2GHZA 1GYCA 4QI1A 5I5IA 2EIJB 1M0KA 1MDAA 1PNCA 1KBVA 4XXJA 5FC9A 2ZIYA 3S3DB 5E9NA 4E9SA 2PEDA 3WQJA 3RZEA 3AM6A 4CSZA 3X1GA 2Z73A 1HAWA 3CZUB 1OCRB 3NJGA 5B1BB 5B7MA 2J4YA 2DYSB 2JXMA 5B6ZA 1OCOB 3FYIB 5DHGA 6PAZA 2TSAA 4DP9X 2BWDA 3TASA 4NB7A 3UTVA 1SDDB 2PP9A 4YL4A 1M9WA 5AFAA 1ETJA 3HEIB 3FQ2A 5I26A 1KGBA 1PZAA 2YCWA 5AKRA 2JAFA 4M3HA 5AX1A 1BXVA 1SF3A 2ZFEA 1AR1B 3FQYA 3V2WA 4DJHA 4N6HA 4KOBA 4KO5A 3IEAA 1P8HA 1IW6A 4P5RA 4BDVA 4A2DA 2JAGA 1JOIA 3QPKA 3NYAA 2IWKA 3CVBA 5B7FA 1AAJA 1KG9A 1NIEA 5AHYA 1PXSA 3OE0A 1YLBB 2GIMA 3HAPA 2G87A 3NY9A 4G7RB 1VLXA 2BHFA 2PLTA 1S52A 2ZWNA 1M0LA 1AP9A 1ASQA 1I53A 4KO7A 2HXAA 1BRXA 2KSBA 1BQ5A 1JV6A 1FBBA 2PP7A 1CYXA 2UX6A 4E9TA 3DKHA 3X1BA 2WSDA 3FU8A 2JFCA 1X0SA 2HX9A 1BXUA 3MX0B 3OM3B 5JJEA 1JXGA 4W9ZA 5TK4A 3S3CB 5I6OA 1QKPA 2GSMB 2IH9A 3EH3B 1SJMA 4GRVA 2HX8A 2IDUA 8PAZA 2XYBA 5H2JA 4YVUA 1QKOA 5B1KA 4ZK8A 2CBPA 3HANA 4E9YA 5G36A 4DP5X 4E9WA 2FQEA 5ETZA 3RYMA 1HAUA 4YSUA 3PAZA 1GS8A 2VSMB 1TN5A 3QAPA 3NJNA 3UABA 4E9VA 1GZMA 5ITEA 1FFTB 3CDZB 3VW7A 1E67A 1IW9A 2Y1AA 4G70B 4KNSA 1AACA 3JT2A 4A66A 3NSFA 3QJQB 4HCFA 3T6WA 1PY6A 1OV8A 4G72B 3A7KA 2BW4A 4PAZA 4GP5B 2AZUA 5TK2A 3UAAA 1A8ZA 1ZIBA 1J9RA 1NZRA 2BP0A 2GB2A 5I6MA 4QKTA 3COCA 1QLEB 3S3BB 5H2KA 2CJ3A 2ZXWB 2FQGA 5ANHA 2VT4A 4TL3A 3UGEA 3T71A 2UXFA 3FT0A 1BAWA 1NIAA 1FBKA 1LN6A 1L9RA 1NWOA 3OD3A 4PXFA 2I1XA 3OMAB 3FYEB 5AZUA 1GR7A 2BP0B 2ZOOA 2MTAA 3WG7B 3UTYA 3SBRA 1UAZA 3ZPRA 5AX0A 3BQVA 2HRGA 2UX7A 3ABMB 3OE9A 3PCYA 2FQDA 4GY4A 4GP8B 1JXFA 3NJJA 4BWTA 3CAPA 5H2IA 5B6VA 1JFPA 1PLAA 4GBRA 2BZCA 3HAQA 5B34A 2YCYA 4A4MA 1A65A 4W1TA 5AWZA 3PBLA 4G7QB 1E0PA 1P8IA 3T6XA 2W8CA 5A8EA 3VHZA 2YAPA 2I7SA 4J4QA 4N4WA 3RFMA 1KBWA 1N68A 1RZQA 2YDOA 3L45A 3TBBA 2HRHA 2MRYA 4KNFA 2ZONA 4IB4A 1F56A 1ASPA 3UTWA 2YAHA 1JVLA 1W6WA 5JJJA 3TU6A 3NJMA 3QBKA 2AFNA 1M57B 4DKLA 3FPYA 1P8UA 1V54B 1ILSA 3NSYA 2PPDA 1ET7A 2XUWA 4HAKA 1PLCA 4HHWA 3NJHA 2YXWA 2EILB 2IDSA 1JGJA 4KOCA 5C1MA 1GU8A 1J9SA 2CALA 3AW5A 1NIDA 1NIBA 5A44A 5LWEA 1XB8A 2XX0A 3C75A 4A2EA 3FU7B 3UZCA 1E5YA 2F93A 4P5SA 3NT0A 2FWLB 3FU9A 3EH5B 2VW6A 1A4AA 3WIAA 5I6KA 2GC4C 5H2HA 1A3ZA 3OQRA 1BRDA 1C8RA 5EHFA 5IY5B 2B08A 2WJKA 1IKOP 3PQRA 1PLBA 1XB6A 3NJFA 3FPXA 5G2DA 5G28A 1NICA 2QT6A 5B6WA 2IWEA 3NJLA 3TBCA 4DP8X 1T5KA 1SF5A 3VG9A 2HZHA 2VW7A 4F2EA 4TXVB 3PWHA 2X87A 1SNRA 2EIMB 3KW8A 5I5JA 3SBQA 4YSSA 3NY8A 4FBZA 3CODA 1X9RA 2VMJA 5B0WA 1X9UA 1ASOA 1J9TA 2IAAC 4RH4A 4WKXA 5B1AB 5B7EA 3UACA 2XXGA 2BRDA 2PCYA 1Q5JA 1NIFA 4DPAX 4XTLA 2Y01A 2RACA 1S51A 5J7AA 4YSOA 4X31A 1KCBA 1GY1A 1KYAA 1RKRA 3ZIYA 2VM3A 1W6LA 3OMNB 3MBWB 2IWFA 4BVNA 1KMEA 1E30A 3ABGA 1H2SA 1JZJA 4YSPA 4IAQA 2CUAA 1PAZA 2XXFA 1NINA 4MQSA 2I21A 3QQXA 4PCYA 2Y02A 4DP6X 1S54A 4QIDA 1OCZB 4M4RB 2VN3A 2LLNA 3V9EA 2P80D 3EH4B 5KKHA 3TA4D 4XTOA 2BP8B 3AYMA 4BV0A 2E86A 3AG2B 4HCGA 1L9PA 1RCYA 1ZV2A 5A45A 4MFHA 5A7EA 5EN0A 1PY0A 4MBSA 2OV0A 3DIVA 3FSWA 4BEYA 2YARA 4Q8BA 4A2FA 2ZZLA 1J9QA 3ASNB 1WS8A 4AKQA 1TEFA 2PPEA 2X88A 4KLYA 3QDCA 2J56A 3QJUB 2Y04A 3UZAA 2DWSA 3QJSB 3H4FA 1JXDA 3X3CA 2M3GA 4HALA
chains in the Genus database with same CATH superfamily
3VSVA 1EHNA 3NZHH 4XT1A 1C08A 1QZNA 3GUFA 1VF5C 5B8CC 4BZ2H 3SE9H 1S7TB 1U93B 4QRUB 4DGUA 3X3BA 1YC8A 5C9KA 1XR9A 2WAQA 3QXDA 1E12A 5LAPA 3ZKXC 2DQMA 1JGUH 2B20A 4HHAB 4IGBD 4C4KO 3HG1D 4FI6A 5F0LB 4HJIA 1OAYL 4KVNH 3V2AR 4AW7A 1AXTH 2X2IA 3FU7A 3N04A 2VYRE 5IW3A 4AQ1C 3LIZL 4D3CL 3FCGA 3RY4A 5JHDD 3AADB 4XP4H 3KS0J 1ZOXA 2ZWYA 1OE1A 4KDTA 5DD6A 3FCTB 3PAUA 4HSAC 3ISRA 4LNVA 1SEQH 5CWSB 1LQSR 1EGJL 4U05A 3CSPA 3CVHL 3IU4H 4GMSH 2WKOF 3TBVB 2PR4L 1AQKH 1TKWA 4BXSV 5HYSA 1CF8H 2BNRA 1OF2A 2EAEA 4M43H 3ZE2E 3VX1A 2MPAL 5L8LB 1PD1A 2YWYA 3FN0L 5KVGL 5DK0A 1AS7A 4F15C 4UZGA 4MMZA 3OHXA 2XN9D 4A7VA 2Z4QB 5CGTA 1AIZA 2O6EA 3PHAA 4QOKA 5GGQL 4LU5H 5HHXH 1XGYH 3H56A 4PW4A 1YAZA 4LLUA 1NOFA 4HISA 1MCPH 1YN7B 4HAGA 1I85A 1NGQH 4BZYA 4Y2OB 5I75B 1GYVA 3QO1B 4WI0A 4LQFH 5IBTL 3GMNB 3VXSA 1SXCA 4G3YL 1LWHA 3QORC 4AYBA 4OTXL 2ZXQA 4ONHA 4DP1X 3R06B 1AJ7L 5LG6A 1LWRA 1MH5B 1B0WA 2P5WA 4IBLT 1FE8L 3VWJB 1DJIA 1DVZA 1ADWA 2WVTA 3IN2A 4Y88A 4X32A 4J8RA 3CFTA 2J1WA 4PJXA 1S8JA 3DTDA 2YAFA 1T0PB 4N68A 2AXWA 2F53E 2DH2A 4ICXA 1JGUL 2Q6WA 1PW3A 1XL6A 1K6QL 2XPGB 4YXHH 5DK2A 3FTGA 2YPLD 2DYPD 3NIGE 1GOHA 4LCIL 3RTQC 3SDCA 2VR9A 4Y7MA 4XHJC 5J11C 3GBNL 3CSYB 4OCMC 2VZOA 3DMMC 3C5ZA 2IDTA 2WBXA 3BAEH 2PO6B 3MRLB 4GBXC 1WLHA 3ARFD 3RBSA 4XTNA 4MXWH 2DY2A 3DUSB 3UYPB 4HJ0C 5BRPA 3CN3A 3RZCB 1U9KA 1FBIL 4U3CA 1R3JB 2FDBP 3C2SA 1G9NL 3HUJF 3EGDA 4GKLA 4J28A 3TCXA 1SEBB 1F3DJ 4BFNA 1F3JA 5A2BA 2XQBH 2VDOH 2Y5EA 3D1MC 4MQXC 3APCA 3VMOA 3IF1A 2BO0A 4JFFE 4M62H 1XZ0B 3NYKA 2GYSA 5KVEH 4BKTC 4I4WB 4BWBA 1BYOA 4HPYL 1AZNA 5E9AA 3HVNA 3U6XS 3ATBA 1NJ9A 3L4VA 3TFKC 3WHXB 4AQAA 2MPVA 3WFEH 5TPWH 2PP8A 4NJAL 3HARA 2NY5L 2W9EL 3DJRA 3UOAB 2V7NA 5HSFA 4TNEA 1P9MC 1S8DB 3CG8A 1K8DB 4OU3A 1BWMA 2GQHA 2XWRA 2GI0A 3U6XA 4URTB 2KHAA 1RHHA 1RU9L 2ODHA 2YXMA 2Y5QA 1IFHL 4QPEA 1RZFL 3QJXA 3MRIA 4OFPA 1X5YA 3MLYH 4JE0A 1M2VB 3I6KB 4GSDL 1X3DA 1AGEB 3NSJA 3LS4L 5IB1A 3LZLA 4BQ6A 3SYOA 3O6KL 1EO8H 5HI5C 3WBDA 1S7SA 4WU5B 4YGVB 1UC6A 4ZUUA 3MCLL 2ADFH 3BAXA 4GYBA 4FOMA 3SYQA 1FDLL 2J21A 3KXFA 3LOWA 4ZUWA 5I8CB 1MIEH 1CF8L 4R4FH 4R7LA 5HYIA 4LESA 5F6HJ 3MRMB 4WUUD 1V27A 2YCZA 5EIVA 4GSXA 2F68X 4FFZA 3LN4A 4HIQA 3UZEA 4XVUD 4X2UA 4NRYA 1KB9J 5LN8A 4MAYB 3MN8A 4IDJL 2ZXCA 4JDZA 4MAYA 3TIDA 4AQEA 4ENZA 1JFQH 4ZMLA 4FA6A 4K5YA 3MTXA 2FAUA 3PNWB 3U0PA 4NN6B 3VCLB 1HEZA 5D1XA 1AZBA 3P0GB 3QI9D 1MLBB 1I8KB 3E6FA 2VR5A 1I7TA 3BAEL 1JPTL 1U8NB 3BQUD 1O6VA 4DAJA 3C6SB 3JT0A 3C9MA 3OR6B 4FULA 2MKWA 3ULVD 4XC1L 3QUKB 1TNMA 5K39B 3NQIA 3L3IA 4EQ2A 1M42A 3MV8D 2DQDL 2ZYIA 4POYA 1BSIA 1KYOJ 3ZY7A 1WFIA 3G6DL 1SJVA 1G7LB 1YDPB 1UA6L 3CN1A 4LSVH 3VXPB 1C9SA 4P06A 4TN9A 1XWVA 5E8EA 1OCWH 2TSBA 3SDXA 2FECL 4G8EB 3CXHJ 4WNQA 3WYRA 2CIIA 4L1LA 3H3BC 5GGUB 4NKIH 4ZDHA 3WTWA 2ZAIA 4XPHH 3VFNA 4CC1A 1RZKC 4AQAB 1RZ8B 3GSRB 1DZBA 4YIQA 5E2WL 1NGQL 3PDGA 4G71B 1N3NA 3FOLA 4K7PL 2PWDA 1I1AD 3CIAA 3IDYB 2B1HL 3NPSC 3S6CA 2CO6A 4I18A 3KPNA 4EUPB 5LN4A 3A5VA 3IJHA 4PVLA 4YHPB 3D4YA 4G82A 1T0OA 1KCSL 3HAEG 1T7VA 5C6PB 4FNRA 4IRSC 2F1BA 3WQJA 1MCDA 1CGYA 4BFIB 3T0XA 4PJFE 1ACZA 2DBLL 2VDLL 3O8XD 5DHGA 5F7FA 3IB4A 4HBCH 1FI8C 1GXEA 2VQ1B 4CN4A 3UTVA 1BOGA 4IBQA 4HMEA 4PR5A 2GUOA 2P5WE 1MHCA 2X4QB 3QEQE 4JM4H 4MJ2A 1QX1A 1S2EA 3BGFC 1SYSA 3PUUA 4WWKA 2BJMH 4PRIA 2NCEA 5E9DE 5GIRA 4M1GH 4D0DB 3FQUA 4JZJB 4GKSA 5IK3B 3DX6B 4L1TA 4LNRB 1XCQB 1T7WA 4M6ML 1IW6A 4LL4A 4BDVA 1A0QH 2JAGA 1FYHB 1DQQB 5C0BB 5E4AA 4XNMA 2P8LB 2GEEA 3D7PA 1VLXA 1K4CA 1OTSC 4YHZH 3KZ8A 3TZVC 1HXMB 1M1XA 1KN2H 2PP7A 4L0YA 4PJ5E 4XODA 2EDKA 3CV5A 3M46A 3KDMA 4FQCL 2E7LA 2KDYA 1G6RA 5JJEA 1JXGA 4P9HL 4ZPVB 5C0RH 1FGNL 4AEIH 3IGAA 1IT9H 4KWUA 5A7BA 1KB9K 1JRHH 3IFPB 2L7EA 2O72A 2VXTL 1AIFA 3VGAC 4AGPA 3MXVH 3FQ4A 5EBLB 1EEYA 3C5XA 4JCLA 2HKFL 4FXKC 5F8QC 1S5HB 5LDSA 2EDYA 5IZ7A 2WVVB 4Z3IA 4M8QA 1TCRB 1A6ZB 5CUSL 3KM2A 1OAKH 4HA1A 4C8XA 1JD7A 3IDMB 3U0TA 4FX5A 1HL5A 5B3JF 2ZOKB 3MRGB 2AXGB 1A6VH 1T0NB 4KKRA 4PAZA 1DSWA 3UAAA 2EIEA 2H1PH 1NZRA 4PRHE 2DI8A 4F7PA 4G5AA 5CBAA 2FQGA 4QHMA 5JXED 3WKNA 2AEQL 5L8JB 4YWGL 1DN0A 3N9GH 1L9RA 1ZLSL 2IQAA 3ZKSD 4GW1A 2BXZA 2MTAA 4TM9A 4XR8C 4OJFL 1HNYA 4U4IA 3WG7B 3MV9B 1H9DA 3ZPRA 5F88A 1N2RA 4WO4D 3CAPA 1IKFL 3MLWH 4P2QA 4X0KA 1MRDL 4YS4A 2XTJD 4ODWB 1O9ZA 5ACLA 2BSTB 5DZNA 1JBJA 1GZPB 4TQEL 5F7YC 3VFWA 5IESH 4AE0A 1KLGA 1RI8A 4TSBH 4GG8A 1Z6JT 3HR5A 2UUDK 4UT9L 1QLFA 1KGXA 1MCPL 1S9YA 1OB1B 2HJFB 3K8MA 1F18A 2E7DA 1KTDB 3JV5A 5T1DL 1I9JL 5IFHL 3MLRL 2XFXB 4NBXB 1CK0L 3WUZA 5IR1A 2I25N 4JKWA 3P0YH 3WTXA 1I8MA 2B59B 4DW2L 2J1KA 1GU8A 2C9SA 5T5FH 5IREA 3UAJC 1XHHA 4HD5A 2P5ED 5LWEA 5IG7B 1YPZE 2NY6D 2VR3A 3FU9A 2MNWA 3EHBC 3L4XA 2APXA 4M7KL 2EVJA 3O2DH 2L04A 1BRDA 2R1XA 3JV0A 4XNDA 5ID1A 3QG6A 3QQ9D 3RL2B 3B2XA 2CHWA 3BDXA 5IVZA 3N91A 3PWLB 1BAFH 1G87A 2VMEA 3KCWA 2NY4C 2AQSA 1A7QH 1C8QA 4AGMA 5I5JA 2X4TA 2EIZA 5EF3A 1KC5L 2JB6A 2H6UA 3CODA 5DJDB 2IPKB 3S88H 1BX2B 4FTDA 3P9MB 4GUCA 1A4KB 4WIQA 1NLBL 4HDIB 3A4EA 4A7GA 1ML0A 1GY1A 4N5ED 5E2JA 1RKRA 3HAEA 3HRPA 4H2CA 5FYJU 1K4DB 2DEYX 2IEPA 3KPOB 2EZ0D 2VUOA 4HQQL 2VL5B 1A0QL 2Y7SA 4O2EB 4IJ3C 1YYCA 4B9ZA 4UTAH 3RWEB 4LDCA 2HA1A 3B9AA 4Z0XB 5A2LH 5E99H 1E3FA 4HFWB 5EC2B 5FM5M 3QUMA 3FAXA 1LDPL 4L3ED 3ARBC 2I21A 1URLA 5FHBH 5JHDE 3JQOB 3CSBA 3VI4B 5AD0A 1NM4A 2P49B 4NKOA 4JZOB 4LLYA 3Q2VA 2P80D 4PJEB 5DWPA 4TLSA 4BKLB 1OGAA 3W9EA 1MHHA 4KK9C 5D70L 3A22A 3O4LE 3W57A 4L4VA 1M53A 1WFNA 1QRNB 4QXWA 5JOFB 1IAIH 4XRCA 1VGKB 4AJVA 4YC2C 4ZX5A 4XO3A 5LGYA 3DHJA 3THMH 1H6FA 3NACH 1KY7A 4KGLA 2DQIH 2PPEA 1X5FA 5I1CH 5KW9H 4X99B 4O51A 3T77B 2O61A 5K9OA 2GEQA 3BAKA 3QXVA 4U1IA 4PJIA 2CAKA 3GJFA 3LHPH 3CQQA 4WK0B 5EN2A 2XVBA 4GIAA 5KANG 3H85A 4O9HH 1LVEA 4P2OA 4CVXA 3KVPA 5KAQG 2Q20A 1TJXA 2R2HB 2G2RA 2LFEA 5SWSD 4M1GL 4KO6A 4WAFA 1KN4H 3R7RA 3GIVA 4Y1AA 5HVFB 5KVEE 3S3SA 3FK3A 3JZ7A 1PFCA 1QZ1A 1SDYA 2J72A 1UURA 2Z34A 4UIMB 2DM2A 3VI4E 4PB0L 5EEXA 4CILA 1WA2X 4N28A 3RI5K 5E9DA 3ORJA 4E9QA 1QUPA 3K7UA 3N2JA 4WVRA 2CGRH 4KKQA 1WISA 1KTRL 1UOVA 1RZPA 4MAYC 4HUNB 4XPTH 4BH8A 1J5OH 2F18A 3CNKA 3GPSA 2JMRA 5I1CL 4LARL 4PJDA 4OZGE 4XMTA 1NDGA 1W72A 1LLAA 1QPKA 3A6CL 4OLVL 5EWIH 3SQBB 1T5XA 4GRLB 3T04D 3TO4A 3WHE0 1BBJB 3ABWA 4GG8B 4DKFH 3U48A 3MV7B 1CXLA 4OLZL 4QXUL 1YEIH 1EHLH 2YXVA 4DFHA 1A4CA 2DEWX 3H4HA 2A4CA 1OSYA 2YD7A 5H2LA 3VTTA 1FSKB 1K2DA 3TO4D 4Y16B 4PJCA 5HYJA 4QI3A 4PRPB 2BZDA 2HRPL 3K8KA 2WANA 3II1A 4WWPA 5EN3A 1FZOB 6FABL 3CVIH 1A1NA 2CLZB 2EDNA 2YKLH 5BUAA 1GGCH 4NQVB 1AZUA 4HOXA 2OJ1A 3BT2H 3ULAB 2CJSA 1RZJH 1L3WA 2J57A 2BIHA 1HK6A 2WZAA 3CC5A 4ZZFA 2HH0H 4JHAH 3O0LA 5C0ND 1YCSA 1RJZB 5E2TL 2A6IA 1VZIA 4GXFA 3TS8A 3RKDD 5IV2B 4OZGB 3QYCA 4AQZA 2OZ4L 3WEOA 4H40A 5AW4B 1RUKH 2JELL 5FA4B 4JKNA 4EN3C 2DZEA 3QZWA 3RAJH 3DO3A 4PTTA 5ALCH 1MW2A 2WVVA 3F01A 5J9PB 2AAAA 3DMMD 4BUOA 4YBLB 3O2DL 3VD4A 3KEHA 1XF5B 2JTYA 3SKOA 5HHOB 3HC2A 3Q43A 1CGTA 4O58H 1JNHA 1XB3A 2WY3B 3KDMB 2X70A 3VG0L 5HI4D 4I0CC 4U6YA 4BE5A 5EO0A 4WFHE 4J8RB 3WD5L 4Z7WF 3FFDB 4IIQA 4YUEL 4HPHA 2Z8VC 4X1HA 1JZFA 3LS4H 4NFBA 4K8RH 3CMOL 1QLEL 4I3SL 2WCSA 3DX6A 1TTFA 5LBSL 3MRPB 1FFPB 1GW0A 5C2UB 3CX2A 1BV8A 2VLJB 3FU3A 3MLSH 4YE0A 3C6LA 4TNWK 5IMOA 1MY5A 4NN7B 3V0HA 1U58B 3KPLA 1DUYA 4HXAH 4JHVA 3PXLA 1U8IB 3U9PH 1PQZB 1JZ7A 3T6QC 1P1ZB 2OL3H 5A2KH 4UQDA 1CDYA 3L7EA 2YUXA 1U8JB 3RDJA 2N7BA 4AYFA 3A6BH 3EJSA 3M1OA 5DQDH 1W16A 3SPHA 3ZKNC 2YRLA 1YAIA 3DXAB 3V8CA 2ARWA 1Z0MA 1G7QA 2V5YA 1H5BB 3BQUB 4ZMVA 4WHYG 3BUYB 4XNYL 3O6LH 2Q7AA 1D6VH 1IU1A 1YQVL 5FUCC 1OSEA 4GAFB 2AMGA 4BQ8A 1KLFA 1UXLA 1F4ZA 1RZ7L 2Z6FA 1SYSB 4D94A 1T22B 4DGIH 3HUJE 1A6AB 2LGNA 3BXNA 3UC0H 4IYKA 4M02A 4FQ1H 4Q9QL 5C6TH 3OR7B 4ZW3A 1SFDA 1NLDL 5LGHL 5E6ID 2B4CL 1RZFH 3AG1B 1AQHA 3PABB 2OJEA 3ZMRA 3C60C 1EERB 1XGTA 4HYTB 1CLZL 3KPPB 4JO5A 1GS6X 3BCDA 4OFYD 4U1MB 2V7HB 3TNNB 4GBXD 5HDQH 5J4MA 1ZRUA 4YO0A 1TO5A 1OM9A 3QJTB 1ES0A 1MFAL 3RX8A 3LNEA 1AO7B 4ENEC 6TAAA 5LBSA 1YYMH 1BD2A 3ILQC 3QDME 3UERA 2BCMA 4HXBH 4KKBC 4ESKA 4CVUA 4OSUH 4HPYH 4K3EL 4DZ8A 1FFQA 5IBLD 3FSOA 2VLME 3A67L 3MXWH 4PU2A 2F53A 1S5IL 5IW6A 3SDXB 1I7ZA 1ET5A 4OT1H 5HHMD 5AZ2L 3R8BB 4EI5D 2ARJA 2JWYA 4O00A 2VXUH 3DROB 5HHVL 4FXLA 5L2KE 2VAJA 3EDDA 5SX4H 4XBEH 1JCKA 2KLSA 1QPXA 2YD0A 5IB2B 3D0AA 4KKCC 4PP2A 1JWSB 3BD4A 3W3BA 3RHWK 4NM8L 3WY1A 2HH0L 4Y19E 1ZVSA 3U9UB 4G8IB 4XNBA 4Z7OE 4FKEA 1CBJA 3AJ7A 4HF5H 5EU6B 2XCMC 3TZVD 2XJLA 5IM7B 4FP8L 4G8AC 2FEJA 4QNPF 1H3PL 3EDJA 1KIPA 3CVIL 1XGQB 3V7MA 4GG6A 4TL4A 3GK8L 4G11A 4LCCB 2A0LD 1IM9D 3BLKA 3REVA 4XXJA 4GRMB 1N59B 4AXWB 2PEDA 5IB1B 3UJIL 3E8UH 1PPIA 1XBRA 4XN4A 4GO8A 4CSZA 3OAYH 1TZGL 2F54B 4N2LA 1AJ7H 1E9OB 4EIUA 1KEML 2HVKA 3D39E 4IBYA 5CKAA 1JYWA 4AIXA 3BH8A 4KTEL 15C8H 3MUGA 1A1OA 1I7ZB 4YK4C 2QQNL 3NIGF 2EDTA 2V2WA 3W38A 2EP6A 5DLMH 1JF6A 1T6BX 3TEZA 4X7DC 5I24A 4FHKA 1FZMA 2YCWA 1SF3A 4OD2A 3BSZL 1Z9PA 4NN6C 3GLZA 5GGQH 3II3A 3LYRA 4P4RB 2X3BA 2GTZA 5HYJE 3WHXA 2V37A 1PZ5A 2WTRB 2NNCA 3WTYA 1Q9OB 1JRHI 4G9FA 1NIEA 2YUZA 2X09A 1X7QB 2PLTA 3MLSL 4HT1H 4ANUA 4PI2A 3IDUA 4IRJC 1XZ0A 5CAYB 3DVGB 5I1HH 2KSBA 1BQ5A 3WU1A 4XOBA 4FCHA 5EBGA 2YSSB 1E5UI 4U1MA 3FU8A 2JFCA 5AG8A 4IKNA 1ITCA 2CIKA 3GSVA 2L0DA 3I02A 4NKMB 3WD5H 1SJMA 2CA3A 2PN5A 2GITB 4JQIA 2MIZA 3U4EA 2NT0A 3G9VA 4NP4L 1P5UC 5DS8B 3R7QA 1ZGLP 5EBMB 4NS0A 5J06A 3LKNA 4FKHA 4MNHA 2C1OB 4K9EH 2JKNA 3KVDD 1INDL 2BFVH 3ECBA 3ETBJ 5DJXA 1HSAB 3EFOA 4XN7A 3O3BB 4K55A 1GS8A 2WZ5A 1P5VA 2FJGB 1A02N 3T4AC 1RFDH 2A6JB 2BOBA 4RAVA 4XP1L 3VD2A 4OLXL 1ZT7B 5L2JB 2HT3C 1T04B 1U4FA 1AACA 1XCQA 3PHSA 4LNRA 4W6YB 3X14A 2UZIH 4FQ1L 3FQUB 2ERJB 4JHZA 1AHKA 2MPAH 3QDJD 3VD0A 2V2TA 2XVGA 3L3DB 4BZ2L 4IKLA 3EZ8A 5C0FA 2GW5A 4DVRL 2CJ3A 3DVIA 1M2OA 3R1GL 4A38A 5D1QB 1D6VL 4AM0A 3BO8A 3R06A 3FYEB 3LRLA 4KGJA 1BVNT 5GQBA 1I4FA 1UAZA 2UX7A 4MASA 5JXAL 1L6XA 1OP4A 2EDRA 3PDDA 4LCUA 2JCWA 4L8SC 4QRRD 4BWTA 3B5GA 2EIBA 4YE4L 1B4JH 1J18A 2W94A 1U8CA 3V6OE 3TX4A 3GD1C 5GGTH 4WW2C 5EG6C 3GXDA 4UOW1 4DCQB 5ENWB 3FUJA 3VACA 3QHZL 3EFOB 3NJXA 2R15A 4N4WA 5TFSL 2CK2A 3H6AA 4IOFD 1CGXA 3L45A 2MRYA 3SEPA 4HUMB 2OTPA 3FT4B 4PIBA 4ZSOA 1KGIA 4JGMA 3VXSB 3PL6D 2H4EA 1COBA 3R18A 1MVUA 3MJ8A 1YN7A 3HA0A 2EDXA 2WNXA 1S9KC 4WSJA 1KFGA 3LN5A 4DTGH 5JW5B 3AW5A 4PGBA 4L1DA 5D7LE 4KFMA 5LKNA 1E7UA 2DLHA 1G6VK 3KR3L 3OKKB 3QG7L 4OGAD 5DQJB 3KYMA 3CMGA 1S9XB 3M7OA 3N40F 4LEOB 5I6KA 3UPRA 4M4PA 1H8LA 3NJLA 3PJNA 1CURA 4JKPL 5B6WA 2IWEA 1M7DB 1T5KA 5D6CA 4Z3TA 4G83A 5EU6A 4FLOA 1CK0H 3OX8B 3NTCL 1HEZB 1NH6A 2FR4B 4M7ZB 2VMJA 5I6XB 1FZOA 2CSPA 3NACL 2CBTA 3D09A 2V2XA 2GCYA 1PLGL 1XGUA 2OYLA 5T8IA 3SCMB 2WXGA 4UT9H 3REVB 3DUUA 1J88A 2EH8L 2DEXX 5AL0A 2CHXA 3FHEA 4JO1H 4XXDA 3MBWB 4ZS7L 2QSVA 4F8LA 4H26B 4H88L 2CLVB 3HS0C 5DRWB 1CDBA 3T0EA 5HD8D 1NGPL 1T5XB 4GRLA 4D7PA 3CFBA 3BVTA 2ZUTA 4Z7NB 2ZCHH 3QFGA 4Q9BA 2YGVA 4PV1C 4TUJA 4LHUD 4Z3GA 5CGYC 2X4OB 1BVNP 5T1KA 1N5YH 3CDCA 1XT5A 5D7SL 1ES0B 1FPTL 1YECH 4JPKL 5FM4A 3KWVA 2KDGA 2F15A 4XZUA 1CXHA 3ES6A 5DUJA 4OB5H 4PMEA 2BVQB 4I77L 1MJ8L 2OJEB 2E27H 2Y36H 3EG9A 4JFSA 1K8DA 2ENYA 2QQLH 3AM8C 1A6PA 2LU3A 4IKJA 1CVRA 5ABAA 3D08A 5ABDE 3A6CH 1RJYB 5EWIL 3TZVA 3GJEA 3QAZB 3V0VB 2Z55A 2H3KA 5KOMC 4W9HC 2C9VA 3DX2A 4Q56A 2H0FA 5EEVA 4BH7B 4B27A 3NJIA 4FG6C 1FYTB 4FJYA 1X5AA 4J6IA 4YO0B 3IDGB 4GQRA 3UX9B 4KV5E 2KBGA 4WFED 1SY6L 4R5XA 2RTTA 3CDGA 4MB4A 3U79A 2NTSP 3EDFA 1SEBA 3EOBA 3FFCD 3SPGA 1IJNA 4NQUA 3KPMA 3QA3B 1QEWA 4XWGL 4PGBB 3BUIA 3VVKA 3HZVA 4IMLA 3T0EE 4BZ1L 3DUSA 3WUWG 2HB0A 3FSAA 5T1MA 4FZEH 3K0WA 1H3GA 1QFHA 5EPMB 1Z9OA 3ZBMA 3JWNH 4C4UA 4LCCC 3ROLA 4Z95H 4BEIA 5J12B 3F7VA 4I77H 1I1RA 5GSVA 2WXLA 4LGRB 4QF1B 5I66B 2PR9A 4I0PA 1OD7A 4X98A 3ZHFA 1DVXA 4PJAB 4Y7OC 5J7CC 4MDIB 5TDPA 1S7VA 1JGLH 4LVOB 1SLUA 2PTTB 2DQEL 1U42A 2FUQA 3I84A 2NQ3A 3FUNA 1N5YL 5AB0A 4OFYA 43CAA 2I9TA 1B3IA 3P69A 1MFMA 1B90A 1R1CA 3N1MC 4S1RH 5HJGA 3EFDL 2ADJA 3SKJL 2ZP0T 3J8F7 2APVA 1L9QA 1UQSA 1J5DA 1NGPH 1VKXB 2VDLB 1I7RB 3NJVA 4HLZH 2YBRB 1WBYA 1AT9A 3QIUC 3PWPD 3LDBC 5E56A 5HYFA 2F19L 4OFIA 4FJZA 4PRAA 1MZZA 4W81A 1E4JA 2BHYA 2IBBA 3ML9A 3Q2WA 2W07B 1K72A 4Q6IA 1E65A 3RX9A 3DX7A 5FUCE 4ZFFB 5G5DA 4RCAA 1C3WA 2EXYD 2GK2A 4G5ZH 4FQLL 4JFFA 4XHQA 3S98A 3MOBH 4A2GA 5IJCC 3H2QA 3RL2A 2V2TB 1YEGL 1II4E 3RA7L 4A7SA 3SZ6A 3L3KA 1SDAB 4NKIL 1A6UH 1MG2C 3QEUA 3H9SB 5C7XL 1UYWH 3VSUA 3BKML 1KB3A 3FT9A 2BOBB 5E94B 5BJTB 4DIXA 5GS3A 5H2NA 5HDBF 1FH2A 3TN0C 4ABWA 5KYXB 1SZNA 4B3EA 3ZDXF 3D52A 4UCFA 3NCCB 4PS4H 3C5SB 4EIBA 1MCWW 5B3SB 5KVFE 1E2WA 4YDVA 1HHJA 3W37A 3T2LA 2GJ6A 3O3AA 4HS6A 1FLRL 3OKMA 1GTFA 1SM3L 5E00A 2EC8A 2FZ3A 2B2XH 3PLYA 3ZN6A 2R2EA 1MCQA 2E9WA 4S0TD 2B5IC 2ZE0A 2YBGA 4FI7A 4FMVA 2WWKO 2WUBL 2AHIA 2H41A 4GMTH 3OLIA 1CB4A 4ICWA 1MLCA 1MJ8H 2IANE 3CC5B 1CBVL 1S78D 4KAQH 5BS0D 1IM9A 2XV6B 4NYLB 1FQ9C 5DF0A 5FXCH 5IFHH 3ASOB 1S7TA 2BNUA 4WQOA 4DUVA 2I32A 3FZUC 4J3WA 2XA3A 2CLRA 3VM5A 2JQAA 4P2QB 3QXWA 4Q89A 3IKCB 1F4XL 3POHA 1R9FA 3GEWB 5K9JL 1JF1A 4KQ0A 3LV3B 3NSCA 3FN9A 1WC7A 4JFTA 4HS6B 2EDOA 3LEVL 4KY1L 4MAUL 2X72A 3ULUC 1QR1B 2QDWA 2L4OA 5E0QA 3GMMA 5DJZB 3C5SA 3NZUA 4K7FB 4H5SB 4LGSB 1T03H 4B60A 2YLKA 1QI3A 3GHEL 4KKLC 4PGDB 4KU1A 5BS0E 2F1AA 1ED3A 3Q2NA 3MJGX 3IU3B 1FFOB 3P3YA 4BUGA 4E2OA 1PAMA 2B1HH 4KXZI 4K5MA 3T45A 4AENB 3AG3B 5LXVA 4KFZC 3HB3B 2K6WA 2F8VA 2CO1A 1AFVL 4QHNA 2WLIB 5BVPH 3TGXA 3FFCE 1KIPB 1MCHA 2YPKB 1E9PA 3GRWH 1RUAL 3KPSD 1FO0L 1LO4L 4JG0H 3JTSB 1KG8A 2DTMH 1IE5A 2Y1YA 3K6NA 4TVPH 3PWUB 4RISL 3MBXH 2KQMA 4R2GD 5I0WA 5I28A 2AERT 2DI9A 4LE8A 2AZAA 2WGNB 2UWEF 2VJ0A 4Q9CA 4N2AA 1BVOA 4IARA 3BE1H 1P6AB 1CIUA 4GBXA 1H68A 3DMMA 2MHAB 2GHWB 4TMPA 4N0UE 2BCKA 3P4LA 2E4FA 1HXMA 1E4XI 1MWAA 3F8UB 4CGTA 3SDCC 2VWEE 4NI6A 5JORB 4ELKA 2HFFB 3R19A 3FW6A 3OKNA 3ME0A 2A6DB 3I75B 1GKEA 2ATPA 4WWID 2VABA 1NPJA 3N55A 5BZDA 2WJLA 4XOEA 1JPTH 4RDQG 1QFPA 4UF7C 5EDXA 1Z5LB 1SN2A 3F7VB 4XPBL 1WGVA 4LSRL 4OZGF 2HCZX 4ZMAT 1GYAA 3IJSB 2YN3A 2QQLL 3GJFK 5HHOD 1LE5A 1MUJA 2FD6L 2DQDH 4N2KA 5EPMA 4UZUA 5JXEC 2YZ8A 3MNVB 4K5OA 4F5CE 2I60H 3UTXA 1EXUB 3MUZ1 3TN0D 1FIEA 2YOCA 4UTBA 2BNQE 1KBBA 4Z7VE 4P5KB 2BP3A 2D4DA 4JO4L 1BWWA 4P9ML 3AT9A 5C70A 3U1SH 3BT0A 1XIOA 1L0QA 3IJHB 2EE3A 4TUKH 4MJIB 1JERA 4RRPM 3ELQA 4ZUTB 2R23A 4NAJA 1ZHBB 5CD3B 1RZKL 4I0PD 1LEKB 3F7QA 1B3JA 4YHLL 2BW5A 1EO7A 2GJRA 2V9RA 5EOCL 1GOGA 1B9KA 3GSWB 4MA1B 4AMXA 1Z3GL 4Z7WB 1SQ2N 4HDIA 3WFDH 4W4NA 1B4LA 3BPOC 3QAZC 1Z7JA 4L4VD 5DO8A 2XN1A 5E6IC 5HDWA 2JXMA 4YN3A 5EU6E 3VXRD 3HFMH 3NFNA 2TSAA 2BWDA 4JG1L 5AFAA 2AABL 3IS1X 2J6EA 1JK9A 1FJ1A 1MHPL 4JLRB 2IG2H 4PS8A 4PJ7B 4Y5XC 3L4YA 1P6WA 5T1KB 2BY0A 1THCA 5DDHA 5IJVB 4OBSA 1JE6A 4Q14A 3L17A 3P0VH 4PV9A 4V1DA 3UTQB 2H45A 4HEPG 5EF0A 2BP5M 3D2UA 2G9HB 3ZE1B 4HUXB 1D3CA 1U21A 1UUSA 4XN2A 5GISH 4X6CB 2XICA 3QPKA 5JXEA 2BSBA 5KBDA 4OLEA 1P84J 5J6HA 2ED7A 1NGWB 3CUPB 4OZFG 5HPMB 5CZXD 4CAGA 2OS7A 1I8KA 4RMBA 1WCQA 4JRXA 1UWEH 1X5ZA 2H9GA 4MD4A 4OH2A 1S3KH 3B1TA 1Q38A 5H35A 1PG7X 2PXYA 4DQOH 3D33A 5I16A 1CL7I 2O6FA 2XFXA 4EXPX 5G4NA 4MVBD 3UDWA 4UOJA 2E9IA 5F9JA 5ICXA 1QQDA 2FX9L 2F6AA 1BIIB 4IEFB 3UJTH 4B0MM 3HC3H 1C8PA 2FR4A 4U0RB 1EMTH 3KBHE 1SQMA 2NZ9D 4LHUA 2ZSWA 5GJSH 1DQJB 5ETZA 1IFRA 4JY5H 3OLGA 1HAUA 2E9GA 2XXMB 2YC1A 3NJNA 3MNDA 5TD4A 4AK2A 5T5FA 3B2UD 15C8L 5EO1A 4A66A 4QAMB 3NSFA 1NC2A 3WCYA 2LQRA 2BW4A 1SN5A 3MRQB 4ZOEA 1PD6A 3HW7A 4IS6A 4ABVA 1F2QA 1ORQA 3QEQD 2N7AA 4JFDA 4QTIH 2XN0A 3P4NB 2PWEA 1A14L 5J6SA 1LO0H 1MOEA 3AUVA 1R5IA 2NW2B 2NY6B 2VKWA 5CINH 5F70A 2UXFA 5J56B 3KPSA 1KSRA 1LN6A 4S1SH 5EU7C 4U3HA 1DBJH 1IKNA 1DVFC 3IGAB 1DSFL 4LSSL 3PCYA 5AX0A 4MVBC 3PG2A 3O2VH 2W0FB 3V6OC 5I16B 4PJDF 3NJJA 1WFUA 3MGOB 3LEXA 3SPVA 5GZOA 4L8DA 4B96A 4YHIA 1EAOA 3KYKH 3UBXA 1E3XA 4QR7A 3L4WA 1X5IA 3N1GC 1NCCL 2PYFB 2XRAL 4Z5RB 2YAPA 1SVBA 2IGFH 2YK1L 4IRZA 1WITA 1UJ3C 3WFEL 5HI5D 1ASPA 1LK3L 3HZMA 1EGJH 3KYOA 4ZSOE 1ONQA 4Q2ZB 4L8CB 3NJMA 3U1PA 2R51A 4DO5A 2UZPA 4FI8A 4ZPVA 3IAGC 2IFGA 1MHCB 3QNFA 2CO7A 4W68A 1J8HD 2XUWA 4F37K 3EO0A 1G4RA 2IDSA 3MHZA 2A2QT 3BUPA 3OVUB 4M9OA 2J88H 1UZGA 3G5ZB 1DQQA 1E5YA 3Q3GA 3QORB 4AEHH 3OB0H 5GS2H 1YNKH 4WSKA 2O5XL 1WZ1H 5E5MB 1JPSH 1KXQE 2GSGA 1C8RA 3GKWH 5FUOH 3CZGA 4LPVA 4KH9A 5F7NC 5G2DA 2B4CH 3VD1A 1XGPB 1SNRA 3VTMA 4JGNA 5IQLA 3ETTA 4KMTL 3BPNB 3PXHA 4MNHB 1WZKA 1OP3H 1NFDF 3EO9L 4HBQA 1ZVNA 5EZOH 5GGTL 4DQOL 1ORSB 4WKXA 3CFMA 3FO2A 2BRDA 4NUGL 1HH9B 1NIFA 4MTMA 4DPAX 4RA3A 3MODH 4RZKA 1WAAE 1U36A 4DZBB 2OKMA 1KYAA 3MMEA 4DUXA 4XBPB 3MZTA 1T0MB 1W6LA 2ZNWA 1Q9WB 3O9WA 4QRPB 4N86A 5LAXB 4X83A 5GISL 1I82A 3WLWC 1X7SA 3A6BL 5DQDL 1N3NB 3CZNA 3FOLB 3IGKA 2G5BA 1MCCA 4PJGB 1D5RA 1UD2A 3QHTC 2B5IB 1U8MA 3TJHD 5JNYB 1NINA 4WY7L 3TNMA 1BCIA 1GH7A 4NDMB 4XOAA 1M7UA 1LILA 1T80A 2ATPB 1VIWA 1OCZB 3VXMA 1VA9A 1JPSL 2A6DA 3GKWL 5FUOL 1YNLL 5C9JB 2M2DA 4YBHA 3C6SA 5L6YL 4OGXL 4BV0A 1J1OH 5JPNC 4UV4H 4NZ8A 4R6UA 2XZZA 4MBSA 3B9VA 5KSBB 5FYLE 1O5DT 2OMTB 2ZZLA 3EYQD 4X6BA 5SV3A 3VRLE 1FL5A 3QJUB 4NC1C 3RJQB 4EPSA 4M93C 3V6BR 4NQCD 3CDGB 4U1NA 4G9FD 4HHAA 3VG0H 1DZ0A 3ARBD 2XIDA 4KKAC 4LCCA 3U7YL 3FMGH 1ZS8B 1JUFB 4KXZH 2K3TA 2Z35B 3UTSE 3CZKA 2YD1A 3T1WA 1MRFH 1G7MA 1HZXA 4GIOA 4WTQA 2NYZA 5CIPB 4A7UA 2ZG2A 3OG4B 3F7YA 2PKDA 1D6EB 1SY6H 1C5CL 1TQTA 2WSPA 2AABH 3ECWA 1GY2A 4K7PX 4GI9A 1SYVB 3OKOA 2ZX9A 3I85A 5DRXA 4YQXL 2ICWA 5I1LA 1CLZH 3U36A 4F33A 1YMME 4ZW8A 3ES6B 1DQTA 5HGHA 2R4SH 4L4TE 3FTWA 5IR1B 4ZUWB 3TBTB 2NLJB 1KFAL 3ULUD 5E5UB 1N7ML 4ODHH 3WY3A 5BOPA 3CFCH 3H2PA 5BO0D 5FKAA 1S8DA 4OD1L 1A14H 4Y19A 5F7EL 1TPXB 2TAAA 1IQDA 5ELIA 5F1OB 3OAXA 5KVDH 4CU7A 3QUZC 5AW3B 5I0XA 3NAAH 1CFTB 2XX1A 1IM9B 2DM3A 2AKRA 1DSYA 1M2VA 3I6KA 4S1QH 5DUMH 1EFQA 3ETSA 3MBWA 4ISVA 1M0MA 5EUOE 4PJFA 1JZHA 5FA3A 3FSVA 3SGEH 4YHYB 3SBPA 3EOAA 3VDAA 3EGDB 1C5DA 1KXTB 4MJJA 3OXRA 4GRLC 4YSTA 1OTTD 5LO7A 5B8CB 3T0EC 4NZUH 1R75A 5IVXB 5AYUL 1XMEB 2NRDA 3UYPA 1BQUA 1B9ZA 3EYQC 5AW8B 4XMKL 4Q6YA 1TZIB 3D4GA 2GK0B 3DX0A 3F5WB 4JM0A 1DVQA 1WZLA 2EEBA 4XE5B 3IFLH 3X3GL 1T89A 4LVNC 2LVEA 1BGXH 5ERWA 4KQ4L 4MQ7B 4WKZB 4HH9A 3V4VA 4L35A 4BWUA 4KQ3L 1CWQA 5DT1H 1F45A 3OE6A 1UH3A 3IF1B 3VXSE 3NCYS 1FIGH 1P6FA 3L2LA 3UBHA 4MJ6B 3PQYE 2B1AH 3NPSB 4YPGB 2ILLA 5ADOH 5HDBE 1BEYL 4N8CL 4OJEH 5ICZA 5FYKE 3K71B 3US9A 1G7JA 3LD8B 5EZPA 5D7IB 2GBVA 1Q5IA 3II2A 3RPBA 5I1DB 4HUVA 1C7TA 5CNHA 4OR1A 4N20A 3OE8A 1DYZA 2ESVB 2KLTA 2VLJA 3W2DH 4PYHA 4OCXH 2BNRE 3O41B 4TULH 2X10A 1SN0A 4LLVB 1EEZB 2F5AL 2ZG1A 3B6SB 3AXLB 2VMFA 1AHWB 5CZVH 1MCBA 4QOKB 1O6SB 2PPCA 2I9LB 3SJVE 3HNVL 2CUMA 5C0BA 3K81A 5G4MA 5B38B 4KJWC 4BDVB 3TEUA 3B7SA 2JJUA 1U8PA 4PWFA 3AROA 3RX7A 4IM8A 1U19A 3QRBA 2FBOJ 3QCTL 4YXLL 4QF1A 5D1QD 1J5CA 2X1WL 1PKOA 3AS3A 1T2QH 4F8PA 2HT2D 3LNIA 4PGCA 4ODVL 3T6ZA 1CN4A 3PDOA 5HDBB 4X4ME 25C8H 4WW2A 4DJMA 5B2NA 5FW8A 1EEUA 2APWA 1J05B 1E5ZA 3O6FA 5H2PA 5JHLL 3CFCL 5DHYA 4LOUC 3T3PB 4ILDA 1ROCA 4L23A 5DZ9A 1UH2A 5C0AE 3RNKB 4G8FA 1NAMA 1QD0A 4Z3JA 2YQGA 4NKQB 1TR7A 3IDGA 4PGJA 2BNRB 3TT1L 1BEXA 4LKXA 2XV0A 3I9AA 1U8HB 2O6PA 1AI1L 1UM6L 3BPOB 4YH6A 5HHPB 2C4FU 1DQDH 1A7QL 1NGZA 1TEGA 4RFEB 4IRSA 3B8YA 2X6BA 1YPZB 4F8TA 1FWXA 3HE6D 1CC3A 3WFHB 3AQDA 3QJFB 1CT8A 3E8VA 2YRZA 4FEMA 3Q13A 1MRFL 3OXRB 2BSRA 4MBRA 1JGEA 4HWLA 1BZOA 1JXJA 4OGQC 1OAQL 3APMA 3O81A 4X6FA 4PJ8D 1G7HB 1IBFA 2OFQA 1KB5A 1F5WA 2DDQL 4WK4B 4FG6D 1IT9L 3QXDB 2I20A 1XR9B 3F65A 3MLRH 4OV6F 2BNRD 2FSEA 3CZFB 1PZ5B 3TJPA 1FO0H 2YEZA 4JNXA 3GSNB 4ZMOA 2YAMA 3I2CH 4N2DA 2OMZA 2B9BA 4JQVA 3B2UC 4KVCH 3D69B 5DFVD 1UASA 1USQA 3GDCA 3HHSA 4F2MA 3B7RL 1J48A 4IRJA 2NZIA 3W81A 3ILPB 4FZEL 1N0LA 3CH1B 4D9QD 3L9YA 1ESOA 5FYKU 3QHFH 3WXVL 2DQFB 5I74B 3CXDH 3FO0H 3S4SG 1CO1A 3SYPA 4ODXA 5JW4R 4BEZA 5EC1B 1OGTA 1YN6A 2Y22A 3M7FB 4UMGA 1K3IA 4PJAE 1P4LA 3C09C 5KSUB 1N59A 4FZ8H 4AXWA 3KWUA 4YWGH 4GXUM 4HYJA 4HIEB 5B1JC 1D6EA 3IDNB 1HHIB 1RIHL 4R0LA 4GKNB 5I8CA 2NUPA 2R8SL 2VDML 1N64H 3T0VA 3VFUB 1A2YA 3IAPA 1YMMA 5AYUH 3CLFL 4P2OB 4CVXB 2J8UA 3MROA 5I5MA 3D9AH 5DQJA 3QQ3A 4FABH 1MQ8A 4GAYA 1MWAH 1R5VA 2WNGA 1MJ7H 4Y16C 1ULVA 4D9LH 2V9UA 3WFBH 4LSTL 1YEHH 2BVEA 2Z73A 2H3NB 4GW4B 4WI3A 1OCRB 2J4YA 5F6IB 1NKGA 1ZANL 5D7SH 5IJDC 4YPJA 3RUGB 2OZNA 2FCBA 3LXAA 1YC7A 3DPBA 1W0WA 1JZ8A 1KPUB 2KT6A 2V4LA 4RWYL 2UY6A 1ZTMA 4ZXBC 2R9HC 3E9TA 3VW3H 4FD0A 4NDMA 4OGAC 4PV8A 5F0JB 1P8HA 3EHBD 1KN2L 1MW3A 5EC2A 2PWGA 1HDMA 3FF7A 1JXKA 2ERJC 3IM1A 5IVOA 1KG9A 3UMNA 1YMMD 3HAPA 2G87A 3MOAH 1TJIH 1NCWL 4OM0L 4OVUA 3DVNA 5H4ZA 1N12A 2WNWA 3F2LA 3VXRA 1JV6A 3MV11 1TMCB 1P9MA 1HINL 3BUQA 2CWRA 5AVWB 5DMGD 4FG0A 4W9ZA 4AV5A 3O11A 2GSMB 1I1FA 1XEUA 3MQIA 2P5WD 1FZKA 4P59L 4DGVH 5HDOA 3KNBB 5B1KA 1FG9C 3I74A 5LNDA 3QR2A 1VACB 5DVPA 4A37A 2D31A 3EJJX 1FV1B 3V5DA 4MNGA 1IL1A 1JK8B 4U1GC 2P5PA 1GVIA 4N2EA 1MNNA 4NN5C 5INCA 1KYDA 1NCOA 3AFLA 4XE0A 3V5KB 5EZLB 3F58L 2Z1PA 5JOEA 2P8MA 3NVQA 5D6DC 1Z5YD 1E4XH 3Q2CA 1N6QH 4UILH 4R97C 5TE6L 2G3MA 3BUBA 3GFUA 2VR4A 3C5ZC 1LP9A 1WZMA 4Y19B 1RZKH 1BJ1J 5CHNA 1WWWX 5E24E 4LP4A 2QSCH 3FQRA 1RL1A 1E4WL 2XWTA 1PLGH 2ICCA 3LN9A 3MNWA 2WLHA 5HHQB 2IANA 1W72H 4UAOB 1FL3B 2FSDA 5DEZA 3AWGA 2A38A 2VN5A 2VZVA 4YNYB 3U4EB 1JGVH 2NR6C 1OY3B 3KAAA 2MEJB 4NCDA 5DRNB 5CLZA 2HRGA 2OXGA 3VE0A 5HI3C 3MODL 2IPUK 1C16B 1ZA6A 1LO5A 5FDWB 1JGDB 1BMWA 2COVD 3ZDZE 2O1AA 3HI6H 4Y5XB 5HHNA 4Z5RA 2A74A 2JNZA 2VUKA 3MA7B 4YZWA 5JLZA 1I9RL 5L4IA 5MEND 4OZIB 4XBGB 1W15A 1WBXA 3WKMH 3HMXH 2EKSA 2W60B 3ZDXB 1N19A 1RZQA 25C8L 2X70B 3IPEA 4ODTH 3IVKB 1ACCA 3QNXB 5FOBA 3V55A 1F56A 3S35L 2HTLC 2UZXB 2RA1A 4ETQB 4DAGL 5JJJA 4ZQKB 3IJEA 1P2CA 2ENPA 1OAJA 2FGZA 5CS7A 5IF0B 4QRQA 4Z76A 1JRHL 3OHXC 1MW1A 5KSBA 5EFIA 1XAUA 5GS2D 3WLBA 5C1MA 3SBWC 1KCUL 3L1GA 4WNSA 1ZHKA 4DKEH 4WU7B 1KCVH 3ZZ1A 4I9WD 2DMCA 5ILTH 4KNQA 2F93A 1ZE3H 3TCTA 4B9PA 2OL3B 2XZCH 4Z6AT 3FCUB 1RMFL 2FB4L 4TYUA 3VGDA 3VGFA 1ECZA 4WEMB 2WB7A 4J3VA 1CLYH 2JH2A 2NYYC 4GI6A 1JNNH 1U8MB 2BLFA 3N1PC 4GAGH 2A9NL 2BS71 2LLGA 3Q44A 2EEXA 3IXTA 4BZ2A 3HE7A 3V95A 4R5TA 1Q9WA 5D1ZB 2Y2WA 2NXZC 4UQIM 3T0BA 3GXPA 4JRFA 4ZO6A 5C6TL 3BRGC 4Q9QH 4NENB 2Q76A 3ZYJA 1BA9A 1B0RA 1A5FL 1Q72L 4MSWA 1KBGH 1WPCA 2FVNA 3Q6FA 4N9GA 5JIQA 5CSBA 2VLKA 4UQ3A 4MX7A 4ZOBA 3DHPA 3DX4A 3FF8A 2FUTA 4LCYA 5C0JB 5KEZA 2NW3B 3NK3A 4G1MA 2ZOLB 3NPZB 1J1XH 2WMPA 1JWMB 4YAQA 3MV7A 2HLFC 3ROOB 4NUJA 3T1FB 1HX0A 3PV7A 4AQ8C 2ZQKA 3HNTL 2Q2LA 1KTCA 4PCYA 1SLVA 1I31A 2XJKA 3OSKA 3S3PA 3V9EA 4F5CA 5IB3B 4PJHE 2WBJC 4K9EC 4ZUSA 4CBZA 1CBVH 3QZMA 4G7YH 1IGCL 5BUPA 1NC4B 3X12B 2VQ1A 2Z31D 4RGNC 3BOVA 3RY6A 1MELA 2R1YA 3BEWA 2JQMA 3FSWA 4FKKA 2BRRH 4AJWA 1J9QA 3ASNB 3BFWA 4LARH 3SQOL 3PGDB 3KYOB 3QIUD 4ODSL 4EDXA 2IDCA 3QQDA 4AM0Q 5I1IL 2EYTB 2H0EA 1KGCE 3GXNA 4NUJB 4L3EE 3S35X 5GS0L 4X6DE 1Q8MA 5TE6H 2R2HA 5KUKA 3M07A 4NNXA 2LABA 4PRID 2ZOLA 2VDPL 4MZRA 1RZ8A 4YIQB 3QBLA 2YQ3A 1ERNA 2R2CA 2YQBA 3I3DA 1CD8A 2VLKB 1DO5A 4WTZA 4ONGL 5HYQB 3KJ4C 3O8XA 3AU1B 1EXUA 2BDNL 2D9CA 3OTTA 1DQKA 2VDQL 3QHFL 4RESB 4HG4J 4LCWD 5CZRA 2J1XA 4E5XB 5JOFA 3VWJC 5D7KD 2DWYA 3KPLB 4JHAL 1G7LA 4P2CG 1G7IB 1GA2A 2B16A 5ANMA 4BUHA 3MCKB 3SGEI 2NZ1A 1ET8A 4M5SA 2LAAA 3OF6D 2NPLX 2CKBB 4AZUA 1IM3A 1IGTA 3BW9B 3GMRA 4BBWA 2PPAA 3G6JA 2HFFA 1KYFA 5JPMA 4G43B 1NUDA 2A9DA 4BFRA 3ULVH 5SX5K 2YRBA 5IOPA 1XL4A 4G42B 4MZ3A 1MAMH 4N0FB 4NUQA 3GS0A 3QUMH 4YFEA 4ZOCA 2ZSWB 3PQYA 4O02A 4ONFH 3BVDB 5FHBL 4UT7H 4LEXH 1GJWA 1U3HA 4QRQB 3ARBA 3QDGD 4NZFA 4Z7NE 1BX2A 1IV8A 1NDTA 3VI3E 2KS0A 2NY3C 2UZXA 3V0WL 2K70A 2ZYSA 3SOTA 2R2BB 4TF4A 1GCFA 3HAOA 1IC5L 2D03L 4K3EH 1P1VA 1C12B 1DJGA 3MJ9H 4NO0D 1SRDA 4QT5B 2EDJA 3CGTA 1M56B 4L5FE 3RBGA 5K59E 3HLAB 3KYNB 5IV2A 2WQVA 3ARDC 3SPIA 1ZDQA 1VGEL 3EYUH 4JN1H 2X4RB 2V8LA 4ERSL 4F15B 4YDMA 5IVXE 2Y6TE 3T0WA 1OP9A 1DQLH 3PXOA 2FBJL 3QJOA 3QNZB 4PJCE 2XT1B 3RVTD 3UTQA 4APQD 4B3VA 1YVLA 2NXYB 3AG4B 3BWUF 3H2WA 3QDMA 3QEGH 4PY8I 4KTGA 3ZXAC 3QJRB 4WTWA 3VQLA 3ZOAA 2LFGA 3ODUA 1HL9A 1RUPL 2FO1A 5T3ZL 2DM7A 2NTWA 2LTQC 2ZX8A 4X5QA 5LQBH 2CXGA 1MCOH 5ESVA 3QWRA 1AOHA 1WT5C 3JWOH 3I9IA 4LF3A 4BK8A 1KGYE 3UAJA 3K4AA 1UWYA 3BHBA 2H5UA 3VNYA 2CLRB 5ICYA 1RZ7H 2O5NA 5EZIL 1JWUB 3KG5A 1BYPA 4I3RL 4YBQD 2EICA 5KVFL 4F2FA 4NWUL 2DQHH 4HC1L 3Q1EA 4NNXB 1MJJB 3WJLC 3RY6C 1I1AA 3QEQB 2O5ZL 2QQKH 4OCXL 5E8OB 2WBJA 1WO2A 3Q8AA 3BGMB 3EW3B 2H32A 4JR9L 1T20A 3BP4B 3LMJL 4JHUA 4TSBL 2PCFA 2XDHA 2G75A 1W2KT 3NP3A 1QSZA 1WZAA 4D8PB 4NQEB 3AGVA 5EZJA 4HWBL 1ZEAL 2IOMA 4UYPA 2R0ZH 2EH8H 5KYWA 2J7LA 1QSED 4PN6A 4QRTA 1TTRA 4HYXA 3KLAB 5BVPL 4K2UL 4P5TD 4W70A 1XF2A 2AW2A 4R7DA 2DLIA 4MNQB 1KCRL 1OWWA 1NSNH 4LU5L 3JWOC 3ESPA 4JFED 4GFTB 2HG5A 3HIZA 5AVYB 4NC3A 4N87A 4OLUH 3L3KB 5DTFA 2BERA 4IOFC 2IH3A 4U1GB 4XNAA 3U0TB 4NUMA 1HXYA 3EJPA 4ZODA 2UY6B 2C9UA 1NBYB 4UBDC 4ELKB 4NHUA 2VLRE 2RFXB 3UTTD 4NRZB 5CCJA 1BLNA 2X1PA 3DURA 4NO5B 4Y0GA 2XKUA 3EF4A 4PTUB 1NGXA 4YBQC 3WFCL 3WIHL 5CINL 4AI7A 2H1XA 1RZGA 1PVHA 3IFPA 2QPEB 2NTUA 1A25A 2V9QA 3LRHA 4UI2A 5D9SB 5JTWA 4GW4A 5C0AB 2JKRM 3EKCA 1W8NA 2O61B 1E27B 2E7CA 3SKMB 4V2BA 3MX0A 3TCLB 2YBRA 4CN1A 1P4IL 5ALCL 4TRPH 2ZXGA 1EDQA 3QH3B 2CR0A 1K8IA 2KZBA 2FE0A 2OX5B 1EDYA 2E76C 1NBVH 2W0KA 3QCTH 5I6PA 3ZHNA 3L7FB 3SBWA 3VGAA 3DSNB 5PAZA 4FQXB 5JQ6L 3FUDA 1D9KC 4GKNA 5DFVC 2B0SH 3HMWL 4QRRA 1F4YL 1UKTA 4QHNB 2D0FA 4K71C 2ZKYA 1B6UA 43C9A 3FT1A 4JZJA 1Z5HA 2ZD0A 2QPSA 2BWIA 4K94H 1MJUL 3K1KC 2X53A 2WO2B 2DIJA 3BWAB 3GHBH 1SJHA 1NFIA 1MW0A 3KLQA 4WFHD 5KSVA 1E8WA 4AE1A 5EC1A 3KPOA 4O2CA 5ISZD 4QRTB 3WDHA 3DO7A 1QR1A 5A16B 5D4IA 4K71B 3EJTA 3QORD 2VSKB 3RG1C 1ZD6A 2BVPB 3FONB 5I0VA 5EOTA 5FUZH 2DMGA 4NJ9H 4PRPE 2X4UB 1WV7T 3TFBA 3TTYA 5JQHC 3ARXA 4AVHA 5D93B 4CMHC 4M56A 1NCAL 1OL0A 3ZQ9A 1A3RL 2JIXD 3D85A 4PJ5B 1U93A 3TM6A 1GS7A 3N0PB 3EBHA 1DFBH 4FMKA 3K74B 3C2AL 2ID5A 4K3JL 1K5NA 5CZVL 1JYNA 4G6AC 1NANH 3MLTB 3FH7A 3GMQA 2R2EB 1N64L 3AM6A 2IPTH 1U95A 3NJGA 1D7FA 3GLEA 4XMKH 2WP3O 4HWBH 5CIPH 5D6DA 5AAWC 5GS1B 1DDHA 4Z7IA 1Q1JL 1SJXA 3HPLA 3LXCA 4ZG1A 5I1KL 4AYMC 3QDGA 5EULV 4EN2A 1G1KA 2WTPA 1FHNA 2H8PB 1HIML 1QBML 2NX5B 4TSAL 5BXFA 4M3HA 1NPUA 1IC4H 1BXVA 4HOZA 4JREB 5ICUA 2WHVA 3CPLB 3IMTA 5HHOE 2DYPA 3KVQA 2C7UB 3O4OB 5E7FA 5FHAL 3UO1H 3EYFA 4PW3A 1XF4B 4IU2A 5DC9B 3T0EB 3DC0A 3MACL 1BZ9A 4N2IA 1N67A 2WQUA 4KZCA 4N0UB 4P5MA 1KLGB 3ZL4L 2XTSA 1YLBB 4L4TA 2IJ0C 1IM3D 1LO2L 1NFDB 2BHFA 2EACA 5E2TH 3X13A 5D7IE 1M0LA 4RMWA 1QTSA 5D1XB 3QVAA 4MZIA 4JFPA 1UENA 2XQ0A 5IUCA 3BT2L 2R2BA 1X0SA 5C09D 2VISA 4AQEB 3CLEL 5CFAA 3MO1A 2WXKA 1NEZA 1FVDA 3D30A 4H8UA 4N8VG 2HN7A 1OOAA 3O0RH 4PLOB 4YVUA 1Q0YL 1VEOA 4HUKB 5CCKL 2WYHA 2MMXA 4IBVA 1AZVA 2G4EA 2FQEA 3K6OA 5D1XC 3PWJA 5CEZH 2R69A 5B39G 3CZSA 4UOW0 5ITEA 4IK6A 1FPTH 4JPKH 4WDIB 3N42F 2NY1B 1IM3B 1IGTB 5JW4Q 4P48A 2C4XA 3NFSL 4ZFOB 1UWGL 4GKZA 2ESVA 3LB6D 4M1DL 5JW4M 5K69A 4FP8H 3QIBC 4UUJA 2D2CC 4HC1A 3SPCA 4TL3A 2GFBA 5CLYA 1S9WA 2QGDA 4OLUL 4P3CL 5BZZA 5AZUA 1NWOA 4MD0A 3ZO9A 4WJG3 3HZVB 5CP3H 3SBRA 2JI3A 4XO8A 2NSXA 2QJDA 4ZFOA 5I8OL 4YDLB 1OK0A 3I9PA 4GY4A 4UB0H 5H2IA 4S2SA 4U1LA 5I73B 1M1XB 4F57L 4AL8C 1S5IH 1E0PA 4AGQA 4U6VH 2E56A 1JV5B 4QO1A 3TEWA 3PWJB 3FO9B 5AKSA 3FRPB 1BJ8A 2Z4TA 1D5XA 2R0ZL 3UZQB 3K6SB 4MD5B 1RVFL 3HHRB 4K94C 1W6WA 2CD0A 3OPZL 4BA0A 4X5XA 4JQVC 1YJDH 4LKCA 5FYJE 5K9JH 3EG9B 1KYOK 4KMQA 3MV7E 3DJ9A 4OD3H 1IBHA 3DX8A 5HJDA 5C0CD 5BW7A 1D5ZA 5ITBL 4KOCA 4Y4HB 1J9SA 4O02L 1UJ3B 3FHQA 4GXVH 1NIBA 4LOFA 1FVCA 3D3VD 4MB5A 1J1OL 3D05A 3JVFC 4HWEL 4P5SA 4DK3A 2FWLB 2DWDA 2Y7LA 3DGDA 5IROA 1A4AA 4HZAA 2AK4A 3MBEB 3JV6B 3MLUH 3W39A 4NFCA 5DVLA 4N0YH 4DHLA 1PLBA 5E8DH 4JHBA 2OK0L 3N40P 1SF5A 4X9IA 3KW8A 2OMUB 5LQBL 4XXDB 1MH5A 5C0CE 4EQ3A 5DT1L 5BRZD 3OKEB 3OZLA 3GUTB 1X9RA 3LKQA 3QXUA 1AC6A 1CDJA 1LNUA 1U95B 4LAQH 4MX7B 2P5EE 4XP5L 1DBMH 1WAAF 2GCYB 3BD3A 3I02B 4BSVB 1BMGA 3L9RA 3B8SA 3WKML 2OR7A 1Y6KR 4X31A 3ULUL 3VQMA 3VSQA 4IRSB 2Q8AL 2QZQA 5JR1L 1FNEA 1LWJA 1OALA 3FB6A 1OT1A 3DRQB 3KHQA 3MBED 2R69L 1YDPA 2W59A 2X38A 1R6VA 3VDCA 1H8SA 4M8RA 1E5CA 3L81A 2OW6A 1E8YA 5F3FA 3P0VL 3TPKA 4XX1E 4P3DA 3QQXA 1YZZA 4P3DB 5FIEA 5GGVL 2DF3A 2F8OA 3V4VH 4NKDA 3DV4A 2YMOA 4L5FH 3GT6A 2LLNA 5F21B 4ZAKC 5KKHA 2BVPA 4JZJC 4PQXA 2X6MA 1FL5B 3WS6A 3AG2B 4OM1L 3FB6B 1KJVA 3TWCL 1A1OB 4XVSL 4OSUL 1LD9A 4ETYA 35C8L 4KI5D 5K5YA 5J1SC 4O2CB 3MA9L 4IRZL 3TT3L 4OLWH 2H32H 4FHJA 1TEFA 2K3HA 1I1YB 3LRSB 4QTHB 4AKQA 4PIRF 1ZHLB 4WJ5A 1QVOB 3GRWA 3KHOA 5CMAB 3FUMA 2IH9A 1NAML 2R4SL 2AQ2A 3QNXA 2QR0A 1ETA1 5MEOA 3LDBB 4LIQL 2H3XC 2XV2A 2G5BB 5JQIB 1ACYL 4I1RA 1WIUA 3KXFB 4PB9H 3ZUCA 5IM7A 3AY2A 1CR9H 4XAKE 4Z8FH 2XWEA 1R24A 3DXAE 3BKYL 3V5HB 4WAVA 4M93B 1RZIA 1KCKA 2DQJH 3L9RB 4RRPA 1A6TA 1H3XA 5F1NA 5GZND 5HYJD 1AGEA 1R3KB 1CF1A 3VI4F 1TITA 3BSZH 2J8UE 3L8QA 3D51A 1IEBA 2YGPA 5IP4A 3VH8A 4HUVB 3IFOB 1NGXB 3TTSA 2R7EA 5CEYB 5HHQA 3JWDH 4LPXA 2XWTB 4LXFA 1VESA 4XT1C 3ULSA 2HT4C 4ONOA 4AIZB 1C5BH 1D2PA 4FC3E 2KZKA 4ATTA 3D0VA 2OTWA 3GZPA 2I5YH 3L9BA 4WWNA 3WDIA 1BD2B 3DETC 3IYLW 5T1LD 5KBPA 3HZ3A 5L6YH 3FO9A 4R7DB 4BFGA 3V4VB 4QXUH 5D7IF 4NZRL 5BRZA 2W9DH 5ETUB 3R0MA 3SDAD 4WI2A 3F7LA 2VXSL 3WN5A 3S8WA 4M3JA 1Z66A 3IPFA 4PVNA 5EEZA 2HKFH 2VZUA 1PFOA 4NSKB 4FABL 2G75B 1MVFA 5DEJA 4DS7E 5DJCA 1CGSL 4RMSA 4KPHL 3QUZA 1S4IA 1XSOA 2WPGA 3OR7A 4MD5A 2ZWLT 5FFLA 2GBUA 5MEQA 3ZKXB 2WUCH 1OO2A 1SXSA 1IGFL 2QLVB 4CSPA 2ITDA 4R26H 5DUPL 1L6PA 4R4NC 4UTBH 4YHYC 4P46A 5IJKC 1I7UA 3UJJH 4DP4X 3EBAA 3AB0B 4XOCA 3SDYH 4YSQA 2J8UF 1U8LA 2Y5TB 3P11L 1PZSA 2BNQA 2JKIS 3BKYH 4Z7VA 3BUYA 4XMPL 3VXQB 1VDGA 1KF9B 2Y07H 3QUXA 1GC1H 3STZA 2YDVA 2W0FA 3H54A 3QT2A 3VI3B 4NIYE 3LZNA 5B4MD 5AAPA 4CVZB 1HYSC 4YDNA 1BLIA 2BSCA 5F7AA 2V9TA 3ARDA 3ARRA 3SY0B 3QFJB 2Y7QB 5JMRA 1WF5A 2XVKA 1WICA 4F58H 2CDEB 2WJ7A 4MA1C 1ZSDA 1FNSH 2WLYA 4L0PB 3HNSL 1DHKA 3P4NA 3IBEA 1GMEA 1ORQB 3GMNA 1BW8A 4JFDB 3FCSB 4PLJC 1OP5H 5GS1C 2W0LA 3PPEA 3MRPA 3VO0A 3X1EA 2XG5B 3THML 3WENA 1F3RB 1TSHA 1GGCL 3D4ZA 4AOFA 3GRGA 1R24B 3GQFA 1PCSA 1NLDH 1XGQA 1TENA 5KANI 3L3OC 3QZOA 3AWEA 4L4TB 3OHXB 1VFOA 3UGUA 3TO2B 2C1PB 1KXHA 3W9DB 4MD1A 4E41D 4QRYA 1NCGA 1SXAA 2F95A 4JM2D 5IB5B 1WA1X 4F7EB 2VAAA 1IBDA 3GSOA 1IVLA 3I3BA 2R69H 2CBMA 3MYJA 4XPHL 1E6JL 1SGKA 1QACA 3WI9A 1YN6B 3TC9A 3LHAA 4DT2A 1G0DA 3UO8B 3LPPA 4A6YB 1OCWL 5IOPB 5HGDB 1KJVB 2Y72A 4JKMA 5CSGA 4MGXA 1T3FB 4YOKA 3ESOA 5DHVA 5IGXH 1OTUC 1J1PH 2WTOA 4KROC 5FYKD 2Q8AH 2CGRL 4E41E 1VZGA 3AWFA 2IV9A 5DHEA 3UIZA 1PY4A 3CVHB 1XJIA 2CO2A 3EGSB 4UAOC 4PJ5A 1R0AL 1NPNA 2EI4A 3U46A 3VWJD 1F42A 1MXGA 4H8WH 3U7WL 1M7IA 3IRZA 4FAAB 5DJ6A 4P05A 3UYRL 1FYTE 1U3HD 4P99A 5ISZB 4Y9GA 4ANVA 3KPPA 1ZA3B 2LV4A 1M9SA 3JWDL 3I6LD 3PABA 1NTDA 3QDJB 4Z7OB 3WJJC 1WZ1L 1ZLWK 1ZKAA 4BM7A 5JJNA 2FIRT 3SGJA 1RPKA 5CP7B 4BINA 4XI5D 4FA7B 3IDXL 1QHJA 5L8KB 3NZSA 1FNSL 3FN0H 3NCFB 3B2MA 5D1QE 4L9LA 1KCVL 3B37A 3ZTCC 4ZW7A 2NYKA 3UADA 1QA9A 5DI8B 35C8H 1M3JA 2AJXH 4W9LC 4RAUB 4AMJA 1FA4A 3MCLH 1U8QA 5DO2D 5TGBB 5C0BE 5F97E 4LSPL 2A3TA 1JYXA 2VDOB 4LIQE 3MGTB 4FYRA 2JIXA 2K8MA 1U3NA 3NUKA 4NOFA 4QHLA 2F2HA 1E27A 1NCJA 2E46A 2VDRL 4OJFH 4ZUSB 3SKMA 3GINA 4K23H 1KJ3H 3EAKA 1ODUA 3ZZLA 4I7ZC 2Q7YA 3TVMA 1T83C 4NNPL 3SKNB 5B38A 3OKNB 3KH4A 2N4IA 2Y7MA 3A21A 3G04B 1HKLL 3JV4A 5F2FA 4I88A 1NLBH 3DSNA 2V3FA 1YEHL 1LEGB 2NNXA 3QUGA 3VGAB 5I6XC 3ESMA 3RWIB 4LCYB 2MQ3A 3C09B 1XH0A 3PWNB 3C9LA 5IT2L 3GJFB 2D7TH 2G30A 4Z78A 3C60D 2V17L 4WF7A 5C3TA 3O3EB 1HAWA 2RB8A 4HKXB 5B1BB 5ANME 1FBIH 2VLLA 2D3NA 5KUMA 1E4XL 4LLWA 1R5IB 2NW2A 4NB7A 3WY4A 4EZKA 1GZHC 3T2PA 1E4HA 1QAWA 2RFXA 5EA0H 1QRND 4R90L 4D9RD 1U91A 5AKRA 4CMMB 2JAFA 2X7LA 4F1ZA 2ITEA 5A6IA 3V2WA 1ZT4A 1T1XA 2G3XA 4P5RA 3FZUD 3NYAA 3PFQA 1F8TL 3QZBA 3OE0A 4O2EA 2X4SB 1G9MH 4Q74A 3BLBA 3QJZA 1S46A 4L4VE 3VFSA 4JL2A 5CP7A 4ZTOH 1AY1H 3UO1L 1A9EA 3LD8C 5GRUL 3SJVD 4F7MB 1UM4H 4RRPG 4NO0A 4Z76B 5ICXB 1FCGA 1A3LH 1CDIA 1WH0A 2H32B 2VOTA 3ZLQC 1NUGA 3SD2A 4N8CH 1TTGA 4R4BB 3KMDA 1EV2E 3PP3H 4FLHA 1P7KA 5G36A 4L8SB 2A5UA 5FA3B 4DP5X 3FRUA 3M45A 3BSGA 1HS6A 2NR6A 2H9GB 4MD4B 5FFGA 4EI5C 4NUPA 4YSUA 5JUEH 4IW4C 4H25A 2VSMB 4OZIA 4E9VA 1CL7H 4X6CA 3BH9A 2F7OA 2DLEA 2PMZA 4TS6A 1LO5B 4OUUA 3GXTA 3EYFB 3QJQB 4LLMA 4OUUB 1OV8A 3LZFL 5KVGH 1YEEL 4KUZL 5KZCB 3BLPX 3RVVD 3RHWF 4XPAH 4GP5B 4PJDB 2K0RA 5TK2A 4UQEA 5ESVB 5AALA 4QT5A 3D8MA 1QMUA 4G8GD 1AKJB 1MFCH 1EX0A 2P26A 3TBTA 2ZXWB 2UYLB 3BKJH 4H8PA 4XWOD 4HQQH 1YNLH 4FFVD 4QY8B 4F33B 3OMAB 4PXFA 1BQLL 3QPQC 1ZGLM 2ICWB 4KK8D 2ZOOA 1Y0LA 5T3ZD 2HP4A 1AQDA 4OIBA 3S34L 3U0WL 1HC1A 2F1EA 3MLTA 4F20A 3FH8A 4WV1B 5I71B 4HCRL 2XSKA 3DOHA 1BVLB 1KNOA 3HR6A 1PG7H 3AQZA 3ZK0A 3HAQA 2WAHA 3N1FC 3HR5B 4H0HB 4A4MA 5FUZL 4D0BB 3K2UL 1ETZA 1KEGH 3T6XA 3VRIB 5L4JA 2QHRH 4OJDH 4ZUTA 5GJTH 1SPDA 5ALBH 1AHMA 3IPBA 4Q6IB 4EUPG 2OL3L 1R3LB 3NK4A 4GLRH 1U2HA 3C5JB 4APQA 3QGVA 4YHMH 5IQ9A 4NQCB 2X7LB 4XPBH 3O11B 4Z7UF 4HJEA 4DKFL 2AFNA 1YRKA 1XF3B 5ID0A 1P8UA 3WO3B 1ILSA 4LP5A 4BD4A 4YLCA 5ECGA 4M8UA 3CLEH 2BHZA 3EYSH 4O02H 5K93A 5DMKA 1CFSA 2X4SA 1JV2B 1NIDA 5B1CA 5IHBA 2F61A 3Q6GL 1CICD 4PG2A 3RVUD 3EADA 1DQML 4JFHE 5HYQA 1UCTA 2N1TE 3CFDA 1ICTA 3PWPB 1MEXH 2BNQB 4Z7VB 5FPIA 1T1XB 1RP9A 3QW9A 4J3SA 5C3IA 3VFMA 5DZJA 1G5GA 3AXIA 4KI5E 5IROC 3ZZQA 4DOHE 5GSVB 3WAJA 1L9MA 3UG4A 2YD2A 4BUQA 3RUGA 1TJMA 2DMHA 1AGCA 4KX7A 1RK0B 4Y2DC 5B0WA 2MHAA 1ASOA 3UACA 3ZR5A 1FNLA 3GRBA 1RUAH 4HKXA 4TTDC 5B7EA 4NAQA 1Q5JA 3OPUA 5FX3A 4JZNB 2RACA 2EDQA 3DPDA 3H6JA 3HHMA 4UINL 3DX1A 4Z78B 1TU2B 1HQ4A 3NABL 1RU9H 2WP3T 4B6ZA 4ZNEE 4XB8A 4KXDA 1MFEH 4Z7QB 3DURB 4Z3EA 2N59A 4BVNA 4OF7A 1UHVA 2NUPB 2EUWA 1ZLEA 1CGVA 1NKRA 1ADQL 1U8QB 3D2UD 3V0VA 1CDCA 4NJAH 3PWVA 5DYFA 2VDNB 4JJOA 2R4RH 2QTEA 4FNPA 4MNQA 4X6CF 3LMJH 3N41F 1PBYA 3ZRCC 4DOHB 3RQ3A 1HTYA 1LO0L 2A6KA 5A45A 4KI5C 5D2NB 5TDOB