4G70B

Structure of recombinant cytochrome ba3 oxidase mutant v236t from thermus thermophilus
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant V236T from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 51
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4g70B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4g70B02
1KV7A 3ASOB 5F8UA 5H2JA 2VN3A 4YVNA 3ZBMA 1BRRA 4JQ6A 1A4CA 2GC4C 5JJEA 2UXVA 1VLXA 2DWSA 5ITEA 2ZOOA 4K5YA 3C9MA 4AMJA 2DWTA 1BM1A 1CYWA 3CVDA 5KKHA 3ZX1A 2X88A 1U19A 5H2IA 2MRYA 1CUOA 1AOZA 1M9WA 3X3BA 4A67A 3TBCA 3ABWA 4PAZA 4G72B 1SDDA 4KNFA 2ZFEA 1A3ZA 3FQYA 3FSVA 1OCCB 4P5RA 2I7OA 1PXRA 2KSAA 4AMIA 1GS7A 1AANA 4GYCA 1RCYA 2EILB 5H2OA 5TK2A 2PPAA 1JZIA 3HASA 2PLTA 5B1JC 1MG2C 2DV6A 1AG0A 1GS6X 1OF0A 1ASQA 2GC7C 2BHFA 3KW7A 5AFAA 2R4SA 2BWDA 1GZMA 3ERXA 1KCWA 2Y02A 4HYJA 7PCYA 4YSRA 1KGYE 3V9EA 3QJTB 3OM3B 4X4KA 2ZZLA 2QT6A 2R4RA 3AYMA 2XWZA 4KO9A 2CBPA 2GHZA 1LN6A 2FT6A 3NJIA 3V2YA 4NAJA 2EIMB 3A7KA 2F93A 4FAAB 1BXUA 3NJLA 2GI0A 2J57A 5IY5B 3KJ6A 1WS7A 2CUAA 2XX1A 3NJGA 2KS9A 4A68A 5I5MA 3L45A 1BRXA 1X0I1 1AACA 5LWEA 2UXFA 4BEYA 2IDTA 4JHVA 3OE9A 3WNIA 4F7KA 1PZCA 3CVCA 4WKXA 3X1EA 4DP8X 1QM8A 3IE9A 5G53A 4YSQA 2BWIA 1E12A 3HB3B 4JKNA 1NINA 5B6ZA 2F95A 1EZLA 3D4SA 1GR7A 2QDVA 1A4AA 3NP3A 3NT0A 3T45A 2Q5BA 4MFHA 5AZDA 1E5ZA 1V55B 1JZGA 5B1KA 3SN6R 4A2EA 3HAQA 3EF4A 3EHBB 2KSYA 1ET8A 1X9UA 4KO5A 1E30A 2Z73A 4G70B 1R2NA 5AHYA 5DHGA 1TEFA 1W8EA 2FJSA 4UAHA 3FU8A 4A4MA 4KLYA 4QI1A 2CJ3A 3UGEA 3UTXA 5H2HA 4DPBX 2BW5A 1OOWA 2JFCA 3FU7A 1J5DA 2YARA 2XV0A 4P5SA 5B1JA 8PAZA 3ZEVA 1HAWA 1JV6A 4LDLA 2FQDA 5H2LA 2QDWA 3WQJA 4AKQA 3QBKA 2XV3A 3DIVA 1QKPA 2LNLA 1V10A 3OAXA 5A44A 2PCYA 1JVLA 5PCYA 3U25A 3UACA 1ILUA 1JXDA 1AZRA 4KO7A 2BO0A 2WJLA 4HWLA 1OV8A 1FBBA 1PZBA 4QRYA 1S8LA 1FBKA 3MBWB 5I26A 1ZIAA 4YSSA 3WIAA 2UX6A 1HAUA 2P80D 4KNSA 1E5YA 2AVFA 3G5WA 2L6XA 3S8GB 4XTOA 3S3BB 1F88A 3C75A 1FA4A 1ETJA 3NYAA 1KBVA 1JFPA 1BQ5A 1NIBA 3RYMA 3FT0A 4L0PB 3QJVB 4UANA 3ODUA 1PLAA 4CSPA 2PP8A 4G7RB 1AZCA 2Y01A 3REYA 3NS0A 3FSWA 4DAJA 2IDQA 2NTUA 3NJMA 5B7FA 1URIA 1ADWA 3NJHA 3H56A 1SFDA 5EN0A 3IBOA 2VW4A 4LDOA 3OE0A 1C8SA 3TASA 4E9VA 2XV2A 1KDIA 3WI9A 4BXSV 3GYRA 2YAPA 3V2WA 1AS7A 2IH9A 1IW9A 3CAPA 4GXFA 4BV0A 3SBQA 4DP7X 4N6HA 3S3CB 2XU9A 3TBBA 1H2SA 2A3TA 3X1GA 5C1MA 4K9JA 5B6VA 6PCYA 3N2JA 3NSFA 5G28A 4GBRA 3X2QB 2CCWA 2YCYA 4GP4B 4BEZA 1FWXA 1NDTA 1YLBB 5H2KA 3UZAA 3AW5A 3QJUB 4GP5B 1NZRA 4CSZA 3OMIB 3EH3B 1HZXA 2I1XA 5B6XA 1W6LA 1P8IA 1TN0A 2YCXA 5A8EA 1ZIBA 4FBZA 3KW8A 4PXFA 4YSTA 4MD1A 3TU6A 1W6WA 2IWEA 1AS6A 2R7EA 3HEIB 5BR5A 5G36A 1R84A 1E67A 1V54B 2PPCA 4G7SB 1KYAA 2HLEB 5ETZA 1DZEA 1KG8A 4W1TA 1XB3A 2GB2A 1TU2A 4XTLA 2EIKB 3BVDB 2JKWA 5D4IA 4XXJA 1PLCA 1ZV2A 4HIPA 4KOCA 5B3SB 4HCIA 4GRVA 1P8UA 5B7EA 2PEDA 1JXGA 2VM3A 1SHXA 4EIYA 4HHWA 2HRGA 2P80A 5G2AA 3VVKA 3HAPA 2DYSB 1M57B 1OE2A 4W9ZA 2QPEB 1SF5A 2IDFA 3FPYA 1L9QA 2YAMA 3C9LA 2BZ7A 4BK5C 1BAWA 7PAZA 2RH1A 2FWLB 3PCYA 4IB4A 1KDJA 1DZ0A 5E9NA 3T9WA 2GSMB 1ET7A 3BQVA 3NJNA 2FQGA 1MZYA 5DYSA 1JGJA 3RZEA 4E9QA 1ILSA 4KO6A 3ABGA 1JERA 1KMEA 1PMYA 2XX0A 1ID2A 4X31A 1WS8A 2XVBA 4GP8B 4UHRA 2HX8A 4E9WA 1NIEA 1B3IA 2W8CA 4N4WA 4OV0A 1ASPA 2W88A 3AZUA 1NICA 2FQEA 4YSOA 1XMEB 1SHWA 5I6LA 1CWQA 5I6KA 2X87A 3NJJA 3WNJA 4QKTA 4F2EA 2JXMA 1OE3A 4QIDA 3QBGA 4ZK8A 4GPOA 3EMLA 4WTQA 3EH4B 4HCGA 1JZHA 4DPCX 2Y04A 4BUOA 4E9SA 2R7EB 3VHZA 1L9OA 1J9RA 1GY1A 2XUWA 2YAHA 3H4HA 4FPDA 3SQRA 1AAJA 5I6OA 2YAEA 1UATA 3S8FB 3SBRA 1FFTB 1S8JA 3PDSA 4A2FA 3AG3B 1AT9A 4JR8A 5ITCA 2HX7A 2OJ1A 4G71B 1SNRA 1JZEA 3OMNB 2KSBA 2HZHA 4BWTA 4YSEA 3DQBA 3UTYA 3QAPA 1H68A 1X0K1 3QBIA 2CALA 4A2GA 2BP0B 2Z55A 1Q5IA 1GSKA 1I53A 4XT3A 2VSKB 5LDUA 2AT9A 1PNCA 4Q8BA 3FPXA 1OCZB 2YAFA 3PQRA 1RZPA 3UTWA 2I35A 6PAZA 1UAZA 1Q5JA 1IBZA 3OE6A 1QLEB 4L6RA 1A8ZA 1L9PA 2Y1AA 3FYEB 9PCYA 4GYBA 2BZCA 3QJSB 4XTNA 1IW6A 5G2CA 5B6WA 1CYXA 4YSDA 3AG2B 1IXFA 2N0MA 4PCYA 5G54A 5AZUA 1NPNA 2JAGA 1KGBA 4FA7B 3NJKA 1NIAA 2AANA 1QNIA 3IN2A 3WG7B 1ET5A 3CODA 2NTWA 3FSZA 1AS8A 1S53A 4WW3A 2UXTA 2WJKA 1SF3A 5B6YA 3S3DB 2IAAC 1TEGA 4XT1A 2XXFA 3X1FA 3CDZA 1AZBA 2XLLA 4YVUA 3AY2A 1P8HA 3HANA 3PBLA 4MQSA 5H2NA 3PLYA 1OCRB 1XB8A 2EIJB 4ENZA 2FNWA 3OD3A 4TXVB 2I7SA 5G2DA 2I85A 5B2NA 1NIFA 5F7AA 1HFUA 3VW7A 2QPDB 3UG9A 4J4QA 1AIZA 3ZIYA 2DYRB 4Q89A 4BXVA 2LLNA 3OQRA 1QHQA 4YSCA 3CVBA 4A66A 1OCOB 1JVOA 2JAFA 1L9HA 4UG2A 1PLBA 4DP1X 5A7EA 1AR1B 3ZPQA 2MTAA 5TGZA 2DY2A 2IDUA 2PP7A 2TSBA 1RZQA 2YCZA 1T5KA 4IARA 1NPJA 2J55A 2VW6A 2YCWA 2HRHA 2YDOA 4DP5X 5B34A 1BEXA 2VT4A 2BRDA 1KG9A 3QBLA 4YL4A 2EINB 5I28A 1GU8A 3MBVA 1AZUA 2UXGA 2YQBA 1QKOA 4E9YA 4HHGA 5B0WA 4HAKA 4AX3A 3NY9A 1MG3C 1M0LA 1NIDA 4DP0X 1KCBA 1AG6A 1BXAA 3FS9A 3V9CA 3AM6A 4AKPA 4E9XA 4HCFA 1JZFA 1N68A 2VSMB 1JOIA 2FT7A 4DP2X 1M56B 2BP0A 5A45A 4BVNA 5ANHA 2E86A 2ZXWB 2ZWNA 4LDEA 3JTBA 5AX0A 3VGAA 1NWPA 2YAOA 2IDSA 2YXVA 3CG8A 1GYCA 2BW4A 2ZONA 3N55A 3NSDA 4HYXA 3ASNB 3DKHA 1M0MA 3JT2A 1NTDA 1MGYA 2ZIYA 1ZPUA 5I6NA 3UTVA 2OCCB 4HZ1A 2J56A 1BRDA 1E65A 1C3WA 3VG9A 1J9TA 1VGOA 5F7BA 4F2FA 2VW7A 3CDZB 1JXFA 3PWHA 5DHHA 4MBSA 5D4HA 1ZDQA 2BP8B 1M0KA 2UX7A 2X72A 4L35A 3NSCA 3NSBA 4EJ4A 1BQKA 4BWBA 1KBWA 1PCSA 2XYBA 4AKOA 3RFMA 1ASOA 5FJGA 2HPYA 2J4YA 1WAEA 4YSPA 1PY0A 3OE8A 4A2DA 4IAQA 1ZDSA 1XIOA 5EHFA 3DTUB 1GY2A 3ZDWA 1J5CA 1GW0A 1OE1A 4N8UA 2I20A 1F4ZA 3VI0A 3X3CA 2IWKA 5I5IA 4YSAA 2I21A 4BDVB 1IUZA 4EA3A 2EI4A 2YDVA 3NP4A 1MZZA 3AYNA 1L9RA 4BWUA 3NYKA 4DP9X 1AZNA 1PF3A 2G87A 1A65A 3QDCA 1WA2X 4KNTA 4KOBA 4GY4A 4TL3A 2WO3B 4DPAX 1CURA 1AP9A 1QHJA 4G7QB 4Y9HA 5B35A 2H47C 3NY8A 3GDCA 4DJHA 5JJJA 1CC3A 1TN5A 3AG4B 2XXGA 2H5UA 3QPKA 2Y03A 4EF3A 4NC3A 5I6PA 1S51A 2YAQA 2GBAA 5J7AA 1DYZA 1F56A 4JHUA 1JZJA 3HARA 4M3HA 1O0AA 3FQ1A 2IH8A 3IEAA 3DDLA 1IKOP 2VMJA 4E9TA 2Y00A 1J9QA 1IC0A 1WA0X 5D4JA 1S52A 3OMAB 2OV0A 3FSAA 5TK4A 3T6WA 1J9SA 1EHKB 2J5WA 5AHZA 2Y69B 1L9TA 2YXWA 3SBPA 1PY6A 1SDDB 2CAKA 2IWFA 4AZUA 4N4YB 1SFHA 5B1AB 1SJMA 3QJQB 3AG1B 4UF7C 5B7MA 2HXAA 1PZAA 1S54A 1NWOA 3WKPA 3QJRB 3ABMB 4NB7A 5FC9A 2M3GA 1XJIA 1AQ8A 4RH4A 5BR2A 1VJMA 2AFNA 1TKWA 5H2PA 2PP9A 2TSAA 4HALA 4WAVA 2WSDA 1PXSA 3IN0A 5JJNA 5AWZA 1E0PA 1C8RA 1XB6A 3PXOA 2PPFA 3H4FA 4BWWA 4X32A 3WKQA 3TA4D 1UCQA 1R1CA 3QAKA 1X9RA 3EH5B 2BP8A 1MDAA 3PPSA 4AI7A 3NJFA 3X1BA 2PCFA 1IBYA 3FYIB 1JV7A 1N70A 2PPDA 2WO2B 3HAOA 1PAZA 3T6VA 3UADA 2AZUA 3ABKB 3PAVA 3T71A 3T6XA 3D12B 4DKLA 3UAAA 1L0MA 1A4BA 2FTAA 1GS8A 4QLWA 4YSUA 1L9SA 3T6ZA 1PNDA 5B1BB 2FQFA 3MX0B 2HX9A 3QQXA 1GUEA 1WA1X 2AZAA 4BDVA 4MQTA 3PXLA 3CZUB 3GXUB 3FU9A 5H2MA 4KNUA 4DP6X 2RACA 4E9RA 1BQRA 4DP4X 3UZCA 2H3XC 3NSYA 5AKRA 1BXVA 1BYOA 1BYPA 2NRDA 2Q9OA 3COCA 3ABLB 3UABA 4X1HA 3FQ2A 4PXKA 2B08A 5I5JA 3UONA 5PAZA 2FT8A 1RKRA 4JKVA 2PPEA 5AX1A 3ZPRA 4A2HA 3PAZA 1X0SA 3X1NA 4MD2A 2GIMA 3P0GA 2B3IA 2VM4A 1F50A 3FU7B 3PAUA 4M4RB 3UAEA 4NERA 5I6MA
chains in the Genus database with same CATH superfamily
4NWUH 3IMRA 1UA6H 4H88H 4G8IA 2MQ3A 5AOZA 1FE8H 1U36A 4PJHE 5KKHA 4PP1C 1A6AA 4X8XA 5CD3B 1F2XK 1ZVNA 3UPRB 2CXGA 1CUOA 5JQ6H 1GSMA 1HSAA 5D2LF 3IJ7A 5CEXB 4F93B 5IB2A 5E99H 3FC8A 4V2BA 8FABA 2YPVL 2DJMA 1CGXA 5EF3A 3Q44A 4FCHA 4AMIA 4M5SA 4TQPA 1EHXA 4XVUC 3P69A 5IG7A 3P4NA 1B2YA 1Q0YH 4WNJA 3BSGA 1ZMYA 4Z7WE 1NLDH 1F4YL 1X5FA 3P9MA 4UQ2B 1IE4A 2F0CA 1XF3A 3DTDA 3EJSA 3QUMA 3REVB 3SGJA 1QR1B 2ENJA 3DGGB 3FU6A 5IROA 1B3JA 2MQGA 1RZGA 3ZKSD 4MLSA 4GMSH 1MQKH 2D3JA 3VTTA 2J8UE 2FWOB 4GAJL 4QHMB 1H5BA 3DGDA 3M46A 3OM3B 2LHAA 5EU4B 5SWSE 5I6XB 3IFLL 1F4XH 1TO5A 3HMXL 3BO8A 2BVPB 1J1OH 1LWJA 2RBLA 4OGQC 3ZT6A 3L3JB 2XQ0A 3CFEB 1AC6A 4XR8C 2ARJA 1XGUB 5F7WC 5AENA 4XZ4A 4LSTL 4PJXE 5E08H 3H3PL 3CVCA 4BFJA 3IE9A 4KJWC 5LN8A 3HB3B 2FWUA 1EZLA 4K15A 1OAKH 3Q01A 4GSXA 1LK3H 3WTSA 5GSRB 4OI7A 1HXYA 4FXLA 2J44A 1RZKH 2F8XC 4N6RA 4HGWB 1UB5A 1UM4H 3NZ8A 2MFNA 1TJGH 2L7QA 1OAQL 1U4EA 2GTWB 3ESMA 4R3SB 2W9EL 1W8EA 1MREH 2WUBH 1UJ3A 3ISWA 3NIFB 5D96C 3ULUL 1JHKL 1RURH 3GIZL 3HUJB 3OL2A 4PD4J 4ZW5A 3C8HA 3N1MC 4MJ5A 4KX9A 3NCWA 3DOSA 5BS0B 4L3EE 5DVNA 5SX4I 1DDHA 1KNOB 2FLMA 5PCYA 4L4TB 1YY9D 4EN3B 3N3EA 3MCKB 4WFGD 1FBBA 2FJHB 3BUPA 1TOXA 2OTUB 2IIJA 3QHFH 4NRXB 3UC0L 3QW9A 5GGTH 1E5YA 5C0BB 2VQ1B 4MYWB 2RH0A 4KMLB 1RUMH 1M4KA 3QI9D 4I87A 4BFOA 2R1WB 3REWB 1QASA 3QCTH 4XVSL 2PYEA 1ETJA 2GTQA 4XE0A 4I2XB 4FZ8H 3A4EA 4Z7VE 2NT0A 5HTSA 3ARDC 2I9LB 4Q9QH 4M93B 3WN6A 5T1MA 4Z6AT 4TTGA 4NZRH 2GABA 4H8WH 5EOCJ 4OD2B 3EFOA 4Y5VA 1D3CA 4OZ4A 5E6ZA 4R7DA 2R9HC 3LPWA 1AXIB 2A6DB 3OE0A 2EIEA 2WBWB 3N43F 3WI9A 3ALWA 3OPZH 1JNJA 1OGAA 1MIMH 5D7LB 2RD0A 5TJWK 2EC9U 4U1MB 5GZOD 3P02A 3MNMA 4PRBA 5AVZB 4OGAC 5TH2B 3U4EA 1U8HB 2QJDA 3H55A 1TLMA 2J5LB 2YA0A 2PYFA 3OAZK 2X05A 5G28A 4TUOA 3WE1A 4GIPD 3AW5A 3UZAA 3BH4A 1BIIB 1SYSB 3AXLB 1CZ8H 2QTVA 3CUPB 4EIZC 5HHQB 2X6VA 1KIPB 3VRJB 1TTAA 1QAWA 2GCYA 4LRIC 5BR5A 2P7TB 5T3XH 2ADJB 3VXTA 3GTNA 3Q3GB 3LKPB 2HB0A 2EYRB 1KG8A 2EYTA 2VDQB 1IFHH 2W07B 1E7UA 1U8QA 1VEPA 1WZ1H 2JKWA 4KTDL 4IEFB 4XXJA 4L4VD 4ORGA 3RIAF 4ICWA 4ZSOE 3OF6D 5B3SB 1GIGH 4H0LC 3NFSH 4LLWA 3HG1E 1QUNA 2A9AA 1IGIL 3H9HA 1ZXKA 5DK0A 3QYCA 3UG3A 3TBYA 5TDOB 3ULUC 3JTSB 2K0RA 2QPEB 2A73A 5D1XC 4NPYA 5DFVD 1T83A 3S5ZA 3QEHA 2RH1A 2CPUA 5ETUA 2OQJB 4XC3L 5AB0A 4ETYA 3O6FD 4LBEB 5FUZH 1DR9A 5C07B 1AGFA 4LGRB 4MQSB 1ZRUA 4Y16A 4ZFFA 4V1DA 3P0VH 3RWCB 4PD4K 3WO3B 4O51B 3D85B 1T0MB 3L16A 1UXWB 1UQSB 1X5IA 2LGNA 1DL7L 1YNKL 5GGRY 3AZUA 2C1OB 2XWTB 2KHAA 4G42B 4PJBF 5C0NC 1T1ZA 5HYQB 2X0VA 1EV2E 4YSOA 4ETQB 4JKLA 2DKMA 1PFOA 1DUZA 4GKNA 1URZA 3MRRA 3BIAX 2X4NA 3VGEA 3VRLE 4IRZL 3ZYZA 4YHZH 3SY0A 3TA3B 2LU5A 3EMLA 4FYQA 1F8TL 3I9PA 2F19H 3VAEA 4A6YB 1VFBA 1RU9L 2B15A 1J9RA 4RMSA 1N5YH 1MDTA 1OSZA 1LMKA 1UATA 2R29L 2VZUA 3V4PB 1SEQH 1FFTB 1L0QA 2BK8A 2MPVA 5C97A 1AT9A 2D7TH 4G8EB 3T77B 4XCCH 1ZT1A 2X4RB 5D8JL 2R15A 2C1PA 4X6FB 3WUZA 5DJXB 4QEGA 4JZJB 3ARDB 1DJYA 3VI4F 3WJMA 4YDLB 4Y7MA 1D7DA 4WTXA 3RKPA 1XF2B 3FCTA 2BSRB 4XMWA 1CFSB 3PWPD 4AIZB 4IDJH 1S7WA 2UY7B 2EXSA 1QLEB 4FI7A 3DK0A 5DQJA 4YOKA 3KPOA 4WJKB 4OCXL 5FM5M 1FAIL 4OF7A 5GRJL 2VH5H 3CFCH 1UZ6F 4XO8A 1IGFL 5AZUA 3QQ3A 3S4SG 2ITDB 2EUZA 3I9GL 4HV8A 5ECJE 1YUHB 2AJ3B 1KXTA 1R5VB 4Y4HB 3L3IB 1NAMA 3UO8B 1A7RL 3OZ9H 2IG2L 3JTTB 2X28A 3MYJA 4O2CA 3S3DB 3BESR 4FI6A 4PJCB 1UCBH 5KG9A 5I1IH 2XXFA 1YEGL 4M3KB 3RWGB 5H2NA 4MDIA 2GJ6B 2V2XA 2DI8A 1X5XA 3JV5A 5DHVH 4TXVB 3SBWA 4BFIA 4EXPX 5HYEA 4JKPH 4KKCD 4QRTB 4F33B 3CFJA 4DN3H 3EH2A 2QPDB 1N0XH 3KPQA 1XR8B 4I9WD 3L1EA 4NDMA 3MUGA 5JPMC 2QGDA 3OHXA 2LLNA 5AKSA 1T7XA 5DJYB 4YSCA 3U83A 1M2OA 2YPKB 4XO5A 2ZOWA 3I6KB 2GIXA 4XMPH 1E8XA 2AJVH 2DKUA 4W9JC 1WAAF 4XXWA 3UGXA 1JHTB 3ML8A 5JMRA 3RIFK 3VX1A 1CD8A 2MKLC 5LWYL 2BRDA 1KG9A 2E3VA 3G5YA 1Y6KR 4FABH 1V3LA 4YX2L 3MBVA 1FQ9C 1AGEA 3N40P 3DSNA 2EVGA 3DA0A 3R1GL 2JKTM 2Q3ZA 3GHBL 5CN3A 3VWKD 4AKPA 3BGFB 3KGSA 4DAGH 1NC4B 5LJYH 5DD3L 2AS5M 4LLQA 4MJ2A 4LDEA 4JFED 4DKEH 1QATA 1AR1C 4ADIA 2IPKB 3IDNB 4NYLA 3O2DL 4HMCA 4HYXA 3QZWB 4ZMXA 1CS6A 5I6NA 3BYYA 3MFGB 4QRFA 5C0RH 1KLFB 2J56A 2YEZB 4FJ6A 4GKOA 1BRDA 3H0TB 1LILA 2DQDL 1J9TA 5ILTL 3ZKXC 1NM9A 4I4WB 2VW7A 3GI9L 2P9RA 4GRLD 4YAQA 3ARBB 4X0KA 3WS3B 5D4HA 43CAB 3RVTC 3UJJH 3GMPA 5F71A 2OK0L 2I5YH 4L35A 1G0DA 2Q7AA 5JHAA 4UT6L 4WWPA 2A2QT 2B59A 3BEVB 2YWYA 3R4DA 4OV6F 1PL3A 3SDAC 2IFFH 3VXSD 4BQBA 4NKMA 3VWJC 3MJ9L 1G43A 2VN5A 4GG6B 3WO4B 3CVIL 2ZCLL 1MW3A 1Z9OA 1MEXL 1U8KA 3QIBD 4POUB 4E41D 5D70L 2Y6TE 2V7HA 2Y7LA 3WFBL 1EJOL 3CTTA 2K4WA 5EU5B 4P8QA 4J3UA 3MV7E 4YHOH 1LK2A 2APXA 2EDYA 2WSPA 2XWEA 5IVXF 4HF5H 1S9XB 4RDBA 4GY4A 2B2XH 1PSKL 5IMKA 1HYSC 5M95B 4FXGA 2Q0ZX 5IEKA 3MDJA 5IKCB 4LSPH 5FO7B 1BQLL 25C8L 5DS1A 4NNYB 4P2AA 2OYMA 2VSCA 5E8OB 2UVEA 4JCLA 1Q1PA 1A9EB 1JGUH 4HFUH 1PYWA 1CI3M 1SGKA 1AHWB 2IH8A 5IR1A 2DLGA 4ZW7A 2EDFA 2VMJA 3QO0B 3UBXA 2BP5M 1NBYA 3DXAB 5IUCA 5F9DC 4ZTOH 3V0VA 1RUQL 4PQXA 5AHZA 3SBPA 3JT0A 5JYLA 5AW9B 1V7NH 5K9OB 1W80A 3T0EB 4N6QA 3GBMH 4NI3A 4DVBA 4F8NA 2TRHA 1HI6A 3CSYB 3QJRB 2BNQB 2JI3A 4JFYA 4V11A 5DJ6A 1ZHBB 1F97A 2X4OA 1XSKA 1FNHA 2CJUL 2ICEB 1YMMB 4L29A 1CDHA 3H4FA 1E0PA 4F20A 4BSWA 1B88A 4BWWA 3HNTL 4KVNL 1WBZA 2YGQA 5I66B 1ZGLM 4XVJL 1XZ0A 4Y2DC 5LBVA 1XT5A 3BZDA 3VVWA 5G4OA 5DUBA 1CN4A 2IAND 4YFLI 1VHPA 3FQTB 4MX7A 5C6PB 1O7VA 1TCMA 3F7PC 4YE0A 4Z3GA 3QJFB 3T6VA 1UFGA 2HH0L 1KXVC 2AZUA 4GS7C 4BZ1A 4WUUB 2J6EL 4IMKC 4DKLA 1QW9A 2EDNA 3DGGA 4IDLA 3RFRA 4L0ZA 4W4NA 1RPUA 4JPIB 3B6SA 4QLRA 3MKKA 3SOBH 2YEVB 5BZZA 4EXKA 2FQFA 3K74B 2PWHA 4RAVA 2EH8H 1VFAB 3K6FA 4H2AA 3FTZA 3GEWB 4FS0A 1KN2H 1BXVA 2EP6A 2PUQT 4WAFA 3KLHD 4B9JA 4D9RD 4H2CA 2WN2A 1BJMA 3DUUB 2FZ3A 4YIQA 3TLRA 1MCKA 5I5RA 3N0AA 1RKRA 2IAMC 3S37L 3LN5B 2JKLA 1Y6MR 1RIUL 1HL5A 5F21B 2QADC 3SPVB 4HXAH 5DYOA 1HH6A 2NY2B 3DX6A 4O2FB 3BKJH 1IKNA 3QA3B 2KUTA 4WW2F 4DFIA 5JQ6L 2EDMA 3WGVB 5E99L 2CO3A 1PGRB 4IRSD 1FJ1B 1U19A 3BRDA 2VCOA 1BZ7B 3PIQB 2EYSB 4K3EH 5BCAA 3O0RL 3ZTJH 2Y23A 4NJ9H 4KRPB 5T1DH 1GS7A 1RCYA 2DM7A 1TFPA 4UU9A 4WU5A 5HVWA 3U2JA 1IBHA 2X4TA 1G7LA 2WBXA 1MQKL 4GMSL 4L4TA 5FHBL 2QPFA 3QUYD 2CA3A 3KYOB 1IAKA 1VB9A 3IVKB 5D2NB 5DSCB 1NBZA 3BAJA 4OUUA 1IJNA 1J1OL 1B0RA 3N40F 3PWJA 3PXJA 1JUFA 4QWWD 4X6CA 3LIUA 4LARL 1LN6A 2ED6A 2EDLA 1EHNA 3AWFA 3EIFA 2H8PB 3Q8EA 4UMSA 2H26B 3SKUD 1XGQB 4HLZH 2NXYB 12E8H 4NO3A 3V5KB 3HC0A 1KB9J 2BVOB 5JOFB 1VSCA 5LWEA 5JDJA 4G8FB 1CFQB 1JXJA 3X1EA 1LK3L 1MJ7L 1U8CB 3TZVB 3HE6A 3L3OA 3VXOB 4UDUB 2IOOA 3CFKA 4Z3HA 4XE5B 2V7NB 4KK9C 3KR3L 1UM4L 5DJZA 3BAXA 1BYNA 2A4CA 1CE1H 3WU1A 4NHUB 3K72A 4PJ7B 4QAMB 4F7EA 3SN6R 1XH2A 4MCYB 4XNMA 4RGOH 3ES6A 1MREL 2WUBL 1WITA 4PB0L 2OAAA 4ACPA 3FU3A 5L8JB 2I60H 4LOEA 3MQIA 4Z77A 3GXDA 3UZVB 1TTGA 4IKKA 4FA8A 3KBPA 4Y5XC 5I8EA 3FU7A 2JFCA 5B38A 2XV0A 3DO3A 2QHRL 1OAYL 4JPWH 5GJTH 3WQJA 3ETBJ 3KPRD 5F1IB 1GC1H 4YO0A 5IV2B 4OD3H 43C9B 2G2RB 1HYRC 2P5WE 3MACL 1NFDA 1U8PB 2WAQA 2IPUK 1X6NA 3DVIA 1VF5C 3QQ9C 1CQKA 1RUML 3VFRB 3DJRA 3QCTL 1UB6B 2HPOA 3P4OA 3L7EB 4JN1L 4YBLC 2RQEA 5IB4A 3EYQD 5ABZA 3V6ZB 4Q9QL 1EAPA 3HLAA 3ODUA 1PLAA 4H26A 5C0AB 4CSPA 1IBBA 2AV7A 4P06A 3REYA 2ERJB 2DEXX 3KDMB 5IK3B 1FI8C 3MA7B 5B7FA 4JFTA 3T4AB 2MNUA 2OQJA 3OPZL 2MQ0A 5GS2H 3HC3H 2Y06H 4H0IA 4HFWB 1PCXA 1VACB 3BP4A 2EIDA 3DBXA 4ZX4A 4Z7UA 4EN2A 2X3CA 1AGBA 3U7WH 4WO4C 1JZ7A 3ZL2A 3DI2B 4PRNA 2XU9A 5KN5B 5D1QB 2WLMA 2WNGA 4BFGA 3TIDB 5L9DL 3X2QB 4GP4B 4YQXH 2RCSH 1CZ8L 3MGOA 3KYKL 4PS4H 5DLML 5SWQA 3KWWA 5LGYA 1OTUC 1SXCA 4AH2A 3KW8A 4M48H 2C4XA 3FB5A 3KE0A 5T3XL 4HUWB 4YSTA 2WXKA 4BE5A 1QFHA 2NY0B 5MEQA 3P30L 3WSQH 5E1AB 3FB7A 1S8DB 2XWJA 3BSZA 1IFHL 5E1QA 4EO5A 3K2IA 1WZ1L 4LSDA 4ABWA 1P4LA 4MAUL 3U0PB 2EXYC 1GIGL 1YEHL 4W1TA 2WMPB 4WTZA 1PKQA 1IGML 3QFJE 1ZSDA 3INOA 2ADFL 2YS4A 1XV8A 3ZQWA 5DJXA 4EPSA 4QNPE 1NANH 4HWUA 3LS4H 3ARDA 4U1JB 5DXWA 3GUTB 2YPVA 1IAOB 2HRGA 4FTVA 2HTLC 5FFOA 4J2XA 1X4YA 3PUUA 5FUOH 3RFZB 4LL4A 3N42B 3O4LD 5JIQA 1NOLA 5J6SA 1XL6A 3MLWH 4M62H 5FUZL 3BW9B 3U6RA 3DIFB 1MNNA 4JVPA 4R97B 5DJAB 2OMUB 1XCTA 3P0VL 3KLQA 2AJXH 2A9NL 4NI6A 1I7UB 4L37A 5FYJH 1FDLH 4D7PA 4NFDA 2Q3XA 3UTSE 4OGXH 5CBEB 4GAYA 4G6MH 4P23C 2XVBA 2Z6FA 3NJVA 3Q5YA 3TFBA 4QF1B 3HMXA 4AYFB 3LNDA 3CQFA 1A7BA 2Y1YA 2ZNWA 5IBUG 3T0AA 3QPQC 4YHYB 3RWGA 1S9YB 3OV6A 1S5IL 5CBAB 5FLVA 1K8IA 3D39A 2X9ZA 5HHMD 2Q8AL 4YHLL 5CEYA 3ZRFC 1N5YL 4WTQA 3THML 1J5OH 1RIHL 2LTQB 3VHZA 3BI9X 1GA2A 4OZGF 1IQDB 4FNRA 1TQCC 4FYTA 1PG7H 2X0WA 4M43H 5ITCA 3W9EA 3B2UD 3TTYA 4XODA 3LKNB 4NM4H 1QPXA 4AVKA 4YHNB 1Y18B 3LPGA 4XHJD 3UG4A 1W91A 1BLNB 4ZO7A 2B1AH 4LCCC 5D1XA 1EEQA 3WFHA 4A7SA 3BIBX 1PNCA 3Q8BA 1OAXL 2X70A 1FYHB 2CKBB 1ND0A 3MV8A 2VDQH 1Q5JA 1C8QA 1XWVA 2VH5L 3BPCB 1WRFA 3CFCL 3CN3A 3HCVA 3QCUH 1HU8A 4S1SL 4W70A 5KSBB 1KN4H 5I24A 1I4FA 1IXFA 1IIKA 1HQ4B 1UEYA 3AB0B 3L2MA 3WEOA 4FI8A 4OQTH 2ZSVA 1OZTG 3I6GA 3CFQA 3V7AE 3L54A 1ACYH 1ZY9A 4K3HA 1ZSHA 5DZVA 1T66C 1Z1WA 4DZ8B 3Q6GH 1MPAH 3QZWA 1JGEB 3UXFA 3TJHD 5GGSA 4JO2H 4DK3A 3EDJA 2NUPA 4O58H 1L0XA 4BZ2H 4EVNA 3JYCA 1U3HC 4ADGA 3GB7A 5DMIH 4H40A 4YVUA 3OKMB 4UM9D 4Z7OF 2FEJA 3A6CH 1FV1B 4WWKC 5AUMB 4NAMA 3NZUA 1N0XL 4JFFB 1CXLA 2E8ZA 5AW3B 3QH3A 3KVQA 3B4NA 4OLYH 2V9TA 5E1IA 2RIKA 1R0AH 3BGAA 4W93A 4G7YH 3UYRH 4KAQL 1EX0A 4M6OH 1UGNA 2MWCA 3MREB 3OQRA 3LIZA 2FIKA 4XMPL 2HRLA 2IH3A 3FQRA 2OYKA 3GPSA 2E7MA 2K1MA 3VYOA 5BW7C 3IAGC 3ZPQA 2YA1A 2BSED 3SCMC 2KLTA 4A6YH 3DX1A 1A6ZA 1IC5H 1KLUA 5C09D 4DP5X 3SQBB 2YUZA 3AACA 5IHHA 1HEZA 2VXSH 5IQLA 4J39A 5F70A 4G7VL 5IJVB 3TS8A 2P5EB 3D4ZA 5J1SC 1W0WA 3RVXC 3FOLA 3FT1A 4K8RH 5DUML 3LHAA 3NY9A 1TZ8A 4HJ0D 1E28B 1JVKA 1N5AA 4EQ2A 4E9XA 3MAWA 4WK2B 1JOIA 5HGBB 1E5AA 2ZXWB 3OKOB 1XIWC 3NIFE 1DQIA 2BW4A 3HUJE 3MRGB 5KSUA 3GEFA 4PJGF 2VLJA 5HSFA 5J3HD 2BJMH 1QLEH 3RTLA 2BDNH 4ABQA 3BSHA 3HZKA 5BS0E 4EI0A 4IW4C 5F96L 1KGXA 2A0LD 5E8NB 4XC1H 4XGZB 2P5PA 2I5YL 5F7BA 5HI4C 4ZPVA 2XG4B 4L4TE 4Q74A 5F7KC 2VMDA 2IFFL 2XN2A 3F58H 1DJGA 1X5HA 4QXUH 4B5ZA 4D8PA 3ULVF 4EJ4A 1C5DB 3Q6FB 3QIWD 4KVCL 4AKOA 5JPMA 2AC0A 4IK7A 3SQOH 3LSOB 2R51A 5C0BE 4OCYL 4N0CD 5DO2C 5FYJE 3MVSA 4I0CC 4I2XE 1NEZA 1XGPB 1L7IH 2C3VB 1T03H 3QDJB 1U93A 4YHOL 4WI9A 2X09A 2OZ4H 3N06B 1R33A 4BWUA 2V0AA 2YJQA 5INDB 4IRZA 4NWTL 2VLKA 4Y9HA 2BP3A 4HBQA 2Y3AA 5F72S 2F08A 1F3RB 5D7LE 1AOZA 5CILH 4QGYA 4NC3A 3A6BL 3SD5A 1JGUL 4XN2A 4HFUL 5I6PA 2R29A 3CIAA 1JZ6A 5E8EA 1FCGA 3EGDA 4HXBH 2VRAA 1VFMA 4ZTOL 2A9MH 2FGZA 2Q7NA 5CWSB 2ALAA 4ERSH 2M26A 1DQTA 3GDBA 2FX8H 3LS5H 2CDGB 3JZ7A 4FG6C 1AKJD 5ACZA 2KC0A 4L48A 3CSFA 3RWFA 1SDDB 4P5TB 3QEUB 3SE9L 3WIFB 3SDAA 4U1GC 1EDHA 4QRQA 2C26A 2EUXA 3FH7A 5BO0D 1PZAA 4XN8A 2ZIDA 1UT2A 1S54A 1T04B 3VWJA 1RZJC 2P8PA 4F3FB 4J12A 5HYSA 3DMMB 1UXLA 3P4MB 1TTBA 4QRPA 4X7TB 5JJNA 1E6JH 5IHWA 3BFOA 1UCQA 3SSGA 1ZK9A 2Y25A 3GC3A 3NJFA 1XH0A 3ZHKA 4YPGB 2YR3A 2AAAA 1X7QB 3EGXA 5HDQL 4XAKD 3T71A 4R8WH 2DZEA 3KPSB 3WTYA 1XGRA 4AJVA 2X2HA 4M8QA 4QLWA 1J9CT 1TSRA 1YAIA 2JVUA 2PTTA 3MX0B 4R7NB 3ZZLA 1WA1X 4GRWF 2O61B 1KN2L 1P7BA 4PI2A 4P2RB 3ZE1B 2BOCA 3GXUB 1JTOA 3VD2A 2JTDA 2H8PA 4WK4B 4Z76B 4FMVA 3UTOA 2ZX5A 3GSVA 4W6XB 5FYKH 4KQ3H 4AYBA 2XBTA 3UABA 1E6OH 5JHBA 4XPHH 2OR7A 3HG3A 3L5IA 5E0QA 3VFPB 4G8GA 3OQ3B 1DLFH 5FM8A 2D4FA 3CD4A 4P5KB 5C0CA 1TCRA 3BKJL 5LO7A 2XPZA 3T3MB 3NEXA 2DMKA 3P11L 4W9HC 2EDWA 2R59A 2WV3A 5T1LD 2EDOA 5JHDD 3DI3B 5IW6A 4MCYA 2VAJA 3IU3A 3GKWH 4C83B 4OLWH 1LO0H 4ZAKD 4GW4B 3O2DA 3IJYA 4EZJA 1F1DA 4NJ9L 4Q7DA 4Y2DA 3HNSH 5T1DL 3VFOB 4LEOB 4F58H 2H0FA 1ZHNB 3EAKA 2BY2A 4TSBL 1FN4B 1KXVA 2WLKA 2VYRE 4FX5A 4EE2A 4IMKA 2XWBA 2BVEA 3O6FB 4G9FB 5MERB 4TV3A 4F7PA 3OAYH 1U42A 3GMRB 4I77H 4HKJA 1FSKC 5EO1A 3TNNA 5C0FA 1U8PA 5I1HH 4NT6A 3MJ6A 2FAUA 5BO1H 4IJ3C 1MJUL 1ZGLP 1UB6A 3ZSTA 3MJ9A 3O9WB 4JQVC 1T6BX 1PEZA 1A9BA 2XRAH 4NAJA 2GIYA 4PJCE 3NJLA 2GI0A 3LZFH 2BOBB 3RZCC 1LDPH 4BBWA 3GMNA 5IUSA 2GJ6E 2IAMA 5SWZB 4Z23A 4PCKA 2UXFA 3PABA 5EC2B 2EO1A 2OSWA 2XKNB 4L18A 1K8DA 3HBPA 1JPTL 1CICC 4R4FH 2GUOA 1MRCL 4JKNA 2K9UA 1CE1L 2CRMA 3EO1B 3ASWA 5CD5D 3T04D 2R2HB 2VDKB 2MCG1 4XRCB 4D0BA 2AGJH 4BFFA 1CXEA 3FOMA 4ZT1A 5E2WH 2I60L 1LWRA 3RJDA 4OZHB 4JDZB 2B4CH 4TM9A 1S9KC 4GO6B 5AHYA 4G70B 3CVHB 3FU0A 3TT3H 1TEFA 3S3PA 1CE6A 4FQ2H 1JRHI 2K6ZA 3ZDYF 4JPWL 1RHHB 2BW5A 5GJTL 1CFBA 1EFXD 2VC2B 3FL7A 4M4RA 5BRPA 5L2JB 1T2JA 1XAUA 1J5DA 4F15B 4ACTA 2ADIB 2WQWA 3APNA 1P4BH 1BZEA 1NSNH 4W6YB 5T1KD 3O3EA 1NCOA 2BO0A 4YXLH 3L7FB 4BQ8A 4ILDA 1JRHL 1BD2B 2A74B 3AUWB 2NYKA 2OR8A 2E9WA 4APQB 4KRLB 4P5MA 2V5YA 5F3BA 5CEZD 1FIGH 2CLVA 4AM0A 4H44C 5H2BB 3TO2B 4U6VL 3QISA 3PXHA 3E3QC 1EH9A 3TH3T 4JREB 3T09A 3FF7A 3S5LG 4R9HA 4JFOB 3NJHA 5A2AA 2J6EA 3EADA 4GBXB 2Z9TA 1DVXA 1JWMA 1INQA 3U7WL 4H1LH 4QRBA 3MJGX 1OSPH 2W9DL 4H8VA 4JANA 4JGUA 4PJFB 3V2WA 4RAUB 4GG6E 2HJFB 3SGKC 2XJKA 2CBTA 3BRGC 2AK4A 4CILA 1BQHB 1T1WB 3ILDA 5B6VA 3WN5C 1HOCB 1NDTA 1CG9B 1O6TA 4Y5XA 4GFXA 1JYVA 1ED3B 2GQHA 3WEMA 5BRZB 1IM3D 3CJJA 4M48L 1U8IB 5EO0A 1NANI 5FYKE 3MUUA 2WQSA 4HWNA 4UQ3B 1QHPA 2PCPB 4OIBA 3VWKB 5LVEA 2YUXA 4FNSA 2XFXB 5I9QC 2IV8A 1P5VB 3CE1A 3BT2H 4MNGA 1IGYB 1FO0B 3OR7B 3B2DC 1JD9A 3LS4L 4X7SL 4KOCA 1L0YA 4U6XA 4QGTA 4MQXD 1U4FA 4IIQC 3DXAE 3SD2A 3TT1L 3GJFK 5IMOA 2P80A 4IBSA 1A4JA 3MLWL 4GRLB 3I6LD 4IBTA 1SJXA 1TO4A 4H20L 2CKBA 1SF5A 3D25B 1AQHA 3MLTB 4OBSA 5DUJA 1M7IB 1XD0A 3T0EE 2CD0A 2X4PB 2XXCB 1I3GH 3EBHA 3VCLB 3NJNA 3ALPA 1FDLL 2UYLA 4WO4A 1DEEB 2NMSA 5EEVA 3VRLF 3V52H 4J1UA 5FECA 3RDJA 5F3FA 2X4UB 1RJYB 3ABGA 3QIBB 1KMEA 3PJNA 4J8RB 2F5BH 4K23H 3WTVA 3ZTNH 1YMME 4XI5C 1JGEA 1HOEA 3ZDZB 2ATPA 2AEPH 2DEWX 5IIEB 1FORL 2NY6C 1TQUA 1WFIA 3N44F 4NZ8A 5E2TL 5JNYA 2WXFA 3VXNB 4PJDA 2AJSH 4PJ9C 1CWQA 1PIFA 2PR4L 4WUUE 5INCB 3PUCA 1J5OL 1S2EA 4YK4B 1YPZA 4GPOA 2QKIB 1ES0A 3VXPB 3MNVA 5EO9A 4AJWA 4E9SA 4NQDB 2XUWA 4ZTEA 1DBML 1K4CB 1JYNA 4UOW0 1WDAA 4G71B 4M7ZC 4OSUL 4C56A 2KSBA 2HZHA 4BWTA 2B1AL 1K3ZA 2CNYA 5H37A 3UTYA 1BWWA 3ZK0A 3F6LA 4DJMA 3RX8A 5ICYA 4AW7A 1ZLDA 2G9HB 2BSTA 4AL8H 4CJ1A 1UXSB 5CN2A 3RTQD 3UTWA 2ZF8A 4PWKA 3RVUC 4AENB 3FYEB 5ALCL 3TH4T 1Q9LB 3RWJB 1P1ZB 3N1FC 1NUGA 1BMZA 3BWAB 3US9A 3WELA 3POHA 2Y07L 4HKBA 1OKEA 5EZIH 4HYTB 4P23A 5I8CB 5C0EB 1OP3H 5I76B 1MPAL 2DD8H 4CBZA 4KPHL 4FG4A 2HT3C 3G5ZB 5DGQA 2ATAA 3CDFA 2E9IA 4O58L 3IN2A 3QS2A 2Q1EA 4UM8A 3TYGH 1YEIH 1VPOH 4OCWH 3WG7B 1KYOJ 5BQDA 4ELMB 2WJKA 4X5XA 4ZFZA 3S98A 5FM4A 1SEBA 1P8HA 2P52A 4XPBL 4Z7QF 5DDHB 5SX5H 2BC4A 1YMHB 1KJ3H 1R0AL 1UD4A 4S1DD 2DQIL 4PM1A 3TCTA 4HUCA 5I9QB 1KTLB 1BEYH 5F7AA 1DVFD 5D2NE 1K72A 3X14B 4NP4H 3W0WA 3HI6H 2DBLL 4J4QA 1MH5B 5AVWB 3IJ9A 1KTDA 4NC1E 1QHQA 1SN5A 1T22B 1OCOB 3P0YH 5T1JA 4N0FA 1MRDL 2N56A 1MVFA 3QXAA 3NCCB 4LCCA 1RZFL 1IC5L 2Q10A 2LVCA 2IBZY 3O41A 1J5IA 3FCGA 4AVJA 5IW1B 3ZE0B 3ECUA 1IT9L 1GJWA 4OW6A 1DQLH 4J5VA 3BAEL 4K8RL 1FHGA 1KC5H 5MP6L 1E27A 1CIDA 4WV1B 3PHQA 3C60B 3HN5A 5C0IB 5HDWA 1IO4C 4PJ7E 3HA0A 1ADQL 2XVLA 2JQMA 4QHUB 4IRSB 2HVKA 3F65A 1TVHA 5JIMA 3VXRD 1M56B 4BELD 2BJML 1A22B 2BDNL 2WVVB 2YXVA 3CG8A 3CSGA 3S97C 2NY6B 5CP7B 5ESQB 3ZKNC 5JXAH 4DO4A 1KIRB 1U3HA 1JAEA 3OVUB 4FFYH 4XC1L 3FT3B 5DZ9A 5C2BL 2V37A 4OCRL 4NSKA 4HQQH 5DD1L 1UWXH 2WCPA 4WWKA 1TNMA 3WDJA 1GZQB 2ZOKA 1U8OA 4YLBA 1HEHC 4EDWL 4QXUL 1P2CB 3F58L 3IXTA 4L9LC 2W60B 3OSKA 3EGSB 1HNGA 1YECH 2NR6C 2X7LA 2BP8B 1M0KA 4JM2C 4EKJA 5CZKA 5DZNA 3NSCA 3OAUL 1KBWA 1WISA 1QA9B 5FO9B 2YJLA 5FGBC 4X5WB 4XNXH 5EHFA 3APDA 2VRKA 1A47A 1L7IL 1K5NA 3PGFL 3UIZA 5BW7A 2DYPA 3NRPA 3FRPB 2NUTA 1IL1B 4X7TA 3SCMA 3ARED 5C0AE 5I5IA 3S36X 4BDVB 1OWRM 4MQTB 3D4YA 4BFNA 3RVWD 2EO9A 3RG1C 1CLYL 1PZUB 1DVZA 3F2LA 3PL6D 5CILL 4U4IA 4IHOB 2UY6A 1QHJA 3WL9A 2DJSA 1GHFH 4L5FL 3QPKA 5GS3A 1Z3GH 3BZEA 3O2VH 1NGXB 1KYOK 2Y7QA 1S51A 2IQAA 2MIZA 4AV0A 3MX0A 1XIWA 5D1QE 2WLNA 3VFGH 4ZMYA 4OLZH 4XVTL 2A9ML 5KBKA 5J12C 1H6TA 1TZGH 2F15A 4TLSA 1KPVA 4U1KA 5M7QA 4HUVA 2FX8L 2JCWA 5AOIA 4XMKH 1F58L 1HXMB 4BCYA 1U8MA 4DGVH 5B39B 5A2FA 4B7IA 1WA0X 3FT4A 3MCLH 1S52A 3MRIA 1YUKB 3LZQA 1H3WM 3MUZ1 4KKBD 3HR5A 1UJTA 4JRWA 5DJ2A 1TJXA 4WNQB 5TE7H 5HVFB 2XTLA 5AWNH 3AG1B 1J8SA 2Z4QA 4M9PA 2DIBA 4BINA 4D9QD 4ZFOL 1JPSL 1RUPL 1ZJAA 3L3KB 3LB6C 4IOIB 2NY1C 4AEHH 3MKGA 2AFNA 4C83A 3MRCA 4DEPB 1RJZB 1EO5A 2WSDA 3JVGC 3HZVA 4IBZA 4X4XA 1M3IA 4KX8A 1G6RB 3IS0X 5CKGA 2N1KA 2BIIA 2A4ZA 2BIPA 1UYWL 4R8WL 5LGHL 3MBEC 3HAOA 4IOSD 2ZCKH 2V3FA 2FD6H 3V0EA 4JZOA 5F7EH 3KXFB 1PY9A 3GS7A 1MFDH 1RHFA 2GKIA 3MFFB 3QQXA 4G6JL 4I7ZC 2B8OT 3E80A 4LLUB 4Y4FC 3OKDA 1QUPA 3D0AA 4LSVH 3FU9A 5BXFB 2JKJA 4UUJA 2KQMA 2ZXDA 4KQ3L 1KJ2B 3O6KL 3F7YA 3Q7JA 1BYOA 1CF8H 3VI3B 3A4DA 3QR2A 5I8OH 4FXKC 3ABLB 4MVBC 4HJEA 3AMLA 4KZEH 2L7EA 2X1OA 4XP9H 4FTDA 4NO0A 1JNHA 5I2IA 3PAYA 3ZL1A 3PWUA 2J8OA 3AWEA 4JEGB 3NBNA 5DRXB 4AQ1B 5DTFA 3ISYA 4YE4H 2E7BA 3CU1A 5DMGD 5F7LB 3RI5F 3VU2A 4YDJA 3S35H 3RDTC 3CZSA 3ROLB 2VN3A 1MFAH 3FRUB 3BAIA 4OLWL 4JDZA 4L8CA 1C16A 2ZG1A 1P7KB 3DRTA 4F58L 4YDMA 1L6PA 2V5RA 4XOAA 3UBXG 3HAEB 1ZXQA 2ZUQB 4KNFA 4NBZB 5I1JL 4H4NA 4FQXC 3HMWH 4JG9A 1Z5LA 1MSPA 1AANA 3JSSA 4HKXA 4Z8FL 1FNGA 4D94A 1OP5K 3LZPA 5I1HL 5KSBE 4PTUA 1JZIA 2PLTA 3P9LB 4NJAH 3BKCL 3UAJD 1DJIA 3RI5K 1QFOA 2DV6A 4JPKH 5C3LD 5BO1L 1GKEA 1G7MA 2HFGH 3BPLC 4IRJC 3VRIB 2OTWA 2IMMA 4JRYB 2Y02A 1I82A 4Q6IC 4OKDA 5BNXD 1DSFL 2XRAL 1DQVA 3V9EA 2LU4A 5JW3H 3LZFL 4KO9A 2F7RA 1GMIA 2CBPA 4N2EA 5EUKA 1U91A 3KGTA 2NZ1A 1KACB 1EA9C 4LIQE 5B21A 3ZE2F 5FPIA 4JAMA 1BRXA 3MV9B 2KT6A 1ORQA 4BEYA 3NFNA 4JFFE 1XBRA 2D7NA 2NT1A 2VR3A 4PREA 2BIHA 4RNRA 3DX0A 3NIDB 2AGJL 3Q9QA 4FKEA 2MOQA 5E2WL 5DVOA 1EEZB 1V55B 4BD4A 2B4CL 2IOIA 1KGCE 5TDNB 2F53A 1TF4A 4NBYB 5EUOA 4WSKA 2WLZA 3T2NL 3FTWA 3QP3A 1BQHA 3VFSB 2OR9H 1WZAA 3OJDA 4ZUSB 4JG1L 2XQYA 3KHOA 4XNUH 1T5WB 4MCMA 5E6IB 3TV3H 1MVUB 1QI4A 4AIOA 4DPBX 3UEZA 3O3AA 4PRIA 4WDIB 2UV3A 1DJWA 2BMKB 3DRQB 1K2DA 2P5EE 2BIMA 2R69L 5I75B 2EE3A 1HAWA 4LDLA 4A04A 3GMQB 3KYNA 3QRGH 1HDMB 3C5SA 4XX1G 1WFUA 3A5VA 1BFOB 1K4DA 2NX5A 3VGHA 2Y22A 1OB1A 3DO7A 1A02N 2F54B 1S8LA 4JQVA 1A6VH 4UINH 4U1SB 5CHNA 1QRNB 4N0RA 4PG9B 1ONQB 1FIGL 2AABL 2J8HA 1WVZA 4N2HA 5I23A 2L6XA 4HOZA 3RZCA 1F88A 1DQJA 2OMXA 4JMXA 4D9LH 3MRJB 4NFCA 4Y7OC 1JFPA 2XTJB 5D2LB 5IQ9A 4AXWB 4UM9B 4MQ7A 1CICA 1QO3B 4ODWB 4OV5A 3VH8B 4JRLA 1I9IL 3JQOB 1L3NA 1OSPL 5DYFA 3RDTB 4BQCA 2VLLB 1PKOA 3GYRA 2HVJB 2HJKA 3LHPH 4O9HH 3H2WA 2BCKA 3SDDC 3ZPDA 3QDJE 4HLJA 3US1A 5FEBA 5K9QG 4B97A 1JN6B 2WWOA 4WZ9A 4C4KO 5C09B 4BHUI 5DD5H 4AWJC 4L3CA 5H2KA 3VXNA 5LDSA 3LN4B 5EFIB 5INCA 2VDKH 1EAOA 2EDKA 1JNNL 4N8VA 4LKCB 2VUOA 3OLIA 1RUKH 3LYRA 2GK0B 4AC4A 4FE9A 4IRJB 1LD9B 4NQDA 3BT2L 5IQMA 2E27L 3CVHH 5ETZA 2FEEL 3UERA 5I1GL 5B4MD 4QYOA 3ZUNC 1UT1A 2VC2H 2YPLB 4MJ4A 1NCBL 2ZXGA 4XB8A 1Q90A 4BCXA 1B4JH 1JXGA 3FONB 3H9SA 4E42B 4K3JH 1IEAB 2VDOL 3VDBA 3CAFA 2DTML 3IMBA 1UKTA 1BVZA 2FEDD 4XOBA 1RP9A 5CGYD 5KJ7E 5B38G 2PWGA 1S7XB 2IDFA 5EORH 3H54A 3L48A 4MXQC 4BK5C 1H3GA 1SBBA 2PO6D 1KDJA 2PW2B 2WLYA 1EGJA 3BKML 1ET7A 4PRPD 3V52L 3FFCA 5A3IC 3SGKA 4KXZH 4P4RA 2F5BL 1XF5A 5G2NA 2P24A 3ZGIA 2XXMB 4AQAB 2NY5H 4LHUB 5LB1A 1NBVL 2GYSA 2HFEB 3K46A 1JERA 5DA0B 3WN5A 3K4DA 3G5ZA 4UTBH 5F0PB 4X31A 1MQ8A 3U30B 1WCQA 3NQKA 2FBJL 3O3UN 3QORC 5EZOL 1B3IA 2W88A 2AJSL 4Y19B 4O02B 4QOKD 3UZEC 1AQKH 2B9BA 1ETA1 4XP5H 4JW3A 1A6TA 2PW1A 1R3LA 5DD6B 2N3JA 3DJTA 3KPSE 4P2OC 2EUWA 1XEDA 4F9PC 1N2RB 1OE3A 3DURA 3U36B 2ZQKA 3NN8B 1MI5D 4HJGB 4RCAA 3B1TA 4DPCX 4OZIB 2D3VA 2ENPA 2EACA 5ABAA 1G5AA 2IGFH 4P2RE 3ZE1E 4J6IA 3N43B 1JZ5A 2AXWA 3WDHA 3SJVD 2OMBA 5CSZA 5IHLB 4IIQA 4QD2E 3WCYA 2CIKA 4L1TA 2G5BB 3GXTA 1JFHA 3FTGB 4B9YA 4K5MA 4YSEA 4UZSA 1OM3H 3TJEH 3GFUA 3T0WA 1I7RB 2CALA 3AQXA 3NDZE 3QUHA 1A7PH 5E6SB 4MA3A 1GVIA 4P2QD 4P57B 1VA9A 2RR3A 3ARVA 2AJUL 3HS0C 3FNKA 2UZXB 4M1CC 1BWMA 2FE0A 2VJ8A 4J3OH 2L8AA 5B1CA 1FO0H 1ZAGA 3T3ME 2Q3AA 3TPUA 3CXHJ 2DBJA 3VG9B 4JG5A 2V9RA 4UIMA 4QHUA 5IT2H 2HT2D 2YQGA 1M6OB 3WJLC 4OCWL 1MWAA 2BPBA 4HZLB 4NQCA 5CJQL 4OLXH 3WIIH 2ZOLA 5L88H 2APTA 3G9VA 1VERA 3IETB 1XO8A 3PP4L 1N59B 3ZZQA 1HZLA 4PJ9A 3WLBB 4OY9A 1FBIH 1SXBA 3F3HA 1KJ3L 4G9FE 3X1FA 3V0JA 2H32B 2NCEA 1EFQA 1BEYL 1XB8A 2HLAB 4Y1SA 4Z7NE 4O5LH 2A6KA 5SWSD 1PEWA 1CTMA 4TSAH 1I8MA 1HFUA 5M94B 4MASA 1JWUB 1QA9A 2ZCHL 3OWEA 1XF4A 5AD0A 4FNLL 5DD0H 3ECWA 4QXGL 3V0DA 1G1KA 4GRMA 4FFWD 3ZRCC 4HIIA 3GJEB 3MJWA 1BREA 5DFAA 5KYWA 2VJ0A 5SWZE 1JXKA 3MJ7B 4A2MA 3NIFF 2YCZA 4ISVA 4TUJA 1J0ZA 1KC5L 1NPJA 2DQFA 2YCWA 2R56L 4PJBB 5IM7B 1Q94B 3JUYA 5JPNB 3BGMB 5CZXD 2NQCA 2EINB 5CIPA 3TN0D 5E9DB 4NQEB 1NMAL 4WUKH 4POYA 2QQKH 3QRBA 3MNZB 5K39A 2NNXA 5GGUB 4OZHE 2FVNA 1LE5B 1QEWB 2E86A 2V5TA 2KDYA 4FFYL 4L3ED 3PNWA 3B7SA 2VAAB 3OR6A 4X6CF 3H1ZA 4WNSA 1H8OA 1IC4H 4KK5C 4NENA 1WBXB 2XV6B 3VI4B 4PJ8D 2PXYD 1JMZA 3STZB 4X9IA 2J1WA 1R75A 4J3WA 2EZ0D 3L3GB 4XBEH 4IHBA 3JWOH 1HSBA 3PDOB 3SKMA 5AW5B 1QSFB 1D9KD 1U6AH 1BD2E 3LDBB 3HE7D 3LV3A 5DEFB 3PG2A 4CU6A 5KSAD 1HKLL 3QWNA 4NM8H 2R4RL 2YSSB 1DQMH 4UOW1 3SKJL 3QZWG 1S7RB 1P7QB 1M2VA 4KITB 5KYNA 2OXGB 3W11C 3C6LD 5I0WA 2BIOA 3CXHK 3EJZC 3KS0H 3X3FL 3HI1A 5AKTA 1WHPA 1ETB1 5FXCH 3ATBA 1Z3GL 4DUWA 1CURA 1DJXA 2ENSA 5H94B 1ZK5A 4BRJA 4G9DB 2VXTH 4PW9A 3FUIA 4EF3A 1FVCA 4HWZA 4HIEB 1DBKL 4OLZL 3UTPE 1PG7X 3VXMB 3DROB 1NFDF 3D4CA 3D2UD 4RISL 2NY4C 2VDMH 4XMKL 1F4WH 4DGVL 1ZS8A 3HARA 3NTCH 4R90L 3UTTB 4AEFA 5I73B 5BRZE 4MXWL 1OHZA 3HJ0A 3G6DL 4E9TA 1IC0A 4LF3B 3LXAA 2BNRA 4YR6A 1IGCL 5TE7L 4L9LA 1EHLH 1VKXB 5J1AB 4TRPH 3TBSA 5AWNL 1CPUA 2NR6A 4JM2A 5JUEL 5ICZB 2WB7A 3L08A 3BH9A 1QFUH 2R1XB 4NXSA 3KNBA 5FGBA 5KOVC 3HG1D 4U7MA 1IM9A 4AEHL 3CN2A 4MHHG 1Z9SB 2FO4A 3WKPA 2C7UA 1QSZA 4K5NA 2M3GA 4UV7H 4Z7UF 4RH4A 3RWEB 4JPVH 1TKWA 4ONGH 4DZBA 4F37K 2DQJH 1RZ8B 3BAKA 3IMUA 1LHZA 3QE5A 4Y1AA 1L3WA 1X9RA 4KKAC 1KYUA 1JTPA 2PCFA 3LH8A 2FGWL 1QRKA 1P6AB 3NA9H 2FD6L 3EJRA 1IAIH 3DYMA 3PDGA 4I0PC 4I3GA 4R2GD 4XCYB 4DT2A 4EIGB 5F7EL 2YZ8A 1E2WA 1GS8A 3G5VB 5L2KB 1KUMA 3I9AA 3KJ4C 1CDUA 4Z0XA 3D48R 1NC2B 3ZDZE 4HEMA 2CDFB 3QUZB 4PMFA 2HTKD 4KNUA 5I8OL 1VGKB 1QQDB 1NEZG 1DQQB 4ZUVB 5FYLE 4DP4X 4OJEH 4UTAH 2Z92A 4FKKA 1JK9A 4HS3A 2OSYA 1COBA 2GW5A 2UWEA 1R5IA 1Y0LA 5F2FA 1CVRA 3RQ3A 4U4BA 4GUCA 4WW1B 2XYCA 3TO4B 5BUGA 4W9CC 3T0XA 3ZPRA 3CFBA 1UWGL 1TQSA 3S35L 4NQDE 1MFAL 3P0GA 2B3IA 1JDDA 1VIWA 3EOBA 1QMUA 1EEZA 1ADQA 1VADB 1NCNA 2YOCA 2DQTH 3B56A 3ATEA 5AYTA 1XH3A 5BPPA 2MOGA 3E9TA 3JVGA 4XNQA 4G1EA 4YZFF 3FN0H 4J27A 5I74C 4NKIL 3LPFA 1MHEB 1JV2B 4LPVA 2EXWD 3KPNB 3FB8A 3QQ4A 1GZPA 3BWUC 4DGYH 3TXAA 4FQJH 2DN7A 3FSVA 4QRRA 1CVSC 3MBEA 4CVWA 4UBDD 4HOMA 3ILPB 5CZVH 4JFXB 2X6MA 3V0AC 2Z91A 2WZ5A 3MROA 3UAFA 3QWRD 1AYRA 1W8NA 4D0DB 1BFSA 5I19L 4TUKL 1MHPH 4CVZB 4NUJA 5JW3L 2FR4B 2Z8RA 1G6RH 4Y4FA 1QSVA 2ZJSL 3CH8A 3QDGA 5E8PA 3V2AR 2ZZLA 1R3KA 4UT9L 3RVVC 5I0YA 5HYSG 4ELME 3W9DB 1GH7A 4FXKA 4LCWB 4EBQL 2X89A 3LKRA 4KJYB 1BXUA 4MSWA 3U48A 4M6NL 4HJJH 4ELKB 3NJGA 3DX8B 4NUPA 1MNUH 4I1NB 3ULUF 1DVUA 1RVFH 4ZYKA 2H6PA 4I9XA 4JHVA 3L5XH 4PUBH 3L5WB 3AAZA 4YSQA 1SDYA 1UM5H 1OQOA 2B16A 2NDGA 2PR9A 3RDTA 2FJGA 5DRNA 4WENB 1ORSB 5JQHC 1KJ2H 4PJAB 4XCEA 4MFHA 3MRBA 5EN2A 5AAWC 3A4AA 3IGKA 1JIBA 4DKFL 1HE8A 2AXFA 5EC1B 1DE4B 1JF5A 5LCVL 2CA4A 3AM8C 4DHLA 1BOGA 3TV3L 5TQ2L 3MLXH 2QQLH 3NSXA 3VFVA 4AQEA 4JDVA 4FQXA 4C58B 3ZE0E 3S4SB 1BPVA 2CJ3A 4BFKA 1ICTA 4HP5A 5K9KA 3D07A 3FTSA 4ODXA 2Z8WC 5EFIA 5F7DB 1AZVA 4A2LA 4HX1B 3KD4A 5JLZB 2BX5A 5HPMA 3FTUA 5H2LA 2CKNA 2BSBA 1QSEB 1FLTX 2P8LB 1QKPA 4IRJA 4KY1H 2QSCH 2D7OA 4Q6IA 4YN3A 1JXDA 4MAYD 2WJLA 1PZBA 1S7UA 1S9WA 3DX7B 3SGEI 1IQWL 3EHBC 3HAEH 4NRZB 4WEMB 3MBWB 4ZFOA 1GCFA 3MGTB 1ZIAA 4LQFH 4N2LA 3D09A 5DHYA 4X80H 2K4AA 4LLDA 4WW2B 4QPEA 5E00B 1UEMA 4EI5A 4NRYB 3NYAA 3O11B 3E7JA 3IGAA 3BLKA 5MHSE 5EPMA 3AQZA 4GW1A 4DETA 1AZCA 3FSWA 5EG6C 1S46A 2D9QB 4R96A 5FF6B 5E0FA 5EBLA 3EBGA 4AC2A 1E8ZA 1OPOA 3LHPL 5LUMA 1IZKA 4GSQA 4E9VA 2ODHA 2AKRB 1M1SA 4XP6L 3AQYA 4WJ5B 3M07A 4U0RC 3W82A 4AGQA 1AS7A 2IH9A 4KXCA 1IW9A 2A6IB 4GXFA 2IFGA 3MV7D 2R0KH 2X4QA 3PFUA 4GUPB 1LYQA 5DFWH 1CFNB 1I8IB 1NCHA 1NGZB 3QDMA 4PGEA 5LGJA 1PX3A 4ZQTA 1AH1A 5EOTB 3STLA 2A77L 4O02A 1FWXA 2F7PA 3GHEH 4XP4H 1RY7B 1OGTB 3AC0A 5HI5D 4AMKH 5I18H 1S3KH 3MU3A 1SQMA 3FH5A 1RUKL 2HP4A 4QY8B 1E4JA 3U36A 4Y2OB 2XACC 5JMOC 4MD1A 1WD8A 4XPFH 3CVHL 5GPRA 5G36A 2EIZB 3HKZA 3JBG7 4RWYL 4G7SB 2C3XA 3H6AA 5HGAB 3VYPA 4KX7A 1QG3A 1TU2A 3E6HB 3B5TA 4P3CH 4K2UH 2VM3A 1TIUA 3NH7H 1TITA 2EJ1A 3CQPA 3C2AH 3UH8A 4LKXB 4LXFA 4Y4KD 3WD5H 1U3ZA 3WXVH 1TVBB 1LL1A 2C5DC 2WXGA 4W9ZA 2YD6A 4K5OA 4MXVE 1JV5B 5FUCE 4MD5A 4HUMB 4G3YL 1O6SB 3VFTA 4IBQA 3GMMA 1GOFA 2LR4A 4HSQA 4HBCH 1MVYA 3HKFA 3GSUB 3ZLQC 2QR0B 5EWIL 3OHMB 4E9QA 5HHXL 3SDDA 4NHCH 3UMNA 5DFVC 2GSIA 3U4AA 2QQQA 1GGBL 3QFDA 1OTTD 1FAKT 1QFWI 4OV0A 3IE4A 3I02A 3PJSA 1EZUA 4PTTA 2NXZB 5EU6B 3DVGB 3COOA 5JR1H 4PWGA 3QYMA 3IMSA 1KLGB 3MRHA 1YDPB 3KXFE 4G8AC 2IGFL 3EYVB 2GITA 2R0WH 2YC1A 3LEYL 2WWKT 3IAQA 3SQRA 2IF7A 1SMDA 2E56A 1CLOL 1S7SA 2OMWA 1S8JA 4A2FA 3TJEL 1KPUB 1I8LC 2M1KA 2YRPA 3MLVL 3VI3E 4GUOA 2XIDA 3T08A 2ARJQ 5I17B 4MJJA 5I1AA 1SXSA 3QBIA 5C08A 1WJ3A 2DLFL 2BP0B 2Z55A 3TEWA 4OCLC 5CO1A 1KIQA 2AT9A 4DPRA 5IM7A 3OXRA 3ARFB 4I18C 4BK5A 2R69A 3GTVA 4QKXB 2IPTH 4YHIB 3TIEA 3CDGB 2Y7MA 2VUKA 3MOQA 5F1NA 5L7XH 3CC5B 2XVGA 1ZT4A 5IT2L 1U8NB 1PAMA 3BD3A 3C9NB 3D2TA 3FQNB 2N0MA 2JI2A 3D0VA 5IJCC 5FKPA 3WIIL 1QNZH 1CLZH 3QORA 4K7PY 2WIIA 3E6FB 2WBKA 4N9GB 2JH2A 3UZEA 4A7GA 1C12A 2X40A 3FSZA 1AS8A 5DURD 5D6DC 1SDAB 3NMEA 4L1SA 4XNAA 1EO7A 3GXIA 4P2OA 2IAAC 4F9PA 1I7ZA 1WBXA 1WF5A 4NUQA 1A1NA 5A2LH 4GKZA 2EH7H 1OCRB 3PWVA 1ODAA 5AAMC 5AEAA 4H1LA 4YWGH 3ILQD 2NY7H 4OJCA 3KM2A 4JRYE 1SPDA 2NNAB 1G1OA 1ZLVK 4YNYB 1I1AD 4E36A 2HUHA 1YY8B 3PHOB 4JO3H 1IAIM 3QT2A 4KROB 4PJ7F 4LPYA 4BH8B 4KKCC 5JHLL 3QUGA 1P7QA 2E9GA 3D52A 4ODSL 4ZPTA 5IGXL 1E50A 1IBGL 1Y6NR 3MV9E 3HS0A 5ITFB 4ZTPL 2VW6A 5HYJA 1TNNA 2YKLL 3BZ5A 5GZND 2FLBT 4ZDHB 3NIDE 4WUKL 1T89C 1RERA 2QQKL 5CP3A 2K9FB 4CC0A 3MRKB 1CGYA 1SN0A 5BZDA 3KEHA 4HHGA 2JE8A 4AX3A 5C0JA 1MFMA 3APMA 4BHUA 2VDLL 3WJLA 3AM6A 4ALAC 3GSOA 5LQBL 4LLVB 3QWOB 3SB3A 4Z1PA 4OZGB 1G7QA 2ATKA 2FB4H 4BVNA 4FFVC 4P46C 4PB9L 5AX0A 3KH3A 4I3RL 3UTTA 5H37G 2Y24A 3N55A 4N9OB 2ZKMX 3OGCB 4LT7A 4FYRA 1M0MA 2DWEB 1MGYA 4KUZH 2C9PA 4LEXH 1G9MH 3IF1A 5E70A 4Y2LA 2P5WD 4GQPH 1RP8A 2APBA 4DCQB 1FL5B 1JL8A 4W68A 2QQNH 1SHSA 3JWOL 4RVBA 1I1FB 4NZUH 5KZCD 3PPEA 2F54E 1OANA 1JPFB 2WJ5A 5AB9A 2VDPL 1QRNE 2DL9A 4GB9A 5TDPB 1TZOA 4P0DA 1DQML 3LXUX 4WSGA 4A2DA 1BVKA 3U46A 1N67A 4JY4A 2QTEA 4H5SA 4RZCB 3VMNA 4NOFA 2H32H 4I5BB 3SDCB 2ALWA 2XTJE 35C8H 1BFTA 3B2MA 3HRPA 1U21A 5D2LE 4KJQD 4QHLB 2F8VA 4RIRA 3LKSA 2I21A 4CA4A 3BUDA 4I18B 3BUYA 3AYNA 4B53A 4GMTL 4X4ME 5FO8A 2DMHA 1PF3A 4KQ4H 2NY3D 5K33A 1H3XA 5D1ZB 5D7KE 3OLDA 1C1EH 2ZXCA 2GAZA 1ERNA 2VL4A 2XXGA 3ZT5A 1HL8A 1A66A 2VDML 3SZ6A 1AGCB 4HK0B 1DVSA 5DF0A 1DO5A 1G7JB 4D0CA 3NTCL 1UVQA 4WEEA 3MZGB 1MCPL 2CLRB 4OF3A 1ZHKB 2LU3A 3Q2LA 4QHPA 2BVQB 1BPLB 5CS7A 1A64A 3BP7A 2CO6B 4MNQA 2K6YA 1QFUL 1JPGB 3CSPA 4PY7B 2W91A 4I1PA 4XH2A 3N42F 1KG0B 3H9ZA 4XPGL 1SBSH 2J5WA 2XETA 2WBJB 4WK0B 4NZTL 1JGVH 3ET9F 3QFJD 1VEOA 1U95A 1QLFA 2MQCA 2NTSP 4ZXBD 4PS8A 4UV7L 3TM6A 4UF7C 1O6VA 3AADB 5C3TA 4JPVL 2YPLE 3CFIC 2C4FT 3IRCA 5HGDA 3ARPA 1D5IH 1WC7B 2AJYL 3Q0HA 4LASH 1FGVL 3UTQA 1PXSA 5JO5A 1YEFH 5BUPA 2WQXA 3J7HA 4YFLF 5MENB 2DQHL 3AROA 6TAAA 3W5MA 3NA9L 4PJGB 3RGVD 1N70A 2WWMD 1ITBB 1JJUA 2YO3A 4NN7B 2A99A 1EXUB 1OPGL 4Y9GA 1J05B 5GSVB 3D12B 2Z0BA 3US0A 1I9RH 1SXNA 4KK6D 1J12A 2Z35A 4YSUA 3ESPA 3ZL4H 4Z3IA 4P46B 3QPXH 4HULB 5D5MA 3RU8H 1G6VK 3DTXB 1NCWH 3HI5H 4Y19E 3W9DA 3P77A 2YMXH 4XWGH 5C92A 1EERB 3CZFA 3NSYA 4AGOA 4ZUTB 3T0BA 4CUCA 2DQUH 2G60L 1KB5A 1ACXA 3LQZA 2CHNA 5GGRA 1FFPA 3PAZA 4OZIE 3FAWA 5BJTB 3KLHC 4L1DA 4PBDA 4PJAA 1JK8A 1A4CA 2HVBA 4R4ND 2UXVA 3BN9D 1E8YA 5AL0A 2XDHA 2DWTA 3CLEH 3WY1A 2B1HH 4DGYL 3HRZC 5FA3B 5GRWA 1TPXB 5HVHC 1WP6A 3WKNA 2R1YA 2NDFA 4PAZA 2W38A 3WTTA 4G72B 5CZVL 1LMIA 2FH6A 3FB6A 4I0PA 4HX1A 2OP4L 5D7JC 4X9GA 4N22A 2PO6B 2X2YA 4J28A 1I7TB 3EFDH 4PJDF 5ENWA 4PYHA 1TYRA 2E8YA 1F2QA 2JJTC 4CRPA 4HIJA 5CEZH 1SY6H 2FL5A 4KH9A 3KPPB 4W9IC 1YPZF 1QTSA 2G3NA 2J4WH 3ESNA 4TNEA 2BWDA 5ID0A 1B4RA 1KY7A 1QZ1A 4MWFB 4UDTB 1MXDA 1KGYE 4X4KA 2R4RA 4LDOB 2XWZA 3EG9A 1HCVA 4OZFB 3GSXB 4LLMB 4NO5B 4QOKB 5GS1B 4DEWA 2OL3L 2VZTA 3QUYC 3VD1A 5MEOB 5EU3A 5ANMB 1Z3RA 3HFML 5DJ8A 3KJ6A 3VJ6B 2KS9A 1ETZA 4U3CA 4U49A 4TVUA 5C1MB 1DANT 4QWWC 4KRMB 4BKLB 1UM5L 5GS2D 2ROYA 1YEEH 3F7VB 1R24B 1M71B 1VJSA 2JB5H 4L8DA 4DP8X 1NMBH 3GSNL 4J3BA 4L1LA 3MLPA 3JV6B 4GXVL 5I8KL 1NINA 2VERN 2F95A 1LQSR 2BVTA 1GR7A 3B43A 3NT0A 1QYGH 5EZPA 2Q5BA 5LXGL 4PGDB 1S9VA 2YWZA 1NGYA 1LP9B 1ZV9A 2I07A 2OSLB 5HJGA 2KSYA 3HB3D 4IGBC 3B7UX 1Q9WB 5I16A 4GRWB 3GBNH 4P2QB 2ZUYA 4HS8H 4PJBE 4YBHA 4ZG1A 1DQDL 1A3LH 2GEQA 1Q0XH 3W38A 1P9MC 3MHZA 3IFOA 3ZSSA 4LPXA 3QARA 1X5AA 4NQEE 5E9DE 2QSCL 2FQDA 1YO4A 4UOZA 2AV1B 3R18A 3CH1A 4TQHA 3WNLA 1OB0A 5DZJA 4G80A 3APCA 4CMHC 4CKQA 3RNQB 5JDSA 3K3QA 5BS0D 1CJYA 2WLIB 1AY1L 1G1YA 5HGAA 4AYID 2R23A 2R8SH 2JCCB 4YSSA 5HPOA 3O8XB 4FQCH 3IRPX 1O7DC 5HHNB 4L4TD 3AY4C 4RGMB 4EN3D 1CT8B 3VI4E 4XNYH 1SLXA 1YQ2A 4R4BA 3WIHH 5C7XH 3DUSB 1OT2A 2GBTA 4FCAA 4HT1H 1OAUH 5JW5A 5AYQA 5C0BD 1PZDA 5KANI 2A83B 3EYQC 1QSFE 3FCSB 1N3NB 1P5UB 5AAWA 5FYJD 3RVVD 3VXUA 1A5FH 1D5XB 2R0KL 2EECA 3L9RB 5KVFH 1T20B 4I85A 1FVDA 1UZ6E 3AM8A 4JNXA 2X41A 2V2WA 1QLRB 3TBBA 5HVHB 4MD0B 3GHEL 3ZRSA 1HINH 2Y7OA 2JB6A 3UCRA 1WFOA 3X3GL 1AGDB 5I18L 3ZGHA 4ATWA 1C08B 5D7LD 5D7JB 1B0GA 3SN6N 4JHAL 1Z0MA 1Q1JH 2GSGB 1WWWX 2OXHA 3B5HA 5A6LA 3PGCA 2GT9A 1U2YA 1W6WA 5J13C 1MLBB 1MLCA 2MTPA 3S6CA 3CPUA 3I84A 3S35X 1S5HA 3VXME 2FO8A 3BP5A 1SVCP 1BF5A 3PGDB 3T4YB 4WFEE 2E75C 2Z64C 3D18A 5ESAB 1KCRH 3UTTE 1BQHG 3WD5L 2XQYG 1Y1DA 1A7NL 1AD9B 4PRHB 3FXIC 4GKSB 4B27A 3Q9PA 1F00I 3HHRB 4OFQA 4S0SD 1WAAE 3VFUB 4PJ8B 1KSRA 1NL0H 2ZXBA 2YD5A 3BKYH 2JJVA 3MCYA 4HBCL 4OCSL 4PP2A 3WEXB 3ZDYB 4Q9RH 1XCQA 4NQSB 3C9LA 2B0SL 3Q1SH 4QHKI 5IMLA 4LCIH 4PVLA 2F18A 1AQDB 4POZD 1HQRA 1MZYA 4URTB 4H13C 4PGCA 1ILSA 3DOIA 5CJ5A 3M7OA 1HILB 4IGBB 4UT9A 2V8MA 2SEBB 3V6FA 4GJTB 5C9JB 1Q72L 3GMOB 3FQXA 3WXWL 1MCFA 5AZ2L 1ASPA 2ISDA 3MJ8B 2FQEA 4X6EB 3V9FA 5EF2A 5C6TL 3B2VH 1F6AA 3ORJA 5I6KA 1XVSA 2X87A 2YRLA 3LEXB 2AEIT 1HH9B 4YEFA 3S48A 5L2KE 2BERA 3DPBB 3KPLA 1FCCA 5TGBA 4JO4L 4E2OA 2YXMA 1AD0A 1TZHB 2DWDA 3SBRA 4GSRA 2Z8VC 3T1FA 1HKFA 3LNIA 3PDSA 5LCVA 3VGBA 3K2KA 1TQTA 4NUMA 1BFVH 3TA3D 2EQDA 4QO1A 2Y9RT 1HZHL 2EDRA 2V5SA 1GSKA 4L4VA 5TPWH 2IPTL 1JWSB 3OF6A 2XN9B 3GJFB 4GW5B 4JFDB 5GJSL 1K85A 2VN6A 3B2UC 3I75B 2I35A 3MRKA 3ENEA 4XHJC 5HDBF 4L6RA 5I1EL 4HIQA 3U2IA 3ARDD 4WFHE 4X7FC 4YDVB 1G7IA 3CQQA 3C8DA 3LEVL 2EC9T 3AG2B 4NNXB 5TF0A 4Z7NF 1WV7T 1CLZL 4JQXC 4FRWA 5A16A 3AABA 5FA4B 3EOTL 1CBVL 3KBFA 2X4SB 3JXAA 3F12B 1LEKB 3GXPA 4FA7B 4HUXA 3BVWA 1ET5A 2OMVB 3CXDH 5EIQA 1DBAH 2Y5TA 2A6JA 4TLUA 4R2GB 4OGAD 5F7HA 4KKRA 3KPMA 4H7VA 1OSEA 1QTYT 2NY7L 4XO9A 5GIRA 3UJTH 2H2SC 2ZUSA 1I1FA 3NGBB 3TJHC 1VFOA 4JM4H 2VABA 5CU9A 5JW4R 4KZDH 1AXTH 5B2NA 4WHYH 4YHPA 4JO3L 5FV1L 2WXOA 5TQ0H 1I8LA 2O5YL 4FZEH 5HDLA 2GJ6D 3IFNH 4LCWE 3FW6A 1MAJA 1UOVA 2BSDA 5KVFE 5CM1A 4A66A 3HNVH 4QRUB 4AK2A 4JHWH 5C2UB 5IFHH 3X12B 3GO1L 4EEEA 5MEPA 4JUSA 3RWIB 4HH9B 4DP1X 3E38A 5KVGL 2V6HA 4NEHB 4S1RH 1X6LA 3WHE0 1AO7B 1BP3B 4I18A 5TGZA 2IDUA 5GXBB 1T0NB 3EYSL 3MO1A 4MJIB 2J55A 3JWDH 4DOHB 4YC2C 2HRHA 2WGNB 3MRDA 3I2CL 3N44B 2XVKA 3V0WH 2AXGA 5KVEE 5EEUA 2ZYIA 4PJAE 5C0DA 3WY4A 3ME0A 1MELA 5J11C 3PWPA 4Q56A 1AGCA 4ATTA 1YN7A 1CXHA 3QUXB 1BXXA 2YBRB 4BFEA 3ARTA 3O4OB 5IHUH 1HHIA 2ZWNA 1Y07A 1J1PH 3TBVA 5D6DA 4LEXL 1BX2B 1DHKA 4B9KC 2OBGA 4HJ0C 5TF1H 2YD1A 2IXQA 1DQKA 1IEBB 3KWXA 1NCDL 4FN0A 2Y72A 1NC4D 5AAMA 3NCEB 4OAWB 1Q9OA 4NZUL 1QSEE 2LVEA 1ZVHA 3D3VB 4U1NA 4YDIL 1ZGLB 4CGUB 1EAQA 3EO0B 4JPQA 1AP2A 4ZW3A 2HMID 4BH7B 1B90A 1SMAA 5J3HC 3APFA 1G9NC 3JV4A 4CN1A 3NSBA 2E9JA 3BQUC 4BWBA 3KL5A 3NPSC 3GLDA 3ELQA 3LKQB 3INUH 4S0TD 2A0LC 1ZEAL 2PWEA 2WM0A 3BZ4B 1E3ZA 2JKIS 3ARBD 4FNTA 4P3DB 4N8CH 4HPYH 5E5LA 1OE1A 5EUOF 4DQOL 2KZBA 3V0IA 2IWKA 3QIWC 3VI0A 3IDJB 5MENA 1GTNA 4HDIA 3MLYL 4KQ4L 1T89A 1C1EL 2W65A 3OMZA 3M7FB 4HUUA 4HKZA 4KOBA 4BSVA 2VWEC 3GI8H 4HC1H 4Z7QB 4ZOEA 1J48A 2DQEL 3AG4B 4N2OA 2XWXA 4F24A 2EUVA 3P40A 1CLCA 1L7TH 2ILLA 4P46A 3QQDB 4LSUL 3SKNB 4M7LL 1HC1A 1UA3A 3VSQA 2HFFB 2GBAA 3M1CA 1BM3L 4LSQH 3ARGB 5FYKD 1DYZA 1F56A 4IK6A 1JZJA 2JSFA 4J3VA 4OF0A 1MCQA 4XO3A 5A2BA 1T3FA 5IQ7H 3WAJA 2NTFA 5E4IA 4G8IB 1NFAA 4JFEA 2VE6A 1SBSL 4XNZB 1A6AB 2F61A 1KYDA 2C8NA 2OV0A 2O5XH 4IOFD 2W80C 4LSRH 4PBVC 1HSAB 3QG7H 2ZXAA 5IB2B 5FDWA 3H2PA 8FABB 1PY6A 3U0WL 1I31A 3OLEA 4WSJA 2FUQA 1SJMA 5DC9B 3V4UH 1UH3A 3E2HB 1D5IL 1HTYA 3P4NB 5IG7B 3FCBA 3P9MB 4JFQA 1XF3B 1XJIA 3BEWA 1YEFL 4U6HA 4JM0A 1RZGB 2I9TA 3VXSA 2FYYA 4FLHA 3VD7A 4G6FB 3T0ED 1C8RA 4PY8I 1H5BB 3ZDZF 4X32A 3QBTB 3U9WA 4AI7A 3LH2H 3QXTA 2VGLM 4PRDA 3NZHL 1S4IA 4E41A 3U0TA 3BO8B 3PY9A 3HZYA 1DVYA 2J1XA 1YMMD 4F57H 3ZL4L 3R7QA 3UAAA 1L0MA 4L8SC 2ARJB 2ZUWA 3NZSA 1IVTA 2HKFH 4YXHL 2WVTA 1A6WH 3D7PA 1WQVT 3RU8L 7FABL 1NCWL 4NC0B 3C6EA 1PNDA 4UYQA 2VDNH 4XWGL 2VLRA 5HXMA 1YYLH 4WUUD 5FFGA 5JHLA 5DO8A 2DQUL 3GWJA 5A6IA 1HXYB 5MEOA 1IGJA 3BPNC 4N6RB 1UB5B 2CM5A 2EDDA 3NZ8B 2YD7A 3QDHA 5EU6E 3IU4H 3TCXA 1Q9KA 1UACH 3KG5A 3R4RA 1UJ3B 2XN0A 4HVBA 1PZ5A 3TBWA 3BQUB 3O81A 1RXLA 4MJ5B 1F50A 2EIBA 3DOSB 4N2FA 1B0IA 4J3TA 3ASOB 5E7FA 1DDHB 1H0DA 4JGJA 2B1HL 2K8MA 4WKZA 2Z1KA 3U4BH 3ZX1A 5FWQA 4XPAH 5H2IA 3SDAD 4OVVA 2NY2D 3GGWA 5KOMC 5F7YC 4X83A 2ITCA 1A3ZA 4PLKD 4JJ5A 4OFVA 4P5RA 2WCSA 1YN6A 5CEZL 3G7TA 1KXQA 1KENH 4ZAKC 2PYEB 5BVJA 1OK8A 2H3KA 1MG2C 2DTSA 2IANA 1AG0A