4G75A

Structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
292
structure length
292
Chain Sequence
b'VMDLGTTTIVAGQGDFSAYNYGNNGANWPAPSPAQVGYISKGQRDVAYVNGDWEKPLLALWAQWANWGTTLYGYPSLPFPNYEFIWDIFDLPQADYNQFSLGDDRITAMNRAQNHQYPFPNNEGIPSWDRPKIDTFNGGVYTPAAAFAHYLTGKGKKMNFPIERLNIKPNVKAMPQFIGVLTSSPMGQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVKSTSGQWSFRGEIRAYDDLYDFNPSNHRTETAEGMTRLGREVGQKFKDTTPYPIGIPGAIPVNISGRSHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphodiesterase
publication title Functional and Structural Characterization of PaeM, a Colicin M-like Bacteriocin Produced by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 79
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.280 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4g75A01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4g75A02
2XMXA 3DA4A 4G75A 2XTQA 4N59A 4FZNA 3DA3A 4N58A 4FZMA 4FZLA 4G76A 2XTRA
chains in the Genus database with same CATH superfamily
2QZGA 2FGQX 1P4TA 1GFOA 3VE1A 1QJ9A 4D65A 3WI4A 4XNKA 2QGMA 4KR4A 4GCQA 1YS5A 1T1LA 1GFQA 2KZ7A 3PQSA 3JTYA 4JFBA 1QJPA 2GE4A 2MNHA 2JB1A 1ZHYA 2XE5A 2PORA 2O4VA 3AA1B 1SJ8A 2W80C 5E79O 1TDPA 3KZIO 2L1LB 2XTRA 2V1CC 4FT6A 4K3CA 2X9KA 2BL8A 2J1NA 3BRZA 3LJ0A 2F66B 5LNK1 2XMXA 4AFKA 2KDYA 4N58A 4O3XB 2Y0HA 4GCSA 5DL7A 1U5KA 4FZMA 4LSIA 3IAS1 4PL4A 3WI5A 1BT9A 4GXTA 4G76A 4FMSA 3UITA 2KC0A 4RJXA 3SZDA 4B61A 3AA7B 4KR8A 5AFUK 5ADXK 3LK3B 4AZLA 3LK3A 3SYBA 2MHLA 4O4XA 2M06A 4C4VB 4RLCA 4Q9VA 3KP9A 4C4VA 3DWNA 4AYID 3LK42 3JSBA 4PUXA 3PGSA 3I9V1 3WU2O 3VE2A 3TZGA 2JQYA 4G75A 2IWVA 3HOLA 6PRNA 3VZTX 4AKRA 3BRYA 2F1TA 3UPGA 2P22B 1ZHZA 2R89A 2JB3A 4Z7GA 4O3ZA 2F6MB 5B66O 1W3SA 1G90A 2R4PA 2ZW3A 2FGRA 3AA0B 5DL8A 4K3BA 3O0EA 3AA0A 2FUG1 1HXTA 1S5LO 5DL5A 3POQA 4OAUC 3T20A 2RIOA 4O49A 4E1SA 5IYUA 4YZ9A 2AXTO 4FZLA 5TISO 3LJ1A 2R8AA 4DWLA 3AAEB 4PL5A 3VY8X 5GTIO 3PRNA 4FESA 2K0LA 3AA1A 3PF1A 4JCVE 2GSCA 3QRCA 1H6S1 1T16A 4GF4A 5GV0A 2WVPA 1GFPA 3VY9X 4O3WA 2XE3A 4Z3TA 3VA9A 4I1TA 2N2LA 3PGRA 4O4UA 2R88A 8PRNA 3PORA 4FRXA 4PJ0O 4GCPA 3SZVA 1OSMA 1PHOA 3HOEA 3SY7A 3A0HO 2RADA 5KAFO 2FU2A 4O1OA 4C69X 5G3AA 2F1CX 1E54A 4AS3A 1GFMA 3V8UA 2MJFB 2ERVA 4FSPA 3AA6B 3FBVA 2A2DA 2JBWA 3AA7A 4FUVA 5G38A 3NSGA 3NJTA 3DA4A 4D64A 4N59A 3DO9A 5ADXL 5AFUL 3HWBA 4LSHA 1HXUA 5HGIA 5D5DA 2XTQA 3VZUX 3POXA 1ZHTA 3HW9A 4YZDA 4IL6O 4BUMX 4JCHA 2PRNA 1Q9GA 4O3YA 2XE2A 4D5UA 1THQA 2RLDA 3RBHA 3BS0A 3FVVA 2R4OA 4UB8O 3AAAB 5DL6A 4AYNA 3AAAA 2ZRRA 4RLBA 2IWWA 4UB6O 3SDJA 2Y2XA 2YNKA 4LSFA 3PQUA 1ZHWA 3VZWX 3DZMA 2KKMA 2ETDA 1MM5A 5T5FA 2FEFA 4AS2A 3FYXA 2R4NA 5JDPA 1MPFA 3LK2B 2CAZB 4NV2A 2V6EA 2N2MA 3LK2A 4AKMA 4AUIA 5B5EO 1MM4A 4N74A 3P23A 2Y0LA 2OMFA 4GHBA 1GFNA 2JB2A 1ORMA 3UAQA 5FVNA 3G7GA 4U9CA 4AYDC 2A2CA 3SY9A 1BXWA 5PRNA 3A2SX 5G26A 3AAEA 3C5OA 1Q9FA 2LHFA 4NV5A 3LK41 2KXPB 4OAVB 1IZNB 2KXPA 1IZNA 4KRAA 2YPVA 4E1TA 3A0BO 2BL7A 4YZCA 4QQ1A 4AYMC 4FRTA 2KZ7B 4CTDA 4N75A 3FNBA 4U6RA 1OPFA 4HEA1 5KAIO 2J4UP 2F1VA 3SYSA 1PRNA 1JQOA 3AJFA 3DA3A 4Z7HA 2K19A 1BH3A 2ZLDA 4FZNA 3T0SA 2WJQA 3JCUO 4RJWA 4C00A 4RL9A 2ODJA 2ZFGA 3QRAA 3AA6A 2WJRA 4FSOA 5EE2A 5H2FO 3LJ2A 2HGKA 4PR7A 4PL3A 5GTHO 2XE1A 3POUA 2R4LA 2X27X 3B55A 7PRNA 4FOZA 3PGUA 3L0IA 4O1PA 2IP6A 1YO7A 2QTKA 3UU2A 2W81C 1QJ8A 3GP6A 4XNLA 5G39A 4AYEC 3DWOX 2JMMA 3KVDD 3K19A 2YFAA 2LFUA 4AKRB 2QSBA 2Y0KA 4HFVA 2K4TA 2M07A 4LSEA 2JAEA 3F4MA 2E8GA 3T24A 1HXXA 1ZHXA 4F4BA 4FQEA 2Y7SA 3Q8DA 2YFBA 3EMNX 2XG6A 3IAM1
chains in the Genus database with same CATH topology
2FGQX 1P4TA 1GFOA 3VE1A 1QJ9A 4D65A 3WI4A 4XNKA 4KR4A 4GCQA 1YS5A 1GFQA 2KZ7A 3PQSA 3JTYA 4JFBA 1QJPA 2GE4A 2MNHA 2JB1A 1ZHYA 2XE5A 2PORA 2O4VA 3AA1B 1SJ8A 2W80C 2L1LB 2XTRA 2V1CC 4FT6A 2J1NA 3LJ0A 2F66B 5LNK1 2XMXA 4AFKA 2KDYA 4N58A 4O3XB 2Y0HA 4GCSA 5DL7A 1U5KA 4FZMA 4LSIA 3IAS1 4PL4A 3WI5A 1BT9A 4GXTA 4G76A 4FMSA 3UITA 2KC0A 4RJXA 3SZDA 4B61A 3AA7B 4KR8A 5AFUK 5ADXK 3LK3B 4AZLA 3LK3A 3SYBA 2MHLA 4O4XA 2M06A 4RLCA 4Q9VA 3KP9A 4AYID 3LK42 3JSBA 4PUXA 3I9V1 3VE2A 3TZGA 4G75A 3HOLA 6PRNA 3VZTX 4AKRA 2F1TA 3UPGA 2P22B 1ZHZA 2JB3A 4Z7GA 4O3ZA 2F6MB 1W3SA 1G90A 2FGRA 3AA0B 5DL8A 3O0EA 3AA0A 2FUG1 1HXTA 5DL5A 3POQA 4OAUC 3T20A 2RIOA 4O49A 4E1SA 5IYUA 4YZ9A 4FZLA 3LJ1A 4DWLA 3AAEB 4PL5A 3VY8X 3PRNA 4FESA 2K0LA 3AA1A 4JCVE 3QRCA 1H6S1 4GF4A 5GV0A 1GFPA 3VY9X 4O3WA 2XE3A 4Z3TA 3VA9A 4I1TA 2N2LA 4O4UA 8PRNA 3PORA 4FRXA 4GCPA 3SZVA 1OSMA 1PHOA 3HOEA 3SY7A 4O1OA 4C69X 1E54A 4AS3A 1GFMA 3V8UA 2MJFB 2ERVA 4FSPA 3AA6B 3FBVA 2A2DA 3AA7A 4FUVA 3NSGA 3DA4A 4D64A 4N59A 3DO9A 5ADXL 5AFUL 3HWBA 4LSHA 1HXUA 5HGIA 5D5DA 2XTQA 3VZUX 3POXA 1ZHTA 3HW9A 4YZDA 4BUMX 4JCHA 2PRNA 1Q9GA 4O3YA 2XE2A 4D5UA 1THQA 3RBHA 3AAAB 5DL6A 4AYNA 3AAAA 2ZRRA 4RLBA 3SDJA 2Y2XA 2YNKA 4LSFA 3PQUA 1ZHWA 3VZWX 2KKMA 1MM5A 5T5FA 4AS2A 3FYXA 5JDPA 1MPFA 3LK2B 2CAZB 4NV2A 2V6EA 2N2MA 3LK2A 4AKMA 4AUIA 1MM4A 3P23A 2Y0LA 2OMFA 4GHBA 1GFNA 2JB2A 1ORMA 3UAQA 5FVNA 3G7GA 4U9CA 4AYDC 2A2CA 3SY9A 1BXWA 5PRNA 3A2SX 5G26A 3AAEA 3C5OA 1Q9FA 2LHFA 4NV5A 3LK41 2KXPB 4OAVB 1IZNB 2KXPA 1IZNA 4KRAA 2YPVA 4E1TA 4YZCA 4QQ1A 4AYMC 4FRTA 2KZ7B 4U6RA 1OPFA 4HEA1 2J4UP 2F1VA 3SYSA 1PRNA 3AJFA 3DA3A 4Z7HA 2K19A 1BH3A 2ZLDA 4FZNA 3T0SA 4RJWA 4RL9A 2ODJA 2ZFGA 3QRAA 3AA6A 4FSOA 5EE2A 3LJ2A 4PL3A 2XE1A 3POUA 2X27X 7PRNA 4FOZA 3L0IA 4O1PA 2IP6A 1YO7A 2QTKA 3UU2A 2W81C 1QJ8A 3GP6A 4XNLA 4AYEC 2JMMA 3KVDD 3K19A 2YFAA 2LFUA 4AKRB 2Y0KA 4HFVA 2K4TA 2M07A 4LSEA 2JAEA 3F4MA 2E8GA 3T24A 1HXXA 1ZHXA 4F4BA 2Y7SA 3Q8DA 2YFBA 3EMNX 2XG6A 3IAM1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XMX A;  3DA4 A;  4G75 A;  2XTQ A;  4N59 A;  4FZN A;  3DA3 A;  4N58 A;  4FZM A;  4FZL A;  4G76 A;  2XTR A; 
#chains in the Genus database with same CATH topology
 2QZG A;  2FGQ X;  1P4T A;  1GFO A;  3VE1 A;  1QJ9 A;  4D65 A;  3WI4 A;  4XNK A;  2QGM A;  4KR4 A;  4GCQ A;  1YS5 A;  1T1L A;  1GFQ A;  2KZ7 A;  3PQS A;  3JTY A;  4JFB A;  1QJP A;  2GE4 A;  2MNH A;  2JB1 A;  1ZHY A;  2XE5 A;  2POR A;  2O4V A;  3AA1 B;  1SJ8 A;  2W80 C;  5E79 O;  1TDP A;  3KZI O;  2L1L B;  2XTR A;  2V1C C;  4FT6 A;  4K3C A;  2X9K A;  2BL8 A;  2J1N A;  3BRZ A;  3LJ0 A;  2F66 B;  5LNK 1;  2XMX A;  4AFK A;  2KDY A;  4N58 A;  4O3X B;  2Y0H A;  4GCS A;  5DL7 A;  1U5K A;  4FZM A;  4LSI A;  3IAS 1;  4PL4 A;  3WI5 A;  1BT9 A;  4GXT A;  4G76 A;  4FMS A;  3UIT A;  2KC0 A;  4RJX A;  3SZD A;  4B61 A;  3AA7 B;  4KR8 A;  5AFU K;  5ADX K;  3LK3 B;  4AZL A;  3LK3 A;  3SYB A;  2MHL A;  4O4X A;  2M06 A;  4C4V B;  4RLC A;  4Q9V A;  3KP9 A;  4C4V A;  3DWN A;  4AYI D;  3LK4 2;  3JSB A;  4PUX A;  3PGS A;  3I9V 1;  3WU2 O;  3VE2 A;  3TZG A;  2JQY A;  4G75 A;  2IWV A;  3HOL A;  6PRN A;  3VZT X;  4AKR A;  3BRY A;  2F1T A;  3UPG A;  2P22 B;  1ZHZ A;  2R89 A;  2JB3 A;  4Z7G A;  4O3Z A;  2F6M B;  5B66 O;  1W3S A;  1G90 A;  2R4P A;  2ZW3 A;  2FGR A;  3AA0 B;  5DL8 A;  4K3B A;  3O0E A;  3AA0 A;  2FUG 1;  1HXT A;  1S5L O;  5DL5 A;  3POQ A;  4OAU C;  3T20 A;  2RIO A;  4O49 A;  4E1S A;  5IYU A;  4YZ9 A;  2AXT O;  4FZL A;  5TIS O;  3LJ1 A;  2R8A A;  4DWL A;  3AAE B;  4PL5 A;  3VY8 X;  5GTI O;  3PRN A;  4FES A;  2K0L A;  3AA1 A;  3PF1 A;  4JCV E;  2GSC A;  3QRC A;  1H6S 1;  1T16 A;  4GF4 A;  5GV0 A;  2WVP A;  1GFP A;  3VY9 X;  4O3W A;  2XE3 A;  4Z3T A;  3VA9 A;  4I1T A;  2N2L A;  3PGR A;  4O4U A;  2R88 A;  8PRN A;  3POR A;  4FRX A;  4PJ0 O;  4GCP A;  3SZV A;  1OSM A;  1PHO A;  3HOE A;  3SY7 A;  3A0H O;  2RAD A;  5KAF O;  2FU2 A;  4O1O A;  4C69 X;  5G3A A;  2F1C X;  1E54 A;  4AS3 A;  1GFM A;  3V8U A;  2MJF B;  2ERV A;  4FSP A;  3AA6 B;  3FBV A;  2A2D A;  2JBW A;  3AA7 A;  4FUV A;  5G38 A;  3NSG A;  3NJT A;  3DA4 A;  4D64 A;  4N59 A;  3DO9 A;  5ADX L;  5AFU L;  3HWB A;  4LSH A;  1HXU A;  5HGI A;  5D5D A;  2XTQ A;  3VZU X;  3POX A;  1ZHT A;  3HW9 A;  4YZD A;  4IL6 O;  4BUM X;  4JCH A;  2PRN A;  1Q9G A;  4O3Y A;  2XE2 A;  4D5U A;  1THQ A;  2RLD A;  3RBH A;  3BS0 A;  3FVV A;  2R4O A;  4UB8 O;  3AAA B;  5DL6 A;  4AYN A;  3AAA A;  2ZRR A;  4RLB A;  2IWW A;  4UB6 O;  3SDJ A;  2Y2X A;  2YNK A;  4LSF A;  3PQU A;  1ZHW A;  3VZW X;  3DZM A;  2KKM A;  2ETD A;  1MM5 A;  5T5F A;  2FEF A;  4AS2 A;  3FYX A;  2R4N A;  5JDP A;  1MPF A;  3LK2 B;  2CAZ B;  4NV2 A;  2V6E A;  2N2M A;  3LK2 A;  4AKM A;  4AUI A;  5B5E O;  1MM4 A;  4N74 A;  3P23 A;  2Y0L A;  2OMF A;  4GHB A;  1GFN A;  2JB2 A;  1ORM A;  3UAQ A;  5FVN A;  3G7G A;  4U9C A;  4AYD C;  2A2C A;  3SY9 A;  1BXW A;  5PRN A;  3A2S X;  5G26 A;  3AAE A;  3C5O A;  1Q9F A;  2LHF A;  4NV5 A;  3LK4 1;  2KXP B;  4OAV B;  1IZN B;  2KXP A;  1IZN A;  4KRA A;  2YPV A;  4E1T A;  3A0B O;  2BL7 A;  4YZC A;  4QQ1 A;  4AYM C;  4FRT A;  2KZ7 B;  4CTD A;  4N75 A;  3FNB A;  4U6R A;  1OPF A;  4HEA 1;  5KAI O;  2J4U P;  2F1V A;  3SYS A;  1PRN A;  1JQO A;  3AJF A;  3DA3 A;  4Z7H A;  2K19 A;  1BH3 A;  2ZLD A;  4FZN A;  3T0S A;  2WJQ A;  3JCU O;  4RJW A;  4C00 A;  4RL9 A;  2ODJ A;  2ZFG A;  3QRA A;  3AA6 A;  2WJR A;  4FSO A;  5EE2 A;  5H2F O;  3LJ2 A;  2HGK A;  4PR7 A;  4PL3 A;  5GTH O;  2XE1 A;  3POU A;  2R4L A;  2X27 X;  3B55 A;  7PRN A;  4FOZ A;  3PGU A;  3L0I A;  4O1P A;  2IP6 A;  1YO7 A;  2QTK A;  3UU2 A;  2W81 C;  1QJ8 A;  3GP6 A;  4XNL A;  5G39 A;  4AYE C;  3DWO X;  2JMM A;  3KVD D;  3K19 A;  2YFA A;  2LFU A;  4AKR B;  2QSB A;  2Y0K A;  4HFV A;  2K4T A;  2M07 A;  4LSE A;  2JAE A;  3F4M A;  2E8G A;  3T24 A;  1HXX A;  1ZHX A;  4F4B A;  4FQE A;  2Y7S A;  3Q8D A;  2YFB A;  3EMN X;  2XG6 A;  3IAM 1; 
#chains in the Genus database with same CATH homology
 2FGQ X;  1P4T A;  1GFO A;  3VE1 A;  1QJ9 A;  4D65 A;  3WI4 A;  4XNK A;  4KR4 A;  4GCQ A;  1YS5 A;  1GFQ A;  2KZ7 A;  3PQS A;  3JTY A;  4JFB A;  1QJP A;  2GE4 A;  2MNH A;  2JB1 A;  1ZHY A;  2XE5 A;  2POR A;  2O4V A;  3AA1 B;  1SJ8 A;  2W80 C;  2L1L B;  2XTR A;  2V1C C;  4FT6 A;  2J1N A;  3LJ0 A;  2F66 B;  5LNK 1;  2XMX A;  4AFK A;  2KDY A;  4N58 A;  4O3X B;  2Y0H A;  4GCS A;  5DL7 A;  1U5K A;  4FZM A;  4LSI A;  3IAS 1;  4PL4 A;  3WI5 A;  1BT9 A;  4GXT A;  4G76 A;  4FMS A;  3UIT A;  2KC0 A;  4RJX A;  3SZD A;  4B61 A;  3AA7 B;  4KR8 A;  5AFU K;  5ADX K;  3LK3 B;  4AZL A;  3LK3 A;  3SYB A;  2MHL A;  4O4X A;  2M06 A;  4RLC A;  4Q9V A;  3KP9 A;  4AYI D;  3LK4 2;  3JSB A;  4PUX A;  3I9V 1;  3VE2 A;  3TZG A;  4G75 A;  3HOL A;  6PRN A;  3VZT X;  4AKR A;  2F1T A;  3UPG A;  2P22 B;  1ZHZ A;  2JB3 A;  4Z7G A;  4O3Z A;  2F6M B;  1W3S A;  1G90 A;  2FGR A;  3AA0 B;  5DL8 A;  3O0E A;  3AA0 A;  2FUG 1;  1HXT A;  5DL5 A;  3POQ A;  4OAU C;  3T20 A;  2RIO A;  4O49 A;  4E1S A;  5IYU A;  4YZ9 A;  4FZL A;  3LJ1 A;  4DWL A;  3AAE B;  4PL5 A;  3VY8 X;  3PRN A;  4FES A;  2K0L A;  3AA1 A;  4JCV E;  3QRC A;  1H6S 1;  4GF4 A;  5GV0 A;  1GFP A;  3VY9 X;  4O3W A;  2XE3 A;  4Z3T A;  3VA9 A;  4I1T A;  2N2L A;  4O4U A;  8PRN A;  3POR A;  4FRX A;  4GCP A;  3SZV A;  1OSM A;  1PHO A;  3HOE A;  3SY7 A;  4O1O A;  4C69 X;  1E54 A;  4AS3 A;  1GFM A;  3V8U A;  2MJF B;  2ERV A;  4FSP A;  3AA6 B;  3FBV A;  2A2D A;  3AA7 A;  4FUV A;  3NSG A;  3DA4 A;  4D64 A;  4N59 A;  3DO9 A;  5ADX L;  5AFU L;  3HWB A;  4LSH A;  1HXU A;  5HGI A;  5D5D A;  2XTQ A;  3VZU X;  3POX A;  1ZHT A;  3HW9 A;  4YZD A;  4BUM X;  4JCH A;  2PRN A;  1Q9G A;  4O3Y A;  2XE2 A;  4D5U A;  1THQ A;  3RBH A;  3AAA B;  5DL6 A;  4AYN A;  3AAA A;  2ZRR A;  4RLB A;  3SDJ A;  2Y2X A;  2YNK A;  4LSF A;  3PQU A;  1ZHW A;  3VZW X;  2KKM A;  1MM5 A;  5T5F A;  4AS2 A;  3FYX A;  5JDP A;  1MPF A;  3LK2 B;  2CAZ B;  4NV2 A;  2V6E A;  2N2M A;  3LK2 A;  4AKM A;  4AUI A;  1MM4 A;  3P23 A;  2Y0L A;  2OMF A;  4GHB A;  1GFN A;  2JB2 A;  1ORM A;  3UAQ A;  5FVN A;  3G7G A;  4U9C A;  4AYD C;  2A2C A;  3SY9 A;  1BXW A;  5PRN A;  3A2S X;  5G26 A;  3AAE A;  3C5O A;  1Q9F A;  2LHF A;  4NV5 A;  3LK4 1;  2KXP B;  4OAV B;  1IZN B;  2KXP A;  1IZN A;  4KRA A;  2YPV A;  4E1T A;  4YZC A;  4QQ1 A;  4AYM C;  4FRT A;  2KZ7 B;  4U6R A;  1OPF A;  4HEA 1;  2J4U P;  2F1V A;  3SYS A;  1PRN A;  3AJF A;  3DA3 A;  4Z7H A;  2K19 A;  1BH3 A;  2ZLD A;  4FZN A;  3T0S A;  4RJW A;  4RL9 A;  2ODJ A;  2ZFG A;  3QRA A;  3AA6 A;  4FSO A;  5EE2 A;  3LJ2 A;  4PL3 A;  2XE1 A;  3POU A;  2X27 X;  7PRN A;  4FOZ A;  3L0I A;  4O1P A;  2IP6 A;  1YO7 A;  2QTK A;  3UU2 A;  2W81 C;  1QJ8 A;  3GP6 A;  4XNL A;  4AYE C;  2JMM A;  3KVD D;  3K19 A;  2YFA A;  2LFU A;  4AKR B;  2Y0K A;  4HFV A;  2K4T A;  2M07 A;  4LSE A;  2JAE A;  3F4M A;  2E8G A;  3T24 A;  1HXX A;  1ZHX A;  4F4B A;  2Y7S A;  3Q8D A;  2YFB A;  3EMN X;  2XG6 A;  3IAM 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...