4G75A

Structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
292
structure length
292
Chain Sequence
VMDLGTTTIVAGQGDFSAYNYGNNGANWPAPSPAQVGYISKGQRDVAYVNGDWEKPLLALWAQWANWGTTLYGYPSLPFPNYEFIWDIFDLPQADYNQFSLGDDRITAMNRAQNHQYPFPNNEGIPSWDRPKIDTFNGGVYTPAAAFAHYLTGKGKKMNFPIERLNIKPNVKAMPQFIGVLTSSPMGQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVKSTSGQWSFRGEIRAYDDLYDFNPSNHRTETAEGMTRLGREVGQKFKDTTPYPIGIPGAIPVNISGRSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Characterization of PaeM, a Colicin M-like Bacteriocin Produced by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords phosphodiesterase
total genus 79
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.280 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4g75A01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4g75A02
2XMXA 3DA4A 4FZMA 4FZLA 2XTRA 4N58A 4G75A 3DA3A 4FZNA 2XTQA 4N59A 4G76A
chains in the Genus database with same CATH superfamily
1YO7A 2N2LA 2YNKA 1ZHTA 3PGSA 1TDPA 4I1TA 4JCVE 4E1TA 1HXUA 4KR8A 4QQ1A 3AA7A 2R89A 4LSFA 4O3WA 1Q9FA 3UITA 1GFMA 4LSIA 4O3ZA 3LJ0A 4G76A 4FRTA 2XTRA 1P4TA 8PRNA 1T16A 2Y2XA 1PHOA 4O1PA 4FSPA 4KRAA 2A2CA 1GFOA 3V8UA 3POQA 3LK2B 3A0BO 5T5FA 2V1CC 1HXTA 2MNHA 4AYNA 3VY8X 7PRNA 5G26A 5JDPA 2P22B 2KZ7B 5ADXL 3POUA 4FZMA 3FYXA 1THQA 3DWOX 2GE4A 2F1CX 2Y7SA 2FU2A 3GP6A 4G75A 2V6EA 3A0HO 5ADXK 3SZVA 4IL6O 2LHFA 4OAUC 2YFAA 2R4PA 4UB8O 2OMFA 4C4VA 4O49A 3VA9A 4JFBA 3KP9A 3SYBA 2F1TA 4Z7HA 3AA1A 4AYEC 3HOLA 4AYDC 3LJ1A 3DO9A 4C4VB 2RADA 4O1OA 2XMXA 2JAEA 4XNLA 4E1SA 3LJ2A 4F4BA 2XE3A 2RLDA 5G39A 2ZRRA 3IAM1 1ZHZA 2F1VA 3IAS1 2K4TA 2E8GA 3AA7B 2JBWA 3PQSA 5B5EO 2A2DA 2K19A 4FESA 5DL7A 4NV5A 4KR4A 4K3CA 5DL6A 3AA1B 2FGRA 3SY9A 3BS0A 3POXA 3LK3A 4AYMC 1ZHXA 2WJRA 2IWWA 2WJQA 2MJFB 4Q9VA 4Z7GA 2IP6A 4PL4A 5G38A 2W81C 1GFQA 3VZUX 3A2SX 3SZDA 4O4XA 4AKMA 1T1LA 1QJPA 3LK3B 2R8AA 3PRNA 2LFUA 4GHBA 4AKRA 4AYID 4RLCA 4JCHA 1H6S1 2F6MB 3NJTA 3DWNA 5B66O 3DA3A 4N59A 1ORMA 3QRCA 4AS3A 3PGRA 4N75A 4FZLA 3HW9A 3FBVA 1GFNA 5DL5A 4GCSA 3B55A 4D64A 4FZNA 1IZNA 3PQUA 5KAIO 2BL8A 3F4MA 3AAAA 2M06A 3I9V1 1MM4A 3AAEA 3VZTX 2MHLA 1BXWA 1U5KA 4K3BA 1QJ8A 2BL7A 1JQOA 4CTDA 2F66B 3LK42 3PORA 2QSBA 2FUG1 1BH3A 2ERVA 2XE2A 1GFPA 2Y0KA 3AA6B 4U9CA 2J1NA 5AFUL 3DA4A 3TZGA 3NSGA 2XE1A 4FUVA 4PJ0O 4Z3TA 5GV0A 3WI5A 2R4OA 4FQEA 4D5UA 5E79O 3AA0A 2X9KA 3BRZA 4PR7A 3DZMA 4PUXA 5IYUA 3G7GA 2ZLDA 2XE5A 4LSEA 4FMSA 1MM5A 2M07A 4O3XB 3WU2O 4D65A 3AA6A 4GCPA 2JB2A 3JCUO 3FNBA 2R4LA 3SYSA 2WVPA 2Y0HA 4FT6A 1BT9A 3VY9X 2R4NA 4U6RA 3P23A 2ZFGA 2CAZB 4O3YA 1W3SA 1IZNB 2JB3A 1PRNA 2Y0LA 2IWVA 2GSCA 4NV2A 3AAAB 3L0IA 1ZHWA 3JSBA 2KDYA 5G3AA 2JB1A 4LSHA 5HGIA 4AUIA 2KXPA 4AKRB 3T0SA 2KKMA 2QZGA 2ETDA 4PL5A 4YZDA 4O4UA 1OPFA 2ZW3A 5AFUK 3UPGA 3AAEB 5D5DA 4GXTA 3PGUA 4FOZA 5LNK1 3VE2A 4FSOA 5KAFO 3KVDD 2R88A 4C69X 1SJ8A 3SY7A 2FEFA 4GCQA 3T20A 4AS2A 5PRNA 1ZHYA 2XTQA 3RBHA 4RL9A 3HWBA 5GTIO 4OAVB 3HOEA 2FGQX 2AXTO 2X27X 4B61A 3O0EA 4RLBA 5GTHO 2QTKA 4YZ9A 2ODJA 1MPFA 2L1LB 4GF4A 4PL3A 1Q9GA 3T24A 3Q8DA 3UAQA 4AFKA 3VZWX 3BRYA 4RJXA 3PF1A 2YPVA 2N2MA 3VE1A 2XG6A 2KC0A 3FVVA 2JMMA 3AJFA 2W80C 3LK2A 4UB6O 2J4UP 4FRXA 5EE2A 2RIOA 5FVNA 4N58A 5TISO 2HGKA 2O4VA 3QRAA 3C5OA 3K19A 4C00A 1QJ9A 4HFVA 2KXPB 5DL8A 2JQYA 4AZLA 3LK41 3AA0B 3EMNX 4BUMX 4RJWA 1E54A 1YS5A 2KZ7A 3WI4A 2PRNA 2QGMA 1S5LO 6PRNA 4HEA1 2K0LA 3JTYA 3UU2A 3KZIO 1HXXA 2YFBA 2PORA 4DWLA 3SDJA 4N74A 5H2FO 1G90A 4YZCA 1OSMA 4XNKA
chains in the Genus database with same CATH topology
4FESA 3UPGA 5AFUK 3AAEB 1YO7A 2N2LA 5D5DA 5DL7A 2YNKA 4NV5A 1ZHTA 1QJ8A 4GXTA 4KR4A 4FOZA 5LNK1 3VE2A 4FSOA 2F66B 3KVDD 3LK42 5DL6A 3PORA 4I1TA 3AA1B 2FGRA 4JCVE 4C69X 4E1TA 1SJ8A 1HXUA 2FUG1 4KR8A 3SY7A 4QQ1A 3SY9A 3AA7A 1BH3A 4LSFA 3POXA 2ERVA 2XE2A 1GFPA 4GCQA 4O3WA 3LK3A 4AYMC 3T20A 1Q9FA 3UITA 4AS2A 2Y0KA 1GFMA 5PRNA 1ZHYA 3AA6B 2XTQA 1ZHXA 3LJ0A 4LSIA 4G76A 4O3ZA 3HWBA 4FRTA 4RL9A 4OAVB 3HOEA 2XTRA 4U9CA 2MJFB 4Q9VA 1P4TA 4Z7GA 2FGQX 2J1NA 2X27X 5AFUL 2IP6A 4B61A 8PRNA 3O0EA 4PL4A 4RLBA 2Y2XA 3DA4A 2QTKA 1PHOA 3NSGA 4YZ9A 2W81C 4O1PA 2XE1A 4FUVA 4FSPA 3TZGA 4Z3TA 5GV0A 3WI5A 4KRAA 2A2CA 1GFQA 2ODJA 1GFOA 1MPFA 2L1LB 3V8UA 3POQA 4D5UA 3LK2B 4GF4A 5T5FA 2V1CC 1HXTA 2MNHA 3AA0A 4AYNA 3VY8X 4PL3A 1Q9GA 3VZUX 3A2SX 3SZDA 7PRNA 5G26A 3T24A 3Q8DA 3UAQA 4AFKA 4O4XA 4AKMA 5JDPA 3VZWX 4PUXA 4RJXA 5IYUA 3G7GA 2P22B 2ZLDA 2YPVA 2XE5A 2KZ7B 1QJPA 3POUA 5ADXL 4LSEA 4FMSA 4FZMA 1MM5A 2M07A 2N2MA 3FYXA 1THQA 3LK3B 2GE4A 4O3XB 3PRNA 4D65A 2LFUA 2Y7SA 3VE1A 3AA6A 2XG6A 4GCPA 2KC0A 4GHBA 2JMMA 3AJFA 2JB2A 2W80C 3GP6A 4RLCA 4AKRA 4AYID 4JCHA 3LK2A 4G75A 2V6EA 1OSMA 3SYSA 2J4UP 1H6S1 2F6MB 4FRXA 5ADXK 3SZVA 2Y0HA 4FT6A 5EE2A 1BT9A 2LHFA 3DA3A 4OAUC 3VY9X 2RIOA 5FVNA 2YFAA 4N59A 4N58A 4U6RA 1ORMA 2O4VA 3QRCA 3QRAA 3P23A 2ZFGA 4AKRB 3C5OA 4AS3A 3K19A 2CAZB 1QJ9A 4HFVA 2OMFA 4O3YA 4O49A 4FZLA 3VA9A 2KXPB 5DL8A 1W3SA 4JFBA 4AZLA 1IZNB 3HW9A 3FBVA 3KP9A 2JB3A 1PRNA 1GFNA 2Y0LA 3LK41 3SYBA 2F1TA 4NV2A 3AA0B 4Z7HA 3AA1A 5DL5A 4GCSA 3EMNX 4AYEC 3HOLA 3AAAB 4AYDC 3LJ1A 3DO9A 3L0IA 4BUMX 4RJWA 4O1OA 1ZHWA 4D64A 4FZNA 3JSBA 1E54A 2XMXA 2JAEA 1IZNA 1YS5A 2KDYA 4XNLA 4E1SA 3LJ2A 2JB1A 2KZ7A 3PQUA 4LSHA 5HGIA 3RBHA 4AUIA 4F4BA 3F4MA 2XE3A 3WI4A 2PRNA 3AAAA 6PRNA 2M06A 2ZRRA 4HEA1 2K0LA 3IAM1 3JTYA 3UU2A 2KXPA 1OPFA 3I9V1 1HXXA 3IAS1 1MM4A 1ZHZA 2F1VA 2K4TA 2YFBA 3AAEA 2E8GA 3T0SA 3VZTX 2KKMA 2PORA 3AA7B 4DWLA 3SDJA 2MHLA 3PQSA 4PL5A 4YZDA 4O4UA 1G90A 4YZCA 2A2DA 1BXWA 2K19A 1U5KA 4XNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XMX A;  3DA4 A;  4FZM A;  4FZL A;  2XTR A;  4N58 A;  4G75 A;  3DA3 A;  4FZN A;  2XTQ A;  4N59 A;  4G76 A; 
#chains in the Genus database with same CATH topology
 1YO7 A;  2N2L A;  2YNK A;  1ZHT A;  3PGS A;  1TDP A;  4I1T A;  4JCV E;  4E1T A;  1HXU A;  4KR8 A;  4QQ1 A;  3AA7 A;  2R89 A;  4LSF A;  4O3W A;  1Q9F A;  3UIT A;  1GFM A;  4LSI A;  4O3Z A;  3LJ0 A;  4G76 A;  4FRT A;  2XTR A;  1P4T A;  8PRN A;  1T16 A;  2Y2X A;  1PHO A;  4O1P A;  4FSP A;  4KRA A;  2A2C A;  1GFO A;  3V8U A;  3POQ A;  3LK2 B;  3A0B O;  5T5F A;  2V1C C;  1HXT A;  2MNH A;  4AYN A;  3VY8 X;  7PRN A;  5G26 A;  5JDP A;  2P22 B;  2KZ7 B;  5ADX L;  3POU A;  4FZM A;  3FYX A;  1THQ A;  3DWO X;  2GE4 A;  2F1C X;  2Y7S A;  2FU2 A;  3GP6 A;  4G75 A;  2V6E A;  3A0H O;  5ADX K;  3SZV A;  4IL6 O;  2LHF A;  4OAU C;  2YFA A;  2R4P A;  4UB8 O;  2OMF A;  4C4V A;  4O49 A;  3VA9 A;  4JFB A;  3KP9 A;  3SYB A;  2F1T A;  4Z7H A;  3AA1 A;  4AYE C;  3HOL A;  4AYD C;  3LJ1 A;  3DO9 A;  4C4V B;  2RAD A;  4O1O A;  2XMX A;  2JAE A;  4XNL A;  4E1S A;  3LJ2 A;  4F4B A;  2XE3 A;  2RLD A;  5G39 A;  2ZRR A;  3IAM 1;  1ZHZ A;  2F1V A;  3IAS 1;  2K4T A;  2E8G A;  3AA7 B;  2JBW A;  3PQS A;  5B5E O;  2A2D A;  2K19 A;  4FES A;  5DL7 A;  4NV5 A;  4KR4 A;  4K3C A;  5DL6 A;  3AA1 B;  2FGR A;  3SY9 A;  3BS0 A;  3POX A;  3LK3 A;  4AYM C;  1ZHX A;  2WJR A;  2IWW A;  2WJQ A;  2MJF B;  4Q9V A;  4Z7G A;  2IP6 A;  4PL4 A;  5G38 A;  2W81 C;  1GFQ A;  3VZU X;  3A2S X;  3SZD A;  4O4X A;  4AKM A;  1T1L A;  1QJP A;  3LK3 B;  2R8A A;  3PRN A;  2LFU A;  4GHB A;  4AKR A;  4AYI D;  4RLC A;  4JCH A;  1H6S 1;  2F6M B;  3NJT A;  3DWN A;  5B66 O;  3DA3 A;  4N59 A;  1ORM A;  3QRC A;  4AS3 A;  3PGR A;  4N75 A;  4FZL A;  3HW9 A;  3FBV A;  1GFN A;  5DL5 A;  4GCS A;  3B55 A;  4D64 A;  4FZN A;  1IZN A;  3PQU A;  5KAI O;  2BL8 A;  3F4M A;  3AAA A;  2M06 A;  3I9V 1;  1MM4 A;  3AAE A;  3VZT X;  2MHL A;  1BXW A;  1U5K A;  4K3B A;  1QJ8 A;  2BL7 A;  1JQO A;  4CTD A;  2F66 B;  3LK4 2;  3POR A;  2QSB A;  2FUG 1;  1BH3 A;  2ERV A;  2XE2 A;  1GFP A;  2Y0K A;  3AA6 B;  4U9C A;  2J1N A;  5AFU L;  3DA4 A;  3TZG A;  3NSG A;  2XE1 A;  4FUV A;  4PJ0 O;  4Z3T A;  5GV0 A;  3WI5 A;  2R4O A;  4FQE A;  4D5U A;  5E79 O;  3AA0 A;  2X9K A;  3BRZ A;  4PR7 A;  3DZM A;  4PUX A;  5IYU A;  3G7G A;  2ZLD A;  2XE5 A;  4LSE A;  4FMS A;  1MM5 A;  2M07 A;  4O3X B;  3WU2 O;  4D65 A;  3AA6 A;  4GCP A;  2JB2 A;  3JCU O;  3FNB A;  2R4L A;  3SYS A;  2WVP A;  2Y0H A;  4FT6 A;  1BT9 A;  3VY9 X;  2R4N A;  4U6R A;  3P23 A;  2ZFG A;  2CAZ B;  4O3Y A;  1W3S A;  1IZN B;  2JB3 A;  1PRN A;  2Y0L A;  2IWV A;  2GSC A;  4NV2 A;  3AAA B;  3L0I A;  1ZHW A;  3JSB A;  2KDY A;  5G3A A;  2JB1 A;  4LSH A;  5HGI A;  4AUI A;  2KXP A;  4AKR B;  3T0S A;  2KKM A;  2QZG A;  2ETD A;  4PL5 A;  4YZD A;  4O4U A;  1OPF A;  2ZW3 A;  5AFU K;  3UPG A;  3AAE B;  5D5D A;  4GXT A;  3PGU A;  4FOZ A;  5LNK 1;  3VE2 A;  4FSO A;  5KAF O;  3KVD D;  2R88 A;  4C69 X;  1SJ8 A;  3SY7 A;  2FEF A;  4GCQ A;  3T20 A;  4AS2 A;  5PRN A;  1ZHY A;  2XTQ A;  3RBH A;  4RL9 A;  3HWB A;  5GTI O;  4OAV B;  3HOE A;  2FGQ X;  2AXT O;  2X27 X;  4B61 A;  3O0E A;  4RLB A;  5GTH O;  2QTK A;  4YZ9 A;  2ODJ A;  1MPF A;  2L1L B;  4GF4 A;  4PL3 A;  1Q9G A;  3T24 A;  3Q8D A;  3UAQ A;  4AFK A;  3VZW X;  3BRY A;  4RJX A;  3PF1 A;  2YPV A;  2N2M A;  3VE1 A;  2XG6 A;  2KC0 A;  3FVV A;  2JMM A;  3AJF A;  2W80 C;  3LK2 A;  4UB6 O;  2J4U P;  4FRX A;  5EE2 A;  2RIO A;  5FVN A;  4N58 A;  5TIS O;  2HGK A;  2O4V A;  3QRA A;  3C5O A;  3K19 A;  4C00 A;  1QJ9 A;  4HFV A;  2KXP B;  5DL8 A;  2JQY A;  4AZL A;  3LK4 1;  3AA0 B;  3EMN X;  4BUM X;  4RJW A;  1E54 A;  1YS5 A;  2KZ7 A;  3WI4 A;  2PRN A;  2QGM A;  1S5L O;  6PRN A;  4HEA 1;  2K0L A;  3JTY A;  3UU2 A;  3KZI O;  1HXX A;  2YFB A;  2POR A;  4DWL A;  3SDJ A;  4N74 A;  5H2F O;  1G90 A;  4YZC A;  1OSM A;  4XNK A; 
#chains in the Genus database with same CATH homology
 4FES A;  3UPG A;  5AFU K;  3AAE B;  1YO7 A;  2N2L A;  5D5D A;  5DL7 A;  2YNK A;  4NV5 A;  1ZHT A;  1QJ8 A;  4GXT A;  4KR4 A;  4FOZ A;  5LNK 1;  3VE2 A;  4FSO A;  2F66 B;  3KVD D;  3LK4 2;  5DL6 A;  3POR A;  4I1T A;  3AA1 B;  2FGR A;  4JCV E;  4C69 X;  4E1T A;  1SJ8 A;  1HXU A;  2FUG 1;  4KR8 A;  3SY7 A;  4QQ1 A;  3SY9 A;  3AA7 A;  1BH3 A;  4LSF A;  3POX A;  2ERV A;  2XE2 A;  1GFP A;  4GCQ A;  4O3W A;  3LK3 A;  4AYM C;  3T20 A;  1Q9F A;  3UIT A;  4AS2 A;  2Y0K A;  1GFM A;  5PRN A;  1ZHY A;  3AA6 B;  2XTQ A;  1ZHX A;  3LJ0 A;  4LSI A;  4G76 A;  4O3Z A;  3HWB A;  4FRT A;  4RL9 A;  4OAV B;  3HOE A;  2XTR A;  4U9C A;  2MJF B;  4Q9V A;  1P4T A;  4Z7G A;  2FGQ X;  2J1N A;  2X27 X;  5AFU L;  2IP6 A;  4B61 A;  8PRN A;  3O0E A;  4PL4 A;  4RLB A;  2Y2X A;  3DA4 A;  2QTK A;  1PHO A;  3NSG A;  4YZ9 A;  2W81 C;  4O1P A;  2XE1 A;  4FUV A;  4FSP A;  3TZG A;  4Z3T A;  5GV0 A;  3WI5 A;  4KRA A;  2A2C A;  1GFQ A;  2ODJ A;  1GFO A;  1MPF A;  2L1L B;  3V8U A;  3POQ A;  4D5U A;  3LK2 B;  4GF4 A;  5T5F A;  2V1C C;  1HXT A;  2MNH A;  3AA0 A;  4AYN A;  3VY8 X;  4PL3 A;  1Q9G A;  3VZU X;  3A2S X;  3SZD A;  7PRN A;  5G26 A;  3T24 A;  3Q8D A;  3UAQ A;  4AFK A;  4O4X A;  4AKM A;  5JDP A;  3VZW X;  4PUX A;  4RJX A;  5IYU A;  3G7G A;  2P22 B;  2ZLD A;  2YPV A;  2XE5 A;  2KZ7 B;  1QJP A;  3POU A;  5ADX L;  4LSE A;  4FMS A;  4FZM A;  1MM5 A;  2M07 A;  2N2M A;  3FYX A;  1THQ A;  3LK3 B;  2GE4 A;  4O3X B;  3PRN A;  4D65 A;  2LFU A;  2Y7S A;  3VE1 A;  3AA6 A;  2XG6 A;  4GCP A;  2KC0 A;  4GHB A;  2JMM A;  3AJF A;  2JB2 A;  2W80 C;  3GP6 A;  4RLC A;  4AKR A;  4AYI D;  4JCH A;  3LK2 A;  4G75 A;  2V6E A;  1OSM A;  3SYS A;  2J4U P;  1H6S 1;  2F6M B;  4FRX A;  5ADX K;  3SZV A;  2Y0H A;  4FT6 A;  5EE2 A;  1BT9 A;  2LHF A;  3DA3 A;  4OAU C;  3VY9 X;  2RIO A;  5FVN A;  2YFA A;  4N59 A;  4N58 A;  4U6R A;  1ORM A;  2O4V A;  3QRC A;  3QRA A;  3P23 A;  2ZFG A;  4AKR B;  3C5O A;  4AS3 A;  3K19 A;  2CAZ B;  1QJ9 A;  4HFV A;  2OMF A;  4O3Y A;  4O49 A;  4FZL A;  3VA9 A;  2KXP B;  5DL8 A;  1W3S A;  4JFB A;  4AZL A;  1IZN B;  3HW9 A;  3FBV A;  3KP9 A;  2JB3 A;  1PRN A;  1GFN A;  2Y0L A;  3LK4 1;  3SYB A;  2F1T A;  4NV2 A;  3AA0 B;  4Z7H A;  3AA1 A;  5DL5 A;  4GCS A;  3EMN X;  4AYE C;  3HOL A;  3AAA B;  4AYD C;  3LJ1 A;  3DO9 A;  3L0I A;  4BUM X;  4RJW A;  4O1O A;  1ZHW A;  4D64 A;  4FZN A;  3JSB A;  1E54 A;  2XMX A;  2JAE A;  1IZN A;  1YS5 A;  2KDY A;  4XNL A;  4E1S A;  3LJ2 A;  2JB1 A;  2KZ7 A;  3PQU A;  4LSH A;  5HGI A;  3RBH A;  4AUI A;  4F4B A;  3F4M A;  2XE3 A;  3WI4 A;  2PRN A;  3AAA A;  6PRN A;  2M06 A;  2ZRR A;  4HEA 1;  2K0L A;  3IAM 1;  3JTY A;  3UU2 A;  2KXP A;  1OPF A;  3I9V 1;  1HXX A;  3IAS 1;  1MM4 A;  1ZHZ A;  2F1V A;  2K4T A;  2YFB A;  3AAE A;  2E8G A;  3T0S A;  3VZT X;  2KKM A;  2POR A;  3AA7 B;  4DWL A;  3SDJ A;  2MHL A;  3PQS A;  4PL5 A;  4YZD A;  4O4U A;  1G90 A;  4YZC A;  2A2D A;  1BXW A;  2K19 A;  1U5K A;  4XNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...