4G75A

Structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
292
structure length
292
Chain Sequence
VMDLGTTTIVAGQGDFSAYNYGNNGANWPAPSPAQVGYISKGQRDVAYVNGDWEKPLLALWAQWANWGTTLYGYPSLPFPNYEFIWDIFDLPQADYNQFSLGDDRITAMNRAQNHQYPFPNNEGIPSWDRPKIDTFNGGVYTPAAAFAHYLTGKGKKMNFPIERLNIKPNVKAMPQFIGVLTSSPMGQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVKSTSGQWSFRGEIRAYDDLYDFNPSNHRTETAEGMTRLGREVGQKFKDTTPYPIGIPGAIPVNISGRSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Characterization of PaeM, a Colicin M-like Bacteriocin Produced by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords phosphodiesterase
total genus 79
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.280 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4g75A01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4g75A02
4FZLA 2XTQA 2XMXA 4FZNA 4N59A 3DA4A 4FZMA 4G75A 4N58A 3DA3A 4G76A 2XTRA
chains in the Genus database with same CATH superfamily
4RLCA 2M06A 4FMSA 1HXXA 3IAM1 3TZGA 3Q8DA 2YPVA 3UU2A 4PL5A 2YFAA 3K19A 4KRAA 3HW9A 3SZVA 4AYEC 4GCSA 4HEA1 4U6RA 4UB8O 1HXTA 5LNK1 4PL3A 4FZMA 4C4VA 4AYNA 1MPFA 4O3WA 2JAEA 2KXPA 8PRNA 5H2FO 2JMMA 3AA6B 4O49A 1YO7A 2PORA 2Y0HA 2QSBA 1G90A 1SJ8A 4IL6O 3AA0B 7PRNA 2O4VA 2N2MA 1GFOA 3LJ2A 2JB3A 2K4TA 4FZNA 5GTHO 4G76A 2BL7A 4XNLA 5HGIA 1QJPA 3WU2O 4N58A 2RADA 1Q9FA 2HGKA 1OSMA 2LHFA 1S5LO 3SYBA 4D64A 4AZLA 2F1TA 2R89A 3VZWX 4FRXA 5DL5A 1GFPA 3DO9A 4FSPA 1IZNA 1P4TA 2K0LA 2KKMA 2OMFA 5KAFO 3HWBA 4AS2A 5G3AA 3F4MA 1QJ9A 1ZHTA 2LFUA 2Y0KA 3AA0A 3G7GA 2QZGA 3A0HO 3LJ0A 3PF1A 4JCVE 3LK2B 3A2SX 2F1VA 3RBHA 1ZHYA 4UB6O 2F6MB 2ERVA 4C4VB 4FRTA 4GHBA 1GFQA 4AKRB 1THQA 3AAEB 4JFBA 4YZCA 2WVPA 3AJFA 1ZHWA 3UITA 4AYDC 2R4PA 2MHLA 3FNBA 2ZRRA 4FESA 3VZTX 2FUG1 1TDPA 3DZMA 3GP6A 3PGRA 4AFKA 4O4UA 2V6EA 3UPGA 4FUVA 5TISO 4F4BA 5EE2A 3T0SA 4O1PA 1QJ8A 4DWLA 4AYID 2IP6A 3AAEA 4N74A 4AKRA 3PQUA 3SY7A 4AYMC 4AKMA 3NSGA 4O4XA 1GFMA 2V1CC 2E8GA 4FT6A 2XTRA 4FSOA 2KZ7B 2QTKA 2P22B 4FQEA 4O3XB 3T24A 5DL7A 2XE3A 2A2DA 3FVVA 3KZIO 2YNKA 2JQYA 3AA1A 3LK42 4O3ZA 2R88A 3C5OA 4GXTA 2ETDA 4B61A 5ADXK 4C00A 2JBWA 3BRYA 4GF4A 5FVNA 2IWWA 5B5EO 3UAQA 2MJFB 1PHOA 3I9V1 3PGSA 2ZW3A 4OAUC 1BT9A 1GFNA 4D65A 5GV0A 2FGRA 4FOZA 3AA7A 3P23A 3KVDD 4LSFA 4N59A 2FGQX 2MNHA 2XMXA 2FEFA 3V8UA 3VE1A 3NJTA 2W80C 4RLBA 2ODJA 3VE2A 4Z7GA 5D5DA 3SDJA 1U5KA 2Y0LA 3DA3A 2A2CA 2XE2A 3SYSA 4NV2A 4JCHA 3POQA 1OPFA 3PRNA 4CTDA 3AAAB 3PQSA 3DWNA 3WI5A 3QRCA 2ZFGA 1ORMA 4YZ9A 2IWVA 3PORA 4E1TA 5IYUA 4FZLA 1W3SA 5AFUL 3HOEA 5G26A 3FYXA 2KDYA 3AA7B 4U9CA 2R4NA 4Z7HA 5DL8A 3VZUX 2K19A 2R4OA 4Q9VA 1BXWA 5E79O 5JDPA 3DA4A 4RL9A 4I1TA 2X9KA 6PRNA 2KXPB 5AFUK 2J1NA 3SY9A 2CAZB 4AS3A 3VA9A 4E1SA 4K3BA 3LJ1A 4GCQA 2F1CX 1ZHXA 4LSEA 2JB2A 3FBVA 3HOLA 2KZ7A 4XNKA 2M07A 4RJWA 2GSCA 3L0IA 4PJ0O 2F66B 2QGMA 2AXTO 2W81C 4PL4A 2WJRA 3BRZA 4O3YA 4YZDA 4LSIA 4D5UA 2JB1A 5GTIO 2FU2A 3T20A 3JCUO 3B55A 3KP9A 2XTQA 2PRNA 3QRAA 5DL6A 3BS0A 3IAS1 3AA1B 1Q9GA 1IZNB 5G39A 1E54A 3SZDA 3LK3A 5G38A 4GCPA 2GE4A 2RLDA 2WJQA 3EMNX 3LK2A 1JQOA 4LSHA 5PRNA 1T1LA 2R8AA 4QQ1A 3VY8X 4RJXA 2XG6A 2ZLDA 2N2LA 1YS5A 4Z3TA 2L1LB 2RIOA 4G75A 2R4LA 4AUIA 3AAAA 2KC0A 3PGUA 4PR7A 3AA6A 3POXA 3DWOX 4PUXA 3JSBA 1T16A 3POUA 1MM4A 5T5FA 2YFBA 2Y7SA 3VY9X 3LK3B 4N75A 1H6S1 2BL8A 2XE5A 3A0BO 2Y2XA 1BH3A 4C69X 4KR4A 3WI4A 4KR8A 4K3CA 5ADXL 3JTYA 5B66O 1ZHZA 2XE1A 3O0EA 4NV5A 4HFVA 1PRNA 4O1OA 4BUMX 2J4UP 2X27X 4OAVB 3LK41 1MM5A 1HXUA 5KAIO
chains in the Genus database with same CATH topology
3KP9A 2XTQA 2PRNA 3KVDD 3QRAA 4LSFA 4RLCA 5DL6A 2M06A 4N59A 3LJ0A 4FMSA 2FGQX 1HXXA 3IAS1 3IAM1 2MNHA 4JCVE 3TZGA 3AA1B 3Q8DA 2YPVA 1Q9GA 3LK2B 3UU2A 1IZNB 2XMXA 4PL5A 1E54A 3A2SX 3SZDA 3LK3A 2F1VA 3RBHA 1ZHYA 3V8UA 2YFAA 2F6MB 2ERVA 3VE1A 3K19A 2W80C 4RLBA 4GCPA 2ODJA 4KRAA 4FRTA 2GE4A 4GHBA 1GFQA 3VE2A 4AKRB 4Z7GA 3HW9A 5D5DA 1THQA 3AAEB 3SDJA 4JFBA 4O3YA 4YZCA 3EMNX 4GCSA 3SZVA 1U5KA 3LK2A 4AYEC 5JDPA 4HEA1 4U6RA 4LSHA 5PRNA 2Y0LA 3DA3A 3AJFA 1ZHWA 2A2CA 3UITA 2XE2A 3SYSA 4AYDC 1HXTA 2MHLA 4QQ1A 3VY8X 4RJXA 2ZRRA 4NV2A 5LNK1 4FESA 3VZTX 4PL3A 4JCHA 2FUG1 4FZMA 2XG6A 2ZLDA 3POQA 2N2LA 1YS5A 1OPFA 4AYNA 4Z3TA 3GP6A 2L1LB 1MPFA 4O3WA 2RIOA 3PRNA 4G75A 3AAAB 4AFKA 2JAEA 2KXPA 4AUIA 4O4UA 8PRNA 2V6EA 3UPGA 4FUVA 3PQSA 3AAAA 2KC0A 3WI5A 2JMMA 3AA6B 5EE2A 3T0SA 4F4BA 4O49A 1YO7A 4O1PA 2PORA 2Y0HA 3QRCA 1QJ8A 1G90A 2ZFGA 1ORMA 1SJ8A 4YZ9A 4DWLA 3AA6A 3AA0B 3POXA 3PORA 4PUXA 4AYID 3JSBA 2IP6A 3AAEA 4AKRA 4E1TA 7PRNA 3PQUA 4FZLA 1W3SA 3POUA 5AFUL 5IYUA 3SY7A 4AYMC 3HOEA 4AKMA 2O4VA 5G26A 3NSGA 3FYXA 2N2MA 4O4XA 1MM4A 2KDYA 5T5FA 1GFOA 3AA7B 3LJ2A 2JB3A 2YFBA 1GFMA 2V1CC 2Y7SA 2K4TA 4U9CA 4FZNA 3VY9X 3LK3B 2E8GA 4Z7HA 4G76A 1H6S1 5DL8A 3VZUX 4FT6A 2XTRA 2K19A 4XNLA 4Q9VA 5HGIA 1BXWA 2KZ7B 2XE5A 2Y2XA 4FSOA 3DA4A 1QJPA 4I1TA 2QTKA 2P22B 4N58A 4RL9A 1BH3A 1Q9FA 6PRNA 4C69X 2KXPB 1OSMA 4O3XB 5AFUK 2J1NA 3T24A 4KR4A 2CAZB 5DL7A 3SY9A 4AS3A 2XE3A 3WI4A 2A2DA 3VA9A 4KR8A 2YNKA 3AA1A 2LHFA 3LK42 4E1SA 5ADXL 4O3ZA 3SYBA 4D64A 4AZLA 3JTYA 3LJ1A 2F1TA 4GCQA 3VZWX 4FRXA 1ZHZA 3C5OA 5DL5A 4GXTA 2XE1A 1GFPA 3O0EA 3DO9A 4B61A 4FSPA 1IZNA 1P4TA 1ZHXA 4NV5A 4HFVA 4GF4A 5ADXK 5FVNA 1PRNA 2K0LA 4LSEA 3UAQA 2MJFB 2KKMA 4O1OA 1PHOA 2OMFA 4BUMX 2JB2A 3I9V1 2J4UP 3FBVA 3HOLA 2X27X 2KZ7A 4OAVB 3LK41 4XNKA 2M07A 1MM5A 3L0IA 3HWBA 4OAUC 4RJWA 2F66B 1BT9A 1GFNA 4AS2A 4D65A 2W81C 5GV0A 3F4MA 2FGRA 4PL4A 1QJ9A 1ZHTA 4YZDA 2LFUA 2Y0KA 3AA0A 4LSIA 2JB1A 1HXUA 3G7GA 4FOZA 4D5UA 3AA7A 3T20A 3P23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZL A;  2XTQ A;  2XMX A;  4FZN A;  4N59 A;  3DA4 A;  4FZM A;  4G75 A;  4N58 A;  3DA3 A;  4G76 A;  2XTR A; 
#chains in the Genus database with same CATH topology
 4RLC A;  2M06 A;  4FMS A;  1HXX A;  3IAM 1;  3TZG A;  3Q8D A;  2YPV A;  3UU2 A;  4PL5 A;  2YFA A;  3K19 A;  4KRA A;  3HW9 A;  3SZV A;  4AYE C;  4GCS A;  4HEA 1;  4U6R A;  4UB8 O;  1HXT A;  5LNK 1;  4PL3 A;  4FZM A;  4C4V A;  4AYN A;  1MPF A;  4O3W A;  2JAE A;  2KXP A;  8PRN A;  5H2F O;  2JMM A;  3AA6 B;  4O49 A;  1YO7 A;  2POR A;  2Y0H A;  2QSB A;  1G90 A;  1SJ8 A;  4IL6 O;  3AA0 B;  7PRN A;  2O4V A;  2N2M A;  1GFO A;  3LJ2 A;  2JB3 A;  2K4T A;  4FZN A;  5GTH O;  4G76 A;  2BL7 A;  4XNL A;  5HGI A;  1QJP A;  3WU2 O;  4N58 A;  2RAD A;  1Q9F A;  2HGK A;  1OSM A;  2LHF A;  1S5L O;  3SYB A;  4D64 A;  4AZL A;  2F1T A;  2R89 A;  3VZW X;  4FRX A;  5DL5 A;  1GFP A;  3DO9 A;  4FSP A;  1IZN A;  1P4T A;  2K0L A;  2KKM A;  2OMF A;  5KAF O;  3HWB A;  4AS2 A;  5G3A A;  3F4M A;  1QJ9 A;  1ZHT A;  2LFU A;  2Y0K A;  3AA0 A;  3G7G A;  2QZG A;  3A0H O;  3LJ0 A;  3PF1 A;  4JCV E;  3LK2 B;  3A2S X;  2F1V A;  3RBH A;  1ZHY A;  4UB6 O;  2F6M B;  2ERV A;  4C4V B;  4FRT A;  4GHB A;  1GFQ A;  4AKR B;  1THQ A;  3AAE B;  4JFB A;  4YZC A;  2WVP A;  3AJF A;  1ZHW A;  3UIT A;  4AYD C;  2R4P A;  2MHL A;  3FNB A;  2ZRR A;  4FES A;  3VZT X;  2FUG 1;  1TDP A;  3DZM A;  3GP6 A;  3PGR A;  4AFK A;  4O4U A;  2V6E A;  3UPG A;  4FUV A;  5TIS O;  4F4B A;  5EE2 A;  3T0S A;  4O1P A;  1QJ8 A;  4DWL A;  4AYI D;  2IP6 A;  3AAE A;  4N74 A;  4AKR A;  3PQU A;  3SY7 A;  4AYM C;  4AKM A;  3NSG A;  4O4X A;  1GFM A;  2V1C C;  2E8G A;  4FT6 A;  2XTR A;  4FSO A;  2KZ7 B;  2QTK A;  2P22 B;  4FQE A;  4O3X B;  3T24 A;  5DL7 A;  2XE3 A;  2A2D A;  3FVV A;  3KZI O;  2YNK A;  2JQY A;  3AA1 A;  3LK4 2;  4O3Z A;  2R88 A;  3C5O A;  4GXT A;  2ETD A;  4B61 A;  5ADX K;  4C00 A;  2JBW A;  3BRY A;  4GF4 A;  5FVN A;  2IWW A;  5B5E O;  3UAQ A;  2MJF B;  1PHO A;  3I9V 1;  3PGS A;  2ZW3 A;  4OAU C;  1BT9 A;  1GFN A;  4D65 A;  5GV0 A;  2FGR A;  4FOZ A;  3AA7 A;  3P23 A;  3KVD D;  4LSF A;  4N59 A;  2FGQ X;  2MNH A;  2XMX A;  2FEF A;  3V8U A;  3VE1 A;  3NJT A;  2W80 C;  4RLB A;  2ODJ A;  3VE2 A;  4Z7G A;  5D5D A;  3SDJ A;  1U5K A;  2Y0L A;  3DA3 A;  2A2C A;  2XE2 A;  3SYS A;  4NV2 A;  4JCH A;  3POQ A;  1OPF A;  3PRN A;  4CTD A;  3AAA B;  3PQS A;  3DWN A;  3WI5 A;  3QRC A;  2ZFG A;  1ORM A;  4YZ9 A;  2IWV A;  3POR A;  4E1T A;  5IYU A;  4FZL A;  1W3S A;  5AFU L;  3HOE A;  5G26 A;  3FYX A;  2KDY A;  3AA7 B;  4U9C A;  2R4N A;  4Z7H A;  5DL8 A;  3VZU X;  2K19 A;  2R4O A;  4Q9V A;  1BXW A;  5E79 O;  5JDP A;  3DA4 A;  4RL9 A;  4I1T A;  2X9K A;  6PRN A;  2KXP B;  5AFU K;  2J1N A;  3SY9 A;  2CAZ B;  4AS3 A;  3VA9 A;  4E1S A;  4K3B A;  3LJ1 A;  4GCQ A;  2F1C X;  1ZHX A;  4LSE A;  2JB2 A;  3FBV A;  3HOL A;  2KZ7 A;  4XNK A;  2M07 A;  4RJW A;  2GSC A;  3L0I A;  4PJ0 O;  2F66 B;  2QGM A;  2AXT O;  2W81 C;  4PL4 A;  2WJR A;  3BRZ A;  4O3Y A;  4YZD A;  4LSI A;  4D5U A;  2JB1 A;  5GTI O;  2FU2 A;  3T20 A;  3JCU O;  3B55 A;  3KP9 A;  2XTQ A;  2PRN A;  3QRA A;  5DL6 A;  3BS0 A;  3IAS 1;  3AA1 B;  1Q9G A;  1IZN B;  5G39 A;  1E54 A;  3SZD A;  3LK3 A;  5G38 A;  4GCP A;  2GE4 A;  2RLD A;  2WJQ A;  3EMN X;  3LK2 A;  1JQO A;  4LSH A;  5PRN A;  1T1L A;  2R8A A;  4QQ1 A;  3VY8 X;  4RJX A;  2XG6 A;  2ZLD A;  2N2L A;  1YS5 A;  4Z3T A;  2L1L B;  2RIO A;  4G75 A;  2R4L A;  4AUI A;  3AAA A;  2KC0 A;  3PGU A;  4PR7 A;  3AA6 A;  3POX A;  3DWO X;  4PUX A;  3JSB A;  1T16 A;  3POU A;  1MM4 A;  5T5F A;  2YFB A;  2Y7S A;  3VY9 X;  3LK3 B;  4N75 A;  1H6S 1;  2BL8 A;  2XE5 A;  3A0B O;  2Y2X A;  1BH3 A;  4C69 X;  4KR4 A;  3WI4 A;  4KR8 A;  4K3C A;  5ADX L;  3JTY A;  5B66 O;  1ZHZ A;  2XE1 A;  3O0E A;  4NV5 A;  4HFV A;  1PRN A;  4O1O A;  4BUM X;  2J4U P;  2X27 X;  4OAV B;  3LK4 1;  1MM5 A;  1HXU A;  5KAI O; 
#chains in the Genus database with same CATH homology
 3KP9 A;  2XTQ A;  2PRN A;  3KVD D;  3QRA A;  4LSF A;  4RLC A;  5DL6 A;  2M06 A;  4N59 A;  3LJ0 A;  4FMS A;  2FGQ X;  1HXX A;  3IAS 1;  3IAM 1;  2MNH A;  4JCV E;  3TZG A;  3AA1 B;  3Q8D A;  2YPV A;  1Q9G A;  3LK2 B;  3UU2 A;  1IZN B;  2XMX A;  4PL5 A;  1E54 A;  3A2S X;  3SZD A;  3LK3 A;  2F1V A;  3RBH A;  1ZHY A;  3V8U A;  2YFA A;  2F6M B;  2ERV A;  3VE1 A;  3K19 A;  2W80 C;  4RLB A;  4GCP A;  2ODJ A;  4KRA A;  4FRT A;  2GE4 A;  4GHB A;  1GFQ A;  3VE2 A;  4AKR B;  4Z7G A;  3HW9 A;  5D5D A;  1THQ A;  3AAE B;  3SDJ A;  4JFB A;  4O3Y A;  4YZC A;  3EMN X;  4GCS A;  3SZV A;  1U5K A;  3LK2 A;  4AYE C;  5JDP A;  4HEA 1;  4U6R A;  4LSH A;  5PRN A;  2Y0L A;  3DA3 A;  3AJF A;  1ZHW A;  2A2C A;  3UIT A;  2XE2 A;  3SYS A;  4AYD C;  1HXT A;  2MHL A;  4QQ1 A;  3VY8 X;  4RJX A;  2ZRR A;  4NV2 A;  5LNK 1;  4FES A;  3VZT X;  4PL3 A;  4JCH A;  2FUG 1;  4FZM A;  2XG6 A;  2ZLD A;  3POQ A;  2N2L A;  1YS5 A;  1OPF A;  4AYN A;  4Z3T A;  3GP6 A;  2L1L B;  1MPF A;  4O3W A;  2RIO A;  3PRN A;  4G75 A;  3AAA B;  4AFK A;  2JAE A;  2KXP A;  4AUI A;  4O4U A;  8PRN A;  2V6E A;  3UPG A;  4FUV A;  3PQS A;  3AAA A;  2KC0 A;  3WI5 A;  2JMM A;  3AA6 B;  5EE2 A;  3T0S A;  4F4B A;  4O49 A;  1YO7 A;  4O1P A;  2POR A;  2Y0H A;  3QRC A;  1QJ8 A;  1G90 A;  2ZFG A;  1ORM A;  1SJ8 A;  4YZ9 A;  4DWL A;  3AA6 A;  3AA0 B;  3POX A;  3POR A;  4PUX A;  4AYI D;  3JSB A;  2IP6 A;  3AAE A;  4AKR A;  4E1T A;  7PRN A;  3PQU A;  4FZL A;  1W3S A;  3POU A;  5AFU L;  5IYU A;  3SY7 A;  4AYM C;  3HOE A;  4AKM A;  2O4V A;  5G26 A;  3NSG A;  3FYX A;  2N2M A;  4O4X A;  1MM4 A;  2KDY A;  5T5F A;  1GFO A;  3AA7 B;  3LJ2 A;  2JB3 A;  2YFB A;  1GFM A;  2V1C C;  2Y7S A;  2K4T A;  4U9C A;  4FZN A;  3VY9 X;  3LK3 B;  2E8G A;  4Z7H A;  4G76 A;  1H6S 1;  5DL8 A;  3VZU X;  4FT6 A;  2XTR A;  2K19 A;  4XNL A;  4Q9V A;  5HGI A;  1BXW A;  2KZ7 B;  2XE5 A;  2Y2X A;  4FSO A;  3DA4 A;  1QJP A;  4I1T A;  2QTK A;  2P22 B;  4N58 A;  4RL9 A;  1BH3 A;  1Q9F A;  6PRN A;  4C69 X;  2KXP B;  1OSM A;  4O3X B;  5AFU K;  2J1N A;  3T24 A;  4KR4 A;  2CAZ B;  5DL7 A;  3SY9 A;  4AS3 A;  2XE3 A;  3WI4 A;  2A2D A;  3VA9 A;  4KR8 A;  2YNK A;  3AA1 A;  2LHF A;  3LK4 2;  4E1S A;  5ADX L;  4O3Z A;  3SYB A;  4D64 A;  4AZL A;  3JTY A;  3LJ1 A;  2F1T A;  4GCQ A;  3VZW X;  4FRX A;  1ZHZ A;  3C5O A;  5DL5 A;  4GXT A;  2XE1 A;  1GFP A;  3O0E A;  3DO9 A;  4B61 A;  4FSP A;  1IZN A;  1P4T A;  1ZHX A;  4NV5 A;  4HFV A;  4GF4 A;  5ADX K;  5FVN A;  1PRN A;  2K0L A;  4LSE A;  3UAQ A;  2MJF B;  2KKM A;  4O1O A;  1PHO A;  2OMF A;  4BUM X;  2JB2 A;  3I9V 1;  2J4U P;  3FBV A;  3HOL A;  2X27 X;  2KZ7 A;  4OAV B;  3LK4 1;  4XNK A;  2M07 A;  1MM5 A;  3L0I A;  3HWB A;  4OAU C;  4RJW A;  2F66 B;  1BT9 A;  1GFN A;  4AS2 A;  4D65 A;  2W81 C;  5GV0 A;  3F4M A;  2FGR A;  4PL4 A;  1QJ9 A;  1ZHT A;  4YZD A;  2LFU A;  2Y0K A;  3AA0 A;  4LSI A;  2JB1 A;  1HXU A;  3G7G A;  4FOZ A;  4D5U A;  3AA7 A;  3T20 A;  3P23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...