4G75A

Structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
292
structure length
292
Chain Sequence
VMDLGTTTIVAGQGDFSAYNYGNNGANWPAPSPAQVGYISKGQRDVAYVNGDWEKPLLALWAQWANWGTTLYGYPSLPFPNYEFIWDIFDLPQADYNQFSLGDDRITAMNRAQNHQYPFPNNEGIPSWDRPKIDTFNGGVYTPAAAFAHYLTGKGKKMNFPIERLNIKPNVKAMPQFIGVLTSSPMGQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVKSTSGQWSFRGEIRAYDDLYDFNPSNHRTETAEGMTRLGREVGQKFKDTTPYPIGIPGAIPVNISGRSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphodiesterase
publication title Functional and Structural Characterization of PaeM, a Colicin M-like Bacteriocin Produced by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 79
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.280 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4g75A01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4g75A02
4G76A 3DA3A 4N58A 4G75A 4FZNA 2XTQA 4N59A 2XTRA 4FZMA 3DA4A 2XMXA 4FZLA
chains in the Genus database with same CATH superfamily
4D5UA 3UU2A 4PR7A 3HWBA 4AYEC 3NSGA 4C00A 1HXXA 1JQOA 3Q8DA 4NV5A 3PGRA 2JMMA 4AYMC 4LSFA 3LJ2A 2JB1A 2Y0KA 4RLCA 2R8AA 2K19A 2ZW3A 4IL6O 2W81C 3AA1A 3JCUO 4FOZA 5FVNA 2QTKA 4DWLA 4O49A 4FSPA 5G26A 4YZDA 3HOLA 3POQA 3UAQA 4O1PA 3POUA 5G3AA 2XE1A 3AA0B 1W3SA 4E1TA 5T5FA 5GTHO 3GP6A 2GE4A 2GSCA 4XNLA 4FRTA 3F4MA 3L0IA 2QGMA 4KR8A 3AA0A 5TISO 2R4LA 3I9V1 4GCPA 3AA7B 2MNHA 2FEFA 2IP6A 3BS0A 4XNKA 4K3CA 5DL5A 4O1OA 2W80C 1GFOA 2XE3A 2IWWA 2Y7SA 3HOEA 2X27X 4FUVA 4AYNA 4NV2A 4GCQA 3AAEB 2M07A 1H6S1 2K0LA 2X9KA 5JDPA 1G90A 2JB3A 4N59A 1PRNA 4D64A 2AXTO 2ZRRA 3AAEA 3VY9X 2J4UP 2JAEA 4PJ0O 4YZ9A 3O0EA 1BH3A 2V6EA 1OPFA 2A2CA 4YZCA 2YPVA 4JFBA 3SYBA 1BT9A 3VE1A 2XE5A 4KR4A 3A2SX 3PGUA 5D5DA 4U9CA 4AFKA 3SYSA 4Z7GA 1ZHWA 3DA3A 3SZVA 5AFUL 4B61A 4D65A 1QJPA 4AS2A 3LJ0A 4N58A 3LJ1A 2ZLDA 3KVDD 4LSHA 2CAZB 1IZNA 5PRNA 2ETDA 4AKRA 3FVVA 3SY9A 3AA1B 5KAFO 2XE2A 2YFAA 2O4VA 2Y0HA 3WI5A 4FSOA 5GTIO 4FESA 4AYID 1PHOA 2ODJA 3JTYA 1Q9GA 4UB6O 5B66O 3PQUA 4AZLA 2OMFA 4O3ZA 3WU2O 4UB8O 3DA4A 3P23A 3TZGA 1ORMA 1MM4A 3K19A 3IAM1 4BUMX 2RADA 2KC0A 3DWNA 4RJXA 4I1TA 1QJ9A 1T1LA 2F1TA 3EMNX 3SY7A 5DL6A 3DO9A 4HEA1 5KAIO 3POXA 4LSEA 2XTQA 1GFNA 3G7GA 3VA9A 5ADXL 3DWOX 3FBVA 2F6MB 3VZWX 4C69X 2LFUA 3VY8X 2KDYA 1S5LO 1SJ8A 4Q9VA 2JBWA 2L1LB 5G39A 4C4VB 4G76A 5E79O 3IAS1 2YNKA 3RBHA 4C4VA 3LK2B 2WJQA 5LNK1 6PRNA 4GHBA 2BL8A 4KRAA 3LK2A 3B55A 2E8GA 3BRYA 4AS3A 4PUXA 2WVPA 4O3YA 2FGRA 5G38A 3VE2A 3VZUX 3QRCA 1HXUA 2R4OA 3SDJA 4JCVE 2MJFB 2A2DA 3SZDA 5IYUA 5ADXK 4O3XB 4F4BA 2KZ7A 4AYDC 3PRNA 1IZNB 2PRNA 4AKRB 2FGQX 3LK3B 4JCHA 2QZGA 1Q9FA 3V8UA 2RIOA 3JSBA 4GCSA 4E1SA 2F1VA 2IWVA 2BL7A 2LHFA 3T20A 2WJRA 3LK3A 4G75A 1ZHYA 4PL3A 3UPGA 3HW9A 2XMXA 3A0BO 8PRNA 1ZHZA 5EE2A 5B5EO 4Z3TA 3PORA 1YS5A 2Y0LA 2R4NA 2KXPB 4AKMA 2V1CC 2F1CX 1MPFA 1OSMA 3LK42 2PORA 4O4XA 2KXPA 4O3WA 2N2LA 3VZTX 4K3BA 4FT6A 2ERVA 2K4TA 2RLDA 4FMSA 5AFUK 1ZHTA 4LSIA 2ZFGA 2XG6A 4HFVA 4N75A 4OAVB 3A0HO 3AJFA 3UITA 3DZMA 3NJTA 3C5OA 4CTDA 2R88A 2R89A 3AAAB 4GF4A 4FRXA 4GXTA 5DL8A 2N2MA 1HXTA 1GFQA 1BXWA 5DL7A 5GV0A 2YFBA 2FUG1 3WI4A 3AAAA 3KZIO 4RLBA 7PRNA 1MM5A 2KKMA 1U5KA 3PQSA 3KP9A 3PF1A 2JQYA 3AA7A 1ZHXA 2JB2A 1E54A 2J1NA 4U6RA 4OAUC 5HGIA 3AA6B 4RL9A 2Y2XA 4QQ1A 3FYXA 4Z7HA 4FQEA 1P4TA 2KZ7B 4N74A 3AA6A 2P22B 5H2FO 2FU2A 2XTRA 3LK41 3T0SA 2F66B 3FNBA 4FZLA 3QRAA 1T16A 4O4UA 1YO7A 4PL5A 1THQA 2R4PA 1GFPA 1TDPA 4FZMA 3BRZA 2HGKA 4AUIA 3PGSA 4RJWA 2M06A 4FZNA 2MHLA 1GFMA 1QJ8A 4PL4A 2QSBA 3T24A
chains in the Genus database with same CATH topology
4D5UA 3UU2A 3HWBA 4AYEC 3NSGA 1HXXA 3Q8DA 4NV5A 2JMMA 4AYMC 4LSFA 3LJ2A 2JB1A 2Y0KA 4RLCA 2K19A 2W81C 3AA1A 4FOZA 5FVNA 2QTKA 4DWLA 4O49A 4FSPA 5G26A 4YZDA 3HOLA 3POQA 3UAQA 4O1PA 3POUA 2XE1A 3AA0B 1W3SA 4E1TA 5T5FA 3GP6A 2GE4A 4XNLA 4FRTA 3F4MA 3L0IA 4KR8A 3AA0A 3I9V1 4GCPA 3AA7B 2MNHA 2IP6A 4XNKA 5DL5A 4O1OA 2W80C 1GFOA 2XE3A 2Y7SA 3HOEA 4AYNA 2X27X 4FUVA 4NV2A 4GCQA 3AAEB 2M07A 1H6S1 2K0LA 5JDPA 1G90A 2JB3A 4N59A 1PRNA 4D64A 2ZRRA 3AAEA 3VY9X 2J4UP 2JAEA 4YZ9A 3O0EA 1BH3A 2V6EA 1OPFA 2A2CA 4YZCA 2YPVA 4JFBA 3SYBA 1BT9A 3VE1A 2XE5A 4KR4A 3A2SX 5D5DA 4U9CA 4AFKA 3SYSA 4Z7GA 1ZHWA 3DA3A 3SZVA 5AFUL 4B61A 4D65A 1QJPA 4AS2A 3LJ0A 4N58A 3LJ1A 2ZLDA 3KVDD 4LSHA 2CAZB 1IZNA 5PRNA 4AKRA 3SY9A 3AA1B 2XE2A 2YFAA 2O4VA 2Y0HA 3WI5A 4FSOA 4FESA 4AYID 1PHOA 2ODJA 3JTYA 1Q9GA 3PQUA 4AZLA 2OMFA 4O3ZA 3DA4A 3P23A 3TZGA 1ORMA 1MM4A 3K19A 3IAM1 4BUMX 2KC0A 4RJXA 4I1TA 1QJ9A 2F1TA 3EMNX 3SY7A 5DL6A 3DO9A 4HEA1 3POXA 4LSEA 2XTQA 1GFNA 3G7GA 3VA9A 5ADXL 3FBVA 2F6MB 3VZWX 4C69X 2LFUA 3VY8X 2KDYA 1SJ8A 4Q9VA 2L1LB 4G76A 3IAS1 2YNKA 3RBHA 3LK2B 5LNK1 6PRNA 4GHBA 4KRAA 3LK2A 2E8GA 4AS3A 4PUXA 3VE2A 4O3YA 2FGRA 3VZUX 3QRCA 1HXUA 3SDJA 4JCVE 2MJFB 2A2DA 3SZDA 5IYUA 5ADXK 4O3XB 4F4BA 2KZ7A 4AYDC 3PRNA 4AKRB 1IZNB 2PRNA 2FGQX 3LK3B 4JCHA 1Q9FA 3V8UA 2RIOA 3JSBA 4GCSA 4E1SA 2F1VA 2LHFA 3T20A 3LK3A 4G75A 1ZHYA 4PL3A 3UPGA 3HW9A 2XMXA 8PRNA 1ZHZA 5EE2A 4Z3TA 3PORA 1YS5A 2Y0LA 2KXPB 4AKMA 2V1CC 1MPFA 1OSMA 3LK42 2PORA 4O4XA 2KXPA 4O3WA 2N2LA 3VZTX 4FT6A 2ERVA 2K4TA 4FMSA 5AFUK 1ZHTA 4LSIA 2ZFGA 2XG6A 4HFVA 4OAVB 3AJFA 3UITA 3C5OA 3AAAB 4GF4A 4FRXA 4GXTA 5DL8A 2N2MA 1HXTA 1GFQA 1BXWA 5DL7A 5GV0A 2YFBA 2FUG1 3WI4A 3AAAA 4RLBA 7PRNA 1MM5A 2KKMA 1U5KA 3PQSA 3KP9A 3AA7A 1ZHXA 2JB2A 1E54A 2J1NA 4U6RA 4OAUC 5HGIA 3AA6B 4RL9A 2Y2XA 4QQ1A 3FYXA 4Z7HA 1P4TA 2KZ7B 3AA6A 2P22B 2XTRA 3LK41 3T0SA 2F66B 4FZLA 3QRAA 4O4UA 1YO7A 4PL5A 1THQA 1GFPA 4FZMA 4AUIA 4RJWA 2M06A 4FZNA 2MHLA 1GFMA 1QJ8A 4PL4A 3T24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G76 A;  3DA3 A;  4N58 A;  4G75 A;  4FZN A;  2XTQ A;  4N59 A;  2XTR A;  4FZM A;  3DA4 A;  2XMX A;  4FZL A; 
#chains in the Genus database with same CATH topology
 4D5U A;  3UU2 A;  4PR7 A;  3HWB A;  4AYE C;  3NSG A;  4C00 A;  1HXX A;  1JQO A;  3Q8D A;  4NV5 A;  3PGR A;  2JMM A;  4AYM C;  4LSF A;  3LJ2 A;  2JB1 A;  2Y0K A;  4RLC A;  2R8A A;  2K19 A;  2ZW3 A;  4IL6 O;  2W81 C;  3AA1 A;  3JCU O;  4FOZ A;  5FVN A;  2QTK A;  4DWL A;  4O49 A;  4FSP A;  5G26 A;  4YZD A;  3HOL A;  3POQ A;  3UAQ A;  4O1P A;  3POU A;  5G3A A;  2XE1 A;  3AA0 B;  1W3S A;  4E1T A;  5T5F A;  5GTH O;  3GP6 A;  2GE4 A;  2GSC A;  4XNL A;  4FRT A;  3F4M A;  3L0I A;  2QGM A;  4KR8 A;  3AA0 A;  5TIS O;  2R4L A;  3I9V 1;  4GCP A;  3AA7 B;  2MNH A;  2FEF A;  2IP6 A;  3BS0 A;  4XNK A;  4K3C A;  5DL5 A;  4O1O A;  2W80 C;  1GFO A;  2XE3 A;  2IWW A;  2Y7S A;  3HOE A;  2X27 X;  4FUV A;  4AYN A;  4NV2 A;  4GCQ A;  3AAE B;  2M07 A;  1H6S 1;  2K0L A;  2X9K A;  5JDP A;  1G90 A;  2JB3 A;  4N59 A;  1PRN A;  4D64 A;  2AXT O;  2ZRR A;  3AAE A;  3VY9 X;  2J4U P;  2JAE A;  4PJ0 O;  4YZ9 A;  3O0E A;  1BH3 A;  2V6E A;  1OPF A;  2A2C A;  4YZC A;  2YPV A;  4JFB A;  3SYB A;  1BT9 A;  3VE1 A;  2XE5 A;  4KR4 A;  3A2S X;  3PGU A;  5D5D A;  4U9C A;  4AFK A;  3SYS A;  4Z7G A;  1ZHW A;  3DA3 A;  3SZV A;  5AFU L;  4B61 A;  4D65 A;  1QJP A;  4AS2 A;  3LJ0 A;  4N58 A;  3LJ1 A;  2ZLD A;  3KVD D;  4LSH A;  2CAZ B;  1IZN A;  5PRN A;  2ETD A;  4AKR A;  3FVV A;  3SY9 A;  3AA1 B;  5KAF O;  2XE2 A;  2YFA A;  2O4V A;  2Y0H A;  3WI5 A;  4FSO A;  5GTI O;  4FES A;  4AYI D;  1PHO A;  2ODJ A;  3JTY A;  1Q9G A;  4UB6 O;  5B66 O;  3PQU A;  4AZL A;  2OMF A;  4O3Z A;  3WU2 O;  4UB8 O;  3DA4 A;  3P23 A;  3TZG A;  1ORM A;  1MM4 A;  3K19 A;  3IAM 1;  4BUM X;  2RAD A;  2KC0 A;  3DWN A;  4RJX A;  4I1T A;  1QJ9 A;  1T1L A;  2F1T A;  3EMN X;  3SY7 A;  5DL6 A;  3DO9 A;  4HEA 1;  5KAI O;  3POX A;  4LSE A;  2XTQ A;  1GFN A;  3G7G A;  3VA9 A;  5ADX L;  3DWO X;  3FBV A;  2F6M B;  3VZW X;  4C69 X;  2LFU A;  3VY8 X;  2KDY A;  1S5L O;  1SJ8 A;  4Q9V A;  2JBW A;  2L1L B;  5G39 A;  4C4V B;  4G76 A;  5E79 O;  3IAS 1;  2YNK A;  3RBH A;  4C4V A;  3LK2 B;  2WJQ A;  5LNK 1;  6PRN A;  4GHB A;  2BL8 A;  4KRA A;  3LK2 A;  3B55 A;  2E8G A;  3BRY A;  4AS3 A;  4PUX A;  2WVP A;  4O3Y A;  2FGR A;  5G38 A;  3VE2 A;  3VZU X;  3QRC A;  1HXU A;  2R4O A;  3SDJ A;  4JCV E;  2MJF B;  2A2D A;  3SZD A;  5IYU A;  5ADX K;  4O3X B;  4F4B A;  2KZ7 A;  4AYD C;  3PRN A;  1IZN B;  2PRN A;  4AKR B;  2FGQ X;  3LK3 B;  4JCH A;  2QZG A;  1Q9F A;  3V8U A;  2RIO A;  3JSB A;  4GCS A;  4E1S A;  2F1V A;  2IWV A;  2BL7 A;  2LHF A;  3T20 A;  2WJR A;  3LK3 A;  4G75 A;  1ZHY A;  4PL3 A;  3UPG A;  3HW9 A;  2XMX A;  3A0B O;  8PRN A;  1ZHZ A;  5EE2 A;  5B5E O;  4Z3T A;  3POR A;  1YS5 A;  2Y0L A;  2R4N A;  2KXP B;  4AKM A;  2V1C C;  2F1C X;  1MPF A;  1OSM A;  3LK4 2;  2POR A;  4O4X A;  2KXP A;  4O3W A;  2N2L A;  3VZT X;  4K3B A;  4FT6 A;  2ERV A;  2K4T A;  2RLD A;  4FMS A;  5AFU K;  1ZHT A;  4LSI A;  2ZFG A;  2XG6 A;  4HFV A;  4N75 A;  4OAV B;  3A0H O;  3AJF A;  3UIT A;  3DZM A;  3NJT A;  3C5O A;  4CTD A;  2R88 A;  2R89 A;  3AAA B;  4GF4 A;  4FRX A;  4GXT A;  5DL8 A;  2N2M A;  1HXT A;  1GFQ A;  1BXW A;  5DL7 A;  5GV0 A;  2YFB A;  2FUG 1;  3WI4 A;  3AAA A;  3KZI O;  4RLB A;  7PRN A;  1MM5 A;  2KKM A;  1U5K A;  3PQS A;  3KP9 A;  3PF1 A;  2JQY A;  3AA7 A;  1ZHX A;  2JB2 A;  1E54 A;  2J1N A;  4U6R A;  4OAU C;  5HGI A;  3AA6 B;  4RL9 A;  2Y2X A;  4QQ1 A;  3FYX A;  4Z7H A;  4FQE A;  1P4T A;  2KZ7 B;  4N74 A;  3AA6 A;  2P22 B;  5H2F O;  2FU2 A;  2XTR A;  3LK4 1;  3T0S A;  2F66 B;  3FNB A;  4FZL A;  3QRA A;  1T16 A;  4O4U A;  1YO7 A;  4PL5 A;  1THQ A;  2R4P A;  1GFP A;  1TDP A;  4FZM A;  3BRZ A;  2HGK A;  4AUI A;  3PGS A;  4RJW A;  2M06 A;  4FZN A;  2MHL A;  1GFM A;  1QJ8 A;  4PL4 A;  2QSB A;  3T24 A; 
#chains in the Genus database with same CATH homology
 4D5U A;  3UU2 A;  3HWB A;  4AYE C;  3NSG A;  1HXX A;  3Q8D A;  4NV5 A;  2JMM A;  4AYM C;  4LSF A;  3LJ2 A;  2JB1 A;  2Y0K A;  4RLC A;  2K19 A;  2W81 C;  3AA1 A;  4FOZ A;  5FVN A;  2QTK A;  4DWL A;  4O49 A;  4FSP A;  5G26 A;  4YZD A;  3HOL A;  3POQ A;  3UAQ A;  4O1P A;  3POU A;  2XE1 A;  3AA0 B;  1W3S A;  4E1T A;  5T5F A;  3GP6 A;  2GE4 A;  4XNL A;  4FRT A;  3F4M A;  3L0I A;  4KR8 A;  3AA0 A;  3I9V 1;  4GCP A;  3AA7 B;  2MNH A;  2IP6 A;  4XNK A;  5DL5 A;  4O1O A;  2W80 C;  1GFO A;  2XE3 A;  2Y7S A;  3HOE A;  4AYN A;  2X27 X;  4FUV A;  4NV2 A;  4GCQ A;  3AAE B;  2M07 A;  1H6S 1;  2K0L A;  5JDP A;  1G90 A;  2JB3 A;  4N59 A;  1PRN A;  4D64 A;  2ZRR A;  3AAE A;  3VY9 X;  2J4U P;  2JAE A;  4YZ9 A;  3O0E A;  1BH3 A;  2V6E A;  1OPF A;  2A2C A;  4YZC A;  2YPV A;  4JFB A;  3SYB A;  1BT9 A;  3VE1 A;  2XE5 A;  4KR4 A;  3A2S X;  5D5D A;  4U9C A;  4AFK A;  3SYS A;  4Z7G A;  1ZHW A;  3DA3 A;  3SZV A;  5AFU L;  4B61 A;  4D65 A;  1QJP A;  4AS2 A;  3LJ0 A;  4N58 A;  3LJ1 A;  2ZLD A;  3KVD D;  4LSH A;  2CAZ B;  1IZN A;  5PRN A;  4AKR A;  3SY9 A;  3AA1 B;  2XE2 A;  2YFA A;  2O4V A;  2Y0H A;  3WI5 A;  4FSO A;  4FES A;  4AYI D;  1PHO A;  2ODJ A;  3JTY A;  1Q9G A;  3PQU A;  4AZL A;  2OMF A;  4O3Z A;  3DA4 A;  3P23 A;  3TZG A;  1ORM A;  1MM4 A;  3K19 A;  3IAM 1;  4BUM X;  2KC0 A;  4RJX A;  4I1T A;  1QJ9 A;  2F1T A;  3EMN X;  3SY7 A;  5DL6 A;  3DO9 A;  4HEA 1;  3POX A;  4LSE A;  2XTQ A;  1GFN A;  3G7G A;  3VA9 A;  5ADX L;  3FBV A;  2F6M B;  3VZW X;  4C69 X;  2LFU A;  3VY8 X;  2KDY A;  1SJ8 A;  4Q9V A;  2L1L B;  4G76 A;  3IAS 1;  2YNK A;  3RBH A;  3LK2 B;  5LNK 1;  6PRN A;  4GHB A;  4KRA A;  3LK2 A;  2E8G A;  4AS3 A;  4PUX A;  3VE2 A;  4O3Y A;  2FGR A;  3VZU X;  3QRC A;  1HXU A;  3SDJ A;  4JCV E;  2MJF B;  2A2D A;  3SZD A;  5IYU A;  5ADX K;  4O3X B;  4F4B A;  2KZ7 A;  4AYD C;  3PRN A;  4AKR B;  1IZN B;  2PRN A;  2FGQ X;  3LK3 B;  4JCH A;  1Q9F A;  3V8U A;  2RIO A;  3JSB A;  4GCS A;  4E1S A;  2F1V A;  2LHF A;  3T20 A;  3LK3 A;  4G75 A;  1ZHY A;  4PL3 A;  3UPG A;  3HW9 A;  2XMX A;  8PRN A;  1ZHZ A;  5EE2 A;  4Z3T A;  3POR A;  1YS5 A;  2Y0L A;  2KXP B;  4AKM A;  2V1C C;  1MPF A;  1OSM A;  3LK4 2;  2POR A;  4O4X A;  2KXP A;  4O3W A;  2N2L A;  3VZT X;  4FT6 A;  2ERV A;  2K4T A;  4FMS A;  5AFU K;  1ZHT A;  4LSI A;  2ZFG A;  2XG6 A;  4HFV A;  4OAV B;  3AJF A;  3UIT A;  3C5O A;  3AAA B;  4GF4 A;  4FRX A;  4GXT A;  5DL8 A;  2N2M A;  1HXT A;  1GFQ A;  1BXW A;  5DL7 A;  5GV0 A;  2YFB A;  2FUG 1;  3WI4 A;  3AAA A;  4RLB A;  7PRN A;  1MM5 A;  2KKM A;  1U5K A;  3PQS A;  3KP9 A;  3AA7 A;  1ZHX A;  2JB2 A;  1E54 A;  2J1N A;  4U6R A;  4OAU C;  5HGI A;  3AA6 B;  4RL9 A;  2Y2X A;  4QQ1 A;  3FYX A;  4Z7H A;  1P4T A;  2KZ7 B;  3AA6 A;  2P22 B;  2XTR A;  3LK4 1;  3T0S A;  2F66 B;  4FZL A;  3QRA A;  4O4U A;  1YO7 A;  4PL5 A;  1THQ A;  1GFP A;  4FZM A;  4AUI A;  4RJW A;  2M06 A;  4FZN A;  2MHL A;  1GFM A;  1QJ8 A;  4PL4 A;  3T24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...