4G7OA

Crystal structure of thermus thermophilus transcription initiation complex containing 2 nt of rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
226
Chain Sequence
b'SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
total genus 51
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7oA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7oA01
2E2IK 4LLGA 5C4XC 2R93C 2WAQD 4A3MC 2JA5C 5IP9K 3CQZC 4BXXC 1TWGK 4YG2A 3HOWK 3S2HC 4A3DC 3S15K 3S1QK 1SFOK 2O5IA 1I6HK 2A6EA 2E2IC 4YFNA 1WCMK 1Y1WK 1TWAK 3RZDK 3S14K 5IP9C 2E2JK 1TWGC 1TWHK 5FJ8K 3HOWC 3S1QC 3S15C 4A3EK 3GTGK 3S1NK 1SFOC 1I6HC 2NVQK 2BE5A 1WCMC 2Y0SL 1Y1WC 3H3VD 1TWAC 3HKZL 3RZDC 3S14C 2E2JC 2WB1L 1TWHC 3S1NC 4A3EC 3GTGC 1HQMA 4OIQA 2NVQC 4A3GC 4Q4ZA 5M5XK 4OIOA 4QIWL 4BY7K 4AYBD 3I4MK 3K7AK 3HOZK 4OINA 5IP7K 4YFXA 5M5YK 3H0GK 4LK0A 4QJVB 2A6HA 4BY7C 3HOXC 5M3FK 3HOVK 3I4MC 3M3YK 2PPBA 3K7AC 3EQLA 5IP7C 3HOZC 4C3JK 2NVXK 3H0GC 3S2DK 1YNJA 4LJZA 4KN4A 3HOVC 3M3YC 5M5WK 5FLMK 3GTLK 4C3IK 3PO2K 1TWFK 4OIRA 2Y0SD 4C3JC 4XLNA 2CW0A 3HKZD 2NVXC 2PMZL 4A3BK 3S2DC 3PO3K 2WB1D 5IYDK 3S17K 5FLMC 3GTLC 3PO2C 4XSZA 4MEYA 4C3IC 3GTOK 1I50K 3I4NK 1TWFC 4A3BC 1TWCK 3GTKK 4Y52K 3PO3C 3GTMK 4QIWD 5IYDC 3S17C 2A68A 3GTOC 4A3FK 5C4JK 4MQ9A 4MEXA 1I50C 3I4NC 2YU9K 1Y1VK 4A3CK 1TWCC 4LK1A 5IYCK 2NVTK 3GTKC 4Y52C 4BBRK 4X6AK 3GTMC 4XSXA 3M4OK 4A3FC 5C4JC 5M3MK 4OIPA 4YFKA 2YU9C 2O5JA 2B63K 1Y1VC 4A3CC 4C2MK 5IYCC 2NVTC 1I6VA 4BBRC 4KMUA 4X6AC 2JA6K 5IYBK 5C44K 3M4OC 5TMFA 2PA8L 1R9TK 2E2HK 4G7HA 2B63C 3HOXK 4G7ZA 4A93K 5D4DA 2PMZD 4C2MC 5C4XK 5C3EK 2JA8K 4ZH4A 2JA7K 2A69A 2R7ZK 1SMYA 4GZYA 1BDFA 2NVYK 2JA6C 4C3HK 5IYBC 5C44C 3S16K 5TMCA 4NOIA 1R9TC 2E2HC 4A3LK 3S1MK 1YNNA 4A93C 4Q5SA 2WAQL 5C3EC 2JA8C 2R7ZC 2JA7C 3GTJK 4QJVA 2NVYC 4C3HC 1I3QK 3S1RK 3S16C 4XLPA 4G7OA 1IW7A 4A3LC 3S1MC 3GTQK 3HOUK 3GTJC 2VUMK 3HOYK 1I3QC 1XPPA 3FKIK 3S1RC 4A3KK 4A3IK 1ZYRA 3DXJA 2R92K 4JK1A 3GTQC 3HOUC 4Y7NK 3H3VL 4A3JK 3RZOK 4A3GK 4BBSK 2VUMC 3HOYC 3FKIC 4A3KC 4A3IC 1K83K 2PA8D 3GTPK 2R92C 4BY1K 4Y7NC 4BBSC 3RZOC 4A3JC 2R93K 2JA5K 4A3MK 4KN7A 3CQZK 3WODA 4BXXK 3S2HK 4A3DK 4AYBL 1K83C 3GTPC 4BY1C
chains in the Genus database with same CATH superfamily
2RH6A 2E2IK 2WAQD 2GSNA 5IP9K 1C0AA 3HOWK 3S15K 2O5IA 2A6EA 1WCMK 1Y1WK 1INNA 1TWAK 3TFIA 3RZDK 1TWGC 5FJ8K 3S1NK 3G4CA 4KMHA 1IBAA 2BE5A 3HKZL 1B4BA 1TWHC 3GTGC 4WFBS 1HQMA 3Q3QA 4QIWL 1TWCA 4BY7K 3I4MK 4IOAS 3K7AK 1DD5A 3ADAC 4LK0A 3H0GK 1O2AA 3HOXC 2V6SA 1IQ0A 4C45A 1WIHA 4C3JK 1O2BA 3BP3A 2ZUEA 2R92A 3HOVC 5FLMK 2KQ1A 3T00A 2JA6A 4XLNA 1O28A 4GTAA 2E2HA 3PO3K 2WB1D 4WFNS 5IYDK 1L0WA 3PO2C 4XSZA 4C3IC 2JA7A 2NVYA 3I4NK 1TWFC 1VJEA 1GE9A 3CF5S 3GTKK 3GTMK 3AH5A 3GTJA 1HI9A 5C4JK 1TWGA 1Y1VK 4A3CK 4LK1A 2NVTK 2JH3A 4BBRK 4LOWA 2YU9C 5HL7S 3FKIA 4C2MK 1PJ6A 4X6AC 3TFJA 3M4OC 5TMFA 2PA8L 1BJTA 2XCOA 1R9TK 2B63C 1K83A 2JA8K 2R7ZK 1BDFA 1EK8A 5IYBC 5C44C 4G0UA 2JA5A 3A8IA 4A93C 2WAQL 5C3EC 4QJVA 2ZUFA 1ZVUA 2E2IA 5HL8A 3S1MC 3L4JA 2GSUA 4FZBA 1VGXA 1WCMA 4KM9A 1Y1WA 3TTGA 1TWAA 1ZYRA 4FM9A 1DCPA 2R92K 4JK1A 4A3JK 1FEUA 1USOA 1WOOA 1TWFA 5IOTA 4WCES 4A3IC 3FOFA 1WOPA 1XXAA 4Y7NC 3NUHA 4KN7A 4BY1C 3OPFA 2XCQA 2YU9A 4BXXC 1TWGK 4XCHA 4KB2A 1J6XA 3GDZA 1TWHK 3HXAA 3S1QC 3GTGK 4PAAA 2ZJPS 3H3VD 3S14C 1J98A 5IOSA 2E2JC 1DCHA 2WB1L 4OIQA 2NVQC 5E68A 4Q4ZA 5M5XK 1AB4A 4OIOA 3ERED 3BUEA 1JOEA 4AYBD 3GTKA 1O2FB 3GTMA 3N0BA 1XXBA 4QJVB 2A6HA 5JVHS 1Y1VA 3SZYA 3HOVK 2PPBA 3EQLA 5IP7C 3HOZC 4GTCA 4LJZA 1J6VA 4ILDA 1IE0A 4C3IK 3PO2K 1TWFK 4OIRA 1R9TA 2ZJRS 1VH2A 3GTLC 2R7ZA 4WILA 3DLLS 3S17C 3GTOC 2V6UA 2YU9K 1I50C 3FOEA 1F7UA 2P8TA 4Y52C 4X6AK 1XZPA 4XSXA 3M4OK 4A3FC 2B63K 2D6FC 5IYCC 3JSTA 3AD7C 4KMUA 2CFAA 4DDQA 5IYBK 3AD9C 5C44K 3OREA 4A93K 5C4XK 2PMZD 5C3EK 4ZH4A 1SMYA 4GZYA 2W7VA 2Y3PA 1USMA 5TMCA 3S1MK 4Q5SA 1WQFA 3AD8C 1IW7A 3FHZA 1O26A 1I3QC 1XPPA 4GTBA 4A3IK 2KWAA 3DXJA 1TWHA 4Y7NK 3HOUC 1WSRA 3H3VL 3PIPS 3GTGA 2GSOA 2VUMC 3HOYC 3T02A 5EGHA 4BY1K 1JVIA 3RZOC 4WJ4A 4O2DA 1J6WA 3WODA 4BXXK 4KMAA 4AYBL 5L46A 3A8JA 3GTPC 4KB4A 4LLGA 5C4XC 4A3MC 3CQZC 4YG2A 3S2HC 3S1QK 4M1XA 2RGRA 4YFNA 3CAGA 1KQ4A 4GTFA 3S14K 4U67S 2E2JK 1XZPB 4GTEA 4GT9A 1SFOC 1I6HC 2NVQK 2GAHC 2CFAB 4A3EC 1ZBSA 1ZXOA 1F93A 5IOQA 3HOZK 4OINA 5IP7K 5M5YK 4GFQA 3LAJA 5TJ3A 4KASA 4G0WA 5JVOA 2B63A 1YNJA 1VRQC 2V6TA 1JQWA 3M3YC 5M5WK 3GTLK 1WSVA 3SZZA 4WF9S 4KARA 2Y0SD 2NVXC 2PMZL 4P9SA 3S2DC 3S17K 3GTOK 4MEYA 2KPUA 1I50K 4A3BC 4AH6A 3AQOA 4Y52K 2L3UA 4A3FK 1IL2A 4MEXA 1YX2A 1TWCC 5IYCK 3A8KA 1SFOA 3MMLB 5M3MK 4YFKA 2O5JA 2FQTA 1ISEA 4G7HA 5D4DA 4GTLA 1WOSA 2JA6C 1XXCA 2E2HC 5EGEA 2JA7C 1RU0A 2NVYC 4C3HC 1I3QK 3S16C 4A3LC 2EBBA 1WQGA 3G4AA 3TFHA 1BGWA 1B4AA 3HOUK 1V5VA 3GTJC 3IPJA 2VUMK 3HOYK 3S1RC 2NVXA 5JVGS 3GTQC 4A3GK 4P5BA 3RZOK 1PJ7A 1O29A 3FKIC 4A3KC 3GTPK 2PHCB 4BBSC 4BLAA 4A3MK 3CQZK 4BKWA 5DM6S 3S2HK 1K83C 1O25A 2R93C 2JA5C 3GEEA 4A3DC 4P5AA 1WQHA 1SFOK 1I6HK 2E2IC 2L5NA 5IP9C 3HOWC 4A3EK 3S15C 4LQYA 1F9NA 4KC6A 1X31C 1UV7A 1WCMC 2Y0SL 1Y1WC 5CJ9A 1TWAC 3GTLA 3RZDC 2P5MA 4BLBA 3S1NC 4WJ3M 3PIOS 1EQRA 4A3GC 1VLOA 3GTOA 2GAGC 4J3NA 3LYWA 4KMDA 1I50A 2ZFZA 4YFXA 3LAPA 4IOCS 1XZQA 5CHPA 1EH1A 3GTQA 4BY7C 5M3FK 3M3YK 3I4MC 3K7AC 3V4GA 2FQOA 2NVXK 3H0GC 5IORA 3S2DK 5JFEA 4RMFA 4KN4A 5DM7S 4A3BK 4C3JC 2CW0A 3HKZD 3GIRA 2XCRB 5FLMC 2R93A 4KM8A 3L4KA 1TWCK 1EI6A 3PO3C 4QIWD 5HQHA 5IYDC 2A68A 4MQ9A 3I4NC 1I3QA 1WORA 3N3YA 3GTKC 3GTMC 1DCOA 1YCLA 4KATA 4LR2A 5C4JC 1O24A 4OIPA 2VUMA 3GEIA 1Y1VC 4A3CC 2NVTC 3LPXA 4PABA 3S0XA 1I6VA 4BBRC 3VA7A 2JA6K 3GSIA 3QX3A 2E2HK 4G7ZA 4IO9S 4C2MC 1O27A 3N0CA 1G51A 2JA7K 2A69A 3GTPA 2KXYA 2NVYK 4C3HK 3S16K 1R9TC 4NOIA 4A3LK 3CQZA 1PJ5A 1YNNA 4KDDA 2JA8C 2R7ZC 1IS1A 3T01A 3GTJK 3S1RK 1EFWA 4XLPA 3H0GA 4G7OA 1F7VA 4G0VA 3GTQK 3OEPA 1BS2A 1XZQB 3FKIK 4A3KK 4GTDA 4WFAS 4BBSK 3BP8C 3AQPA 1K83K 2ZJQS 2PA8D 2R92C 4KAWX 4A3JC 2R93K 2JA5K 3GEHA 4A3DK 1ZQ1C 3HOXK
chains in the Genus database with same CATH topology
2E2IK 4LLGA 5C4XC 2R93C 2WAQD 4A3MC 2JA5C 5IP9K 3CQZC 4BXXC 1TWGK 4YG2A 3HOWK 3S2HC 4A3DC 3S15K 3S1QK 1SFOK 2O5IA 1I6HK 2A6EA 2E2IC 4YFNA 1WCMK 1Y1WK 1TWAK 3RZDK 3S14K 5IP9C 2E2JK 1TWGC 1TWHK 5FJ8K 3HOWC 3S1QC 3S15C 4A3EK 3GTGK 3S1NK 1SFOC 1I6HC 2NVQK 2BE5A 1WCMC 2Y0SL 1Y1WC 3H3VD 1TWAC 3HKZL 3RZDC 3S14C 2E2JC 2WB1L 1TWHC 3S1NC 4A3EC 3GTGC 1HQMA 4OIQA 2NVQC 4A3GC 4Q4ZA 5M5XK 4OIOA 4QIWL 4BY7K 4AYBD 3I4MK 3K7AK 3HOZK 4OINA 5IP7K 4YFXA 5M5YK 3H0GK 4LK0A 4QJVB 2A6HA 4BY7C 3HOXC 5M3FK 3HOVK 3I4MC 3M3YK 2PPBA 3K7AC 3EQLA 5IP7C 3HOZC 4C3JK 2NVXK 3H0GC 3S2DK 1YNJA 4LJZA 4KN4A 3HOVC 3M3YC 5M5WK 5FLMK 3GTLK 4C3IK 3PO2K 1TWFK 4OIRA 2Y0SD 4C3JC 4XLNA 2CW0A 3HKZD 2NVXC 2PMZL 4A3BK 3S2DC 3PO3K 2WB1D 5IYDK 3S17K 5FLMC 3GTLC 3PO2C 4XSZA 4MEYA 4C3IC 3GTOK 1I50K 3I4NK 1TWFC 4A3BC 1TWCK 3GTKK 4Y52K 3PO3C 3GTMK 4QIWD 5IYDC 3S17C 2A68A 3GTOC 4A3FK 5C4JK 4MQ9A 4MEXA 1I50C 3I4NC 2YU9K 1Y1VK 4A3CK 1TWCC 4LK1A 5IYCK 2NVTK 3GTKC 4Y52C 4BBRK 4X6AK 3GTMC 4XSXA 3M4OK 4A3FC 5C4JC 5M3MK 4OIPA 4YFKA 2YU9C 2O5JA 2B63K 1Y1VC 4A3CC 4C2MK 5IYCC 2NVTC 1I6VA 4BBRC 4KMUA 4X6AC 2JA6K 5IYBK 5C44K 3M4OC 5TMFA 2PA8L 1R9TK 2E2HK 4G7HA 2B63C 3HOXK 4G7ZA 4A93K 5D4DA 2PMZD 4C2MC 5C4XK 5C3EK 2JA8K 4ZH4A 2JA7K 2A69A 2R7ZK 1SMYA 4GZYA 1BDFA 2NVYK 2JA6C 4C3HK 5IYBC 5C44C 3S16K 5TMCA 4NOIA 1R9TC 2E2HC 4A3LK 3S1MK 1YNNA 4A93C 4Q5SA 2WAQL 5C3EC 2JA8C 2R7ZC 2JA7C 3GTJK 4QJVA 2NVYC 4C3HC 1I3QK 3S1RK 3S16C 4XLPA 4G7OA 1IW7A 4A3LC 3S1MC 3GTQK 3HOUK 3GTJC 2VUMK 3HOYK 1I3QC 1XPPA 3FKIK 3S1RC 4A3KK 4A3IK 1ZYRA 3DXJA 2R92K 4JK1A 3GTQC 3HOUC 4Y7NK 3H3VL 4A3JK 3RZOK 4A3GK 4BBSK 2VUMC 3HOYC 3FKIC 4A3KC 4A3IC 1K83K 2PA8D 3GTPK 2R92C 4BY1K 4Y7NC 4BBSC 3RZOC 4A3JC 2R93K 2JA5K 4A3MK 4KN7A 3CQZK 3WODA 4BXXK 3S2HK 4A3DK 4AYBL 1K83C 3GTPC 4BY1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I K;  4LLG A;  5C4X C;  2R93 C;  2WAQ D;  4A3M C;  2JA5 C;  5IP9 K;  3CQZ C;  4BXX C;  1TWG K;  4YG2 A;  3HOW K;  3S2H C;  4A3D C;  3S15 K;  3S1Q K;  1SFO K;  2O5I A;  1I6H K;  2A6E A;  2E2I C;  4YFN A;  1WCM K;  1Y1W K;  1TWA K;  3RZD K;  3S14 K;  5IP9 C;  2E2J K;  1TWG C;  1TWH K;  5FJ8 K;  3HOW C;  3S1Q C;  3S15 C;  4A3E K;  3GTG K;  3S1N K;  1SFO C;  1I6H C;  2NVQ K;  2BE5 A;  1WCM C;  2Y0S L;  1Y1W C;  3H3V D;  1TWA C;  3HKZ L;  3RZD C;  3S14 C;  2E2J C;  2WB1 L;  1TWH C;  3S1N C;  4A3E C;  3GTG C;  1HQM A;  4OIQ A;  2NVQ C;  4A3G C;  4Q4Z A;  5M5X K;  4OIO A;  4QIW L;  4BY7 K;  4AYB D;  3I4M K;  3K7A K;  3HOZ K;  4OIN A;  5IP7 K;  4YFX A;  5M5Y K;  3H0G K;  4LK0 A;  4QJV B;  2A6H A;  4BY7 C;  3HOX C;  5M3F K;  3HOV K;  3I4M C;  3M3Y K;  2PPB A;  3K7A C;  3EQL A;  5IP7 C;  3HOZ C;  4C3J K;  2NVX K;  3H0G C;  3S2D K;  1YNJ A;  4LJZ A;  4KN4 A;  3HOV C;  3M3Y C;  5M5W K;  5FLM K;  3GTL K;  4C3I K;  3PO2 K;  1TWF K;  4OIR A;  2Y0S D;  4C3J C;  4XLN A;  2CW0 A;  3HKZ D;  2NVX C;  2PMZ L;  4A3B K;  3S2D C;  3PO3 K;  2WB1 D;  5IYD K;  3S17 K;  5FLM C;  3GTL C;  3PO2 C;  4XSZ A;  4MEY A;  4C3I C;  3GTO K;  1I50 K;  3I4N K;  1TWF C;  4A3B C;  1TWC K;  3GTK K;  4Y52 K;  3PO3 C;  3GTM K;  4QIW D;  5IYD C;  3S17 C;  2A68 A;  3GTO C;  4A3F K;  5C4J K;  4MQ9 A;  4MEX A;  1I50 C;  3I4N C;  2YU9 K;  1Y1V K;  4A3C K;  1TWC C;  4LK1 A;  5IYC K;  2NVT K;  3GTK C;  4Y52 C;  4BBR K;  4X6A K;  3GTM C;  4XSX A;  3M4O K;  4A3F C;  5C4J C;  5M3M K;  4OIP A;  4YFK A;  2YU9 C;  2O5J A;  2B63 K;  1Y1V C;  4A3C C;  4C2M K;  5IYC C;  2NVT C;  1I6V A;  4BBR C;  4KMU A;  4X6A C;  2JA6 K;  5IYB K;  5C44 K;  3M4O C;  5TMF A;  2PA8 L;  1R9T K;  2E2H K;  4G7H A;  2B63 C;  3HOX K;  4G7Z A;  4A93 K;  5D4D A;  2PMZ D;  4C2M C;  5C4X K;  5C3E K;  2JA8 K;  4ZH4 A;  2JA7 K;  2A69 A;  2R7Z K;  1SMY A;  4GZY A;  1BDF A;  2NVY K;  2JA6 C;  4C3H K;  5IYB C;  5C44 C;  3S16 K;  5TMC A;  4NOI A;  1R9T C;  2E2H C;  4A3L K;  3S1M K;  1YNN A;  4A93 C;  4Q5S A;  2WAQ L;  5C3E C;  2JA8 C;  2R7Z C;  2JA7 C;  3GTJ K;  4QJV A;  2NVY C;  4C3H C;  1I3Q K;  3S1R K;  3S16 C;  4XLP A;  4G7O A;  1IW7 A;  4A3L C;  3S1M C;  3GTQ K;  3HOU K;  3GTJ C;  2VUM K;  3HOY K;  1I3Q C;  1XPP A;  3FKI K;  3S1R C;  4A3K K;  4A3I K;  1ZYR A;  3DXJ A;  2R92 K;  4JK1 A;  3GTQ C;  3HOU C;  4Y7N K;  3H3V L;  4A3J K;  3RZO K;  4A3G K;  4BBS K;  2VUM C;  3HOY C;  3FKI C;  4A3K C;  4A3I C;  1K83 K;  2PA8 D;  3GTP K;  2R92 C;  4BY1 K;  4Y7N C;  4BBS C;  3RZO C;  4A3J C;  2R93 K;  2JA5 K;  4A3M K;  4KN7 A;  3CQZ K;  3WOD A;  4BXX K;  3S2H K;  4A3D K;  4AYB L;  1K83 C;  3GTP C;  4BY1 C; 
#chains in the Genus database with same CATH topology
 2RH6 A;  2E2I K;  2WAQ D;  2GSN A;  5IP9 K;  1C0A A;  3HOW K;  3S15 K;  2O5I A;  2A6E A;  1WCM K;  1Y1W K;  1INN A;  1TWA K;  3TFI A;  3RZD K;  1TWG C;  5FJ8 K;  3S1N K;  3G4C A;  4KMH A;  1IBA A;  2BE5 A;  3HKZ L;  1B4B A;  1TWH C;  3GTG C;  4WFB S;  1HQM A;  3Q3Q A;  4QIW L;  1TWC A;  4BY7 K;  3I4M K;  4IOA S;  3K7A K;  1DD5 A;  3ADA C;  4LK0 A;  3H0G K;  1O2A A;  3HOX C;  2V6S A;  1IQ0 A;  4C45 A;  1WIH A;  4C3J K;  1O2B A;  3BP3 A;  2ZUE A;  2R92 A;  3HOV C;  5FLM K;  2KQ1 A;  3T00 A;  2JA6 A;  4XLN A;  1O28 A;  4GTA A;  2E2H A;  3PO3 K;  2WB1 D;  4WFN S;  5IYD K;  1L0W A;  3PO2 C;  4XSZ A;  4C3I C;  2JA7 A;  2NVY A;  3I4N K;  1TWF C;  1VJE A;  1GE9 A;  3CF5 S;  3GTK K;  3GTM K;  3AH5 A;  3GTJ A;  1HI9 A;  5C4J K;  1TWG A;  1Y1V K;  4A3C K;  4LK1 A;  2NVT K;  2JH3 A;  4BBR K;  4LOW A;  2YU9 C;  5HL7 S;  3FKI A;  4C2M K;  1PJ6 A;  4X6A C;  3TFJ A;  3M4O C;  5TMF A;  2PA8 L;  1BJT A;  2XCO A;  1R9T K;  2B63 C;  1K83 A;  2JA8 K;  2R7Z K;  1BDF A;  1EK8 A;  5IYB C;  5C44 C;  4G0U A;  2JA5 A;  3A8I A;  4A93 C;  2WAQ L;  5C3E C;  4QJV A;  2ZUF A;  1ZVU A;  2E2I A;  5HL8 A;  3S1M C;  3L4J A;  2GSU A;  4FZB A;  1VGX A;  1WCM A;  4KM9 A;  1Y1W A;  3TTG A;  1TWA A;  1ZYR A;  4FM9 A;  1DCP A;  2R92 K;  4JK1 A;  4A3J K;  1FEU A;  1USO A;  1WOO A;  1TWF A;  5IOT A;  4WCE S;  4A3I C;  3FOF A;  1WOP A;  1XXA A;  4Y7N C;  3NUH A;  4KN7 A;  4BY1 C;  3OPF A;  2XCQ A;  2YU9 A;  4BXX C;  1TWG K;  4XCH A;  4KB2 A;  1J6X A;  3GDZ A;  1TWH K;  3HXA A;  3S1Q C;  3GTG K;  4PAA A;  2ZJP S;  3H3V D;  3S14 C;  1J98 A;  5IOS A;  2E2J C;  1DCH A;  2WB1 L;  4OIQ A;  2NVQ C;  5E68 A;  4Q4Z A;  5M5X K;  1AB4 A;  4OIO A;  3ERE D;  3BUE A;  1JOE A;  4AYB D;  3GTK A;  1O2F B;  3GTM A;  3N0B A;  1XXB A;  4QJV B;  2A6H A;  5JVH S;  1Y1V A;  3SZY A;  3HOV K;  2PPB A;  3EQL A;  5IP7 C;  3HOZ C;  4GTC A;  4LJZ A;  1J6V A;  4ILD A;  1IE0 A;  4C3I K;  3PO2 K;  1TWF K;  4OIR A;  1R9T A;  2ZJR S;  1VH2 A;  3GTL C;  2R7Z A;  4WIL A;  3DLL S;  3S17 C;  3GTO C;  2V6U A;  2YU9 K;  1I50 C;  3FOE A;  1F7U A;  2P8T A;  4Y52 C;  4X6A K;  1XZP A;  4XSX A;  3M4O K;  4A3F C;  2B63 K;  2D6F C;  5IYC C;  3JST A;  3AD7 C;  4KMU A;  2CFA A;  4DDQ A;  5IYB K;  3AD9 C;  5C44 K;  3ORE A;  4A93 K;  5C4X K;  2PMZ D;  5C3E K;  4ZH4 A;  1SMY A;  4GZY A;  2W7V A;  2Y3P A;  1USM A;  5TMC A;  3S1M K;  4Q5S A;  1WQF A;  3AD8 C;  1IW7 A;  3FHZ A;  1O26 A;  1I3Q C;  1XPP A;  4GTB A;  4A3I K;  2KWA A;  3DXJ A;  1TWH A;  4Y7N K;  3HOU C;  1WSR A;  3H3V L;  3PIP S;  3GTG A;  2GSO A;  2VUM C;  3HOY C;  3T02 A;  5EGH A;  4BY1 K;  1JVI A;  3RZO C;  4WJ4 A;  4O2D A;  1J6W A;  3WOD A;  4BXX K;  4KMA A;  4AYB L;  5L46 A;  3A8J A;  3GTP C;  4KB4 A;  4LLG A;  5C4X C;  4A3M C;  3CQZ C;  4YG2 A;  3S2H C;  3S1Q K;  4M1X A;  2RGR A;  4YFN A;  3CAG A;  1KQ4 A;  4GTF A;  3S14 K;  4U67 S;  2E2J K;  1XZP B;  4GTE A;  4GT9 A;  1SFO C;  1I6H C;  2NVQ K;  2GAH C;  2CFA B;  4A3E C;  1ZBS A;  1ZXO A;  1F93 A;  5IOQ A;  3HOZ K;  4OIN A;  5IP7 K;  5M5Y K;  4GFQ A;  3LAJ A;  5TJ3 A;  4KAS A;  4G0W A;  5JVO A;  2B63 A;  1YNJ A;  1VRQ C;  2V6T A;  1JQW A;  3M3Y C;  5M5W K;  3GTL K;  1WSV A;  3SZZ A;  4WF9 S;  4KAR A;  2Y0S D;  2NVX C;  2PMZ L;  4P9S A;  3S2D C;  3S17 K;  3GTO K;  4MEY A;  2KPU A;  1I50 K;  4A3B C;  4AH6 A;  3AQO A;  4Y52 K;  2L3U A;  4A3F K;  1IL2 A;  4MEX A;  1YX2 A;  1TWC C;  5IYC K;  3A8K A;  1SFO A;  3MML B;  5M3M K;  4YFK A;  2O5J A;  2FQT A;  1ISE A;  4G7H A;  5D4D A;  4GTL A;  1WOS A;  2JA6 C;  1XXC A;  2E2H C;  5EGE A;  2JA7 C;  1RU0 A;  2NVY C;  4C3H C;  1I3Q K;  3S16 C;  4A3L C;  2EBB A;  1WQG A;  3G4A A;  3TFH A;  1BGW A;  1B4A A;  3HOU K;  1V5V A;  3GTJ C;  3IPJ A;  2VUM K;  3HOY K;  3S1R C;  2NVX A;  5JVG S;  3GTQ C;  4A3G K;  4P5B A;  3RZO K;  1PJ7 A;  1O29 A;  3FKI C;  4A3K C;  3GTP K;  2PHC B;  4BBS C;  4BLA A;  4A3M K;  3CQZ K;  4BKW A;  5DM6 S;  3S2H K;  1K83 C;  1O25 A;  2R93 C;  2JA5 C;  3GEE A;  4A3D C;  4P5A A;  1WQH A;  1SFO K;  1I6H K;  2E2I C;  2L5N A;  5IP9 C;  3HOW C;  4A3E K;  3S15 C;  4LQY A;  1F9N A;  4KC6 A;  1X31 C;  1UV7 A;  1WCM C;  2Y0S L;  1Y1W C;  5CJ9 A;  1TWA C;  3GTL A;  3RZD C;  2P5M A;  4BLB A;  3S1N C;  4WJ3 M;  3PIO S;  1EQR A;  4A3G C;  1VLO A;  3GTO A;  2GAG C;  4J3N A;  3LYW A;  4KMD A;  1I50 A;  2ZFZ A;  4YFX A;  3LAP A;  4IOC S;  1XZQ A;  5CHP A;  1EH1 A;  3GTQ A;  4BY7 C;  5M3F K;  3M3Y K;  3I4M C;  3K7A C;  3V4G A;  2FQO A;  2NVX K;  3H0G C;  5IOR A;  3S2D K;  5JFE A;  4RMF A;  4KN4 A;  5DM7 S;  4A3B K;  4C3J C;  2CW0 A;  3HKZ D;  3GIR A;  2XCR B;  5FLM C;  2R93 A;  4KM8 A;  3L4K A;  1TWC K;  1EI6 A;  3PO3 C;  4QIW D;  5HQH A;  5IYD C;  2A68 A;  4MQ9 A;  3I4N C;  1I3Q A;  1WOR A;  3N3Y A;  3GTK C;  3GTM C;  1DCO A;  1YCL A;  4KAT A;  4LR2 A;  5C4J C;  1O24 A;  4OIP A;  2VUM A;  3GEI A;  1Y1V C;  4A3C C;  2NVT C;  3LPX A;  4PAB A;  3S0X A;  1I6V A;  4BBR C;  3VA7 A;  2JA6 K;  3GSI A;  3QX3 A;  2E2H K;  4G7Z A;  4IO9 S;  4C2M C;  1O27 A;  3N0C A;  1G51 A;  2JA7 K;  2A69 A;  3GTP A;  2KXY A;  2NVY K;  4C3H K;  3S16 K;  1R9T C;  4NOI A;  4A3L K;  3CQZ A;  1PJ5 A;  1YNN A;  4KDD A;  2JA8 C;  2R7Z C;  1IS1 A;  3T01 A;  3GTJ K;  3S1R K;  1EFW A;  4XLP A;  3H0G A;  4G7O A;  1F7V A;  4G0V A;  3GTQ K;  3OEP A;  1BS2 A;  1XZQ B;  3FKI K;  4A3K K;  4GTD A;  4WFA S;  4BBS K;  3BP8 C;  3AQP A;  1K83 K;  2ZJQ S;  2PA8 D;  2R92 C;  4KAW X;  4A3J C;  2R93 K;  2JA5 K;  3GEH A;  4A3D K;  1ZQ1 C;  3HOX K; 
#chains in the Genus database with same CATH homology
 2E2I K;  4LLG A;  5C4X C;  2R93 C;  2WAQ D;  4A3M C;  2JA5 C;  5IP9 K;  3CQZ C;  4BXX C;  1TWG K;  4YG2 A;  3HOW K;  3S2H C;  4A3D C;  3S15 K;  3S1Q K;  1SFO K;  2O5I A;  1I6H K;  2A6E A;  2E2I C;  4YFN A;  1WCM K;  1Y1W K;  1TWA K;  3RZD K;  3S14 K;  5IP9 C;  2E2J K;  1TWG C;  1TWH K;  5FJ8 K;  3HOW C;  3S1Q C;  3S15 C;  4A3E K;  3GTG K;  3S1N K;  1SFO C;  1I6H C;  2NVQ K;  2BE5 A;  1WCM C;  2Y0S L;  1Y1W C;  3H3V D;  1TWA C;  3HKZ L;  3RZD C;  3S14 C;  2E2J C;  2WB1 L;  1TWH C;  3S1N C;  4A3E C;  3GTG C;  1HQM A;  4OIQ A;  2NVQ C;  4A3G C;  4Q4Z A;  5M5X K;  4OIO A;  4QIW L;  4BY7 K;  4AYB D;  3I4M K;  3K7A K;  3HOZ K;  4OIN A;  5IP7 K;  4YFX A;  5M5Y K;  3H0G K;  4LK0 A;  4QJV B;  2A6H A;  4BY7 C;  3HOX C;  5M3F K;  3HOV K;  3I4M C;  3M3Y K;  2PPB A;  3K7A C;  3EQL A;  5IP7 C;  3HOZ C;  4C3J K;  2NVX K;  3H0G C;  3S2D K;  1YNJ A;  4LJZ A;  4KN4 A;  3HOV C;  3M3Y C;  5M5W K;  5FLM K;  3GTL K;  4C3I K;  3PO2 K;  1TWF K;  4OIR A;  2Y0S D;  4C3J C;  4XLN A;  2CW0 A;  3HKZ D;  2NVX C;  2PMZ L;  4A3B K;  3S2D C;  3PO3 K;  2WB1 D;  5IYD K;  3S17 K;  5FLM C;  3GTL C;  3PO2 C;  4XSZ A;  4MEY A;  4C3I C;  3GTO K;  1I50 K;  3I4N K;  1TWF C;  4A3B C;  1TWC K;  3GTK K;  4Y52 K;  3PO3 C;  3GTM K;  4QIW D;  5IYD C;  3S17 C;  2A68 A;  3GTO C;  4A3F K;  5C4J K;  4MQ9 A;  4MEX A;  1I50 C;  3I4N C;  2YU9 K;  1Y1V K;  4A3C K;  1TWC C;  4LK1 A;  5IYC K;  2NVT K;  3GTK C;  4Y52 C;  4BBR K;  4X6A K;  3GTM C;  4XSX A;  3M4O K;  4A3F C;  5C4J C;  5M3M K;  4OIP A;  4YFK A;  2YU9 C;  2O5J A;  2B63 K;  1Y1V C;  4A3C C;  4C2M K;  5IYC C;  2NVT C;  1I6V A;  4BBR C;  4KMU A;  4X6A C;  2JA6 K;  5IYB K;  5C44 K;  3M4O C;  5TMF A;  2PA8 L;  1R9T K;  2E2H K;  4G7H A;  2B63 C;  3HOX K;  4G7Z A;  4A93 K;  5D4D A;  2PMZ D;  4C2M C;  5C4X K;  5C3E K;  2JA8 K;  4ZH4 A;  2JA7 K;  2A69 A;  2R7Z K;  1SMY A;  4GZY A;  1BDF A;  2NVY K;  2JA6 C;  4C3H K;  5IYB C;  5C44 C;  3S16 K;  5TMC A;  4NOI A;  1R9T C;  2E2H C;  4A3L K;  3S1M K;  1YNN A;  4A93 C;  4Q5S A;  2WAQ L;  5C3E C;  2JA8 C;  2R7Z C;  2JA7 C;  3GTJ K;  4QJV A;  2NVY C;  4C3H C;  1I3Q K;  3S1R K;  3S16 C;  4XLP A;  4G7O A;  1IW7 A;  4A3L C;  3S1M C;  3GTQ K;  3HOU K;  3GTJ C;  2VUM K;  3HOY K;  1I3Q C;  1XPP A;  3FKI K;  3S1R C;  4A3K K;  4A3I K;  1ZYR A;  3DXJ A;  2R92 K;  4JK1 A;  3GTQ C;  3HOU C;  4Y7N K;  3H3V L;  4A3J K;  3RZO K;  4A3G K;  4BBS K;  2VUM C;  3HOY C;  3FKI C;  4A3K C;  4A3I C;  1K83 K;  2PA8 D;  3GTP K;  2R92 C;  4BY1 K;  4Y7N C;  4BBS C;  3RZO C;  4A3J C;  2R93 K;  2JA5 K;  4A3M K;  4KN7 A;  3CQZ K;  3WOD A;  4BXX K;  3S2H K;  4A3D K;  4AYB L;  1K83 C;  3GTP C;  4BY1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...