4G7OA

Crystal structure of thermus thermophilus transcription initiation complex containing 2 nt of rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription initiation.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase subunit alpha
molecule tags Transcription, transferase/dna
source organism Thermus thermophilus
total genus 51
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7oA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7oA01
1BDFA 5FLMC 2O5IA 3S1QK 3M3YK 4BY1C 3GTQK 4BBRK 2O5JA 3HOYK 5TMCA 5IP7K 4JK1A 4C3IC 5IYCC 3H0GK 2E2IK 5C3EK 4ZH4A 1WCMK 4C3JK 4OIPA 2R92K 5IP9C 2JA7C 4BXXC 4MQ9A 2JA5C 2BE5A 1Y1WC 1TWCC 3H3VD 3GTPK 3S15K 3M3YC 2A6HA 3GTQC 3GTMK 3HOYC 4LLGA 3GTJK 5IP7C 4QIWL 5C44C 3H0GC 4LJZA 2R7ZK 5IYDC 4KN4A 4XSZA 4A3FC 2JA8C 4QJVB 4C3HK 5FLMK 4A93K 4BY1K 3S1MK 5D4DA 2A69A 4YFNA 3WODA 3S2DC 2CW0A 5IYCK 3HOUC 3S2HC 5M5XK 4A3IK 1TWAC 2JA7K 2A6EA 4BXXK 2YU9C 4Q4ZA 3GTGC 1Y1WK 1TWCK 5TMFA 1SFOC 5M3FK 4A93C 2JA5K 3GTOK 4MEYA 2WAQD 4QIWD 3S1MC 1TWFC 1YNJA 5C44K 4G7HA 3HOXC 4A3BK 5IYDK 4A3FK 1Y1VK 3RZDC 3HOWC 2JA8K 2R93C 4A3IC 3FKIC 3CQZK 2WB1D 3S2DK 3GTOC 3HOUK 4A3GC 3S2HK 1TWAK 4A3KK 3S1RC 4Q5SA 2YU9K 4A3BC 3GTGK 1Y1VC 1SFOK 4A3CC 3DXJA 2NVQK 1TWFK 4YFKA 2VUMC 3CQZC 5IYBC 3I4MC 4BY7C 4XLNA 2E2JC 3HOXK 5M5YK 2PPBA 3RZDK 4NOIA 3HOWK 4A3DC 4A3KC 3FKIK 3S14K 4BBSK 4XLPA 2R93K 4AYBL 3GTKC 3S1NC 4A3GK 5C4JC 3HOZC 4Y7NC 4LK0A 5M3MK 1I3QK 2NVQC 4YFXA 3S1RK 4X6AK 2Y0SL 4A3EK 3S14C 4A3CK 2NVYC 2PMZL 4OIOA 1K83C 4BBSC 3K7AC 2VUMK 5IYBK 4BY7K 3I4MK 4C2MC 2E2JK 4LK1A 4OINA 1IW7A 5M5WK 3HOVK 1I6VA 1I3QC 4AYBD 4A3DK 2JA6C 4GZYA 3EQLA 1I50K 4X6AC 2A68A 1TWGK 1ZYRA 3GTKK 3S16K 4A3EC 3S1NK 4OIQA 4XSXA 4Y52C 1R9TK 3GTLK 5C4JK 3HOZK 3RZOC 4Y7NK 5FJ8K 1SMYA 4A3JC 1XPPA 2PMZD 3I4NK 3HOVC 1TWHC 2NVYK 3HKZL 1K83K 4KMUA 1I6HK 1I50C 1YNNA 3S16C 3M4OC 1TWGC 3K7AK 4KN7A 4G7ZA 4C2MK 3GTLC 1R9TC 4A3LC 4C3HC 3PO2C 2PA8L 2JA6K 2NVTC 4A3MC 2NVXK 3I4NC 3S1QC 4BBRC 4Y52K 5C4XK 3S17K 3RZOK 1I6HC 2B63K 2WAQL 2E2HK 3PO3K 4YG2A 2E2IC 5C3EC 4A3JK 1WCMC 3HKZD 4C3JC 2R92C 4G7OA 1TWHK 1HQMA 3PO2K 4OIRA 2NVXC 3GTPC 4C3IK 3S15C 3M4OK 3H3VL 2PA8D 3GTJC 3GTMC 5C4XC 2WB1L 4QJVA 3PO3C 4MEXA 2B63C 3S17C 2E2HC 5IP9K 4A3LK 2Y0SD 2NVTK 2R7ZC 4A3MK
chains in the Genus database with same CATH superfamily
5FLMC 4PAAA 3S1QK 4BY1C 2O5JA 1R9TA 2ZUFA 4KB2A 1XXCA 1O28A 1WCMK 4C3JK 4OIPA 2R92K 1JOEA 2JA5C 1Y1WC 3AD7C 4QJVB 5FLMK 1EH1A 4BY1K 3OREA 3PIOS 3S2DC 3HOUC 5EGEA 4BLBA 2GSUA 4Q4ZA 1Y1WK 2JA5K 5TMFA 4U67S 1I50A 4QIWD 3S1MC 1TWFC 1IBAA 4G7HA 3RZDC 3HOWC 3FOEA 4A3IC 3FKIC 4GTBA 4KC6A 3S2DK 3AQPA 2GAHC 3GTOC 3HOUK 1VLOA 4A3GC 2ZUEA 1WCMA 3N0CA 2R92A 1YX2A 3BP8C 2D6FC 1TWFK 4YFKA 2E2JC 3RZDK 3HOWK 4PABA 3TFIA 3FKIK 4XLPA 3S1NC 4WJ3M 1JQWA 5C4JC 3HOZC 4A3GK 3V4GA 2JA5A 1Y1WA 2NVYC 2PMZL 1XXAA 3K7AC 1USMA 1G51A 3AQOA 2E2JK 1F93A 3HOVK 3SZZA 1C0AA 4AYBD 4GTLA 4ILDA 3EQLA 1XZQA 4X6AC 3A8IA 3S1NK 5CHPA 4XSXA 5C4JK 3HOZK 1O27A 2V6SA 2ZJPS 4GTFA 1TWHC 2NVYK 3CF5S 4KMUA 2P8TA 1YNNA 3S16C 3K7AK 3GSIA 1TWFA 4WILA 3GTLC 1R9TC 4WFNS 4G0UA 4IO9S 3G4AA 3FKIA 2CFAB 2NVXK 3I4NC 4BBRC 1B4AA 1EQRA 3HXAA 2B63K 2E2HK 3HKZD 2CFAA 1TWHK 5JVOA 1O2AA 1PJ6A 1XZPB 2WB1L 1O25A 1WSVA 5IP9K 2P5MA 2Y0SD 2ZJRS 2O5IA 1ZQ1C 1F9NA 3GTQK 4BBRK 3HOYK 1WQHA 5IP7K 3L4KA 1VJEA 3FOFA 3CAGA 3LAPA 4WF9S 2NVYA 1O29A 3H3VD 1TWCC 1DCPA 1VH2A 4WJ4A 2ZFZA 2KPUA 4LJZA 5TJ3A 3T01A 4XSZA 4A3FC 2JA8C 1DD5A 4A93K 1PJ5A 2A69A 4IOCS 2GSNA 3DLLS 2B63A 1DCHA 4LR2A 3S2HC 4G0VA 1ZXOA 2A6EA 1F7UA 2YU9C 1TWHA 1TWCK 2WAQD 3GTLA 3HOXC 1USOA 4A3FK 1Y1VK 2JA8K 5DM6S 3LAJA 1ISEA 3L4JA 2PHCB 3S2HK 1B4BA 2ZJQS 1WSRA 4Q5SA 3LYWA 2YU9K 2XCRB 3BP3A 2KQ1A 2VUMC 3GEHA 3I4MC 4XLNA 3HOXK 1X31C 2PPBA 4A3DC 4BBSK 3AD9C 4BKWA 1I3QK 3TFHA 1TWCA 4WFBS 1V5VA 1K83C 3GEIA 2VUMK 3I4MK 4OINA 2L5NA 5M5WK 1I6VA 4A3DK 2JA6C 1TWGK 1WIHA 4Y52C 5IOTA 1O2FB 3RZOC 4A3JC 3MMLB 2PMZD 2YU9A 3HOVC 1K83K 1DCOA 4KN7A 4O2DA 3BUEA 4KMHA 4A3LC 2JA6K 2V6TA 3OEPA 4GTAA 1IQ0A 4Y52K 1XZQB 5IOQA 2XCQA 3RZOK 3PO3K 1IE0A 1IS1A 4WCES 5C3EC 4KATA 5IOSA 4A3JK 4G7OA 1HQMA 4OIRA 2NVXC 3GTPC 4C3IK 3S15C 3T02A 2VUMA 3GTJC 2B63C 4A3LK 2E2HC 4GFQA 1BDFA 3M3YK 1BJTA 1J6XA 4JK1A 1PJ7A 3H0GK 5IYCC 5C3EK 5IP9C 1ZBSA 4MQ9A 2BE5A 1K83A 3A8JA 2RGRA 3GTPK 3S15K 3GTQC 3HOYC 3GTJK 2V6UA 5IP7C 5IYDC 2GSOA 2JA6A 3GDZA 3Q3QA 4XCHA 2KWAA 5IYCK 5M5XK 1WOSA 4GTCA 1IL2A 1SFOC 4A93C 3GEEA 4MEYA 1BS2A 4LOWA 4A3BK 5IYDK 4FZBA 4M1XA 1L0WA 3CQZK 3H0GA 4A3KK 3S1RC 4KMDA 1J98A 1Y1VC 1SFOK 3GTPA 2NVXA 1INNA 3GTJA 2NVQK 2XCOA 5IYBC 3OPFA 3FHZA 2E2HA 4P5BA 3S14K 4NOIA 5CJ9A 3TTGA 3GTKC 2RH6A 4Y7NC 4LK0A 5HL8A 5HQHA 1J6WA 1VGXA 4YFXA 3S1RK 4KASA 1ZVUA 4GT9A 2Y0SL 4A3EK 4KMAA 4FM9A 2FQTA 4BBSC 3GTQA 1YCLA 5IYBK 4C2MC 3LPXA 1I3QC 4GZYA 1I50K 3GTKK 1ZYRA 3CQZA 1EFWA 4Y7NK 1WOPA 4WFAS 1GE9A 1SFOA 2L3UA 1I6HK 1TWGC 2KXYA 4G7ZA 4C2MK 1WORA 2PA8L 4BLAA 5C4XK 2Y3PA 3S17K 2WAQL 2E2IC 5HL7S 4C45A 5EGHA 1Y1VA 3T00A 4G0WA 4P9SA 1HI9A 3GTMC 4QJVA 3PO3C 2R7ZC 4GTDA 3GTKA 5TMCA 4KDDA 4C3IC 2E2IK 4ZH4A 1F7VA 2JA7C 4BXXC 3M3YC 2A6HA 3GTMK 4LLGA 4QIWL 5E68A 5C44C 3H0GC 4KAWX 1I3QA 2R7ZK 4KN4A 3S1MK 5D4DA 1O2BA 2W7VA 4YFNA 3WODA 2CW0A 3N0BA 4RMFA 1J6VA 4KARA 4A3IK 1TWAC 3PIPS 4KM9A 1UV7A 3VA7A 2JA7K 4BXXK 3GTGC 1WQGA 5M3FK 3GTOK 1TWGA 4LQYA 3ERED 1KQ4A 1XXBA 1YNJA 5C44K 2R93C 4KM8A 2WB1D 3N3YA 2E2IA 1TWAK 3G4CA 4A3BC 3GTGK 4A3CC 3DXJA 5DM7S 1RU0A 3GTMA 3QX3A 3CQZC 4BY7C 2R7ZA 5M5YK 2JH3A 3TFJA 2R93K 4A3KC 1WOOA 1O26A 4AYBL 4AH6A 2GAGC 5M3MK 1WQFA 2NVQC 3JSTA 2JA7A 4X6AK 5JFEA 3S14C 3GIRA 4A3CK 4DDQA 3AH5A 3GTOA 4OIOA 1EI6A 2EBBA 3SZYA 1BGWA 3ADAC 3AD8C 5JVGS 4BY7K 4LK1A 1IW7A 4KB4A 4IOAS 3S16K 2A68A 4A3EC 4OIQA 3GTLK 1R9TK 1VRQC 1EK8A 3IPJA 5FJ8K 1SMYA 1TWAA 3NUHA 1XPPA 3I4NK 4J3NA 3GTGA 3HKZL 2FQOA 1XZPA 5L46A 3S0XA 1I50C 3M4OC 3A8KA 4C3HC 3PO2C 1AB4A 5IORA 2R93A 2NVTC 4A3MC 3S1QC 4P5AA 1JVIA 1I6HC 4GTEA 4YG2A 1WCMC 5JVHS 4C3JC 2R92C 1FEUA 1O24A 3M4OK 3H3VL 2PA8D 5C4XC 3S17C 4MEXA 4C3HK 3PO2K 2NVTK 4A3MK
chains in the Genus database with same CATH topology
1BDFA 5FLMC 2O5IA 3S1QK 3M3YK 4BY1C 3GTQK 4BBRK 2O5JA 3HOYK 5TMCA 5IP7K 4JK1A 4C3IC 5IYCC 3H0GK 2E2IK 5C3EK 4ZH4A 1WCMK 4C3JK 4OIPA 2R92K 5IP9C 2JA7C 4BXXC 4MQ9A 2JA5C 2BE5A 1Y1WC 1TWCC 3H3VD 3GTPK 3S15K 3M3YC 2A6HA 3GTQC 3GTMK 3HOYC 4LLGA 3GTJK 5IP7C 4QIWL 5C44C 3H0GC 4LJZA 2R7ZK 5IYDC 4KN4A 4XSZA 4A3FC 2JA8C 4QJVB 4C3HK 5FLMK 4A93K 4BY1K 3S1MK 5D4DA 2A69A 4YFNA 3WODA 3S2DC 2CW0A 5IYCK 3HOUC 3S2HC 5M5XK 4A3IK 1TWAC 2JA7K 2A6EA 4BXXK 2YU9C 4Q4ZA 3GTGC 1Y1WK 1TWCK 5TMFA 1SFOC 5M3FK 4A93C 2JA5K 3GTOK 4MEYA 2WAQD 4QIWD 3S1MC 1TWFC 1YNJA 5C44K 4G7HA 3HOXC 4A3BK 5IYDK 4A3FK 1Y1VK 3RZDC 3HOWC 2JA8K 2R93C 4A3IC 3FKIC 3CQZK 2WB1D 3S2DK 3GTOC 3HOUK 4A3GC 3S2HK 1TWAK 4A3KK 3S1RC 4Q5SA 2YU9K 4A3BC 3GTGK 1Y1VC 1SFOK 4A3CC 3DXJA 2NVQK 1TWFK 4YFKA 2VUMC 3CQZC 5IYBC 3I4MC 4BY7C 4XLNA 2E2JC 3HOXK 5M5YK 2PPBA 3RZDK 4NOIA 3HOWK 4A3DC 4A3KC 3FKIK 3S14K 4BBSK 4XLPA 2R93K 4AYBL 3GTKC 3S1NC 4A3GK 5C4JC 3HOZC 4Y7NC 4LK0A 5M3MK 1I3QK 2NVQC 4YFXA 3S1RK 4X6AK 2Y0SL 4A3EK 3S14C 4A3CK 2NVYC 2PMZL 4OIOA 1K83C 4BBSC 3K7AC 2VUMK 5IYBK 4BY7K 3I4MK 4C2MC 2E2JK 4LK1A 4OINA 1IW7A 5M5WK 3HOVK 1I6VA 1I3QC 4AYBD 4A3DK 2JA6C 4GZYA 3EQLA 1I50K 4X6AC 2A68A 1TWGK 1ZYRA 3GTKK 3S16K 4A3EC 3S1NK 4OIQA 4XSXA 4Y52C 1R9TK 3GTLK 5C4JK 3HOZK 3RZOC 4Y7NK 5FJ8K 1SMYA 4A3JC 1XPPA 2PMZD 3I4NK 3HOVC 1TWHC 2NVYK 3HKZL 1K83K 4KMUA 1I6HK 1I50C 1YNNA 3S16C 3M4OC 1TWGC 3K7AK 4KN7A 4G7ZA 4C2MK 3GTLC 1R9TC 4A3LC 4C3HC 3PO2C 2PA8L 2JA6K 2NVTC 4A3MC 2NVXK 3I4NC 3S1QC 4BBRC 4Y52K 5C4XK 3S17K 3RZOK 1I6HC 2B63K 2WAQL 2E2HK 3PO3K 4YG2A 2E2IC 5C3EC 4A3JK 1WCMC 3HKZD 4C3JC 2R92C 4G7OA 1TWHK 1HQMA 3PO2K 4OIRA 2NVXC 3GTPC 4C3IK 3S15C 3M4OK 3H3VL 2PA8D 3GTJC 3GTMC 5C4XC 2WB1L 4QJVA 3PO3C 4MEXA 2B63C 3S17C 2E2HC 5IP9K 4A3LK 2Y0SD 2NVTK 2R7ZC 4A3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDF A;  5FLM C;  2O5I A;  3S1Q K;  3M3Y K;  4BY1 C;  3GTQ K;  4BBR K;  2O5J A;  3HOY K;  5TMC A;  5IP7 K;  4JK1 A;  4C3I C;  5IYC C;  3H0G K;  2E2I K;  5C3E K;  4ZH4 A;  1WCM K;  4C3J K;  4OIP A;  2R92 K;  5IP9 C;  2JA7 C;  4BXX C;  4MQ9 A;  2JA5 C;  2BE5 A;  1Y1W C;  1TWC C;  3H3V D;  3GTP K;  3S15 K;  3M3Y C;  2A6H A;  3GTQ C;  3GTM K;  3HOY C;  4LLG A;  3GTJ K;  5IP7 C;  4QIW L;  5C44 C;  3H0G C;  4LJZ A;  2R7Z K;  5IYD C;  4KN4 A;  4XSZ A;  4A3F C;  2JA8 C;  4QJV B;  4C3H K;  5FLM K;  4A93 K;  4BY1 K;  3S1M K;  5D4D A;  2A69 A;  4YFN A;  3WOD A;  3S2D C;  2CW0 A;  5IYC K;  3HOU C;  3S2H C;  5M5X K;  4A3I K;  1TWA C;  2JA7 K;  2A6E A;  4BXX K;  2YU9 C;  4Q4Z A;  3GTG C;  1Y1W K;  1TWC K;  5TMF A;  1SFO C;  5M3F K;  4A93 C;  2JA5 K;  3GTO K;  4MEY A;  2WAQ D;  4QIW D;  3S1M C;  1TWF C;  1YNJ A;  5C44 K;  4G7H A;  3HOX C;  4A3B K;  5IYD K;  4A3F K;  1Y1V K;  3RZD C;  3HOW C;  2JA8 K;  2R93 C;  4A3I C;  3FKI C;  3CQZ K;  2WB1 D;  3S2D K;  3GTO C;  3HOU K;  4A3G C;  3S2H K;  1TWA K;  4A3K K;  3S1R C;  4Q5S A;  2YU9 K;  4A3B C;  3GTG K;  1Y1V C;  1SFO K;  4A3C C;  3DXJ A;  2NVQ K;  1TWF K;  4YFK A;  2VUM C;  3CQZ C;  5IYB C;  3I4M C;  4BY7 C;  4XLN A;  2E2J C;  3HOX K;  5M5Y K;  2PPB A;  3RZD K;  4NOI A;  3HOW K;  4A3D C;  4A3K C;  3FKI K;  3S14 K;  4BBS K;  4XLP A;  2R93 K;  4AYB L;  3GTK C;  3S1N C;  4A3G K;  5C4J C;  3HOZ C;  4Y7N C;  4LK0 A;  5M3M K;  1I3Q K;  2NVQ C;  4YFX A;  3S1R K;  4X6A K;  2Y0S L;  4A3E K;  3S14 C;  4A3C K;  2NVY C;  2PMZ L;  4OIO A;  1K83 C;  4BBS C;  3K7A C;  2VUM K;  5IYB K;  4BY7 K;  3I4M K;  4C2M C;  2E2J K;  4LK1 A;  4OIN A;  1IW7 A;  5M5W K;  3HOV K;  1I6V A;  1I3Q C;  4AYB D;  4A3D K;  2JA6 C;  4GZY A;  3EQL A;  1I50 K;  4X6A C;  2A68 A;  1TWG K;  1ZYR A;  3GTK K;  3S16 K;  4A3E C;  3S1N K;  4OIQ A;  4XSX A;  4Y52 C;  1R9T K;  3GTL K;  5C4J K;  3HOZ K;  3RZO C;  4Y7N K;  5FJ8 K;  1SMY A;  4A3J C;  1XPP A;  2PMZ D;  3I4N K;  3HOV C;  1TWH C;  2NVY K;  3HKZ L;  1K83 K;  4KMU A;  1I6H K;  1I50 C;  1YNN A;  3S16 C;  3M4O C;  1TWG C;  3K7A K;  4KN7 A;  4G7Z A;  4C2M K;  3GTL C;  1R9T C;  4A3L C;  4C3H C;  3PO2 C;  2PA8 L;  2JA6 K;  2NVT C;  4A3M C;  2NVX K;  3I4N C;  3S1Q C;  4BBR C;  4Y52 K;  5C4X K;  3S17 K;  3RZO K;  1I6H C;  2B63 K;  2WAQ L;  2E2H K;  3PO3 K;  4YG2 A;  2E2I C;  5C3E C;  4A3J K;  1WCM C;  3HKZ D;  4C3J C;  2R92 C;  4G7O A;  1TWH K;  1HQM A;  3PO2 K;  4OIR A;  2NVX C;  3GTP C;  4C3I K;  3S15 C;  3M4O K;  3H3V L;  2PA8 D;  3GTJ C;  3GTM C;  5C4X C;  2WB1 L;  4QJV A;  3PO3 C;  4MEX A;  2B63 C;  3S17 C;  2E2H C;  5IP9 K;  4A3L K;  2Y0S D;  2NVT K;  2R7Z C;  4A3M K; 
#chains in the Genus database with same CATH topology
 5FLM C;  4PAA A;  3S1Q K;  4BY1 C;  2O5J A;  1R9T A;  2ZUF A;  4KB2 A;  1XXC A;  1O28 A;  1WCM K;  4C3J K;  4OIP A;  2R92 K;  1JOE A;  2JA5 C;  1Y1W C;  3AD7 C;  4QJV B;  5FLM K;  1EH1 A;  4BY1 K;  3ORE A;  3PIO S;  3S2D C;  3HOU C;  5EGE A;  4BLB A;  2GSU A;  4Q4Z A;  1Y1W K;  2JA5 K;  5TMF A;  4U67 S;  1I50 A;  4QIW D;  3S1M C;  1TWF C;  1IBA A;  4G7H A;  3RZD C;  3HOW C;  3FOE A;  4A3I C;  3FKI C;  4GTB A;  4KC6 A;  3S2D K;  3AQP A;  2GAH C;  3GTO C;  3HOU K;  1VLO A;  4A3G C;  2ZUE A;  1WCM A;  3N0C A;  2R92 A;  1YX2 A;  3BP8 C;  2D6F C;  1TWF K;  4YFK A;  2E2J C;  3RZD K;  3HOW K;  4PAB A;  3TFI A;  3FKI K;  4XLP A;  3S1N C;  4WJ3 M;  1JQW A;  5C4J C;  3HOZ C;  4A3G K;  3V4G A;  2JA5 A;  1Y1W A;  2NVY C;  2PMZ L;  1XXA A;  3K7A C;  1USM A;  1G51 A;  3AQO A;  2E2J K;  1F93 A;  3HOV K;  3SZZ A;  1C0A A;  4AYB D;  4GTL A;  4ILD A;  3EQL A;  1XZQ A;  4X6A C;  3A8I A;  3S1N K;  5CHP A;  4XSX A;  5C4J K;  3HOZ K;  1O27 A;  2V6S A;  2ZJP S;  4GTF A;  1TWH C;  2NVY K;  3CF5 S;  4KMU A;  2P8T A;  1YNN A;  3S16 C;  3K7A K;  3GSI A;  1TWF A;  4WIL A;  3GTL C;  1R9T C;  4WFN S;  4G0U A;  4IO9 S;  3G4A A;  3FKI A;  2CFA B;  2NVX K;  3I4N C;  4BBR C;  1B4A A;  1EQR A;  3HXA A;  2B63 K;  2E2H K;  3HKZ D;  2CFA A;  1TWH K;  5JVO A;  1O2A A;  1PJ6 A;  1XZP B;  2WB1 L;  1O25 A;  1WSV A;  5IP9 K;  2P5M A;  2Y0S D;  2ZJR S;  2O5I A;  1ZQ1 C;  1F9N A;  3GTQ K;  4BBR K;  3HOY K;  1WQH A;  5IP7 K;  3L4K A;  1VJE A;  3FOF A;  3CAG A;  3LAP A;  4WF9 S;  2NVY A;  1O29 A;  3H3V D;  1TWC C;  1DCP A;  1VH2 A;  4WJ4 A;  2ZFZ A;  2KPU A;  4LJZ A;  5TJ3 A;  3T01 A;  4XSZ A;  4A3F C;  2JA8 C;  1DD5 A;  4A93 K;  1PJ5 A;  2A69 A;  4IOC S;  2GSN A;  3DLL S;  2B63 A;  1DCH A;  4LR2 A;  3S2H C;  4G0V A;  1ZXO A;  2A6E A;  1F7U A;  2YU9 C;  1TWH A;  1TWC K;  2WAQ D;  3GTL A;  3HOX C;  1USO A;  4A3F K;  1Y1V K;  2JA8 K;  5DM6 S;  3LAJ A;  1ISE A;  3L4J A;  2PHC B;  3S2H K;  1B4B A;  2ZJQ S;  1WSR A;  4Q5S A;  3LYW A;  2YU9 K;  2XCR B;  3BP3 A;  2KQ1 A;  2VUM C;  3GEH A;  3I4M C;  4XLN A;  3HOX K;  1X31 C;  2PPB A;  4A3D C;  4BBS K;  3AD9 C;  4BKW A;  1I3Q K;  3TFH A;  1TWC A;  4WFB S;  1V5V A;  1K83 C;  3GEI A;  2VUM K;  3I4M K;  4OIN A;  2L5N A;  5M5W K;  1I6V A;  4A3D K;  2JA6 C;  1TWG K;  1WIH A;  4Y52 C;  5IOT A;  1O2F B;  3RZO C;  4A3J C;  3MML B;  2PMZ D;  2YU9 A;  3HOV C;  1K83 K;  1DCO A;  4KN7 A;  4O2D A;  3BUE A;  4KMH A;  4A3L C;  2JA6 K;  2V6T A;  3OEP A;  4GTA A;  1IQ0 A;  4Y52 K;  1XZQ B;  5IOQ A;  2XCQ A;  3RZO K;  3PO3 K;  1IE0 A;  1IS1 A;  4WCE S;  5C3E C;  4KAT A;  5IOS A;  4A3J K;  4G7O A;  1HQM A;  4OIR A;  2NVX C;  3GTP C;  4C3I K;  3S15 C;  3T02 A;  2VUM A;  3GTJ C;  2B63 C;  4A3L K;  2E2H C;  4GFQ A;  1BDF A;  3M3Y K;  1BJT A;  1J6X A;  4JK1 A;  1PJ7 A;  3H0G K;  5IYC C;  5C3E K;  5IP9 C;  1ZBS A;  4MQ9 A;  2BE5 A;  1K83 A;  3A8J A;  2RGR A;  3GTP K;  3S15 K;  3GTQ C;  3HOY C;  3GTJ K;  2V6U A;  5IP7 C;  5IYD C;  2GSO A;  2JA6 A;  3GDZ A;  3Q3Q A;  4XCH A;  2KWA A;  5IYC K;  5M5X K;  1WOS A;  4GTC A;  1IL2 A;  1SFO C;  4A93 C;  3GEE A;  4MEY A;  1BS2 A;  4LOW A;  4A3B K;  5IYD K;  4FZB A;  4M1X A;  1L0W A;  3CQZ K;  3H0G A;  4A3K K;  3S1R C;  4KMD A;  1J98 A;  1Y1V C;  1SFO K;  3GTP A;  2NVX A;  1INN A;  3GTJ A;  2NVQ K;  2XCO A;  5IYB C;  3OPF A;  3FHZ A;  2E2H A;  4P5B A;  3S14 K;  4NOI A;  5CJ9 A;  3TTG A;  3GTK C;  2RH6 A;  4Y7N C;  4LK0 A;  5HL8 A;  5HQH A;  1J6W A;  1VGX A;  4YFX A;  3S1R K;  4KAS A;  1ZVU A;  4GT9 A;  2Y0S L;  4A3E K;  4KMA A;  4FM9 A;  2FQT A;  4BBS C;  3GTQ A;  1YCL A;  5IYB K;  4C2M C;  3LPX A;  1I3Q C;  4GZY A;  1I50 K;  3GTK K;  1ZYR A;  3CQZ A;  1EFW A;  4Y7N K;  1WOP A;  4WFA S;  1GE9 A;  1SFO A;  2L3U A;  1I6H K;  1TWG C;  2KXY A;  4G7Z A;  4C2M K;  1WOR A;  2PA8 L;  4BLA A;  5C4X K;  2Y3P A;  3S17 K;  2WAQ L;  2E2I C;  5HL7 S;  4C45 A;  5EGH A;  1Y1V A;  3T00 A;  4G0W A;  4P9S A;  1HI9 A;  3GTM C;  4QJV A;  3PO3 C;  2R7Z C;  4GTD A;  3GTK A;  5TMC A;  4KDD A;  4C3I C;  2E2I K;  4ZH4 A;  1F7V A;  2JA7 C;  4BXX C;  3M3Y C;  2A6H A;  3GTM K;  4LLG A;  4QIW L;  5E68 A;  5C44 C;  3H0G C;  4KAW X;  1I3Q A;  2R7Z K;  4KN4 A;  3S1M K;  5D4D A;  1O2B A;  2W7V A;  4YFN A;  3WOD A;  2CW0 A;  3N0B A;  4RMF A;  1J6V A;  4KAR A;  4A3I K;  1TWA C;  3PIP S;  4KM9 A;  1UV7 A;  3VA7 A;  2JA7 K;  4BXX K;  3GTG C;  1WQG A;  5M3F K;  3GTO K;  1TWG A;  4LQY A;  3ERE D;  1KQ4 A;  1XXB A;  1YNJ A;  5C44 K;  2R93 C;  4KM8 A;  2WB1 D;  3N3Y A;  2E2I A;  1TWA K;  3G4C A;  4A3B C;  3GTG K;  4A3C C;  3DXJ A;  5DM7 S;  1RU0 A;  3GTM A;  3QX3 A;  3CQZ C;  4BY7 C;  2R7Z A;  5M5Y K;  2JH3 A;  3TFJ A;  2R93 K;  4A3K C;  1WOO A;  1O26 A;  4AYB L;  4AH6 A;  2GAG C;  5M3M K;  1WQF A;  2NVQ C;  3JST A;  2JA7 A;  4X6A K;  5JFE A;  3S14 C;  3GIR A;  4A3C K;  4DDQ A;  3AH5 A;  3GTO A;  4OIO A;  1EI6 A;  2EBB A;  3SZY A;  1BGW A;  3ADA C;  3AD8 C;  5JVG S;  4BY7 K;  4LK1 A;  1IW7 A;  4KB4 A;  4IOA S;  3S16 K;  2A68 A;  4A3E C;  4OIQ A;  3GTL K;  1R9T K;  1VRQ C;  1EK8 A;  3IPJ A;  5FJ8 K;  1SMY A;  1TWA A;  3NUH A;  1XPP A;  3I4N K;  4J3N A;  3GTG A;  3HKZ L;  2FQO A;  1XZP A;  5L46 A;  3S0X A;  1I50 C;  3M4O C;  3A8K A;  4C3H C;  3PO2 C;  1AB4 A;  5IOR A;  2R93 A;  2NVT C;  4A3M C;  3S1Q C;  4P5A A;  1JVI A;  1I6H C;  4GTE A;  4YG2 A;  1WCM C;  5JVH S;  4C3J C;  2R92 C;  1FEU A;  1O24 A;  3M4O K;  3H3V L;  2PA8 D;  5C4X C;  3S17 C;  4MEX A;  4C3H K;  3PO2 K;  2NVT K;  4A3M K; 
#chains in the Genus database with same CATH homology
 1BDF A;  5FLM C;  2O5I A;  3S1Q K;  3M3Y K;  4BY1 C;  3GTQ K;  4BBR K;  2O5J A;  3HOY K;  5TMC A;  5IP7 K;  4JK1 A;  4C3I C;  5IYC C;  3H0G K;  2E2I K;  5C3E K;  4ZH4 A;  1WCM K;  4C3J K;  4OIP A;  2R92 K;  5IP9 C;  2JA7 C;  4BXX C;  4MQ9 A;  2JA5 C;  2BE5 A;  1Y1W C;  1TWC C;  3H3V D;  3GTP K;  3S15 K;  3M3Y C;  2A6H A;  3GTQ C;  3GTM K;  3HOY C;  4LLG A;  3GTJ K;  5IP7 C;  4QIW L;  5C44 C;  3H0G C;  4LJZ A;  2R7Z K;  5IYD C;  4KN4 A;  4XSZ A;  4A3F C;  2JA8 C;  4QJV B;  4C3H K;  5FLM K;  4A93 K;  4BY1 K;  3S1M K;  5D4D A;  2A69 A;  4YFN A;  3WOD A;  3S2D C;  2CW0 A;  5IYC K;  3HOU C;  3S2H C;  5M5X K;  4A3I K;  1TWA C;  2JA7 K;  2A6E A;  4BXX K;  2YU9 C;  4Q4Z A;  3GTG C;  1Y1W K;  1TWC K;  5TMF A;  1SFO C;  5M3F K;  4A93 C;  2JA5 K;  3GTO K;  4MEY A;  2WAQ D;  4QIW D;  3S1M C;  1TWF C;  1YNJ A;  5C44 K;  4G7H A;  3HOX C;  4A3B K;  5IYD K;  4A3F K;  1Y1V K;  3RZD C;  3HOW C;  2JA8 K;  2R93 C;  4A3I C;  3FKI C;  3CQZ K;  2WB1 D;  3S2D K;  3GTO C;  3HOU K;  4A3G C;  3S2H K;  1TWA K;  4A3K K;  3S1R C;  4Q5S A;  2YU9 K;  4A3B C;  3GTG K;  1Y1V C;  1SFO K;  4A3C C;  3DXJ A;  2NVQ K;  1TWF K;  4YFK A;  2VUM C;  3CQZ C;  5IYB C;  3I4M C;  4BY7 C;  4XLN A;  2E2J C;  3HOX K;  5M5Y K;  2PPB A;  3RZD K;  4NOI A;  3HOW K;  4A3D C;  4A3K C;  3FKI K;  3S14 K;  4BBS K;  4XLP A;  2R93 K;  4AYB L;  3GTK C;  3S1N C;  4A3G K;  5C4J C;  3HOZ C;  4Y7N C;  4LK0 A;  5M3M K;  1I3Q K;  2NVQ C;  4YFX A;  3S1R K;  4X6A K;  2Y0S L;  4A3E K;  3S14 C;  4A3C K;  2NVY C;  2PMZ L;  4OIO A;  1K83 C;  4BBS C;  3K7A C;  2VUM K;  5IYB K;  4BY7 K;  3I4M K;  4C2M C;  2E2J K;  4LK1 A;  4OIN A;  1IW7 A;  5M5W K;  3HOV K;  1I6V A;  1I3Q C;  4AYB D;  4A3D K;  2JA6 C;  4GZY A;  3EQL A;  1I50 K;  4X6A C;  2A68 A;  1TWG K;  1ZYR A;  3GTK K;  3S16 K;  4A3E C;  3S1N K;  4OIQ A;  4XSX A;  4Y52 C;  1R9T K;  3GTL K;  5C4J K;  3HOZ K;  3RZO C;  4Y7N K;  5FJ8 K;  1SMY A;  4A3J C;  1XPP A;  2PMZ D;  3I4N K;  3HOV C;  1TWH C;  2NVY K;  3HKZ L;  1K83 K;  4KMU A;  1I6H K;  1I50 C;  1YNN A;  3S16 C;  3M4O C;  1TWG C;  3K7A K;  4KN7 A;  4G7Z A;  4C2M K;  3GTL C;  1R9T C;  4A3L C;  4C3H C;  3PO2 C;  2PA8 L;  2JA6 K;  2NVT C;  4A3M C;  2NVX K;  3I4N C;  3S1Q C;  4BBR C;  4Y52 K;  5C4X K;  3S17 K;  3RZO K;  1I6H C;  2B63 K;  2WAQ L;  2E2H K;  3PO3 K;  4YG2 A;  2E2I C;  5C3E C;  4A3J K;  1WCM C;  3HKZ D;  4C3J C;  2R92 C;  4G7O A;  1TWH K;  1HQM A;  3PO2 K;  4OIR A;  2NVX C;  3GTP C;  4C3I K;  3S15 C;  3M4O K;  3H3V L;  2PA8 D;  3GTJ C;  3GTM C;  5C4X C;  2WB1 L;  4QJV A;  3PO3 C;  4MEX A;  2B63 C;  3S17 C;  2E2H C;  5IP9 K;  4A3L K;  2Y0S D;  2NVT K;  2R7Z C;  4A3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...