4G7OA

Crystal structure of thermus thermophilus transcription initiation complex containing 2 nt of rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
total genus 51
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7oA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7oA01
3DXJA 3EQLA 4A3DC 3K7AC 4A3GK 5C44K 4A3LK 4LK0A 4LJZA 3I4MC 3S1QK 2O5IA 3HOUC 5M5WK 2NVXC 3HOVC 4A3MK 2B63K 3CQZC 5M3FK 5C3EK 1I6HK 4A3GC 5C44C 3H0GK 3GTOK 3S1QC 4A3LC 1TWCK 5C4XK 4A93K 2BE5A 5IP9K 1Y1VC 5M3MK 4LK1A 4A3MC 2CW0A 2B63C 3I4NC 4A3KK 4YFXA 5M5XK 2JA5K 5C3EC 1ZYRA 1I6HC 3GTGK 2JA7C 2E2HK 4JK1A 3M4OC 4A93C 2Y0SL 3S16K 4LLGA 5IP9C 2A68A 2R92K 4A3KC 4MQ9A 5IYCK 3GTPC 1TWHC 4A3JK 4OIQA 2WAQD 3RZOC 2PA8L 4QIWD 1WCMK 1I6VA 4QJVB 2VUMK 4C3JK 1HQMA 2R92C 3PO2C 3GTQK 5IYCC 4QIWL 3S17K 3HOWK 3GTJK 3M3YK 4Q4ZA 4A3JC 5FLMK 2E2IK 4YFNA 5D4DA 2VUMC 4XSZA 3GTLK 4NOIA 1SFOC 5IYDK 3GTKK 3S2HK 4BXXK 4KMUA 4C3HK 4C3IK 2E2IC 4BBSK 1YNNA 3GTLC 5IYDC 2JA8K 2R93K 3GTKC 4XLNA 3S2HC 4X6AK 5TMFA 3H0GC 4BY1K 4ZH4A 4BXXC 3HOXK 3GTOC 1TWCC 5C4XC 4OIRA 4C3HC 3HOWC 4Y7NK 2JA5C 2A6EA 3S14K 4X6AC 1YNJA 3GTGC 4BY1C 2E2HC 1SMYA 5IYBK 1Y1WK 4OIOA 4Y52K 1R9TK 3S16C 4A3BK 4BBRK 3HOYK 4Y7NC 2WAQL 1IW7A 4XLPA 3S14C 2E2JK 4XSXA 2NVTK 4KN7A 1WCMC 5IYBC 3HKZD 4C3JC 3H3VD 2NVYK 1R9TC 3S1NK 2A69A 4A3BC 4BBRC 3HOYC 4BY7K 3GTQC 3S17C 3GTJC 2E2JC 2NVTC 3M3YC 3HKZL 5FLMC 2JA6K 4A3DK 4KN4A 2NVQK 3S1NC 4BY7C 1TWFK 2YU9K 2R7ZK 4A3EK 2NVXK 4A3CK 4G7ZA 4C3IC 3S1MK 4BBSC 2JA6C 3GTMK 2NVQC 4QJVA 3WODA 2JA8C 2R93C 1I3QK 4MEXA 4Q5SA 1TWFC 5TMCA 3HOXC 4A3EC 2YU9C 2WB1D 2R7ZC 2PMZD 1Y1VK 3RZDK 4A3CC 3I4NK 3S15K 1TWGK 4OINA 3S1MC 3GTMC 3S2DK 1TWAK 1I50K 4YG2A 4G7HA 1I3QC 1XPPA 2WB1L 2PMZL 3FKIK 2O5JA 5M5YK 2JA7K 3M4OK 1Y1WC 4Y52C 3S15C 5C4JK 4A3FK 3RZDC 1K83K 4A3IK 2Y0SD 2PPBA 1TWGC 4C2MK 5IP7K 3GTPK 1BDFA 3S2DC 1TWHK 1TWAC 1I50C 4MEYA 3S1RK 3FKIC 4OIPA 3H3VL 3HOZK 3RZOK 3PO3K 4AYBD 3K7AK 2PA8D 2NVYC 5C4JC 4A3FC 4A3IC 1K83C 3PO2K 4G7OA 5FJ8K 2A6HA 3I4MK 4C2MC 5IP7C 4GZYA 3HOUK 3HOVK 4AYBL 3S1RC 3CQZK 3HOZC 3PO3C 4YFKA 1SFOK
chains in the Genus database with same CATH superfamily
3EQLA 3K7AC 4A3GK 1RU0A 1YCLA 3IPJA 1WQGA 2O5IA 4IO9S 2B63K 2KXYA 1I6HK 4G0WA 4A3GC 3H0GK 3AQPA 2B63C 3GIRA 4BKWA 1I6HC 2JA7C 1XZPB 3S16K 4LLGA 2A68A 1IS1A 2JA6A 5IYCK 1DCPA 3GDZA 1WCMK 1PJ6A 3PO2C 3SZYA 5IYCC 3GTJK 4WF9S 5DM6S 1WQFA 1SFOC 5IYDK 3S2HK 4BXXK 3N0CA 2ZJQS 2JA7A 4LOWA 4O2DA 1IE0A 5IYDC 3S2HC 1USMA 3ADAC 1F9NA 1K83A 4BY1K 4BXXC 3HOXK 5C4XC 4KMHA 1EQRA 3BP8C 1JQWA 4BY1C 2E2HC 5L46A 4BLBA 4BBRK 4FM9A 1SFOA 4XSXA 3L4KA 4KN7A 2FQOA 2A69A 4BBRC 1IBAA 3GTQC 4G0UA 3S17C 4DDQA 3M3YC 4P5AA 5IOTA 4KN4A 5IOQA 1ZVUA 2YU9K 4PABA 2E2HA 4A3CK 3QX3A 5IOSA 1BGWA 3LYWA 3OEPA 2JA8C 3OREA 1O26A 2YU9C 3S15K 2PMZD 3AD8C 4WFAS 4A3CC 1TWGK 3S2DK 1I50K 4G7HA 3FKIK 2WB1L 3NUHA 3GTQA 2O5JA 5HQHA 2V6SA 3S15C 2E2IA 2GAHC 1TWGC 3AQOA 4C2MK 3GTPK 1BDFA 3S2DC 1I50C 3S1RK 3FKIC 4OIPA 3H3VL 2NVYC 2KQ1A 2A6HA 1UV7A 4C2MC 3N0BA 4GTDA 3TFHA 3S1RC 2YU9A 4LQYA 4KARA 4A3DC 4P5BA 4LJZA 1INNA 1DCOA 4KMAA 5M5WK 5IORA 1R9TA 2RH6A 1VH2A 1TWGA 1F93A 3T00A 1F7UA 3GTOK 4KB4A 5IP9K 3T02A 1Y1VC 4LK1A 3TFJA 2V6TA 2JA5K 2NVYA 3LAPA 3S0XA 3GEHA 5IP9C 2R92K 4MQ9A 1X31C 4OIQA 3RZOC 4QIWD 4QJVB 1I6VA 3Q3QA 2R7ZA 4C3JK 1HQMA 2R92C 3GTMA 5JVGS 4PAAA 5FLMK 4YFNA 4NOIA 1Y1VA 1JOEA 4GTAA 1IQ0A 2ZUFA 1TWAA 4KMUA 2ZJRS 4X6AK 3H0GC 4ZH4A 4OIRA 3T01A 2R92A 3ERED 4X6AC 1EH1A 1Y1WK 4WFNS 1IL2A 5IYBK 4Y52K 3S16C 2CFAB 3HOYK 3PIPS 3V4GA 1IW7A 4XLPA 2E2JK 1EK8A 4KASA 4AH6A 4ILDA 1WCMC 5IYBC 3HXAA 3H3VD 5JVHS 1KQ4A 3S1NK 4C45A 5E68A 2B63A 3HOYC 4BY7K 3H0GA 1O28A 3GTJC 2E2JC 3HKZL 5EGHA 2P5MA 1XZPA 3S1NC 1WOSA 2Y3PA 4BY7C 1TWFK 2NVXK 3G4CA 5CHPA 2D6FC 3WODA 1I3QK 1USOA 2CFAA 1PJ5A 5TJ3A 1TWFC 1C0AA 3HOXC 3I4NK 3RZDK 1WCMA 4YG2A 4GTBA 1I3QC 1XPPA 3VA7A 5M5YK 3M4OK 3GTJA 4IOAS 3A8IA 1O25A 4A3FK 3RZDC 2GSUA 1EFWA 1TWHK 4MEYA 1WQHA 3HOZK 4G0VA 4AYBD 4WJ4A 3BP3A 4A3FC 4KAWX 3I4MK 3CF5S 3HOVK 3FHZA 3CQZK 3HOZC 4YFKA 2FQTA 3DXJA 1WORA 5C44K 3GEIA 3S1QK 4LK0A 3I4MC 1I3QA 3HOVC 3L4JA 4A3MK 3CQZC 5JFEA 5C3EK 5C44C 1O29A 3S1QC 1B4AA 1TWCK 4A93K 2L3UA 3GEEA 5M3MK 3HOWK 4A3MC 2CW0A 3GSIA 4YFXA 5M5XK 5C3EC 1ZYRA 3GTGK 4JK1A 4A93C 1WOPA 1O24A 3GTPC 4A3JK 2L5NA 1WIHA 2PA8L 2GSOA 4WCES 1DD5A 4Q4ZA 4A3JC 1J6VA 1ZBSA 3GTKK 1I50A 3FKIA 4C3HK 4C3IK 4P9SA 4BBSK 4KB2A 2R93K 3GTKC 1VLOA 3AD9C 3GTPA 4XCHA 3FOFA 3GTOC 4C3HC 5CJ9A 3LPXA 2JA5C 2A6EA 3S14K 4OIOA 4A3BK 4WILA 2WAQL 4GT9A 3S14C 3MMLB 4WJ3M 4KDDA 4C3JC 3TTGA 4A3BC 2ZUEA 3GTKA 1O2AA 5FLMC 3GTOA 3JSTA 2JA6K 2NVQK 2JA5A 1EI6A 1XXCA 4IOCS 1JVIA 2JA6C 2NVQC 4QJVA 4KM8A 3CAGA 2WB1D 5HL7S 1G51A 5DM7S 4OINA 3FOEA 2JA7K 2PHCB 2PMZL 1Y1WC 1J6XA 1B4BA 1BJTA 4Y52C 4A3IK 1K83K 2PPBA 5IP7K 2JH3A 4KM9A 1F7VA 2ZFZA 2W7VA 3PO3K 3BUEA 2PA8D 4A3IC 3PO2K 1K83C 1WSRA 4G7OA 5JVOA 2KPUA 5IP7C 4RMFA 3HOUK 4U67S 1O27A 3PO3C 1SFOK 1J6WA 1O2BA 4A3LK 2V6UA 3HOUC 2NVXC 1Y1WA 2XCQA 5M3FK 2P8TA 4A3LC 5C4XK 1ZQ1C 2BE5A 3I4NC 4A3KK 4KATA 1AB4A 2E2HK 1J98A 4KC6A 3M4OC 2Y0SL 3DLLS 1DCHA 1XXBA 4A3KC 1O2FB 1TWHC 2WAQD 2VUMK 1TWFA 2GSNA 4J3NA 2NVXA 1VRQC 3N3YA 4FZBA 3GTQK 3A8KA 4QIWL 3S17K 2GAGC 3M3YK 2E2IK 5D4DA 2VUMC 4XSZA 3GTLK 3AD7C 2E2IC 1BS2A 1XZQB 1YNNA 3GTLC 2KWAA 2JA8K 4GTLA 4XLNA 5TMFA 1TWHA 1WOOA 1TWCC 3HOWC 3TFIA 1YX2A 4Y7NK 4GFQA 4KMDA 1YNJA 3GTGC 1SMYA 1PJ7A 2VUMA 3CQZA 1R9TK 1FEUA 3OPFA 4Y7NC 3PIOS 2NVTK 3LAJA 3HKZD 2NVYK 1R9TC 1V5VA 3GTLA 1XZQA 2NVTC 1ZXOA 1TWCA 3SZZA 4A3DK 4GTEA 4LR2A 1XXAA 2R7ZK 4GTCA 4A3EK 2RGRA 3GTGA 2XCRB 4G7ZA 4C3IC 1HI9A 3S1MK 4BBSC 3GTMK 1WSVA 2R93C 3AH5A 4MEXA 4Q5SA 2R7ZC 5TMCA 4A3EC 1Y1VK 4WFBS 3S1MC 2XCOA 3GTMC 1TWAK 2ZJPS 1L0WA 5C4JK 1GE9A 2Y0SD 3A8JA 1TWAC 3RZOK 3G4AA 4BLAA 1ISEA 3K7AK 5C4JC 2EBBA 5EGEA 5FJ8K 4M1XA 4GZYA 2R93A 4AYBL 5HL8A 1VGXA 1VJEA 4GTFA
chains in the Genus database with same CATH topology
3DXJA 3EQLA 4A3DC 3K7AC 4A3GK 5C44K 4A3LK 4LK0A 4LJZA 3I4MC 3S1QK 2O5IA 3HOUC 5M5WK 2NVXC 3HOVC 4A3MK 2B63K 3CQZC 5M3FK 5C3EK 1I6HK 4A3GC 5C44C 3H0GK 3GTOK 3S1QC 4A3LC 1TWCK 5C4XK 4A93K 2BE5A 5IP9K 1Y1VC 5M3MK 4LK1A 4A3MC 2CW0A 2B63C 3I4NC 4A3KK 4YFXA 5M5XK 2JA5K 5C3EC 1ZYRA 1I6HC 3GTGK 2JA7C 2E2HK 4JK1A 3M4OC 4A93C 2Y0SL 3S16K 4LLGA 5IP9C 2A68A 2R92K 4A3KC 4MQ9A 5IYCK 3GTPC 1TWHC 4A3JK 4OIQA 2WAQD 3RZOC 2PA8L 4QIWD 1WCMK 1I6VA 4QJVB 2VUMK 4C3JK 1HQMA 2R92C 3PO2C 3GTQK 5IYCC 4QIWL 3S17K 3HOWK 3GTJK 3M3YK 4Q4ZA 4A3JC 5FLMK 2E2IK 4YFNA 5D4DA 2VUMC 4XSZA 3GTLK 4NOIA 1SFOC 5IYDK 3GTKK 3S2HK 4BXXK 4KMUA 4C3HK 4C3IK 2E2IC 4BBSK 1YNNA 3GTLC 5IYDC 2JA8K 2R93K 3GTKC 4XLNA 3S2HC 4X6AK 5TMFA 3H0GC 4BY1K 4ZH4A 4BXXC 3HOXK 3GTOC 1TWCC 5C4XC 4OIRA 4C3HC 3HOWC 4Y7NK 2JA5C 2A6EA 3S14K 4X6AC 1YNJA 3GTGC 4BY1C 2E2HC 1SMYA 5IYBK 1Y1WK 4OIOA 4Y52K 1R9TK 3S16C 4A3BK 4BBRK 3HOYK 4Y7NC 2WAQL 1IW7A 4XLPA 3S14C 2E2JK 4XSXA 2NVTK 4KN7A 1WCMC 5IYBC 3HKZD 4C3JC 3H3VD 2NVYK 1R9TC 3S1NK 2A69A 4A3BC 4BBRC 3HOYC 4BY7K 3GTQC 3S17C 3GTJC 2E2JC 2NVTC 3M3YC 3HKZL 5FLMC 2JA6K 4A3DK 4KN4A 2NVQK 3S1NC 4BY7C 1TWFK 2YU9K 2R7ZK 4A3EK 2NVXK 4A3CK 4G7ZA 4C3IC 3S1MK 4BBSC 2JA6C 3GTMK 2NVQC 4QJVA 3WODA 2JA8C 2R93C 1I3QK 4MEXA 4Q5SA 1TWFC 5TMCA 3HOXC 4A3EC 2YU9C 2WB1D 2R7ZC 2PMZD 1Y1VK 3RZDK 4A3CC 3I4NK 3S15K 1TWGK 4OINA 3S1MC 3GTMC 3S2DK 1TWAK 1I50K 4YG2A 4G7HA 1I3QC 1XPPA 2WB1L 2PMZL 3FKIK 2O5JA 5M5YK 2JA7K 3M4OK 1Y1WC 4Y52C 3S15C 5C4JK 4A3FK 3RZDC 1K83K 4A3IK 2Y0SD 2PPBA 1TWGC 4C2MK 5IP7K 3GTPK 1BDFA 3S2DC 1TWHK 1TWAC 1I50C 4MEYA 3S1RK 3FKIC 4OIPA 3H3VL 3HOZK 3RZOK 3PO3K 4AYBD 3K7AK 2PA8D 2NVYC 5C4JC 4A3FC 4A3IC 1K83C 3PO2K 4G7OA 5FJ8K 2A6HA 3I4MK 4C2MC 5IP7C 4GZYA 3HOUK 3HOVK 4AYBL 3S1RC 3CQZK 3HOZC 3PO3C 4YFKA 1SFOK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXJ A;  3EQL A;  4A3D C;  3K7A C;  4A3G K;  5C44 K;  4A3L K;  4LK0 A;  4LJZ A;  3I4M C;  3S1Q K;  2O5I A;  3HOU C;  5M5W K;  2NVX C;  3HOV C;  4A3M K;  2B63 K;  3CQZ C;  5M3F K;  5C3E K;  1I6H K;  4A3G C;  5C44 C;  3H0G K;  3GTO K;  3S1Q C;  4A3L C;  1TWC K;  5C4X K;  4A93 K;  2BE5 A;  5IP9 K;  1Y1V C;  5M3M K;  4LK1 A;  4A3M C;  2CW0 A;  2B63 C;  3I4N C;  4A3K K;  4YFX A;  5M5X K;  2JA5 K;  5C3E C;  1ZYR A;  1I6H C;  3GTG K;  2JA7 C;  2E2H K;  4JK1 A;  3M4O C;  4A93 C;  2Y0S L;  3S16 K;  4LLG A;  5IP9 C;  2A68 A;  2R92 K;  4A3K C;  4MQ9 A;  5IYC K;  3GTP C;  1TWH C;  4A3J K;  4OIQ A;  2WAQ D;  3RZO C;  2PA8 L;  4QIW D;  1WCM K;  1I6V A;  4QJV B;  2VUM K;  4C3J K;  1HQM A;  2R92 C;  3PO2 C;  3GTQ K;  5IYC C;  4QIW L;  3S17 K;  3HOW K;  3GTJ K;  3M3Y K;  4Q4Z A;  4A3J C;  5FLM K;  2E2I K;  4YFN A;  5D4D A;  2VUM C;  4XSZ A;  3GTL K;  4NOI A;  1SFO C;  5IYD K;  3GTK K;  3S2H K;  4BXX K;  4KMU A;  4C3H K;  4C3I K;  2E2I C;  4BBS K;  1YNN A;  3GTL C;  5IYD C;  2JA8 K;  2R93 K;  3GTK C;  4XLN A;  3S2H C;  4X6A K;  5TMF A;  3H0G C;  4BY1 K;  4ZH4 A;  4BXX C;  3HOX K;  3GTO C;  1TWC C;  5C4X C;  4OIR A;  4C3H C;  3HOW C;  4Y7N K;  2JA5 C;  2A6E A;  3S14 K;  4X6A C;  1YNJ A;  3GTG C;  4BY1 C;  2E2H C;  1SMY A;  5IYB K;  1Y1W K;  4OIO A;  4Y52 K;  1R9T K;  3S16 C;  4A3B K;  4BBR K;  3HOY K;  4Y7N C;  2WAQ L;  1IW7 A;  4XLP A;  3S14 C;  2E2J K;  4XSX A;  2NVT K;  4KN7 A;  1WCM C;  5IYB C;  3HKZ D;  4C3J C;  3H3V D;  2NVY K;  1R9T C;  3S1N K;  2A69 A;  4A3B C;  4BBR C;  3HOY C;  4BY7 K;  3GTQ C;  3S17 C;  3GTJ C;  2E2J C;  2NVT C;  3M3Y C;  3HKZ L;  5FLM C;  2JA6 K;  4A3D K;  4KN4 A;  2NVQ K;  3S1N C;  4BY7 C;  1TWF K;  2YU9 K;  2R7Z K;  4A3E K;  2NVX K;  4A3C K;  4G7Z A;  4C3I C;  3S1M K;  4BBS C;  2JA6 C;  3GTM K;  2NVQ C;  4QJV A;  3WOD A;  2JA8 C;  2R93 C;  1I3Q K;  4MEX A;  4Q5S A;  1TWF C;  5TMC A;  3HOX C;  4A3E C;  2YU9 C;  2WB1 D;  2R7Z C;  2PMZ D;  1Y1V K;  3RZD K;  4A3C C;  3I4N K;  3S15 K;  1TWG K;  4OIN A;  3S1M C;  3GTM C;  3S2D K;  1TWA K;  1I50 K;  4YG2 A;  4G7H A;  1I3Q C;  1XPP A;  2WB1 L;  2PMZ L;  3FKI K;  2O5J A;  5M5Y K;  2JA7 K;  3M4O K;  1Y1W C;  4Y52 C;  3S15 C;  5C4J K;  4A3F K;  3RZD C;  1K83 K;  4A3I K;  2Y0S D;  2PPB A;  1TWG C;  4C2M K;  5IP7 K;  3GTP K;  1BDF A;  3S2D C;  1TWH K;  1TWA C;  1I50 C;  4MEY A;  3S1R K;  3FKI C;  4OIP A;  3H3V L;  3HOZ K;  3RZO K;  3PO3 K;  4AYB D;  3K7A K;  2PA8 D;  2NVY C;  5C4J C;  4A3F C;  4A3I C;  1K83 C;  3PO2 K;  4G7O A;  5FJ8 K;  2A6H A;  3I4M K;  4C2M C;  5IP7 C;  4GZY A;  3HOU K;  3HOV K;  4AYB L;  3S1R C;  3CQZ K;  3HOZ C;  3PO3 C;  4YFK A;  1SFO K; 
#chains in the Genus database with same CATH topology
 3EQL A;  3K7A C;  4A3G K;  1RU0 A;  1YCL A;  3IPJ A;  1WQG A;  2O5I A;  4IO9 S;  2B63 K;  2KXY A;  1I6H K;  4G0W A;  4A3G C;  3H0G K;  3AQP A;  2B63 C;  3GIR A;  4BKW A;  1I6H C;  2JA7 C;  1XZP B;  3S16 K;  4LLG A;  2A68 A;  1IS1 A;  2JA6 A;  5IYC K;  1DCP A;  3GDZ A;  1WCM K;  1PJ6 A;  3PO2 C;  3SZY A;  5IYC C;  3GTJ K;  4WF9 S;  5DM6 S;  1WQF A;  1SFO C;  5IYD K;  3S2H K;  4BXX K;  3N0C A;  2ZJQ S;  2JA7 A;  4LOW A;  4O2D A;  1IE0 A;  5IYD C;  3S2H C;  1USM A;  3ADA C;  1F9N A;  1K83 A;  4BY1 K;  4BXX C;  3HOX K;  5C4X C;  4KMH A;  1EQR A;  3BP8 C;  1JQW A;  4BY1 C;  2E2H C;  5L46 A;  4BLB A;  4BBR K;  4FM9 A;  1SFO A;  4XSX A;  3L4K A;  4KN7 A;  2FQO A;  2A69 A;  4BBR C;  1IBA A;  3GTQ C;  4G0U A;  3S17 C;  4DDQ A;  3M3Y C;  4P5A A;  5IOT A;  4KN4 A;  5IOQ A;  1ZVU A;  2YU9 K;  4PAB A;  2E2H A;  4A3C K;  3QX3 A;  5IOS A;  1BGW A;  3LYW A;  3OEP A;  2JA8 C;  3ORE A;  1O26 A;  2YU9 C;  3S15 K;  2PMZ D;  3AD8 C;  4WFA S;  4A3C C;  1TWG K;  3S2D K;  1I50 K;  4G7H A;  3FKI K;  2WB1 L;  3NUH A;  3GTQ A;  2O5J A;  5HQH A;  2V6S A;  3S15 C;  2E2I A;  2GAH C;  1TWG C;  3AQO A;  4C2M K;  3GTP K;  1BDF A;  3S2D C;  1I50 C;  3S1R K;  3FKI C;  4OIP A;  3H3V L;  2NVY C;  2KQ1 A;  2A6H A;  1UV7 A;  4C2M C;  3N0B A;  4GTD A;  3TFH A;  3S1R C;  2YU9 A;  4LQY A;  4KAR A;  4A3D C;  4P5B A;  4LJZ A;  1INN A;  1DCO A;  4KMA A;  5M5W K;  5IOR A;  1R9T A;  2RH6 A;  1VH2 A;  1TWG A;  1F93 A;  3T00 A;  1F7U A;  3GTO K;  4KB4 A;  5IP9 K;  3T02 A;  1Y1V C;  4LK1 A;  3TFJ A;  2V6T A;  2JA5 K;  2NVY A;  3LAP A;  3S0X A;  3GEH A;  5IP9 C;  2R92 K;  4MQ9 A;  1X31 C;  4OIQ A;  3RZO C;  4QIW D;  4QJV B;  1I6V A;  3Q3Q A;  2R7Z A;  4C3J K;  1HQM A;  2R92 C;  3GTM A;  5JVG S;  4PAA A;  5FLM K;  4YFN A;  4NOI A;  1Y1V A;  1JOE A;  4GTA A;  1IQ0 A;  2ZUF A;  1TWA A;  4KMU A;  2ZJR S;  4X6A K;  3H0G C;  4ZH4 A;  4OIR A;  3T01 A;  2R92 A;  3ERE D;  4X6A C;  1EH1 A;  1Y1W K;  4WFN S;  1IL2 A;  5IYB K;  4Y52 K;  3S16 C;  2CFA B;  3HOY K;  3PIP S;  3V4G A;  1IW7 A;  4XLP A;  2E2J K;  1EK8 A;  4KAS A;  4AH6 A;  4ILD A;  1WCM C;  5IYB C;  3HXA A;  3H3V D;  5JVH S;  1KQ4 A;  3S1N K;  4C45 A;  5E68 A;  2B63 A;  3HOY C;  4BY7 K;  3H0G A;  1O28 A;  3GTJ C;  2E2J C;  3HKZ L;  5EGH A;  2P5M A;  1XZP A;  3S1N C;  1WOS A;  2Y3P A;  4BY7 C;  1TWF K;  2NVX K;  3G4C A;  5CHP A;  2D6F C;  3WOD A;  1I3Q K;  1USO A;  2CFA A;  1PJ5 A;  5TJ3 A;  1TWF C;  1C0A A;  3HOX C;  3I4N K;  3RZD K;  1WCM A;  4YG2 A;  4GTB A;  1I3Q C;  1XPP A;  3VA7 A;  5M5Y K;  3M4O K;  3GTJ A;  4IOA S;  3A8I A;  1O25 A;  4A3F K;  3RZD C;  2GSU A;  1EFW A;  1TWH K;  4MEY A;  1WQH A;  3HOZ K;  4G0V A;  4AYB D;  4WJ4 A;  3BP3 A;  4A3F C;  4KAW X;  3I4M K;  3CF5 S;  3HOV K;  3FHZ A;  3CQZ K;  3HOZ C;  4YFK A;  2FQT A;  3DXJ A;  1WOR A;  5C44 K;  3GEI A;  3S1Q K;  4LK0 A;  3I4M C;  1I3Q A;  3HOV C;  3L4J A;  4A3M K;  3CQZ C;  5JFE A;  5C3E K;  5C44 C;  1O29 A;  3S1Q C;  1B4A A;  1TWC K;  4A93 K;  2L3U A;  3GEE A;  5M3M K;  3HOW K;  4A3M C;  2CW0 A;  3GSI A;  4YFX A;  5M5X K;  5C3E C;  1ZYR A;  3GTG K;  4JK1 A;  4A93 C;  1WOP A;  1O24 A;  3GTP C;  4A3J K;  2L5N A;  1WIH A;  2PA8 L;  2GSO A;  4WCE S;  1DD5 A;  4Q4Z A;  4A3J C;  1J6V A;  1ZBS A;  3GTK K;  1I50 A;  3FKI A;  4C3H K;  4C3I K;  4P9S A;  4BBS K;  4KB2 A;  2R93 K;  3GTK C;  1VLO A;  3AD9 C;  3GTP A;  4XCH A;  3FOF A;  3GTO C;  4C3H C;  5CJ9 A;  3LPX A;  2JA5 C;  2A6E A;  3S14 K;  4OIO A;  4A3B K;  4WIL A;  2WAQ L;  4GT9 A;  3S14 C;  3MML B;  4WJ3 M;  4KDD A;  4C3J C;  3TTG A;  4A3B C;  2ZUE A;  3GTK A;  1O2A A;  5FLM C;  3GTO A;  3JST A;  2JA6 K;  2NVQ K;  2JA5 A;  1EI6 A;  1XXC A;  4IOC S;  1JVI A;  2JA6 C;  2NVQ C;  4QJV A;  4KM8 A;  3CAG A;  2WB1 D;  5HL7 S;  1G51 A;  5DM7 S;  4OIN A;  3FOE A;  2JA7 K;  2PHC B;  2PMZ L;  1Y1W C;  1J6X A;  1B4B A;  1BJT A;  4Y52 C;  4A3I K;  1K83 K;  2PPB A;  5IP7 K;  2JH3 A;  4KM9 A;  1F7V A;  2ZFZ A;  2W7V A;  3PO3 K;  3BUE A;  2PA8 D;  4A3I C;  3PO2 K;  1K83 C;  1WSR A;  4G7O A;  5JVO A;  2KPU A;  5IP7 C;  4RMF A;  3HOU K;  4U67 S;  1O27 A;  3PO3 C;  1SFO K;  1J6W A;  1O2B A;  4A3L K;  2V6U A;  3HOU C;  2NVX C;  1Y1W A;  2XCQ A;  5M3F K;  2P8T A;  4A3L C;  5C4X K;  1ZQ1 C;  2BE5 A;  3I4N C;  4A3K K;  4KAT A;  1AB4 A;  2E2H K;  1J98 A;  4KC6 A;  3M4O C;  2Y0S L;  3DLL S;  1DCH A;  1XXB A;  4A3K C;  1O2F B;  1TWH C;  2WAQ D;  2VUM K;  1TWF A;  2GSN A;  4J3N A;  2NVX A;  1VRQ C;  3N3Y A;  4FZB A;  3GTQ K;  3A8K A;  4QIW L;  3S17 K;  2GAG C;  3M3Y K;  2E2I K;  5D4D A;  2VUM C;  4XSZ A;  3GTL K;  3AD7 C;  2E2I C;  1BS2 A;  1XZQ B;  1YNN A;  3GTL C;  2KWA A;  2JA8 K;  4GTL A;  4XLN A;  5TMF A;  1TWH A;  1WOO A;  1TWC C;  3HOW C;  3TFI A;  1YX2 A;  4Y7N K;  4GFQ A;  4KMD A;  1YNJ A;  3GTG C;  1SMY A;  1PJ7 A;  2VUM A;  3CQZ A;  1R9T K;  1FEU A;  3OPF A;  4Y7N C;  3PIO S;  2NVT K;  3LAJ A;  3HKZ D;  2NVY K;  1R9T C;  1V5V A;  3GTL A;  1XZQ A;  2NVT C;  1ZXO A;  1TWC A;  3SZZ A;  4A3D K;  4GTE A;  4LR2 A;  1XXA A;  2R7Z K;  4GTC A;  4A3E K;  2RGR A;  3GTG A;  2XCR B;  4G7Z A;  4C3I C;  1HI9 A;  3S1M K;  4BBS C;  3GTM K;  1WSV A;  2R93 C;  3AH5 A;  4MEX A;  4Q5S A;  2R7Z C;  5TMC A;  4A3E C;  1Y1V K;  4WFB S;  3S1M C;  2XCO A;  3GTM C;  1TWA K;  2ZJP S;  1L0W A;  5C4J K;  1GE9 A;  2Y0S D;  3A8J A;  1TWA C;  3RZO K;  3G4A A;  4BLA A;  1ISE A;  3K7A K;  5C4J C;  2EBB A;  5EGE A;  5FJ8 K;  4M1X A;  4GZY A;  2R93 A;  4AYB L;  5HL8 A;  1VGX A;  1VJE A;  4GTF A; 
#chains in the Genus database with same CATH homology
 3DXJ A;  3EQL A;  4A3D C;  3K7A C;  4A3G K;  5C44 K;  4A3L K;  4LK0 A;  4LJZ A;  3I4M C;  3S1Q K;  2O5I A;  3HOU C;  5M5W K;  2NVX C;  3HOV C;  4A3M K;  2B63 K;  3CQZ C;  5M3F K;  5C3E K;  1I6H K;  4A3G C;  5C44 C;  3H0G K;  3GTO K;  3S1Q C;  4A3L C;  1TWC K;  5C4X K;  4A93 K;  2BE5 A;  5IP9 K;  1Y1V C;  5M3M K;  4LK1 A;  4A3M C;  2CW0 A;  2B63 C;  3I4N C;  4A3K K;  4YFX A;  5M5X K;  2JA5 K;  5C3E C;  1ZYR A;  1I6H C;  3GTG K;  2JA7 C;  2E2H K;  4JK1 A;  3M4O C;  4A93 C;  2Y0S L;  3S16 K;  4LLG A;  5IP9 C;  2A68 A;  2R92 K;  4A3K C;  4MQ9 A;  5IYC K;  3GTP C;  1TWH C;  4A3J K;  4OIQ A;  2WAQ D;  3RZO C;  2PA8 L;  4QIW D;  1WCM K;  1I6V A;  4QJV B;  2VUM K;  4C3J K;  1HQM A;  2R92 C;  3PO2 C;  3GTQ K;  5IYC C;  4QIW L;  3S17 K;  3HOW K;  3GTJ K;  3M3Y K;  4Q4Z A;  4A3J C;  5FLM K;  2E2I K;  4YFN A;  5D4D A;  2VUM C;  4XSZ A;  3GTL K;  4NOI A;  1SFO C;  5IYD K;  3GTK K;  3S2H K;  4BXX K;  4KMU A;  4C3H K;  4C3I K;  2E2I C;  4BBS K;  1YNN A;  3GTL C;  5IYD C;  2JA8 K;  2R93 K;  3GTK C;  4XLN A;  3S2H C;  4X6A K;  5TMF A;  3H0G C;  4BY1 K;  4ZH4 A;  4BXX C;  3HOX K;  3GTO C;  1TWC C;  5C4X C;  4OIR A;  4C3H C;  3HOW C;  4Y7N K;  2JA5 C;  2A6E A;  3S14 K;  4X6A C;  1YNJ A;  3GTG C;  4BY1 C;  2E2H C;  1SMY A;  5IYB K;  1Y1W K;  4OIO A;  4Y52 K;  1R9T K;  3S16 C;  4A3B K;  4BBR K;  3HOY K;  4Y7N C;  2WAQ L;  1IW7 A;  4XLP A;  3S14 C;  2E2J K;  4XSX A;  2NVT K;  4KN7 A;  1WCM C;  5IYB C;  3HKZ D;  4C3J C;  3H3V D;  2NVY K;  1R9T C;  3S1N K;  2A69 A;  4A3B C;  4BBR C;  3HOY C;  4BY7 K;  3GTQ C;  3S17 C;  3GTJ C;  2E2J C;  2NVT C;  3M3Y C;  3HKZ L;  5FLM C;  2JA6 K;  4A3D K;  4KN4 A;  2NVQ K;  3S1N C;  4BY7 C;  1TWF K;  2YU9 K;  2R7Z K;  4A3E K;  2NVX K;  4A3C K;  4G7Z A;  4C3I C;  3S1M K;  4BBS C;  2JA6 C;  3GTM K;  2NVQ C;  4QJV A;  3WOD A;  2JA8 C;  2R93 C;  1I3Q K;  4MEX A;  4Q5S A;  1TWF C;  5TMC A;  3HOX C;  4A3E C;  2YU9 C;  2WB1 D;  2R7Z C;  2PMZ D;  1Y1V K;  3RZD K;  4A3C C;  3I4N K;  3S15 K;  1TWG K;  4OIN A;  3S1M C;  3GTM C;  3S2D K;  1TWA K;  1I50 K;  4YG2 A;  4G7H A;  1I3Q C;  1XPP A;  2WB1 L;  2PMZ L;  3FKI K;  2O5J A;  5M5Y K;  2JA7 K;  3M4O K;  1Y1W C;  4Y52 C;  3S15 C;  5C4J K;  4A3F K;  3RZD C;  1K83 K;  4A3I K;  2Y0S D;  2PPB A;  1TWG C;  4C2M K;  5IP7 K;  3GTP K;  1BDF A;  3S2D C;  1TWH K;  1TWA C;  1I50 C;  4MEY A;  3S1R K;  3FKI C;  4OIP A;  3H3V L;  3HOZ K;  3RZO K;  3PO3 K;  4AYB D;  3K7A K;  2PA8 D;  2NVY C;  5C4J C;  4A3F C;  4A3I C;  1K83 C;  3PO2 K;  4G7O A;  5FJ8 K;  2A6H A;  3I4M K;  4C2M C;  5IP7 C;  4GZY A;  3HOU K;  3HOV K;  4AYB L;  3S1R C;  3CQZ K;  3HOZ C;  3PO3 C;  4YFK A;  1SFO K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...