4G7OA

Crystal structure of thermus thermophilus transcription initiation complex containing 2 nt of rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 51
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7oA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7oA01
2CW0A 4XSZA 4A3JK 1TWFK 3S1NC 3S2HK 4C3HK 4C3IC 1Y1VK 3I4MK 4A3BC 4C2MC 4BBSC 4A3LC 2NVXK 2PA8L 2WB1D 1TWAC 3GTOK 4Q4ZA 4A3JC 3RZDC 3S16K 2B63K 5IP9C 3GTPC 3S17C 3GTPK 3S17K 2PA8D 5IP9K 4Y52K 4Y7NC 5D4DA 4G7HA 3GTJK 3S1MK 1TWAK 2PMZL 5FJ8K 3S1QK 2R92K 5IYCK 4QJVA 2E2IK 4A3LK 2WAQD 1R9TC 3K7AC 4Y7NK 4A3MK 4BBRC 4Y52C 4A3KK 1XPPA 4XLNA 2A69A 1SMYA 4OIPA 3S2HC 3S1NK 2A6EA 2B63C 3PO2K 2JA7C 3RZDK 4KN4A 2E2HC 3GTMK 3GTKC 2NVYK 4LK1A 4LLGA 3DXJA 3S2DK 4A3FK 4LJZA 5C4JC 4BBSK 4MEYA 2R93K 1HQMA 4A3BK 4C3IK 4A3GC 4JK1A 5M3FK 5C3EK 3HOWC 1TWFC 3FKIK 2A68A 4XSXA 4QJVB 5C4XK 1I6HC 3WODA 5C44C 4A3IK 1K83K 3GTOC 3GTGC 4OIQA 1SFOK 3GTLK 5IYBC 1IW7A 4MQ9A 1I3QC 2O5IA 3I4NC 4A3EK 3M3YK 3CQZK 3PO3K 2VUMK 4BY1C 3HOYK 3S15C 3GTQC 4A3CK 1I50K 1TWHC 4QIWL 2YU9K 3HOXC 5IP7C 3H0GC 2NVTC 4YG2A 2JA6C 3HOVC 5M5WK 4A3DK 3S1RC 4ZH4A 3H3VD 5FLMK 3RZOK 4Q5SA 4BXXK 1TWCK 2NVQC 5TMFA 3HOZC 4BY7C 3M4OK 3S14K 4A93C 5TMCA 5M3MK 1TWGK 5IYDK 5IP7K 5M5YK 4X6AC 4XLPA 3S14C 4C3JC 1Y1WK 3M4OC 2JA8C 4G7OA 3HOUC 2PPBA 3GTQK 2E2JK 4YFNA 2WAQL 4QIWD 4BXXC 3S1RK 4BY1K 4NOIA 5M5XK 4GZYA 2A6HA 2VUMC 3PO3C 2R7ZC 3HKZL 3HOUK 2JA8K 1BDFA 3H0GK 1Y1WC 1WCMC 2JA5C 2Y0SL 4C3JK 2NVTK 1WCMK 2JA5K 4A3CC 1TWGC 3EQLA 5IYDC 2R7ZK 5C3EC 3S15K 3HOZK 1YNJA 2R93C 4BY7K 2E2JC 2PMZD 4A3EC 1I3QK 5FLMC 3RZOC 2NVYC 4KMUA 4X6AK 1YNNA 3HOVK 4A3IC 2JA6K 1I6HK 3PO2C 4YFKA 4AYBD 4A93K 1TWHK 1I50C 4A3MC 3K7AK 2NVQK 1R9TK 1TWCC 3S2DC 2O5JA 2Y0SD 3HKZD 2R92C 4AYBL 1ZYRA 3S1QC 4OIOA 4A3DC 3GTKK 2BE5A 3CQZC 2E2HK 3I4NK 4YFXA 2JA7K 3HOXK 2YU9C 1K83C 4MEXA 4A3KC 4OINA 2WB1L 4BBRK 5C44K 3S16C 3H3VL 3FKIC 4KN7A 5IYCC 2E2IC 5C4XC 3HOWK 4G7ZA 3HOYC 4A3GK 4LK0A 4OIRA 2NVXC 5C4JK 1I6VA 3GTJC 3S1MC 4A3FC 4C2MK 3M3YC 3I4MC 1Y1VC 1SFOC 3GTLC 4C3HC 5IYBK 3GTGK 3GTMC
chains in the Genus database with same CATH superfamily
2CW0A 1TWFK 1DCHA 1WCMA 4C3HK 4C2MC 1EQRA 2NVXK 4J3NA 1V5VA 1ISEA 3GTPC 3S17C 1JVIA 4Y7NC 5D4DA 4GFQA 1XXAA 3GDZA 4WFNS 1TWFA 4A3LK 1B4AA 1F93A 3K7AC 4XCHA 4Y7NK 1VLOA 4A3MK 4BBRC 4A3KK 3S2HC 1BJTA 4GTEA 2A6EA 1TWCA 3GTMK 1WSRA 2NVYK 4LJZA 2ZFZA 2ZUFA 4BBSK 1HQMA 5C3EK 3FKIK 5C4XK 1I6HC 3WODA 2KXYA 5C44C 4GTAA 2CFAB 5DM7S 1L0WA 3GTGC 4OIQA 1SFOK 3A8IA 4KB2A 1DD5A 4BY1C 3HOYK 3T01A 3GTKA 1Y1WA 1TWAA 1TWHC 5CHPA 3T02A 2NVTC 4A3DK 5FLMK 4GTCA 3HOZC 2FQTA 1AB4A 3SZYA 5EGEA 4ILDA 5IOSA 4G7OA 2PHCB 2E2JK 3HKZL 2V6SA 4PAAA 3HOUK 1Y1WC 3JSTA 1INNA 4GTBA 5C3EC 4DDQA 1YNJA 2PMZD 4GTDA 2NVYC 4KMUA 2EBBA 3G4CA 4YFKA 4AYBD 1ZQ1C 3K7AK 5JFEA 1ZYRA 3GTKK 1O2BA 2KPUA 1KQ4A 2JA7K 3MMLB 4A3KC 4BBRK 1PJ5A 3HOWK 2E2IC 4O2DA 2ZUEA 3GTPA 1RU0A 2KQ1A 3GTJC 3M3YC 5IYBK 3TTGA 3GTGK 1IBAA 3GTOK 2GSUA 1X31C 4PABA 4A3JK 3S1NC 2V6TA 4BBSC 4A3LC 4LOWA 1IE0A 1TWAC 5IOTA 2NVYA 4KDDA 3FOEA 5CJ9A 3GTPK 3S17K 1VRQC 4Y52K 2GSOA 3S1MK 2V6UA 5FJ8K 3S1QK 3L4JA 2RGRA 5IYCK 2E2IK 2WAQD 4IOAS 1XZPA 1XPPA 2A69A 1SMYA 4OIPA 1VGXA 2JA7C 4KN4A 2E2HC 3GTKC 3OPFA 1WQFA 3N0CA 4C3IK 5M3FK 1B4BA 3HOWC 4QJVB 3N3YA 1K83K 3GTOC 3GTLK 5IYBC 3LAJA 3M3YK 4A3EK 2ZJRS 1O2FB 3CQZK 4GTFA 3GIRA 1J6WA 1J98A 1EFWA 2YU9K 3HOXC 3H0GC 3OREA 4YG2A 1XXBA 3H3VD 1WOPA 3RZOK 4GT9A 2CFAA 4WF9S 5TMFA 4P9SA 2W7VA 5M3MK 5IYDK 3TFIA 1DCOA 4C3JC 3M4OC 3GTQK 1HI9A 3IPJA 4BXXC 3AH5A 3S1RK 3SZZA 4NOIA 3TFHA 3PO3C 2R7ZC 1VJEA 1WCMC 1GE9A 1JOEA 1BGWA 1WCMK 4A3CC 5IYDC 1I50A 3FOFA 4BY7K 4A3EC 1YCLA 3FKIA 4P5BA 1YNNA 3HOVK 1I6HK 3PO2C 4A93K 5IOQA 5IORA 2NVQK 3S2DC 2O5JA 4A3DC 1O25A 3GSIA 4KASA 2E2HK 3HOXK 4KB4A 1C0AA 3S16C 2R93A 2L3UA 1O27A 5EGHA 1WOSA 2GAHC 3GTMC 4XSZA 3S2HK 2JA5A 4C3IC 3I4MK 4FM9A 3ERED 3BP3A 2WB1D 1WQGA 3HXAA 1WIHA 4A3JC 1SFOA 3RZDC 1IS1A 5IP9C 5JVGS 2PA8D 1PJ7A 4KMAA 5IP9K 4G7HA 3GTJK 1TWAK 2P5MA 2PMZL 4QJVA 4GTLA 3ADAC 4Y52C 4XLNA 1XXCA 3VA7A 4IOCS 2KWAA 1WSVA 4LK1A 4LLGA 3DXJA 3S2DK 4A3FK 1PJ6A 4MEYA 4JK1A 2A68A 2D6FC 3BUEA 4A3IK 1WOOA 3GTOA 1VH2A 1IW7A 3PO3K 2P8TA 3PIPS 3Q3QA 3S15C 3A8JA 3GTQC 4WILA 2JA6A 2R92A 1I50K 4QIWL 5IP7C 2JA6C 3QX3A 3HOVC 5M5WK 3S1RC 4ZH4A 4BXXK 4WFAS 4WCES 2Y3PA 3S14K 4A93C 5TMCA 4FZBA 3V4GA 4LR2A 4XLPA 2JA8C 2PPBA 3BP8C 2E2HA 2WAQL 4QIWD 1IQ0A 4GZYA 2A6HA 2FQOA 3OEPA 2VUMA 2JA8K 1BDFA 2NVTK 4C3JK 3LPXA 4P5AA 4KM8A 3EQLA 2R7ZK 2NVXA 3HOZK 2ZJPS 3GTGA 3A8KA 1I3QK 5FLMC 4X6AK 4A3IC 3TFJA 4KMHA 1UV7A 1USMA 3GEIA 2GAGC 3H0GA 3CQZA 1R9TK 1TWCC 3HKZD 3S1QC 4OIOA 3CQZC 1G51A 5HL7S 1YX2A 4YFXA 1K83C 4MEXA 4OINA 1I3QA 5C44K 3H3VL 2XCOA 3AD9C 2E2IA 5IYCC 5E68A 4G7ZA 2ZJQS 3HOYC 4LK0A 4A3GK 2NVXC 3NUHA 1I6VA 5HQHA 4C2MK 3AD7C 3LYWA 1Y1VC 1SFOC 1ZBSA 4C3HC 3CAGA 5JVHS 1J6XA 1EH1A 1O28A 3CF5S 1Y1VK 4A3BC 4AH6A 3GEHA 1ZVUA 1TWHA 2PA8L 3DLLS 4KMDA 4Q4ZA 3GTLA 3S16K 2RH6A 2B63K 4LQYA 3AQOA 1O2AA 5JVOA 3L4KA 1F7UA 2R92K 1R9TC 1WORA 3S1NK 2JA7A 2B63C 3PO2K 3RZDK 2XCQA 3GTQA 1R9TA 5C4JC 3AD8C 2R93K 4C45A 4A3BK 4A3GC 5L46A 4KARA 3FHZA 1TWFC 4XSXA 3LAPA 1XZQB 1ZXOA 2O5IA 4MQ9A 1I3QC 3I4NC 4KATA 2VUMK 4G0VA 1TWGA 4G0WA 4KM9A 1O24A 3S0XA 1DCPA 4A3CK 2R7ZA 1O26A 1EK8A 1Y1VA 4BLAA 4Q5SA 3GTJA 1TWCK 3GTMA 2NVQC 4BY7C 1WQHA 2JH3A 3M4OK 4WJ3M 1F7VA 4RMFA 4KC6A 1JQWA 1EI6A 1TWGK 5IP7K 5M5YK 3PIOS 4X6AC 3S14C 1USOA 1Y1WK 4G0UA 1IL2A 3HOUC 4YFNA 4BKWA 4BY1K 5M5XK 1O29A 2VUMC 1J6VA 1F9NA 2L5NA 3H0GK 2JA5C 3AQPA 2Y0SL 2JA5K 1TWGC 5TJ3A 3N0BA 3T00A 3S15K 4U67S 2R93C 2E2JC 5HL8A 3G4AA 3RZOC 4KAWX 4IO9S 2JA6K 1XZQA 1XZPB 2GSNA 2YU9A 1TWHK 1I50C 4A3MC 4WJ4A 2Y0SD 2R92C 2B63A 4AYBL 2BE5A 3I4NK 4BLBA 2YU9C 2WB1L 3FKIC 4KN7A 5C4XC 2XCRB 4WFBS 1FEUA 4OIRA 4M1XA 5C4JK 3GEEA 3S1MC 4A3FC 3I4MC 1BS2A 3GTLC 1K83A 5DM6S
chains in the Genus database with same CATH topology
2CW0A 4XSZA 4A3JK 1TWFK 3S1NC 3S2HK 4C3HK 4C3IC 1Y1VK 3I4MK 4A3BC 4C2MC 4BBSC 4A3LC 2NVXK 2PA8L 2WB1D 1TWAC 3GTOK 4Q4ZA 4A3JC 3RZDC 3S16K 2B63K 5IP9C 3GTPC 3S17C 3GTPK 3S17K 2PA8D 5IP9K 4Y52K 4Y7NC 5D4DA 4G7HA 3GTJK 3S1MK 1TWAK 2PMZL 5FJ8K 3S1QK 2R92K 5IYCK 4QJVA 2E2IK 4A3LK 2WAQD 1R9TC 3K7AC 4Y7NK 4A3MK 4BBRC 4Y52C 4A3KK 1XPPA 4XLNA 2A69A 1SMYA 4OIPA 3S2HC 3S1NK 2A6EA 2B63C 3PO2K 2JA7C 3RZDK 4KN4A 2E2HC 3GTMK 3GTKC 2NVYK 4LK1A 4LLGA 3DXJA 3S2DK 4A3FK 4LJZA 5C4JC 4BBSK 4MEYA 2R93K 1HQMA 4A3BK 4C3IK 4A3GC 4JK1A 5M3FK 5C3EK 3HOWC 1TWFC 3FKIK 2A68A 4XSXA 4QJVB 5C4XK 1I6HC 3WODA 5C44C 4A3IK 1K83K 3GTOC 3GTGC 4OIQA 1SFOK 3GTLK 5IYBC 1IW7A 4MQ9A 1I3QC 2O5IA 3I4NC 4A3EK 3M3YK 3CQZK 3PO3K 2VUMK 4BY1C 3HOYK 3S15C 3GTQC 4A3CK 1I50K 1TWHC 4QIWL 2YU9K 3HOXC 5IP7C 3H0GC 2NVTC 4YG2A 2JA6C 3HOVC 5M5WK 4A3DK 3S1RC 4ZH4A 3H3VD 5FLMK 3RZOK 4Q5SA 4BXXK 1TWCK 2NVQC 5TMFA 3HOZC 4BY7C 3M4OK 3S14K 4A93C 5TMCA 5M3MK 1TWGK 5IYDK 5IP7K 5M5YK 4X6AC 4XLPA 3S14C 4C3JC 1Y1WK 3M4OC 2JA8C 4G7OA 3HOUC 2PPBA 3GTQK 2E2JK 4YFNA 2WAQL 4QIWD 4BXXC 3S1RK 4BY1K 4NOIA 5M5XK 4GZYA 2A6HA 2VUMC 3PO3C 2R7ZC 3HKZL 3HOUK 2JA8K 1BDFA 3H0GK 1Y1WC 1WCMC 2JA5C 2Y0SL 4C3JK 2NVTK 1WCMK 2JA5K 4A3CC 1TWGC 3EQLA 5IYDC 2R7ZK 5C3EC 3S15K 3HOZK 1YNJA 2R93C 4BY7K 2E2JC 2PMZD 4A3EC 1I3QK 5FLMC 3RZOC 2NVYC 4KMUA 4X6AK 1YNNA 3HOVK 4A3IC 2JA6K 1I6HK 3PO2C 4YFKA 4AYBD 4A93K 1TWHK 1I50C 4A3MC 3K7AK 2NVQK 1R9TK 1TWCC 3S2DC 2O5JA 2Y0SD 3HKZD 2R92C 4AYBL 1ZYRA 3S1QC 4OIOA 4A3DC 3GTKK 2BE5A 3CQZC 2E2HK 3I4NK 4YFXA 2JA7K 3HOXK 2YU9C 1K83C 4MEXA 4A3KC 4OINA 2WB1L 4BBRK 5C44K 3S16C 3H3VL 3FKIC 4KN7A 5IYCC 2E2IC 5C4XC 3HOWK 4G7ZA 3HOYC 4A3GK 4LK0A 4OIRA 2NVXC 5C4JK 1I6VA 3GTJC 3S1MC 4A3FC 4C2MK 3M3YC 3I4MC 1Y1VC 1SFOC 3GTLC 4C3HC 5IYBK 3GTGK 3GTMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW0 A;  4XSZ A;  4A3J K;  1TWF K;  3S1N C;  3S2H K;  4C3H K;  4C3I C;  1Y1V K;  3I4M K;  4A3B C;  4C2M C;  4BBS C;  4A3L C;  2NVX K;  2PA8 L;  2WB1 D;  1TWA C;  3GTO K;  4Q4Z A;  4A3J C;  3RZD C;  3S16 K;  2B63 K;  5IP9 C;  3GTP C;  3S17 C;  3GTP K;  3S17 K;  2PA8 D;  5IP9 K;  4Y52 K;  4Y7N C;  5D4D A;  4G7H A;  3GTJ K;  3S1M K;  1TWA K;  2PMZ L;  5FJ8 K;  3S1Q K;  2R92 K;  5IYC K;  4QJV A;  2E2I K;  4A3L K;  2WAQ D;  1R9T C;  3K7A C;  4Y7N K;  4A3M K;  4BBR C;  4Y52 C;  4A3K K;  1XPP A;  4XLN A;  2A69 A;  1SMY A;  4OIP A;  3S2H C;  3S1N K;  2A6E A;  2B63 C;  3PO2 K;  2JA7 C;  3RZD K;  4KN4 A;  2E2H C;  3GTM K;  3GTK C;  2NVY K;  4LK1 A;  4LLG A;  3DXJ A;  3S2D K;  4A3F K;  4LJZ A;  5C4J C;  4BBS K;  4MEY A;  2R93 K;  1HQM A;  4A3B K;  4C3I K;  4A3G C;  4JK1 A;  5M3F K;  5C3E K;  3HOW C;  1TWF C;  3FKI K;  2A68 A;  4XSX A;  4QJV B;  5C4X K;  1I6H C;  3WOD A;  5C44 C;  4A3I K;  1K83 K;  3GTO C;  3GTG C;  4OIQ A;  1SFO K;  3GTL K;  5IYB C;  1IW7 A;  4MQ9 A;  1I3Q C;  2O5I A;  3I4N C;  4A3E K;  3M3Y K;  3CQZ K;  3PO3 K;  2VUM K;  4BY1 C;  3HOY K;  3S15 C;  3GTQ C;  4A3C K;  1I50 K;  1TWH C;  4QIW L;  2YU9 K;  3HOX C;  5IP7 C;  3H0G C;  2NVT C;  4YG2 A;  2JA6 C;  3HOV C;  5M5W K;  4A3D K;  3S1R C;  4ZH4 A;  3H3V D;  5FLM K;  3RZO K;  4Q5S A;  4BXX K;  1TWC K;  2NVQ C;  5TMF A;  3HOZ C;  4BY7 C;  3M4O K;  3S14 K;  4A93 C;  5TMC A;  5M3M K;  1TWG K;  5IYD K;  5IP7 K;  5M5Y K;  4X6A C;  4XLP A;  3S14 C;  4C3J C;  1Y1W K;  3M4O C;  2JA8 C;  4G7O A;  3HOU C;  2PPB A;  3GTQ K;  2E2J K;  4YFN A;  2WAQ L;  4QIW D;  4BXX C;  3S1R K;  4BY1 K;  4NOI A;  5M5X K;  4GZY A;  2A6H A;  2VUM C;  3PO3 C;  2R7Z C;  3HKZ L;  3HOU K;  2JA8 K;  1BDF A;  3H0G K;  1Y1W C;  1WCM C;  2JA5 C;  2Y0S L;  4C3J K;  2NVT K;  1WCM K;  2JA5 K;  4A3C C;  1TWG C;  3EQL A;  5IYD C;  2R7Z K;  5C3E C;  3S15 K;  3HOZ K;  1YNJ A;  2R93 C;  4BY7 K;  2E2J C;  2PMZ D;  4A3E C;  1I3Q K;  5FLM C;  3RZO C;  2NVY C;  4KMU A;  4X6A K;  1YNN A;  3HOV K;  4A3I C;  2JA6 K;  1I6H K;  3PO2 C;  4YFK A;  4AYB D;  4A93 K;  1TWH K;  1I50 C;  4A3M C;  3K7A K;  2NVQ K;  1R9T K;  1TWC C;  3S2D C;  2O5J A;  2Y0S D;  3HKZ D;  2R92 C;  4AYB L;  1ZYR A;  3S1Q C;  4OIO A;  4A3D C;  3GTK K;  2BE5 A;  3CQZ C;  2E2H K;  3I4N K;  4YFX A;  2JA7 K;  3HOX K;  2YU9 C;  1K83 C;  4MEX A;  4A3K C;  4OIN A;  2WB1 L;  4BBR K;  5C44 K;  3S16 C;  3H3V L;  3FKI C;  4KN7 A;  5IYC C;  2E2I C;  5C4X C;  3HOW K;  4G7Z A;  3HOY C;  4A3G K;  4LK0 A;  4OIR A;  2NVX C;  5C4J K;  1I6V A;  3GTJ C;  3S1M C;  4A3F C;  4C2M K;  3M3Y C;  3I4M C;  1Y1V C;  1SFO C;  3GTL C;  4C3H C;  5IYB K;  3GTG K;  3GTM C; 
#chains in the Genus database with same CATH topology
 2CW0 A;  1TWF K;  1DCH A;  1WCM A;  4C3H K;  4C2M C;  1EQR A;  2NVX K;  4J3N A;  1V5V A;  1ISE A;  3GTP C;  3S17 C;  1JVI A;  4Y7N C;  5D4D A;  4GFQ A;  1XXA A;  3GDZ A;  4WFN S;  1TWF A;  4A3L K;  1B4A A;  1F93 A;  3K7A C;  4XCH A;  4Y7N K;  1VLO A;  4A3M K;  4BBR C;  4A3K K;  3S2H C;  1BJT A;  4GTE A;  2A6E A;  1TWC A;  3GTM K;  1WSR A;  2NVY K;  4LJZ A;  2ZFZ A;  2ZUF A;  4BBS K;  1HQM A;  5C3E K;  3FKI K;  5C4X K;  1I6H C;  3WOD A;  2KXY A;  5C44 C;  4GTA A;  2CFA B;  5DM7 S;  1L0W A;  3GTG C;  4OIQ A;  1SFO K;  3A8I A;  4KB2 A;  1DD5 A;  4BY1 C;  3HOY K;  3T01 A;  3GTK A;  1Y1W A;  1TWA A;  1TWH C;  5CHP A;  3T02 A;  2NVT C;  4A3D K;  5FLM K;  4GTC A;  3HOZ C;  2FQT A;  1AB4 A;  3SZY A;  5EGE A;  4ILD A;  5IOS A;  4G7O A;  2PHC B;  2E2J K;  3HKZ L;  2V6S A;  4PAA A;  3HOU K;  1Y1W C;  3JST A;  1INN A;  4GTB A;  5C3E C;  4DDQ A;  1YNJ A;  2PMZ D;  4GTD A;  2NVY C;  4KMU A;  2EBB A;  3G4C A;  4YFK A;  4AYB D;  1ZQ1 C;  3K7A K;  5JFE A;  1ZYR A;  3GTK K;  1O2B A;  2KPU A;  1KQ4 A;  2JA7 K;  3MML B;  4A3K C;  4BBR K;  1PJ5 A;  3HOW K;  2E2I C;  4O2D A;  2ZUE A;  3GTP A;  1RU0 A;  2KQ1 A;  3GTJ C;  3M3Y C;  5IYB K;  3TTG A;  3GTG K;  1IBA A;  3GTO K;  2GSU A;  1X31 C;  4PAB A;  4A3J K;  3S1N C;  2V6T A;  4BBS C;  4A3L C;  4LOW A;  1IE0 A;  1TWA C;  5IOT A;  2NVY A;  4KDD A;  3FOE A;  5CJ9 A;  3GTP K;  3S17 K;  1VRQ C;  4Y52 K;  2GSO A;  3S1M K;  2V6U A;  5FJ8 K;  3S1Q K;  3L4J A;  2RGR A;  5IYC K;  2E2I K;  2WAQ D;  4IOA S;  1XZP A;  1XPP A;  2A69 A;  1SMY A;  4OIP A;  1VGX A;  2JA7 C;  4KN4 A;  2E2H C;  3GTK C;  3OPF A;  1WQF A;  3N0C A;  4C3I K;  5M3F K;  1B4B A;  3HOW C;  4QJV B;  3N3Y A;  1K83 K;  3GTO C;  3GTL K;  5IYB C;  3LAJ A;  3M3Y K;  4A3E K;  2ZJR S;  1O2F B;  3CQZ K;  4GTF A;  3GIR A;  1J6W A;  1J98 A;  1EFW A;  2YU9 K;  3HOX C;  3H0G C;  3ORE A;  4YG2 A;  1XXB A;  3H3V D;  1WOP A;  3RZO K;  4GT9 A;  2CFA A;  4WF9 S;  5TMF A;  4P9S A;  2W7V A;  5M3M K;  5IYD K;  3TFI A;  1DCO A;  4C3J C;  3M4O C;  3GTQ K;  1HI9 A;  3IPJ A;  4BXX C;  3AH5 A;  3S1R K;  3SZZ A;  4NOI A;  3TFH A;  3PO3 C;  2R7Z C;  1VJE A;  1WCM C;  1GE9 A;  1JOE A;  1BGW A;  1WCM K;  4A3C C;  5IYD C;  1I50 A;  3FOF A;  4BY7 K;  4A3E C;  1YCL A;  3FKI A;  4P5B A;  1YNN A;  3HOV K;  1I6H K;  3PO2 C;  4A93 K;  5IOQ A;  5IOR A;  2NVQ K;  3S2D C;  2O5J A;  4A3D C;  1O25 A;  3GSI A;  4KAS A;  2E2H K;  3HOX K;  4KB4 A;  1C0A A;  3S16 C;  2R93 A;  2L3U A;  1O27 A;  5EGH A;  1WOS A;  2GAH C;  3GTM C;  4XSZ A;  3S2H K;  2JA5 A;  4C3I C;  3I4M K;  4FM9 A;  3ERE D;  3BP3 A;  2WB1 D;  1WQG A;  3HXA A;  1WIH A;  4A3J C;  1SFO A;  3RZD C;  1IS1 A;  5IP9 C;  5JVG S;  2PA8 D;  1PJ7 A;  4KMA A;  5IP9 K;  4G7H A;  3GTJ K;  1TWA K;  2P5M A;  2PMZ L;  4QJV A;  4GTL A;  3ADA C;  4Y52 C;  4XLN A;  1XXC A;  3VA7 A;  4IOC S;  2KWA A;  1WSV A;  4LK1 A;  4LLG A;  3DXJ A;  3S2D K;  4A3F K;  1PJ6 A;  4MEY A;  4JK1 A;  2A68 A;  2D6F C;  3BUE A;  4A3I K;  1WOO A;  3GTO A;  1VH2 A;  1IW7 A;  3PO3 K;  2P8T A;  3PIP S;  3Q3Q A;  3S15 C;  3A8J A;  3GTQ C;  4WIL A;  2JA6 A;  2R92 A;  1I50 K;  4QIW L;  5IP7 C;  2JA6 C;  3QX3 A;  3HOV C;  5M5W K;  3S1R C;  4ZH4 A;  4BXX K;  4WFA S;  4WCE S;  2Y3P A;  3S14 K;  4A93 C;  5TMC A;  4FZB A;  3V4G A;  4LR2 A;  4XLP A;  2JA8 C;  2PPB A;  3BP8 C;  2E2H A;  2WAQ L;  4QIW D;  1IQ0 A;  4GZY A;  2A6H A;  2FQO A;  3OEP A;  2VUM A;  2JA8 K;  1BDF A;  2NVT K;  4C3J K;  3LPX A;  4P5A A;  4KM8 A;  3EQL A;  2R7Z K;  2NVX A;  3HOZ K;  2ZJP S;  3GTG A;  3A8K A;  1I3Q K;  5FLM C;  4X6A K;  4A3I C;  3TFJ A;  4KMH A;  1UV7 A;  1USM A;  3GEI A;  2GAG C;  3H0G A;  3CQZ A;  1R9T K;  1TWC C;  3HKZ D;  3S1Q C;  4OIO A;  3CQZ C;  1G51 A;  5HL7 S;  1YX2 A;  4YFX A;  1K83 C;  4MEX A;  4OIN A;  1I3Q A;  5C44 K;  3H3V L;  2XCO A;  3AD9 C;  2E2I A;  5IYC C;  5E68 A;  4G7Z A;  2ZJQ S;  3HOY C;  4LK0 A;  4A3G K;  2NVX C;  3NUH A;  1I6V A;  5HQH A;  4C2M K;  3AD7 C;  3LYW A;  1Y1V C;  1SFO C;  1ZBS A;  4C3H C;  3CAG A;  5JVH S;  1J6X A;  1EH1 A;  1O28 A;  3CF5 S;  1Y1V K;  4A3B C;  4AH6 A;  3GEH A;  1ZVU A;  1TWH A;  2PA8 L;  3DLL S;  4KMD A;  4Q4Z A;  3GTL A;  3S16 K;  2RH6 A;  2B63 K;  4LQY A;  3AQO A;  1O2A A;  5JVO A;  3L4K A;  1F7U A;  2R92 K;  1R9T C;  1WOR A;  3S1N K;  2JA7 A;  2B63 C;  3PO2 K;  3RZD K;  2XCQ A;  3GTQ A;  1R9T A;  5C4J C;  3AD8 C;  2R93 K;  4C45 A;  4A3B K;  4A3G C;  5L46 A;  4KAR A;  3FHZ A;  1TWF C;  4XSX A;  3LAP A;  1XZQ B;  1ZXO A;  2O5I A;  4MQ9 A;  1I3Q C;  3I4N C;  4KAT A;  2VUM K;  4G0V A;  1TWG A;  4G0W A;  4KM9 A;  1O24 A;  3S0X A;  1DCP A;  4A3C K;  2R7Z A;  1O26 A;  1EK8 A;  1Y1V A;  4BLA A;  4Q5S A;  3GTJ A;  1TWC K;  3GTM A;  2NVQ C;  4BY7 C;  1WQH A;  2JH3 A;  3M4O K;  4WJ3 M;  1F7V A;  4RMF A;  4KC6 A;  1JQW A;  1EI6 A;  1TWG K;  5IP7 K;  5M5Y K;  3PIO S;  4X6A C;  3S14 C;  1USO A;  1Y1W K;  4G0U A;  1IL2 A;  3HOU C;  4YFN A;  4BKW A;  4BY1 K;  5M5X K;  1O29 A;  2VUM C;  1J6V A;  1F9N A;  2L5N A;  3H0G K;  2JA5 C;  3AQP A;  2Y0S L;  2JA5 K;  1TWG C;  5TJ3 A;  3N0B A;  3T00 A;  3S15 K;  4U67 S;  2R93 C;  2E2J C;  5HL8 A;  3G4A A;  3RZO C;  4KAW X;  4IO9 S;  2JA6 K;  1XZQ A;  1XZP B;  2GSN A;  2YU9 A;  1TWH K;  1I50 C;  4A3M C;  4WJ4 A;  2Y0S D;  2R92 C;  2B63 A;  4AYB L;  2BE5 A;  3I4N K;  4BLB A;  2YU9 C;  2WB1 L;  3FKI C;  4KN7 A;  5C4X C;  2XCR B;  4WFB S;  1FEU A;  4OIR A;  4M1X A;  5C4J K;  3GEE A;  3S1M C;  4A3F C;  3I4M C;  1BS2 A;  3GTL C;  1K83 A;  5DM6 S; 
#chains in the Genus database with same CATH homology
 2CW0 A;  4XSZ A;  4A3J K;  1TWF K;  3S1N C;  3S2H K;  4C3H K;  4C3I C;  1Y1V K;  3I4M K;  4A3B C;  4C2M C;  4BBS C;  4A3L C;  2NVX K;  2PA8 L;  2WB1 D;  1TWA C;  3GTO K;  4Q4Z A;  4A3J C;  3RZD C;  3S16 K;  2B63 K;  5IP9 C;  3GTP C;  3S17 C;  3GTP K;  3S17 K;  2PA8 D;  5IP9 K;  4Y52 K;  4Y7N C;  5D4D A;  4G7H A;  3GTJ K;  3S1M K;  1TWA K;  2PMZ L;  5FJ8 K;  3S1Q K;  2R92 K;  5IYC K;  4QJV A;  2E2I K;  4A3L K;  2WAQ D;  1R9T C;  3K7A C;  4Y7N K;  4A3M K;  4BBR C;  4Y52 C;  4A3K K;  1XPP A;  4XLN A;  2A69 A;  1SMY A;  4OIP A;  3S2H C;  3S1N K;  2A6E A;  2B63 C;  3PO2 K;  2JA7 C;  3RZD K;  4KN4 A;  2E2H C;  3GTM K;  3GTK C;  2NVY K;  4LK1 A;  4LLG A;  3DXJ A;  3S2D K;  4A3F K;  4LJZ A;  5C4J C;  4BBS K;  4MEY A;  2R93 K;  1HQM A;  4A3B K;  4C3I K;  4A3G C;  4JK1 A;  5M3F K;  5C3E K;  3HOW C;  1TWF C;  3FKI K;  2A68 A;  4XSX A;  4QJV B;  5C4X K;  1I6H C;  3WOD A;  5C44 C;  4A3I K;  1K83 K;  3GTO C;  3GTG C;  4OIQ A;  1SFO K;  3GTL K;  5IYB C;  1IW7 A;  4MQ9 A;  1I3Q C;  2O5I A;  3I4N C;  4A3E K;  3M3Y K;  3CQZ K;  3PO3 K;  2VUM K;  4BY1 C;  3HOY K;  3S15 C;  3GTQ C;  4A3C K;  1I50 K;  1TWH C;  4QIW L;  2YU9 K;  3HOX C;  5IP7 C;  3H0G C;  2NVT C;  4YG2 A;  2JA6 C;  3HOV C;  5M5W K;  4A3D K;  3S1R C;  4ZH4 A;  3H3V D;  5FLM K;  3RZO K;  4Q5S A;  4BXX K;  1TWC K;  2NVQ C;  5TMF A;  3HOZ C;  4BY7 C;  3M4O K;  3S14 K;  4A93 C;  5TMC A;  5M3M K;  1TWG K;  5IYD K;  5IP7 K;  5M5Y K;  4X6A C;  4XLP A;  3S14 C;  4C3J C;  1Y1W K;  3M4O C;  2JA8 C;  4G7O A;  3HOU C;  2PPB A;  3GTQ K;  2E2J K;  4YFN A;  2WAQ L;  4QIW D;  4BXX C;  3S1R K;  4BY1 K;  4NOI A;  5M5X K;  4GZY A;  2A6H A;  2VUM C;  3PO3 C;  2R7Z C;  3HKZ L;  3HOU K;  2JA8 K;  1BDF A;  3H0G K;  1Y1W C;  1WCM C;  2JA5 C;  2Y0S L;  4C3J K;  2NVT K;  1WCM K;  2JA5 K;  4A3C C;  1TWG C;  3EQL A;  5IYD C;  2R7Z K;  5C3E C;  3S15 K;  3HOZ K;  1YNJ A;  2R93 C;  4BY7 K;  2E2J C;  2PMZ D;  4A3E C;  1I3Q K;  5FLM C;  3RZO C;  2NVY C;  4KMU A;  4X6A K;  1YNN A;  3HOV K;  4A3I C;  2JA6 K;  1I6H K;  3PO2 C;  4YFK A;  4AYB D;  4A93 K;  1TWH K;  1I50 C;  4A3M C;  3K7A K;  2NVQ K;  1R9T K;  1TWC C;  3S2D C;  2O5J A;  2Y0S D;  3HKZ D;  2R92 C;  4AYB L;  1ZYR A;  3S1Q C;  4OIO A;  4A3D C;  3GTK K;  2BE5 A;  3CQZ C;  2E2H K;  3I4N K;  4YFX A;  2JA7 K;  3HOX K;  2YU9 C;  1K83 C;  4MEX A;  4A3K C;  4OIN A;  2WB1 L;  4BBR K;  5C44 K;  3S16 C;  3H3V L;  3FKI C;  4KN7 A;  5IYC C;  2E2I C;  5C4X C;  3HOW K;  4G7Z A;  3HOY C;  4A3G K;  4LK0 A;  4OIR A;  2NVX C;  5C4J K;  1I6V A;  3GTJ C;  3S1M C;  4A3F C;  4C2M K;  3M3Y C;  3I4M C;  1Y1V C;  1SFO C;  3GTL C;  4C3H C;  5IYB K;  3GTG K;  3GTM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...