4G7QB

Structure of recombinant cytochrome ba3 oxidase mutant v236l from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant V236L from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4g7qB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4g7qB02
4LDLA 4FA7B 2F93A 1A4BA 4QRYA 5ITEA 1PCSA 3EHBB 4PAZA 1A4CA 1KDJA 2J57A 3OD3A 4BEYA 5DHHA 4YSOA 4EIYA 2MTAA 3V2WA 1N70A 2MRYA 2BZCA 2YCXA 3CODA 1JZEA 1B3IA 3X3CA 1ET8A 5G36A 4FPDA 1ASPA 2NTUA 1OCZB 2FJSA 5AZDA 4A2EA 1CYWA 4Y9HA 2P80A 1M57B 3MBWB 3FU8A 1VLXA 1AZNA 1BYPA 3ZEVA 3FU9A 3EH4B 4BV0A 3NJHA 5AX1A 2PPCA 1KYAA 4GP8B 3NS0A 1PLAA 2A3TA 1L9QA 1IW9A 1KBWA 1NDTA 2XX0A 1VGOA 4YSPA 3ABLB 2YAQA 1KGBA 3X2QB 4WW3A 3HB3B 3TBCA 1AS8A 1NIFA 1XB8A 3S3CB 2AANA 4G72B 5AKRA 2VT4A 4TL3A 2WO3B 4AKOA 3FPYA 2LNLA 4EA3A 1FFTB 2CJ3A 2PPDA 2FNWA 4Q89A 5PCYA 1J9TA 1JXGA 2Y1AA 3FYEB 2R4SA 4A2HA 4YL4A 1GS7A 3PXOA 5H2JA 3NSDA 3ZIYA 4YSSA 3VI0A 1J9SA 5B7MA 2BO0A 3UADA 3ZBMA 4NERA 4AKQA 2HRHA 3NYAA 2VW4A 5D4JA 1AS7A 4UF7C 5I5MA 4WKXA 5C1MA 3C75A 2J56A 2YAOA 1RZQA 1L9RA 5EHFA 1RKRA 1SDDA 2BP8A 3ZPRA 1GZMA 5B6VA 2HX7A 2QDWA 4KNSA 4F2FA 2UXTA 1BQRA 2BWIA 2HZHA 2FT8A 2EIJB 1BXAA 5AX0A 2N0MA 4YSCA 4A67A 2PLTA 1V10A 2KSBA 1HZXA 2PP9A 3ASOB 2ZFEA 3QJQB 1E12A 2IWKA 4DKLA 2I7SA 3G5WA 4PCYA 5J7AA 1NIEA 3AYMA 5G2AA 2FQGA 3NY8A 5F7BA 5B1KA 4OV0A 1X0K1 3ABMB 4CSPA 1JZJA 4DP8X 1Q5IA 5H2HA 3EH5B 2DYSB 4KO6A 3GXUB 4BEZA 1C8RA 4LDOA 4YSRA 1TN0A 5H2MA 2WJKA 1PY0A 4YSUA 4GRVA 2YCWA 3OMNB 1ZIBA 4BXVA 2FT6A 3VVKA 5E9NA 1MG2C 1AP9A 4A2DA 2GB2A 4NC3A 4GYCA 7PAZA 2FQFA 4E9VA 2J4YA 4XXJA 2OV0A 5JJEA 1KG9A 1QHQA 4KNUA 1BRXA 3SQRA 4IAQA 5A44A 1X0SA 3PXLA 4HHGA 2ZWNA 5B6YA 1KGYE 1CWQA 3OMIB 2M3GA 1AG0A 2YXVA 3UTWA 4K9JA 5D4IA 1H68A 2FWLB 4DP4X 3PAVA 1QKOA 4L0PB 3C9MA 4E9YA 4AKPA 5A8EA 5B1JC 2IDSA 4MD2A 1S52A 1ET5A 5F7AA 1GS8A 1CC3A 1ET7A 3COCA 2Z55A 4HWLA 3NP4A 3AG3B 3IN0A 2FT7A 2YDVA 3NYKA 3OE6A 4XTNA 1JXFA 1C8SA 5BR5A 1Q5JA 3UZAA 3N55A 4P5SA 3UACA 4A68A 3PDSA 4UAHA 4F7KA 2PPFA 2EINB 2UX6A 1AIZA 2H3XC 5B6XA 3V2YA 4BK5C 1E67A 4JHUA 4MD1A 3SN6R 3NSBA 4N6HA 2IDUA 4M3HA 1GY1A 1UAZA 1T5KA 3QJSB 4X4KA 1WAEA 1TEFA 2EILB 4GY4A 3AZUA 4DP2X 2BP8B 3QJVB 3KW7A 4RH4A 1KMEA 2BW5A 2XXFA 1MZYA 4BWUA 2AFNA 3D4SA 4X31A 2UXVA 1QKPA 4HHWA 2H5UA 5B34A 3UAEA 4YVUA 1SNRA 1OE3A 1NWPA 4N8UA 1KG8A 1M0KA 4ENZA 4IB4A 1KCBA 5AHYA 1DZEA 2CUAA 3T6XA 4KOBA 1LN6A 3H4FA 2Q9OA 2HX8A 1PNCA 1PLBA 1DYZA 3NJNA 2Y01A 3DDLA 1BXVA 4XT3A 3QQXA 1SHXA 3UGEA 1L9OA 1S53A 3BVDB 1J9RA 1AZBA 1NIDA 2L6XA 1QLEB 5DHGA 5JJNA 1GS6X 1JGJA 1JZFA 4E9WA 2VW7A 3L45A 3ERXA 2G87A 2YCZA 1TEGA 3IEAA 4IARA 3DTUB 5JJJA 9PCYA 1EHKB 4GP5B 3NJMA 1L9SA 1ZV2A 2XV0A 3GYRA 7PCYA 1UCQA 3PAUA 3U25A 1BRRA 3ZX1A 4FBZA 4JR8A 1WA0X 1WS8A 4KOCA 5I5IA 2IDTA 5I5JA 3FS9A 1F88A 1F56A 2XLLA 3UTVA 2XU9A 4BUOA 2GSMB 4NAJA 1IC0A 2EIKB 3CDZB 1PZCA 2IH8A 4YVNA 3HAPA 1NWOA 3AG4B 4E9TA 4DP1X 4F2EA 3RFMA 1IUZA 4G7QB 2HPYA 1L9HA 2Y69B 1VJMA 3NP3A 1JERA 2YARA 4XTOA 2VMJA 4HCFA 4W9ZA 3T9WA 3HASA 5H2LA 3KJ6A 5I6NA 3KW8A 4JKNA 3ABKB 3FU7A 4W1TA 2GC4C 5F8UA 2UXFA 2HXAA 1A4AA 3IE9A 5TK2A 4WAVA 2X88A 4DPAX 1IW6A 2VM4A 3T6ZA 3VG9A 1P8IA 4WTQA 4KLYA 2HX9A 4XT1A 1BEXA 1J9QA 1SF5A 3QJTB 4L6RA 1J5CA 1S54A 2IDFA 3FSWA 3V9CA 1AR1B 2BW4A 2NTWA 1NIAA 2IWEA 4DP9X 1R84A 3VGAA 2QT6A 1BRDA 5BR2A 1HAUA 3ODUA 2VW6A 2DWTA 3NSFA 2I7OA 2VN3A 4DJHA 2Y04A 1GY2A 2R7EB 3H56A 4KNFA 2J55A 1OCCB 3EMLA 1TKWA 2YCYA 3QBLA 4PXKA 3NJFA 3V9EA 1FBKA 5H2NA 1JZGA 2IDQA 3NJKA 2PPAA 1IBZA 3CVBA 2AZUA 2IH9A 4DP0X 3PWHA 1UATA 4BWBA 3FU7B 4K5YA 3QDCA 4EJ4A 1RZPA 2JFCA 4YSAA 1OE1A 4AI7A 1ASOA 5TK4A 5I6OA 1AQ8A 3CG8A 2Y02A 5DYSA 3OM3B 1M0LA 2X87A 3S8GB 1OCOB 4N4YB 3RZEA 1KDIA 1IBYA 4KO7A 3X1NA 1KV7A 3OE9A 3SBPA 5G2DA 1PMYA 3PPSA 4E9QA 2E86A 4J4QA 2XUWA 2XV3A 1I53A 1ZPUA 1L9PA 5FJGA 1ILUA 2DY2A 2P80D 3PLYA 4N4WA 2Y00A 1OE2A 2DWSA 4DP5X 2JKWA 3PQRA 2Y03A 1NPJA 3JT2A 2J5WA 3X1EA 1AZUA 1HFUA 1NZRA 4LDEA 2PCFA 3AG2B 5B1AB 1GU8A 1SF3A 4KNTA 2PP8A 4QLWA 4AZUA 4XTLA 3TA4D 4KO5A 2W8CA 5B2NA 1OF0A 4AX3A 2BHFA 3WKPA 1SHWA 3DKHA 1X9RA 2ZONA 3OQRA 1W6LA 1N68A 1X0I1 1ID2A 2AZAA 3AM6A 4HIPA 4AMIA 3SBQA 2ZXWB 3CZUB 3HAQA 3FYIB 4GPOA 4GP4B 4A2FA 4GBRA 2BP0A 2XV2A 1L9TA 1XB3A 1NTDA 5I6LA 4GYBA 1S51A 4X32A 2QPEB 3NY9A 5ETZA 3ZPQA 1OV8A 1AZCA 1CURA 1P8UA 2YXWA 3WG7B 4DAJA 4YSTA 4HCIA 5B1JA 2BRDA 3OAXA 1SFDA 1PXSA 3QJRB 2RACA 3DQBA 2NRDA 2PPEA 3PAZA 1XMEB 1IKOP 1PLCA 1WA2X 1PAZA 4NB7A 8PAZA 4QI1A 2ZIYA 4DP6X 5AZUA 3UONA 3QPKA 5G54A 1E0PA 1SFHA 2QDVA 1AS6A 2CCWA 4G70B 1AG6A 1JV6A 1JZIA 3TASA 3X1GA 3HAOA 3T71A 4DPBX 4UG2A 3NJLA 5I6KA 1ILSA 4YSDA 4FAAB 1NPNA 4YSEA 1XJIA 1HAWA 4HAKA 3UTYA 1AOZA 1YLBB 4QIDA 3QBGA 5AHZA 1KBVA 1FWXA 1P8HA 5ITCA 2XYBA 4QKTA 3X1FA 2W88A 1V54B 2GHZA 5D4HA 2Q5BA 2YAPA 1MGYA 3NJJA 3T6WA 3WNIA 2RH1A 3WIAA 1SDDB 2AT9A 2GC7C 1TU2A 2TSBA 1BAWA 1BQ5A 3NJGA 1F4ZA 5B7EA 1C3WA 1ADWA 2VSKB 1O0AA 4M4RB 5PAZA 3FQYA 1BYOA 3VHZA 2BZ7A 3JTBA 3RYMA 4YSQA 1MZZA 1GW0A 5I28A 1U19A 3OE0A 3QAKA 1M56B 2YQBA 4A2GA 2KSYA 3FSVA 2PEDA 1AANA 2CAKA 4BDVB 4DPCX 4HALA 5KKHA 1JOIA 4G7RB 4HYXA 1FBBA 1ZIAA 5B3SB 5FC9A 2HLEB 5G53A 1E5ZA 3NT0A 1JXDA 2FTAA 2DYRB 1QM8A 5G2CA 2PCYA 1E5YA 2AVFA 4CSZA 1JVOA 1MDAA 3P0GA 4X1HA 4G7SB 5B0WA 1R1CA 1WS7A 1SJMA 5A7EA 5AFAA 1L0MA 1NINA 2CALA 3NSCA 4GXFA 1JZHA 4JKVA 3SBRA 3NJIA 1ZDQA 4MQTA 2IAAC 3AG1B 1BQKA 3HEIB 3S3DB 1ZDSA 1M0MA 3WKQA 4BXSV 2VM3A 4E9RA 1JFPA 1PNDA 3AY2A 2DV6A 5I26A 2XWZA 4BDVA 4MQSA 1JV7A 2WJLA 1NIBA 1E30A 5B6WA 1QNIA 2OCCB 4Q8BA 4A4MA 2YAFA 4MFHA 1F50A 4G71B 1URIA 2TSAA 3VW7A 1H2SA 1V55B 3WQJA 1QHJA 4HYJA 2ZOOA 3UTXA 3QAPA 1CUOA 3QJUB 2EIMB 5H2KA 3MX0B 2FQDA 1BM1A 5TGZA 6PCYA 1MG3C 2ZZLA 3HARA 3DIVA 2I20A 3REYA 1OCRB 3FSZA 3S8FB 3AW5A 2KSAA 5B35A 2EI4A 1AACA 3UAAA 2GI0A 2IWFA 1BXUA 3AYNA 1AZRA 4E9SA 4DP7X 2HRGA 1TN5A 2LLNA 1PXRA 5A45A 3IN2A 1CYXA 3PCYA 2BWDA 4A66A 2YAMA 1GYCA 4MBSA 1PZBA 1W6WA 4TXVB 2WSDA 4JHVA 5LDUA 3CDZA 3ZDWA 2I35A 4HZ1A 3TBBA 3CVDA 1GR7A 2KS9A 4BVNA 3FSAA 1GUEA 2XVBA 1A8ZA 5B7FA 3PBLA 2PP7A 2JAFA 1JVLA 2I21A 1PZAA 1M9WA 6PAZA 1NICA 2OJ1A 2R7EA 3UABA 5EN0A 5H2OA 1ETJA 3GDCA 1DZ0A 3EH3B 3BQVA 3WI9A 2FQEA 2GIMA 1S8JA 3QBKA 4P5RA 3FQ2A 3T6VA 3ABWA 1RCYA 2UX7A 3EF4A 4E9XA 1FA4A 3QBIA 2UXGA 1XB6A 2GBAA 5G28A 4BWWA 3S3BB 3X3BA 4ZK8A 2B08A 4EF3A 1W8EA 4PXFA 2QPDB 1S8LA 1AAJA 3MBVA 3OMAB 5I6MA 2YAEA 2XX1A 1AT9A 1A3ZA 1XIOA 1PY6A 2YDOA 5H2PA 2BP0B 2VSMB 3TU6A 2CBPA 1EZLA 3ASNB 3CVCA 2I1XA 3C9LA 2B3IA 3T45A 2YAHA 3ABGA 3NSYA 3UZCA 2WO2B 4HCGA 2F95A 3D12B 3IBOA 4UANA 3X1BA 4AMJA 1KCWA 2H47C 2I85A 2X72A 4KO9A 2JXMA 3A7KA 4BWTA 5H2IA 5I6PA 5B6ZA 2R4RA 1E65A 3UG9A 3FQ1A 5ANHA 3WNJA 1OOWA 1ASQA 3FT0A 3HANA 1X9UA 2JAGA 4UHRA 1R2NA 3CAPA 5IY5B 3N2JA 3FPXA 3OE8A 1A65A 5B1BB 1J5DA 1GSKA 2Z73A 4JQ6A 4L35A 5AWZA 1WA1X 3H4HA 5LWEA 2XXGA 1PF3A 1IXFA
chains in the Genus database with same CATH superfamily
5E8DL 5F97E 5A2AA 2XBDA 1S9KC 5DHHA 2Z9TA 3MRRB 5EU7E 2EH8H 5M7QA 1YEJH 1PPIA 2BZCA 1RZGB 5DDHB 5I1HH 1WWBX 3BW9A 4HPYL 2XFXB 3FUFA 2ESVA 3WIHL 2JMRA 5L2JB 4HKZA 3C5SB 3MBWB 43CAA 2AV1A 1GVIA 5HHNB 2JB5H 3BZFB 4YPGA 3NPZB 4BV0A 5ESQB 1KT2B 3VQLA 1QBLL 1IGCH 4BBWA 5I73B 4YDMA 5FA4B 2V6HA 1KYFA 3MAWA 4M6OH 5CSBA 3REVB 1HJCA 4AV5A 3UXFA 4QHLA 1NDTA 1ZSDA 4KZCA 1NEPA 4J3BA 1KGBA 2X4TA 5IJKA 5TQ2H 3K6FA 3TBCA 2L04A 4UUJB 5AKRA 3FB6B 4LPVA 3G6DL 4XBEL 4O51B 4QTFA 2PPDA 4PB9L 2H4EA 1A5FH 3ZO9A 1OANA 3D08A 1Z9PA 4F37K 1ML0A 3FT4A 4MJ2A 2ICEB 5DQDH 3QORB 2EEAA 2XIBA 5DJDA 43C9A 2YR3A 4JFPA 3MYZA 4HCRA 1PYWB 2BSTB 4X9BA 2AQ2A 5ILTH 4HK0B 5FO2A 1XIWC 1YYCA 2PUQT 5C6TL 1E9QB 4PJ5E 3LHAA 5FGBA 4KK9C 4O02L 4O2FA 5FAAA 3RPIB 1AQKH 2PR9A 3LRKA 1BVNP 2QPUA 2XCMC 4XNDA 4E68A 4JQVA 1GGTA 5JORA 3G5XB 3KLAA 1E2ZA 1HHGA 3I3EA 5JOPD 2BRRH 3VD4A 3UPRA 1WFUA 3OAYK 4ZFZA 4AJVA 5LO7A 15C8H 3N9GL 4KDTA 2O5XL 1Y07A 2X4UB 5I73C 2PNDA 3WSQL 2IAND 2WJKA 1NCIA 5DWUH 2YCWA 3EGSB 3FQWB 5HGAB 2VZTA 1GGIH 3OMNB 5KVEH 1MI5D 2JJTA 4PREB 3QIUA 3IDIA 1UZ6E 3NPSC 1JXKA 5J3HC 1TFHA 3FU6A 2B7DT 1Z3GH 5H2BA 1Q9KB 4X80H 4TNWK 1Z9SA 2JCCB 5A2KH 3P4MB 1E7VA 3PDOA 3MLXH 3T77B 1LQBC 1YEIH 4NYLA 4R7NB 5GS0C 3GGWB 1QI4A 1WFJA 4PJBF 4M5YH 4KUCF 5AYUL 4K8RL 4DHLA 1T0NA 1A9VA 4NQEE 1S52A 4XHJC 1HE8A 2AEQL 1U42A 1BZ7A 3COCA 2EXSA 3RL2B 4N1EA 3VRIB 2YPLE 4QF1A 2YDVA 3I50L 3NYKA 3OE6A 1UM6H 3GUFA 4B9PA 1TTBA 1KWGA 3GS7A 5E9DD 2WQUA 2ZPKH 2W0LA 3LQAH 1VEPA 2ZG3A 2H3XC 3SCMA 4GKSB 5E70A 2G0KA 3Q2VA 2R59A 2ZPKL 1TENA 4JHWH 4U6XA 1NGWA 5EZJB 5IKCB 3D48R 3VFOA 3SN6N 4MD5A 3MRLA 2GG1A 1JF1B 3TL5A 1XTMA 2XKSA 4LCYB 2BY1A 2E76C 3EF7A 1MNUH 1T89A 2NPLX 4JPQA 4MMXB 2EDLA 2K4AA 4YHMH 4DP2X 1P2CA 1T1XA 3ZPDA 1UWGL 3KS0J 4LU5L 3ZHNA 2G5RA 1DDHA 5EB9A 5CEYB 2H5UA 2QKIC 5C07B 3IRZA 2WLIA 1PW3A 1S5HA 2VDOB 4YVUA 3S36X 4O2EA 4X99B 4HCRH 4DKFH 5B3JF 4K71C 2ZWZA 3QA3A 4N8UA 2OR9L 1FL3B 1OAYH 4UWQB 4E2OA 3BFOA 4ENZA 3HA0A 4OD1L 3WFEH 1OSEA 1G0XA 5AHYA 1F4YH 1QZ1A 2VIRA 3CFUA 4RWYH 1LN6A 1K3IA 2HX8A 4Z78B 1U30A 4Z76B 2KZBA 1KWKA 1PNCA 1M7IB 5ICZB 3MBXL 3E9TA 3WD5L 3QHTC 4LCCC 1ZA6B 5J1AB 2WYHA 3BGFC 5DD3H 1JGJA 4KK8D 2WZ0A 1GAFL 1CBVH 5D1QD 1OAXL 3DTXA 4YNYB 5DD6B 2VB5A 3P40A 5I1DB 3AC0A 3S48A 3VB8A 2N0KA 1KY7A 1I3RB 2VLLA 4KJYB 4LFHD 5IROA 3L9EA 3OKNB 1OP3H 4EN3B 3WBDA 3ZDXE 4LF3A 5J89A 1UT9A 2XU9A 1RULL 4NQXB 2X9WA 1NGQH 3GSQB 1A0QH 1OLZA 1B0IA 2V7NA 1N6VA 3EOAB 5HHMB 1IUZA 5A3IC 2WCGA 3VGBA 3JTTA 3WIIH 5DJXA 4AIZB 4NIYE 2A73A 3HASA 2NY1D 3AS3A 4TRPH 4WNQB 4G9FE 2YN3A 2CLVA 3WIHA 2BY3A 4W9LC 4BUHA 5L9DL 4I3GA 4QNPF 1JUFA 5FUCC 5CD5D 2OTUB 1P8IA 1B0WA 2BDNH 4ZMWA 3Q2CA 1SF5A 4XPAH 3MUJA 3IDXH 2R0ZH 3RWCB 3SE4C 2ADJA 2WLZA 3UPCA 4H25A 2ZXQA 5F88A 2ZF9A 3DV6B 4QDGA 4HBCL 4HJGA 2R7EB 4GI9A 4MDRA 3HMXH 1KF9B 4J27A 4X5RA 3L5JA 2JQAA 1G7PB 2Q8BL 2YK1L 4PU2A 4OJEH 1A7NL 4U6YA 3CVBA 1UD6A 4KDVA 5DZ9A 2WB7A 4KDTC 4K5YA 4MZ2A 4XNMB 4R0LC 5D7LE 2BPBA 1ASOA 5TK4A 1JPFA 3IJ9A 4Z0XB 1N5YL 1PIFA 1MUJA 5JHLH 4TQEL 1C16A 4B9ZA 5EF0A 3FFCA 3C60D 1UD2A 3IETA 4MS8D 2Z35A 3OE9A 2IANB 3A4EA 3D4GA 1C7TA 2Y25A 4GT7A 4L4VA 5K33A 5I8EA 3ILPA 1TJHH 3KVPA 1ZPUA 4WWID 5DSCB 1U8HA 2DWSA 2FO4B 2UZIL 4HSAC 2EE3A 3ARGA 2NXYB 3W0WD 4AM0B 4LOUD 1PZ3A 2K6WA 2ZP8A 2BVTA 4OLUL 3QQ4B 5INDA 4YGVA 1SHSA 1FVCB 2DQIL 3W1ZA 2YMTA 1TSRA 1MFDH 3LQZA 5KBDA 4G80A 1JZ7A 1DQMH 1A9EB 2CMRL 2PR4L 3NFPB 3CZUB 5SX4I 4YBLC 4ZYKA 5I17A 4WGVB 5CGYC 1NOFA 3MRBB 4HJ0D 5SWSE 1MCLA 1MXDA 5GISL 4X32A 4K9EL 4ELMA 2KDYA 3GI8L 3MLSL 3E2HC 4KTDH 2NYYD 3TLRA 1SXCA 1MWAL 3CX5J 4Y8AA 5AEAA 3HRPA 4DAJA 2BRDA 2DL2A 4OSUH 4RMBA 4JDZB 2VQ1A 2OMZB 3PAZA 2ZKHH 4ZS7H 4TSBL 1F4AA 2VDQB 3CX5K 4LSSH 1P6AB 1GHFH 4L0ZA 4OCYL 3TV8A 3L5WB 3JWNE 2AK4E 4POZD 1QLRA 4A2MA 1QBMH 3C5JB 3IFNH 5C0GB 4BKLA 1AG6A 3W57A 4JRXB 3LNFA 3L6FA 3DI2B 3RX8A 4TRPL 4ZQKA 3HRZB 5JQ6L 3H0TB 3B6SB 2UVEA 3O6KH 4QXUH 5EEXA 2HT3D 3C6SA 4QIDA 2HSIA 3NZHL 3O3DB 5AB1A 1UM4H 3AU1B 3UTSB 1FYTB 3TNMB 2WXMA 3TYFB 5K9QG 3RILA 2H6OA 3JWDL 3T3PE 3BZEB 5IFHL 3U7YH 1MFMA 3D09A 3OXSA 4KC3B 5C2BL 3UZQA 2XPZA 2VAAA 1WO2A 1E6JL 3GLAA 4JFQB 5HYIA 2VABB 4KK5D 1UD8A 3TEZA 1CDCA 3SDAB 3EYUH 4CVXB 2BSED 4KVNH 1EFXA 3HUJA 4FZ8L 3NRQA 3B3IB 4YZFF 2D9QB 5IMMA 2W0FB 4X8GA 3MLRH 2QADC 4LHUD 5G2CA 4NS0A 1HC1A 3EJZD 4O4YL 4BD4A 3E8UH 3FTGA 4H2CA 2I27N 5CJXC 4AJWA 1JPST 4BFGA 2VNCA 5FCUH 2NY6C 2ZX9A 3ARBB 3QVAA 4B9FA 3CMGA 2UZYA 3I9PA 3T0AA 1L0MA 2AHIA 4N6RB 4X5QA 4HKJB 2K6ZA 5KOVC 1SEQH 4ZMYA 1AKJB 4Y7OC 1PEWA 1FN4B 1MAKA 3WKQA 1BMGA 1I9EA 3KWWB 4IHOB 4BRVA 1PNDA 3VXQB 4LARL 4MQSA 1F3JB 4JO2H 4ECNA 3ZKQD 4TQHA 3HE7C 1CN4A 1LP9F 4YDZA 2UWEF 3QEUB 5HHOB 4YHIB 2WWMD 4BGLA 2OAAA 3JZ7A 3QJUB 1BIHA 4ONGH 5IFAL 5ISZE 4XMVA 1RIVH 4NQDB 5DK3A 1M1SA 1QQDA 3FQUA 5D7SL 1NGXA 3NIGB 1F4XL 3VXRB 3C8DA 1AHKA 2Y3NA 3AW5A 3ZMRA 2KSAA 5GGRB 1U6AH 4X8JB 5CINH 4ABWA 5LWYL 3AMLA 3QCVL 3ARGC 1OCWH 1BCIA 2AMUA 5AKSA 3UTTE 3R1GH 4TKWA 4HAGA 4PJGA 2FB4H 3CH1B 1JV2A 4WI3A 1DBBH 2NT0A 3GMOB 3HVDA 4FDWA 3AUWB 4DKFL 2BNQE 5D7IA 5HHVL 3GBML 1FZMB 3IFOA 4YXKL 1RHHA 2BSSB 1IBGL 1XGQB 1GKOA 5H2OA 4XPBL 3UPRB 3L7EA 2UZXB 1BMZA 1DBML 4PD4K 4ZJ9A 4L18A 3GIVB 2B3RA 1S8JA 2Y7MA 4NRXB 4EI0A 4KI5F 2X4OB 3EF4A 4LKXA 3QBIA 4JO3L 2NUPA 1CR9H 2GSIA 5TDNA 2ENPA 1EXUB 1G7QB 3OR7A 3WJJA 5ACZB 1AD0A 1ESOA 3HN8A 3MFFB 3VSUA 3S96A 1OL0A 4P3CH 3IRPX 3C12A 4TQ8A 1F11B 2ZUVA 3G5VB 3BKJH 1GPOH 3MNMA 4ANUA 1FG2B 4Z95L 4AJ0A 4AEHL 4PJ7A 4PJXB 1HHKB 5GGUB 1DSFL 4F1ZA 3HJ0A 1E65A 1QSEB 2VOTA 3CV5A 4WSJA 5DQJA 3QDJE 4Z3GA 4PBWD 1JRHL 1EO5A 2ZCKH 4FRWA 4ZNEE 2MQCA 3CCHA 1FFPB 4G59C 4GKNB 2FHFA 1A3LH 3EHBB 1K8IB 4FYTA 3EXLA 1R3HA 2ARWA 4MBRA 1GGIL 2PYEA 1B4LA 3RHWK 5KG9B 2N01B 5TQ0H 4GKOA 5JW3H 4LASH 1N4XL 5F8QC 3T0EC 3IFPB 3FCSA 1MSPA 2Q3XA 3H9SA 3DV4B 5GXBB 4ANKA 1KJ2L 3P3UA 3Q8FA 3CJJA 2Z1KA 3GSVB 1ZGLM 3UYOD 1NEZA 5AX1A 4P2QA 3O3BA 2ZE0A 2DQEH 1ZLDA 1G1OA 2FAUA 1JGVH 3SDXB 3UO8B 3W9DA 3GEFA 1YDPA 3RL1A 5LDSA 1MF2H 2F53D 3VI4B 2JKJA 2YSSA 5GGVL 5CJXA 1VACA 2G2NA 2QSTA 1RUPL 5LB1A 3L9RA 1MJJB 3HB3B 4R83A 1AS8A 2BOCA 2QGEA 3ZTCC 4HJJL 4K73A 4AEIH 5EF1A 5AW6B 4KTDL 5E8PB 5EWIL 3SDAA 2LNLA 2FWOB 5DO2D 1JYNA 2W07A 3W2DL 1M2OA 1BVKB 1CDYA 3JWNC 3HG1B 1HCFX 2BO0A 4N2BA 3C2AL 1J8HB 1U3HA 4P07A 4RWHA 4RX4A 3VU2A 4YHPA 1SM3H 2DQUL 4MMZB 1GZPA 2EUZA 5I23A 4LLVB 4C4KO 4GAJH 1YMHB 2DWEA 1OKEA 3KPSE 4F2FA 1RZFL 4GRLB 4JO5A 5M95B 5CKGA 1L3NA 1OM9A 3KDMA 1TNMA 5SWZB 2YQGA 2IG2L 4EN2A 1NM9A 2WIMA 1BOGA 1T83C 2VN7A 2GHWB 2XICA 3FO2A 4JCWA 4XCYB 3MRNB 5F9WC 4PCYA 5J11B 2FQGA 2KLSA 5FCSH 1UWEL 3L6FB 1CL7L 4BEIA 2XY2A 1CLZH 4FXLA 2VL4A 2N3JA 3PWPE 5I18L 1A1NA 3OAZH 4NQVB 2W91A 3I2CL 1TVHB 1N5YH 1CLZL 1TVHA 3JWOL 5B39A 2XFGB 1WITA 3QWRD 4EQ3A 2XNAA 1REIA 2BMKB 2X6AA 3LKQA 3OXRA 4JCLA 4AE0A 4YDKL 5KAQG 3B2VH 1FFQA 2GYSA 1I7UB 5AYTA 4OF6A 4WFEE 2EZ0D 4UTCA 4OV6F 1E4WL 4HHGA 3GXDA 4U1IB 5IMKB 3GRGA 4FD0A 2VR5A 3ELAT 3F62A 2NZ9D 1NEZG 1HQRB 3BAKA 1JNHA 2WOBA 1YEIL 4OCNC 5DWUL 5TFSH 3S98A 4FQ1L 2MNJB 3KYAA 1GZPB 2D7TH 4Y88A 4XNXL 3AG3B 3H9ZA 1CXLA 1BF8A 3DO3A 4OUUB 1U8IA 5DJYA 5C0BE 3X3GH 2DIBA 1XR8A 4ELME 3PHQA 4ZTPH 4PI2A 4ZUWA 1WBYA 5ID1A 1MCSA 2FWOA 2BC4A 3QRFM 3SN6R 1IAIM 2NNCA 1FIGL 2YD7A 5CILH 2NY6D 4ODUA 3D06A 4EDXB 3AXLB 2F8OA 3A6BL 4RGNB 2RAMA 2XG4B 3CXHJ 2PO6B 1K6QH 5DO2C 4KVPA 1G6RH 2F1BA 2RBLA 2A2QT 3CSFA 4BWUA 1KTJA 1ES0B 3ZQ9A 4JFYA 4XNZC 2XG5A 5IHLB 3WMQA 3OHXB 3OX8A 3ZRSA 3N1FC 4NO2A 1LO2H 1IC5L 4UIMA 3MOQA 4OKDA 4XB3A 5EZPA 4FHBD 4HLZH 1MJ7H 1UHVA 3SE9L 4FQ2H 2VC2L 3QEQB 2DWDA 2D0FA 2DWYA 2ZCHH 3IF1A 4AY0A 1X44A 4JEGB 1N3NB 1UGKA 4MJIE 4DUVA 1SHXA 1R47A 4XBEH 1YZZA 4IW4C 1F4WH 3QO0B 4PWJA 5FX3A 3Q1SH 4TUOB 3SE6A 2NY2B 5G2NA 1FFPA 5TQ2L 1L9SA 1MVUB 3MA7B 4QNPE 4UTBL 2EP6A 4UI2A 2D4FA 4GIPD 3EFDH 2YEZB 3WHE1 5ADOH 5I16A 4XC1H 3AM8C 4XNYL 3STZB 4K94C 3EFOA 5I0DA 3ZHDA 3EOYG 5DS1A 1K5WA 3L1OH 4X6CB 2YPVH 4OM0L 5DJXB 1FPTL 3IDGB 1KTRL 5D1XE 3QXTA 3UEZA 1H5BA 4GW1B 3K6NA 3T8MA 5T1KD 2GC4C 3B8SA 1A4AA 3MJ9L 2GEQA 4Z7NB 3WENA 3VG9A 3PP4L 3FQ4A 5DA4A 2V0AA 2W94A 4OBSA 4TSBH 2GSIB 3WS6A 4R2GC 1A6UH 1VADB 4PJDB 4EDWH 4QRPB 4KGJA 1NC4D 1CT8B 1XGPA 3FCUB 1G7IB 2NTWA 1DJZA 2B5IB 2WUBH 4NRXA 4F7PA 3VGAA 3D69B 5EC2A 3KM2A 4NDMA 1AXTL 4QRRB 4Z77A 1F02I 3T0VA 1MHEB 4K3JL 2EDQA 1OCCB 4FFTA 1UWYA 4G6AD 1T22B 5EH1A 2A4CA 3UP6A 3F7KA 4FQLH 3U30B 4DEUA 1T2QL 4QAMB 4BWBA 1O0VA 5BS0D 1CLCA 4P5KA 1QRND 3QPQD 4LLYB 4KPHH 1AXIB 1SJHA 2EDNA 4HUKB 3CG8A 5FWQA 3BEVA 3S8GB 2WXKA 3WL9B 1XIWA 3NFSH 1F4XH 1XGPB 1Y18A 1KV7A 2EC8A 2WCSA 1J8HD 1QFWI 3GK8L 3I6LE 5EBMB 1FNEB 1I53A 2R8SL 3ILQC 4Y1TA 3A22A 2WINA 2A1WH 3UEQA 3PQRA 1HHJB 1NPJA 3QG6B 4JUSA 1YA5A 4ADJA 5ESVB 5AAMA 4FERA 3KPPA 2CO7B 5TF1H 4S1SH 1ZMYA 2OMUA 1WSST 1U8LB 3KWTA 1M2VB 1OM3L 3MRGB 2D31B 4QJ3B 3WXVL 4PRHA 2HMID 1QW9A 3O2VL 1Q1JH 1SHWA 4N26A 1X9RA 4TLKA 1YQVL 1NFDF 4EKXA 5BZWA 4MJIA 4P48A 4CL7A 2X38A 5HI5D 3V0VB 2X4RA 5CSZA 5DRXB 1FN4A 3HE7D 4GW4B 1Z9NA 4FLQA 4LCUA 3M07A 2QPEB 1S7SB 2BVPA 5ADPL 4RESB 3NN8B 3D7PA 3TN0A 1TYRA 1MXGA 2WY3B 3QPXL 5F0PB 1Z5YD 2ZKMX 1NLDH 3WNPA 1GZQA 5E5RB 5CD5C 3PWVA 1KCUH 3N44B 2NRDA 4UU9A 5D5MF 1GRWA 4NB7A 3VRLF 3ZE2F 1OB1A 5MHSD 5EO1B 4ZD3L 2QSVA 4PJXE 3O8XD 3T2PA 4C57C 3OZ9L 4BFKA 2XZAH 5G54A 1CF8H 1B9ZA 2E8YA 2GABA 1SVBA 3FUHA 2ESVE 2VABA 2VDNB 4JFQA 4JY4A 1ZLWK 4PG9B 1P1VA 2R1XB 2V8MA 2CUMA 2FLRT 3OF6D 3ZE0B 4Y4KA 1HQ4A 3MV7B 1CDIA 2ADFH 3ME0A 1KEMH 1MRCL 4HXBL 1MFUA 4ODVH 5ITCA 2R0LH 4JG0L 3G5ZA 3HPJA 2VGLM 1QSFB 4AH2B 3QNYB 3NJJA 4O02B 4NKDA 4QYOA 5AW2B 3S35L 5CXPA 1QMUA 2BHYA 3SKUD 4WJKB 3WNNA 2B1AH 2V9RA 3HCVB 1I85C 5ENWA 4XWGL 1MPAL 5ELIA 3GRWH 3GHBH 5E23A 2E59A 3MGOA 4XZUB 2VDRB 1D5RA 3BVUA 3LKRB 2GFBA 2VXQH 3DI3B 5IHUL 2AERT 1MAMH 1KY6A 3FTYA 2AEOA 3IJSA 3TA3C 4AUYA 4A7SA 3X17A 5I0ZA 1DUZB 2Z7WA 4OZFA 1T03H 1ZIAA 1SXAA 5DZOA 5G53A 3CHQA 3ARXA 3MRKA 2DYRB 3FQXB 1KZQA 4JGJA 3ECWA 3QEGL 4LESA 1W0VA 2F2HA 4ZUTA 1ZTXH 1ZSDB 2WWOA 3U82B 1X4YA 3X3FL 4IDJL 3QRBA 4MA3A 1AE6L 3ZYOA 4K23L 3OKKA 2Y6SD 5FYJH 3V6OE 3B2VL 4OTXL 4WI0B 3CTTA 1FNLA 3LKQB 3LPFA 2HTLC 3OXRB 4MXWH 4UM9B 5BRZB 2AC0A 3SKNA 3FCTB 4YDVA 1UOLA 1QOKA 1NSNH 1TTAA 2P1YA 1JFPA 1QATA 2Z93B 5I26A 2XFXA 3UYPA 1LEGA 2ZSWA 4NQVA 2Q7YB 5JOFB 5IMLB 1Q1JL 5TH2A 4NRYB 3LQZB 5AOZA 4KX9A 5KSBE 2NY5H 2IPUG 1K85A 4ZBJA 5IZ7A 2HT2D 2DQIH 4PCTA 3DX2A 4MLIA 1TJHL 1Z5HA 4NKDB 6PCYA 1KXHA 3PGDB 4MNQD 4X9HA 3PWJA 1O7SA 4LEOA 2J6EL 3G9VA 2P5EA 3S8FB 3CSGA 5B35A 4UQCA 1KTDB 2XRAH 4IRJB 3WE1A 1RUAL 4MMZA 4S1RL 2BJML 2IV8A 3DRQB 5TD4A 1D5XB 1J5OH 5T1MA 4PJIB 4CC1A 3BIKB 3J07A 2ZWKA 4HK3J 4X98B 1RVFH 4ANWA 3V4VL 4MBSA 3EH2A 4M93C 3TVMC 4TXVB 4KI5C 3T4YB 3CDZA 3N43F 4HZ1A 3SGDI 1UOWA 2GK2A 4DN4L 3VVVA 2GUOA 2C9VA 1HSAB 3T08A 1Q1PA 2EDXA 4CKQA 3QUMB 5CINL 4OQTA 3WUWB 2CO2A 4HJJH 2HKFL 4EI5C 3HBQA 4EN3C 4HD5A 5CEZD 1YAZA 2UX7A 5H37H 3ZGHA 5CFHA 4PJ8C 1XB6A 3IXTA 5ITBL 3AREB 1TVDA 3O3BB 1F4WL 2VXQL 1L7IH 4LRNH 3HG3A 1ITBB 3C8HA 4M7JL 4PJCF 2ODHA 2X4RB 5CSZB 4GG6A 3GHBL 4KKBD 4KITB 2Y7QB 2B3IA 4ILDA 3T45A 3SDCA 4OT1H 4HCGA 1M9SA 1JFQH 5K93A 3L3KA 4NENA 5HY9B 3EH1A 1KELL 4I0KA 2NW2A 4HK3N 5LXGH 4CRPA 3K1DA 3DMMB 3QIBD 4OF8A 3OE8A 2WJ7A 3ARDA 1E2VA 4OW6A 1R5WB 4YGAB 5IW3A 5AWZA 1NL0L 3GJEA 4MA8H 4Z0BH 1QPPA 3P2BA 4QR7A 4XI5C 3MLRL 2CBTA 4TUJB 3BUYA 2OXGB 1UD4A 4GOSA 3SODB 3QCUH 3HE6D 1A6AA 3H53A 3OSVA 5HYSA 3WIHH 5AW1B 4OD1H 4GSUA 2OYPA 1ZHKB 5D1QE 3AROA 4DO6A 1GGUA 4Y9HA 5E6UB 1FUNA 4XPTH 3FU8A 2HG5A 1H3WM 3OGCA 4XN5A 3RWGB 2VLRE 4IHBA 5D7KD 4AW7A 1KXVC 3OC8A 4L2YA 1XEUA 4KNQA 1A7OL 4XMLL 4DGVH 5DTFB 4LIQL 1U8NB 3SKMB 1J5OL 1LL1A 2JI3A 3V6FA 2XX0A 3F7YB 2LV4A 3GMRA 4HIIB 5DJAB 4JFFD 3ZR6A 4F37F 1JPGB 4QRQA 2VT4A 4JN1H 5LNGA 4YHOH 2YA2A 4R2GB 4UINH 4BK8A 2H3NA 1UURA 3RX9A 4BSJA 2HLAB 1JXGA 3FYEB 1E28B 1X5HA 1GS7A 3MU3A 2YGVA 3RTQC 2F19H 4M1DH 3SQBA 3NYAA 3LXCA 4WAFA 1VAHA 1JGUH 2Z8RA 4RRPG 5HDQH 4Y16C 1MCPL 3AU0A 1UA6H 1JPTH 3NZ8B 5BJTB 5FFOA 3ZPRA 4HQQH 3FC8A 4JO4L 4ELMF 4KNSA 1NAMB 4MQTB 2P5EE 2DI9A 2J21A 2PW1A 1L5GB 1JPTL 3FK3A 2CSPA 5AX0A 2N0MA 1KTCA 3MA7A 4ZSOE 2M1KA 2KSBA 1HZXA 2QQQA 1ZT1A 4M48L 4WI6A 5E9DB 4HF5H 4D0CB 4WWNA 5T1DH 5EOCJ 3LH9A 1NMBH 2IMMA 4J3OD 4JZNB 3T8XB 1T2QH 2Y1ZA 1NBYA 4X4MA 5E8EA 4DP8X 2V37A 4PRIE 4ETQA 4NRZB 4O2CA 1DFXA 4QOKA 2ITEA 3DXAB 2XQBH 4YSRA 1IAOA 3HUJE 5DJ8B 5HHME 1GOFA 2DDQH 1PLGL 4LDOB 3ZZSA 3BWSA 3QDGA 3QJZA 5DS8A 1WC7A 5KBNC 2GITA 3OKLB 4PVNA 4HIXH 1CZ8H 5CM1A 3O9WC 1JGLL 2WJ5A 4Z7AA 5E0QA 4XXJA 3S5LG 4GXVL 4OLYH 4JZOA 1Z6JT 2A6KA 1UKTA 2GIYA 5BOZG 3QUZB 1J8KA 5GJTH 3MV9A 5CP3H 3RWIA 4AYMC 5C70A 1XF2A 5GGQL 1HIML 3O41A 1XXFC 4N2IA 4PJ9D 4L3AA 2BSTA 4XO8A 3O4OB 4NHCL 4ODWA 3BCDA 4MX7B 1X7QA 4QAWA 3S35X 3CFEB 3QIBA 5IG7A 1HH6B 3ULVC 1M53A 1I9RL 1MFVA 4XTNA 3HG1E 4YHLL 3UZAA 3EO9L 3P77B 2G60L 5E00B 3WMSA 5IBTL 3VGHA 1FHGA 1S78D 3V2YA 3N0PB 4Y5VB 2G75A 2XWJA 4N2HA 2JVUA 4A6YL 1F6FB 4JPVL 5DHVH 5DMIL 2DQFB 5IEKA 3QUYD 2LU5A 2GVYA 4FQ1H 4PEEA 3VMOA 3TNMA 1HESA 4LOVA 1UWGH 4NO0B 3KW7A 2MOGA 4Z7VA 2M8XA 2UXVA 4Q6IC 3AJ7A 4Y1SA 3U48A 2ADIA 2APVA 5AAWA 4OCMC 4UYQA 4LLDB 4M1CD 5HHXH 4QRTB 4N0CC 2QZ5A 1JJUA 1LO2L 2ITCA 1H3UA 1TZOA 2ESVB 2V8LA 2NCEA 3Q8BA 3WDJA 5HVHC 2AJXH 1USQA 2YD5A 2BXYA 5FUOL 4PB0H 3QQXA 2XN9E 1GL4B 2CDFB 5D1ZC 4N68A 1HCYA 3DBXA 2M83A 4PJAA 5GS1B 3O4LE 4F8LA 4N2CA 2FGWL 4Y2DD 2ICWB 2DJUA 3CX2A 3ERXA 2H1LM 5DD0H 1VGEL 2F5BH 3AWEA 2BP3A 2VTFA 4FQXD 5EU6D 1G6RA 1L9MA 1F3RB 3P9WB 2DTMH 4U7MA 3RWFA 5MEQB 5CLYA 1MEXH 4A37A 4LSVH 1PJ9A 4E9TA 3CDZB 1ZJBA 4M5ZL 4JFHD 3CDGB 4I0PB 2EUWA 1CFMA 4HUCA 1RL1A 4AV0A 3BESR 4P46A 4ZW3A 2VE6B 4L8CB 3FFCD 4Z7QF 1JERA 4XTOA 2WVSA 5F1IA 2BNRD 2G3XA 4P2RB 2NYKA 1ECZA 2XRAL 4IRSA 4NM8L 3ISYA 1HI6A 4DUWA 4NFBA 5FUOH 3H42L 5C0EA 3E1ZA 1R5VA 2PN5A 3D87B 2G4EA 4PWIA 4CW1B 2QGBA 3MA9L 2CXGA 2XWEA 5L7XL 2VR4A 1HEZB 3F5WB 4JM2B 1KGIA 5CR8A 4QHUA 1PU0A 4J4PA 3MV8A 3IETB 3K72A 4PCSA 1NIAA 3RNQA 1HAUA 3VH8G 3WIFB 4B9CA 3PUCA 5FDWB 2FHCA 3STLA 3DO7B 2OQJB 3KH4A 2C5DC 3MJ9H 4H8WH 3BDYL 4I87A 1EV2E 2ZYRA 2R4SH 1EX0A 3DJTA 1JK9B 3VDCA 1E40A 3P0VH 4U1JB 5DYOB 2JIXA 3WNMA 2XWXA 3QCUL 2CA4A 4W9CC 1IRAY 4PFEA 2WW8A 3DV6A 3OB0K 3DXAD 1SXBA 1QNZH 1E27A 1OAUH 2ZNWA 1DUYA 3SBPA 5G2DA 4J3UA 4Q9CA 3RWEA 2XUWA 1QI5A 3G6AA 1T83A 4EQ2A 1F1DA 2Y00A 32C2A 4OZFB 5IEKB 1KEGL 2HRLA 4OLWL 1OGPA 2PWFA 4APQC 2VR8A 4UZSA 4PLKD 1GU8A 1QSEA 5FIEA 4M6NL 5HHOE 4ODXB 1L7TH 5CF3A 5KVEE 4TV3A 3LKOB 2HN7B 1TJMA 2FO1A 4AT6B 1OTUC 3ZZLA 4GQQA 1OGAA 2ZONA 3OQRA 2X3CA 1T0OA 3WY1A 1P4UA 1X7QB 3BO8B 2BSBA 3H1ZA 5IG7B 3KJ4C 4BSVA 4E41D 4ZFFA 5BVJB 2NMSA 5A43C 5FO9A 5KW9H 1Z9LA 4GAGL 3FUIA 1NTDA 1QRNB 4IK6A 3P30L 3S5LB 5SWSA 1E9OB 3QFDA 3ZTJG 4Z8FH 1R24A 3VXME 1Z32X 2ZUQB 1U8PA 1G6RL 3RGVC 4Z7OE 3R8QA 3CFBB 3MNVA 4NQCD 2X4OA 4LKXB 2RCSH 2OK0L 3TF7C 3HHSA 4RX4D 3QJRB 1A25A 1P7KB 1XL6A 4R9HA 4U2ZA 3FONA 1QFWM 2FWUA 4ZUUB 4DP6X 5HYEA 1E8YA 2OFQA 4G42A 4ACTA 5DURD 1KC5H 2OMTB 4MRCA 4TVPH 4PJHB 3R4RA 1FVEB 3TTSA 1IIKA 5DA0B 1TETH 1OAYL 5CEZH 1P1ZB 1KN2L 5T1DL 1SY6H 2DB8A 2IOIA 5T3XL 2F68X 3X1GA 1TQCB 3P77A 1UWXK 5E00A 4UIKL 4L37A 4X4XB 4YSDA 2ZNXA 1OTSD 5DMKB 2HJFB 4AYFA 3WHXA 5J6HB 5J06A 4P57A 5LGJA 3DX6B 5AHZA 1ZT1B 3GSNH 3HI6H 4L4TB 4PGBA 4ZS6D 5D7JB 2NY0D 1K2DB 5DRXA 1QQDB 3FQUB 3NIFB 3EG9B 1BFOA 2DM2A 3W39B 3WEXB 4IIQA 5LGKA 3QDGD 2CM6A 3LRMA 1PFOA 3PP4H 5E6IA 4B5EA 2YPKB 1O0AA 1A7RH 2D7MA 4BZ2H 4G6FD 1LTXA 4W9FC 3VXOA 5GS3A 1T20A 1ZHLA 4TNGA 1MZZA 4M43L 2UY7B 3AS0A 2OMUB 2Y36H 4LLQA 3UTSD 2CO7A 5AB0A 2PEDA 1WZ1H 1IAOB 5DJ8A 2CIIB 4OGQC 1LO4L 3EZ8A 3HI5L 4HA1A 1ZEAL 2WINB 3S35H 3O45A 5FC9A 1R6VA 2ZWLT 3M45A 4DVBA 1HEJC 5I75C 4OLZH 4N6RA 1RK7A 4YDLC 2Z3FA 1I7TA 4UTBA 4M6MH 2X42A 1U2HA 3ARFA 4PTUB 4X80L 3U6RB 4F7EA 5HDWA 1D3CA 3UJJH 3MRCB 4OQ1A 1AE6H 5CZVL 4QXGH 5FYKL 1ZDQA 2YD9A 4JQVC 3DX4A 2RH0A 3MUGA 1L9NA 4P2OA 3ZHFA 3CFCH 2NNAB 4E9RA 1RXLA 4I9WD 1IGIL 3ULVD 3TTYA 3WFZA 2R0KH 3P1VA 2E27H 3GMNB 3SQOH 1F50A 1QTYT 3QZOA 5CKAA 2OMBA 3JTSA 1QUNB 5DMGC 3Q06A 4URKA 1URIA 2TRYA 2OXGA 4Y2OB 3MRQB 4NNXB 1YAIA 5B1CA 4EUPA 1ED3A 3TV3H 2EIMB 3GSNB 1CTNA 3GXFA 4UQBA 3QDMD 3NCJL 5C0DA 2JK5B 1MHPL 3CU1A 4BKSC 5CN3A 2OZNA 1GYAA 4G11A 1XCQB 4I2XB 4YX2H 2Q86A 1CK0H 4NAMA 1FZJB 1BVLB 1CDHA 5IBUB 3WLBA 4NT6B 2F74A 4APQA 1EZUA 1GMEA 4OZIA 2WSKA 3GS4A 3N91A 1UACH 2AI0L 3O0RH 2XBTA 2DKUA 2YAMA 2WIIA 3C6LD 3NEOA 4K94H 4RZCB 3SDCB 4BFFA 1JIBA 3FRPB 3DSFH 1UH2A 3P0YL 5GZOA 3KCPA 3T1FA 5B7FA 3PBLA 2HT4C 3EDDA 1TZGL 1S9YA 3ALWA 4TM9A 3VWKD 1P6FA 1MCWW 4AZ8B 3V4PL 2NUTB 5ITFB 1SPDA 3WCYA 5D2NE 1V3JA 4AQOA 4QHLB 1QPKA 2XDHA 5E51A 2WSPA 5G28A 1XDTT 2OLDA 4ZK8A 3N1MC 4DN4H 5E5MA 2AV1B 3IS0X 4P23C 3OMAB 4HKZB 1N2RA 4G6JH 2I69A 2ZX7A 3CFKB 3ULAB 5L4MA 3TEYA 3BKJL 5IB1A 1UA6L 5C1MB 2AGJL 3HFFA 1JHLL 4X7DC 4JDVB 5D7HA 3DOIA 3RGHA 2A7BA 4HT1L 4AEHH 5IUSA 2E7CA 1AP2A 2HFFB 4NBYB 2XG5B 1CFSA 4AMJA 3H7BA 4HP5A 3CZFB 4JN2A 3NA9L 3WAKA 3KVQA 1QFWL 3FT0A 2IGFL 3HANA 3OLIA 5HI4D 5D70H 3RVWC 5IHWA 5IY5B 2QV2A 3CXDL 4X50A 1FIGH 2IQAA 3N40F 2IQAB 5CHNB 1J5DA 3TBTA 1GSKA 2Z73A 4L35A 4U31A 1CGVA 2CPCA 2BIPA 2ADGB 4NN7C 1PF3A 2BSEA 5FS5A 3BSHA 4EJ1C 1A6ZA 3BPOC 3ILQD 3GS0A 3PGCB 4NWUL 1DVQA 1F58H 1WD8A 3CE1A 5HDOA 5JHLL 3TJHD 1JPFB 4P46B 4UBDC 3FH7A 1JZEA 4MSWB 1A4KB 3RVVC 5CWSB 2IH1A 3QZLA 3WY2A 3OR6B 1TJGL 3NEXA 4L29A 2UY6B 2Z93A 35C8H 1OCWL 2VUKA 1MHCB 1AH1A 2VMEA 3S4SG 1JD7A 2DQHH 4HHAA 5SWZD 1G7PA 5E5MB 4A55A 3OGOE 4PJDF 3TESA 1RIHH 4UV7L 5HPOA 3O6MH 4JFXB 4GP8B 1K8DB 4G8GB 3O9WB 3EBIA 1WWAX 3TBVB 3RVTC 2ADGA 3T3MB 4H8WC 3BVXA 4G3YL 1XB8A 2PR4H 2WPGA 4GBXA 4WKZA 1VGKB 5AW8B 5AVRB 4K5LA 3H7BB 3VD3A 2CRYA 5F7EL 3GPSA 2GUYA 5TDOA 5D2LB 3T6QC 5EN2B 4LARH 3F8UB 4KZDL 4R4NC 2VW4A 3MTRA 4J39A 3WLBB 2AXHA 3R19A 4R0LA 5JOFA 5KYYB 2XQ0A 3TXAA 1Q72L 4GEIA 4JZJB 3INUH 3L48A 1JFHA 2OP4H 3RLSA 2XN9A 3CFKA 2EABA 4B0MB 3SGKC 5I76B 1AQKL 4MQ7A 2FHBA 2VLLB 4KJYA 1UJ3C 3E3QC 2FT8A 2HAZA 2EIJB 1KACB 4A67A 1CG9A 4P4RA 2ZTBA 3A6OA 4KXZI 3AXHA 2PCPB 1BX2A 5FOBA 3TBYB 3NY8A 5B1KA 5ES4B 2N1KA 2CHZA 3TBWA 2HKFH 3RIAK 3EH5B 5KVMC 1THCA 4OM1H 5ICZA 3BWAB 5AL0A 5KVEL 1XAUA 2Y4SA 1S7TB 4KRNA 4WFHD 3GXUB 4GRLD 4BEZA 2AABH 3LDBC 5CMAB 2VXSL 3VD5A 5FB8B 3C5ZD 3WN6A 4POUB 4JKMA 4YFEA 4BFRA 5IW1A 1AKPA 1INDH 2FX8H 4I4WA 3O41B 2AABL 1E4XL 3GRWA 1XO8A 1MJJA 5HVHB 1D5ZB 2NY2D 1U8KA 3JWDH 2P43B 4GINA 5GZOC 2K3HA 1KB5H 4Z7UA 4CDHA 3U1SH 2R0ZL 3MRCA 2PWDA 5ENWB 1BVLA 1DQKA 1RSYA 3UTWA 5J6SA 4HSCX 2DF3A 1QKOA 4L0PB 2FDBP 1G94A 1S7SA 3I9GH 4WVRA 2YMXL 4KUZL 1CDUA 3HUJF 4LMQI 2WV3A 4MD5B 5E1IA 1E4JA 4RMRA 4U0RB 4IBWA 2Q6WB 5I8CB 4PLKC 4NC1C 1I9IH 3D6GA 5KG9A 5E4IA 1Q5JA 1BG9A 3N55A 5LVEA 1IM3B 4I5BA 5HGHB 25C8L 3VTMA 1Z9MA 2C7FA 1X4ZA 5B6XA 2FCBA 4GQ9L 2A1WL 4X4ZA 1O6TA 5DI8A 5ANMB 1GGYA 1KFGA 4OFPA 3SDCD 2QQKH 4EI5A 3BAYA 4WWPA 1DVZA 3EO0B 3QJSB 1EK3A 1IGJA 2P7TB 2EILB 2V4LA 3TF4A 3NZ8A 5BJTA 2XXFA 3ARSA 2ED6A 3S37L 3WL9A 5FEBA 4WTXA 4E36A 5B34A 3M1BB 5H2BB 4O00A 3MPCA 4NO3A 4RWYL 3B9KC 3U4EB 1BF2A 3HC2A 3TN0D 1DZEA 3LD8C 3EGSA 1RJZB 3FQWA 1ID5I 4LKCA 3LZRA 5E6RB 5C09D 2L7EA 3OZLA 3NJNA 4X6CE 3LSOA 5CZXC 3UPAA 3FONB 1QP1A 4LSTH 2C3XA 4YDJA 2BS9A 3T2OA 4XAWL 2Z7UA 3CZJA 3FOMB 3TP4A 3GIZL 2KMWA 3L45A 5MI0B 3ATFA 4MS8C 3RAJL 4HU8A 1JGIA 3IGAB 5HYJE 1DL7L 2WVVA 2Q10A 4UOJA 2ZOLA 2IDTA 1FNEA 1HH9A 1QRNA 1EERB 2WP3O 1W72L 4KXAA 2VLKD 4YDLB 2EVFA 2EIKB 5LGJB 1NWOA 2ZX8A 4GW1A 4RFEB 1XIWD 2WQAA 4RDBA 4XHQA 5I19H 3KJ6A 2FB4L 1K9TA 4JO1H 5BPPA 1PQZB 1WWWX 1GGCL 1Q38A 5AUMA 4X6EA 4LDEB 1HE7A 1WDAA 2EIZA 2VM4A 1OXYA 3WLWC 4B9JA 4ZNCD 5E4OA 3CLEL 1RK0B 5D1ZD 3G6AB 3SGKA 2W60A 1WHPA 4PW9A 2WUBL 4ELKA 3QEGH 4IOIA 4N90D 1ZVHA 4XP4L 3DWTA 1N64L 3VFVA 3ESPA 1IVLA 2YKLL 2YC1A 2I24N 2I7OA 3SY6A 4MJ4A 1U8PB 3GZOA 3M1OA 3FO9A 2Y2YA 3SEPA 4OLYL 4PJFA 2VJ8A 3FXIC 5HHNA 1DJXA 4FQIL 3MBWA 1OP9A 5F6IC 3FMGL 4IHOA 4J8QA 4ZFFB 4J3XA 3VI3B 3DJSA 4F8TA 4WEEA 3V0HA 1AFVH 1YMMD 4I0CC 3FULA 5IJBC 4C8XA 4JDEA 3E80A 2X87A 4HBQA 3JWNG 3RZEA 1A3LL 3BP4A 3EFOB 2J1WA 3MV9E 4PY7B 4TNFA 2CA3A 3VFSB 1SOSA 4HJSA 1SUJA 5ERWA 1NCBH 3IMWA 5F0LB 2VDPB 3AXLA 4GO6B 1WGVA 3DROB 4ZT1A 5BS0B 4N4WA 4FJZA 4OZGE 4AXWA 3D2UA 1CCZA 2JKWA 4R96B 4IBQA 1GYUA 4OKVB 3PJNA 4IRSB 2YOAA 4YHLH 3NCBB 4X98A 4QOKE 1QA9B 3CGTA 2JE8A 5DD3L 1UYWH 4AQEA 4FCAA 1FAIH 4OUUA 4QTHA 3MRFB 3SDYL 3BYTA 5LG6A 4KK5C 1T1ZA 4KPHL 4AMIA 3QEQA 3P73A 4Z6AT 1YYLL 3WN5C 4HH9A 3V4LA 2X6CA 3NRFA 4S1RH 3RWFB 3CHRA 5JYMA 5DHVB 1FG9C 5KYUB 1XD0A 5CN1A 4N0UA 4NBZB 3UAFA 4AEEA 1K5NA 1LO3L 3OAXA 2Y6TE 2ZWSA 4QXTB 2QSQA 3BKMH 3H0TA 1YY8B 1I3VA 1RFDH 2NLJB 2YOCA 3F5WA 4JM2A 5C9KA 1WIPA 2X2JA 3UC0H 3WGVB 2YRZA 5IMLA 3QXAA 3E9UA 2H2SD 1J0HA 2I9LB 5D72L 3UJTH 1JHKL 4M02A 4LHQB 1TUPA 3OPZL 4PY8J 2APWA 4M7ZC 1JV6A 4QRTA 5K39A 3Q7JA 3T0EA 1F42A 3MOAH 3SBWC 4B5ZA 4Z7QB 4RMWA 1JF6A 4I18A 2KBGA 4ZW8A 3M86A 3V4PA 5C7ZA 1Y1DA 3IJ8A 5AOLA 1BXXA 4ZMVA 3F3HA 3LRHA 3KLLA 5BVPL 2Q5BA 2YAPA 3RTQD 4U1SA 1YMHA 3BAIA 2DLFL 2YWZA 4LLVA 3SDXE 4GSRA 1ETZA 3RP1A 3HR5B 4LMQE 3LKRA 2WVTA 2X0VA 1C3WA 1TF4A 5D1QA 3EZJB 5C6PB 5EU4A 3WN5B 1M6OA 1EEYA 3D39D 4WI2A 4XGZA 3SDAC 1KELH 3SGJA 3WNLA 3JTBA 5BCAA 1MCHA 1T4KA 2GCYA 5K39B 1MAML 4GRWH 4MB3A 4L8DB 3GUTA 2GSGA 3VSVA 1AVAA 1D7CA 3EIFA 1IKNA 3NK3A 4RSVA 5F1SA 4A2GA 4ISVB 4ZUVB 1ZLEA 2VAJA 4DAGL 4GAYB 3KEHA 3O8XA 3CFJB 5IIEA 1T6VN 5DRNA 2FUTA 3NT0A 5C08B 3NTCL 5KVDH 1BVNT 15C8L 3N9GH 3Q13A 1HZLA 4OLUH 4G6KH 3CZKA 1IQWH 1CPUA 3KBFA 3QUYC 4NUPA 1IQWL 1S7QB 3QFJA 1PS3A 2GJ6B 3NJIA 1ZCRA 3GBLA 5DVOA 1BQKA 3UBXG 1IZKA 1ZDSA 3VG0H 5J12C 3H9SB 4I7ZC 5CILL 1T0MA 1F2QA 4DGYH 5D55A 5CUSL 1PAMA 4LSPL 1EJFA 4A63A 4M8QB 4HWEL 2LFEA 2EXTA 3TCTA 4XPHH 4N2DA 2WQXA 2VO5A 2G4GA 1L7TL 3CFEA 1NBQA 3D05A 3DMMD 2UUDH 3QIBB 4JE0A 4O5LL 4ODWB 4OZHA 4QXGL 4WI8A 1P7QB 5J1SC 4Q6IB 3CMOH 3D25A 1JN6A 5IGXH 2BOCB 4QXWA 1OCRB 1IGMH 3HIZA 5GSVA 2X2HA 4OD3H 5JIKA 5B8CA 2PKDA 3UAAA 2GJZB 3D3VA 3NQKA 5C0CB 2IWFA 3ZMNA 2Q76B 1MN4A 1T1YB 2DQEL 2YZ1A 3QIWC 4WNQA 4PJXA 4WW2A 5GGUA 5IJCC 3K71B 1I1YB 3QI9C 4GAFB 4AYGA 1ACXA 3ROLA 3BKCL 4NPYA 2QMJA 1PXRA 1KNOA 3N42F 1NEZB 3MRGA 5HYSG 2WTPA 2IH3B 1PZBA 4LHJB 4NKOB 4S1SL 4D9RE 1X5IA 4NQXA 2I9TB 4X7FC 3WXVH 2E75C 2CKBB 3F6JA 2Z91A 4JFEB 1AI1H 4UT9H 2GY7B 4RZKA 1A1MB 1IM9B 1B0RA 1VFUA 4K7FA 1CK0L 4GSDL 2EIBA 3ESVF 1E4KC 1YEKL 5EBMA 4E5XG 2DLGA 3WI9A 3ZUNC 2FQEA 2G9HB 1F1GA 1TZIA 1G7JA 2H6UA 4K8RH 2XVKA 2YEQA 3GF8A 3CCHB 3DURA 5L6YH 1TQWA 5A40E 1JTTA 4EAEA 1FZMA 2K9FB 3ML9A 4Z7NE 2XX1A 3QT2A 4F7TB 1BFVH 4IEFA 2FSEB 1DANT 4KAQL 1E9PB 1FZKA 1KN2H 1IGTA 1MW2A 4XP5H 3SCMC 1NCWL 4QWWC 5E2VH 2XC8A 4KAQH 3TWYA 3D12B 3MRDA 3DIFB 4A38A 2B16A 4YO0A 1CS6A 2RALA 1CQKA 2ZUXA 1C08B 1G0YR 5ANHA 1CT8A 3WNJA 1OOWA 4YHML 2P5WD 3CZGA 4FXGC 4K3JH 5JHBA 4UHRA 3IVKB 4MMXA 3E6HA 3RU8H 3QI9B 2X4QA 4JFTA 1BM3L 1J18A 3RIFK 4HOMA 1KG0A 4JE4B 4EZMA 4NBXB 4Y9FA 4KQ3L 4LAJH 3F7YA 4TTDD 4FA7B 2YUWA 1KB5A 4KJPC 2BOBB 3V6ZA 4IYKA 3D3VE 4N8PA 2MTAA 3L4UA 5JW4M 3BUTA 3T1WA 1U3YA 3X3CA 3U0PA 3F7VA 5C0BA 1CYWA 3ARGD 4OI8A 2ILLA 3L3OA 3N6YA 3U46A 3CFNA 4GS7B 5KVGE 5C0IA 2OBGA 2XXCB 5JR1L 3U7AA 5EF3A 2TAAA 3P3RA 2UZYB 4P9MH 5DHEA 4M1GH 1PKQB 2XQYK 4JFHE 3GNMH 1AQDB 4XVJH 1ZK9A 2FR4B 5IROC 5IGXL 1N59A 2XIIA 2VZOA 2J43A 3KD4A 4FXKB 5I1JH 4WW3A 4PGCA 3ZSTA 3BVWA 4IIZA 1PIGA 4ZFGH 1ODAA 2V7HB 4JK0D 1X7SA 2AF2A 3D25B 1OAQH 3K6SA 3QFJE 4LSRH 4ODBD 1EFQA 4ZODA 5C8JB 3PXOA 1JWMB 4JO1L 3AMKA 1KMGA 3MROA 4FXGB 4J3OF 4Z7OF 3IMVA 5IOKA 4XBMA 4G5ZL 5K59E 1IL1A 4GRLC 4X7EC 2J56A 4JFVA 5MP6H 1R0AL 4KKPA 5EPMA 2BP8A 1G6VK 5E1QA 2WBJC 1DQJA 5ESAB 3RQ3A 2HZHA 4V1DE 1S7QA 3BKYH 2FEJA 4Z3IA 2EDMA 5KWYC 3QAZC 4WK2B 4O02H 3ZK0A 5IWLC 2IWKA 1GW6A 1L6PA 4ZUWB 1COBA 3DVGB 3JVGA 1XR8B 2OL3B 1SYSB 4FNRA 1RUKH 4ZQKB 4AQ8A 3A4DA 5HI3D 1LJMA 1Q5IA 3KZ8A 2RGSA 2J2ZB 1AJ7H 1I8LA 4H2AA 4LSTL 1MFBH 4NZRL 3ZKSD 2Q3ZA 5DU7A 3PFUA 4HULB 5K9OA 2C7UA 4HWBH 2GUOB 1J0YA 1NCWH 1UB6A 3INOA 4ZXBB 5IESL 2XTLA 1DBKL 4I3SL 3VE0A 1BFTA 3HC0B 1MG2C 1R3IL 5DZJA 1J88A 2GB2A 1MDTA 2NY4C 4KXDA 4R7VA 4WFFD 1HKFA 5I6XB 3QHZL 3TH2T 4Z5RB 1X0SA 5DF0A 3KGTA 3TN0C 1PSKH 1QBBA 1YEGL 3RE0A 5BV7H 4DP4X 3PAVA 4PSRA 1MNNA 1QTPA 4HUWB 1V7NH 4TSCH 2X1XR 5EU5B 4DFHA 2B8OT 2G3NA 4W68A 3EYSH 3SO3C 2VDQH 4Q58C 4J3VA 5FYLH 2AQPA 4P3WA 4RFNB 2DLIA 2BNUA 1HKLL 4R0LB 3NCYS 1Z0NA 1SN5A 1YNLL 2PTTB 5I30H 2PTTA 4HLZG 1PG7H 3J8F7 3KL0A 1AIZA 3L16A 3IJYB 1LK3L 5CO1A 2VLKA 4K8RD 5I0VA 2XWTA 4PS7A 2PWHA 4RBPH 1NBZA 3QUXC 1ACZA 2JB6A 1TQCC 4XN2A 4HUVA 3D30A 3GK8H 3ILPB 4GY4A 2NOYA 4X0KA 4HUWA 5D71H 1XD1A 4WSKA 1RFDL 2WGNB 4XVTH 3HPLA 1CYGA 5T1KA 3D4SA 1C1EL 1E5UI 3IU4L 4NEHB 4HYTB 3PWUB 1O6SA 5FW6A 1RIHL 3FHEA 4UV7H 1YEHH 4GMSH 4J1UA 1HL4A 1W0VB 4ZUTB 2FJGB 3SPIA 4EBQL 4DCQA 4IS6A 3NCMA 4G6AC 5D1XA 2GBTA 2WLKA 2HFEB 1TJGH 2G60H 4GRWE 1KC5L 3DYPA 1HDMA 1G9NC 3ISWA 3CVHL 1Z1WA 3K6SB 1A4KA 4AWJC 3DYMA 1FFOB 1BXVA 1VFBB 1J8RA 3DVIA 3MGOB 3QDGE 4RMUA 2CLZA 2DMCA 4W6XB 2DEYX 5F9OL 2X9YA 1JZFA 3BRFA 2UWEA 1NLBL 1EDHA 2DTML 3HKFA 1DN2A 1N0LB 1ADQH 4QO1B 1UCQA 4IMKA 3G9AB 4UT9L 1DJYA 5ACLA 1Q94B 3DUUA 5I5IA 5SWQB 2QEJA 4PJFE 1DQJB 4FI8A 5ESAA 1W8NA 2R1YA 2RQEA 1YEKH 4NAJA 5JHLA 4PWGA 3IFPA 2NXYD 4N2MA 4YFDB 3W0WB 4YHYC 4A04A 4R5VA 4DP1X 5D6CA 4F2EA 3UO1L 1U95B 3GHEL 3NP3A 4G7QB 1NGQL 2H41A 2IBGA 3VYNA 4PJ6A 5FV2A 4RAHA 3GSQA 4W1TA 2EJ1A 3RA7H 3BLKA 3RWJA 2Q86B 3N04A 1LO0L 3ECVA 1EHLL 5DRWB 3BKCH 4S1QH 4XH2B 4JHBA 5EMYA 1OAZL 4ENED 4LRNL 1RZ7H 2KLRA 4TTDC 2Z64C 4WUUA 1PKOA 3ZMEA 3VXUB 2AQSA 5DVLA 2NX5D 5F88B 1NC2A 4DP9X 1E4XH 1NDGA 2VW6A 4GBXC 1WGOA 1AC0A 2VN3A 4IKIA 1H3PH 4M7KH 4KNFA 2J55A 4FG6C 4MAYC 4YK4B 5DLMH 4Y2NA 1GGCH 5KVFH 5T1LD 5C6WH 2K8MA 2BNQB 1SMAA 3QEHA 1CFQB 1UB5A 2VC2B 1WG3A 4GW4A 4KTYA 5AUMB 4PJCA 4WDIA 2HH0H 2CGRH 1X5MA 2FX7L 3WFHA 2P24B 4ZO6A 3QIWB 2JFCA 1B2WL 3RHWF 3G6JB 3D9AH 3WJJC 2ICCA 1AQ8A 5CZVH 4HOXA 2AQQA 2NSMA 4L4TD 1YPZF 4PJ7E 1BEYH 4HMDA 4KI5D 1QBAA 3MBED 4F58L 3FQTA 4EKJA 3OBAA 4XPGL 4M3KB 3OKNA 1L9PA 2X4QB 4KUCD 2XOTA 5E95B 2IPKA 4X4YA 4X4YB 5F7HA 1JF1A 1HJBC 3GQFA 4OFYD 4YNYA 5ISZB 3V4UL 3X1EA 2ID5A 5CZXD 5J7CC 4Z23A 3PNWA 4MXVE 2UY7A 1AGCA 5IOPA 3S36L 5FOJA 5IEHB 4G8AC 3RVWD 2V2XB 2AJUL 2WNXA 3ARQA 3A0OA 3QARA 3O81A 4P5KB 3VRIA 5G4OA 1NMAH 4JFUA 2GJZA 3D3VB 1G9HA 1RJZA 2BP0A 4GBXD 1U4EA 4C58B 4EMZA 1UH3A 3SDAD 1TQBC 3RUGA 4UQAA 4LHUG 4ZMPA 4HPOL 7CGTA 3ZPQA 2NNRA 2JF1A 1GJUA 5HYJB 4KFZC 1F3DJ 2DM4A 3RZCD 4HCIA 5F0MB 3FUNA 2F18A 1GGBH 4HUMB 4PG2C 3SOBH 4XCNA 4RGOL 4DGUA 1MH5B 2IV9A 3KYKH 3QO0A 4LCWB 3RA7L 1I8IA 4HWEH 3LPGA 1B0RB 4HGKC 1JGVL 4X42A 1WVZA 4XPFH 4BFEA 5BQ7B 4G1EA 1LWJA 4I77H 4RETB 4G70B 5GRYA 5HHXL 2Z6FA 1H5BB 3CXFA 3QXVA 2WK2A 3VA6A 5IVOA 2BIMA 4DPBX 4UG2A 1W0WB 3Q2LA 4OCXL 3ZHKA 5LQBH 2XZZA 1HHIA 3KYOA 2VQTA 2MCG1 4OB5L 3RL2A 1KXQE 3WEXA 5F7LB 3EJYD 4U2YA 4XRCB 1EUUA 1QFWH 4TQIA 4ORZC 5ETUB 4H0LC 3D2TA 5DEFA 4XCEB 2QGDA 3B3IA 2O6PA 2MH4A 1SMDA 3BP7B 2YGOA 3N1QC 4JQIA 3AXIA 1U8CB 3LN9A 2OW6A 2K1MA 4AOFA 3CLEH 3QQ3B 5J13C 4YDNA 1DJGA 1BOYA 4ZTOH 4LEXH 1FC2D 3PHQB 5DMKA 3C5ZC 1T4KB 3SPVA 3GUTB 4L37B 5AVUB 5H8DA 3VHZA 2RFXB 3FT4B 5CEZL 4LPCA 3VD7A 4YSQA 3MV8D 5CBAB 5HSFA 3K6OA 3OXSB 2YWYA 4YUEL 3TH3T 3RTQA 4DFIA 3AFLA 4HZAA 3LH8A 5EO9A 1FBBA 2EUXA 4ZUUA 2F7OA 4HV8B 4XOCA 5LBGA 1ZA3B 3ZL1A 1BJ1J 4KK9D 2PYED 5AWNH 3SDXF 4X7TB 3U7YL 1MCFA 1WTLA 3FT9A 4LVHB 5FV1L 3ZDYE 4APQD 7FABL 3WXWH 2BNRA 1WV7T 4FFZH 5MENB 3WTVA 5JTWA 3BGMB 3CC5B 3P0GB 2JIXD 4EO5A 2NY1B 1NINA 4C4KT 4PV9A 3T0ED 2JQMA 4YPGB 4NJAH 1EHAA 3N43B 4M00A 4MQ7B 1PDKA 5SWSB 1WT5C 1M0MA 3UERA 1INQB 1JV5B 2VDNL 2NCMA 4Z3FA 1EXHA 3R18A 4ZUVA 1D9KC 2WJLA 2AXGA 5AW5B 2VLKB 5B6WA 1QNIA 4M9PA 1AFVL 5AB9A 4TPRH 1VESA 3LNHA 2DLTA 1UXWA 2NSQA 3EYSL 5A2CA 2BFVL 2GBUA 2ED9A 3GMQA 3MJGX 2BVQB 5DJZA 5EU4B 3VGEA 4MD4A 2GJ6E 4IOSA 4RMVA 4F9LC 5D93C 5JPMA 1URLA 4Y16D 4ONHA 1KPRA 4EE2A 4XP1H 5LHDA 3K2UH 4IU3B 2WN3A 1UCBL 3LRSA 2IANE 3ZHLA 4U1KB 4JFDD 5CEXA 1MI5E 3PIQB 1N6QL 4FHJA 4HX1B 3MLSH 5D7KE 4JFZL 4Q9QL 4HWBL 1IGIH 1H3XA 5A45A 4ZTEA 1A4JB 1LP9A 4ZS6C 3PCYA 4A66A 1QR1B 4V2BA 1S9XA 4M1DL 1W72H 4YGVB 3ZDWA 2OMWA 4CA4A 5C7XH 1G7HA 2KS9A 4JN1L 1C9SA 5K9OB 2VH5L 2BHUA 2ZYHA 5CWSA 2VWEC 3Q8EA 1WP6A 1WYJA 3L9YA 1U8HB 5IREA 4TOYH 5D72H 3Q01A 3DJRA 3UABA 3UJTL 5KBKA 1Y6MR 2EIDA 4OIIL 1HWGB 4PH8A 3F12B 3V9FA 4MMYB 1I1AB 4KMLB 5LBVA 4CUCA 2DWXA 4P5RA 4ZW5A 2WBJD 4YIQB 2R0LL 2X89A 4JG0H 4QUOA 2CDFA 5L8JB 2DRUA 4M62L 1AQHA 3EJCA 3OG6B 3QWRA 3X3BA 2B08A 1ZVYA 4MKMA 1YC8A 3AACA 2Z0UA 3VWJC 4CW1A 3CSPA 2DQJH 1LNUB 3HVNA 3MJWA 4P5MA 1PD1A 3TU6A 4MHHG 2AEIT 2CBPA 1HI6B 2J88L 3SZKC 2IMNA 1R0AH 2KZKA 2AJVL 3KNBB 4QTHB 3G08B 3MCG1 3KJ6L 4XC1L 1FO0A 1W80A 4JY5H 2I85A 4DQOL 1A7NH 3AWFA 4AGOA 3LPPA 3PJSA 4N0CD 4IJ3C 2N59A 4XB8A 1FNSH 1AO7E 2EXWD 5AYUH 1BLIA 1XSKA 3LRSB 1OZUA 5IVXE 2WWMC 2OR7A 1A65A 5IQ9A 5L0QC 4NO5B 2VQ4A 3L5XH 2HVKA 1MQKH 1N67A 2ICWA 3VG9C 4NNYA 2F93A 1A4BA 3ZQWA 2Y7NA 5KEZA 3HTLX 4LPWA 2V2TB 2ISDA 2AK1L 5EUKA 2YSTA 2OMXB 3IJHA 3MOBH 4P9HH 6FABH 4M6AA 3N85H 2XTSA 5IW6A 4ANXA 1M7DB 3L3OB 4GRWB 4GMTH 2FZ3A 4JR9L 1N4XH 4KJPD 3K8LA 1S7VA 1PDKB 3SBWA 3VCLA 2YUZA 4OJYA 4LL1A 3V6BR 4LXFA 1C5DB 2NR6D 5C07E 2CG9X 3FTUA 3DX9B 4XMKH 5DD6A 4KZEL 4K2UL 4WW2F 3K5SA 4K71B 2OSLB 1MCOL 4QI3A 1F97A 2UZXA 1ZA3A 3HZVA 3O6LH 1OAXH 1I8KA 3BP6B 2PYFA 4JJHA 3SPCA 5DMIH 2AANA 2GITB 5GRUH 3K4DA 1MWAH 3FUJA 3UBHA 3RTQB 3DIDA 5IT2H 2QV4A 3LCYA 1BBDL 4QHKJ 3O9WD 5IBLC 4TLUA 3U9WA 1K3ZA 4QRPD 2H45A 1H8SA 1IKNC 2HA1A 1QUNA 2BIOA 1S5HB 1ZPLA 5C07A 1AS7A 3G5VA 4JQIH 2CO4A 3EJYC 1ZXKA 1E9PA 1FZKB 2DQTL 1L9RA 2YAOA 4AYSA 1RKRA 1X9QA 3RNKB 1U8JA 3S36H 4IRZL 5KSBF 4XOBA 3IRCA 4WHTA 4WO4B 4U4BA 3SPHA 3COOA 2ARJQ 1KENL 3HI1A 2VZVA 3VFOB 1YPZA 3WFDH 2JCCE 4KHTH 1MJ8L 1PZ2A 5D70L 2ZQKA 4W81A 1VCAA 2HUHA 2NT1A 4HH8A 1KGCD 1M1XB 3CHPA 4YEEA 3B3BA 2EYTB 3TNNA 3ETSA 3OWRA 4ZFOA 3IJ7A 2PTVA 2TRHA 3IYLW 4OZIE 3FZUC 1AI1L 1FORL 4JFDB 4IBUA 4TMPA 1MFEL 3FO1A 1FGVL 3REWA 4ZMZA 3NIFF 3FQNB 5LUMA 2E3VA 4MS6A 1IC7L 4PJGB 3BWUF 3SDDB 2XKNA 3OJVC 1LO5B 1XH2A 4NYLB 4AMKL 5A44A 4KI1A 5B6YA 3N42B 1Q9KA 4DEWA 5D8JH 1ONQA 1GJWA 3FFCE 3N1GC 2AEPH 4YHZH 5JIQA 4H1LA 3P9LB 4PGDB 1ZAGA 3H42H 1YEGH 4H8UA 3RWDA 5GS0D 4GUPB 2LOEA 3NIGF 3IDNA 1GS8A 2VKWA 3FBQA 3TT1H 3JZYA 3VXPB 1MWAB 5KVGH 4X2UA 2Y3AA 2VXSH 4KWUA 1RMFH 2E56A 3V5HA 3EYVA 5FECB 3WEOA 4O58L 5TPWL 3LYRA 1ROCA 3PDSA 1GIGH 4GQ9H 1UYWL 5CD3A 3QUHA 4WO4C 4C56B 3VXMA 2ZP9A 4ZMLA 4FE9A 5KYNA 1SDYA 4R90H 2UZIH 3GRWL 4GRWF 4MDJA 4MJ6A 4DGYL 1QKZL 3HE6C 2CD0A 4U1LB 2VERN 1LWHA 5CR1A 2G5BA 3M46A 3QJHA 4F93B 1H8NA 4KK6C 5CCGE 3QJVB 3GMRB 5GSRA 4DIXA 4UT6H 1N19A 4M8VA 2OP4L 3N44F 4JFPB 4B41A 2MOVA 5DJDB 3UAEA 1SNRA 1DE4A 1NQBA 1OE3A 1B2WH 1X5AA 5HI4C 1DJHA 2I07A 4JKPL 3MRMA 3SGEH 3T09A 3MKKA 2DQGL 4WY7H 3H4FA 2LFGA 2Y1YA 5D1ZB 2XTJC 5D1ZI 1QBML 1SXSA 3NPSB 4RDQF 5AYQA 1PLBA 3QQDA 3OJDB 3B83A 4LCVA 3KGUA 3CVHH 4KRMB 1IU1A 4M6NH 1AGBB 2A9ML 3EJUA 1M6OB 3L5IA 3ZDZB 5DEZA 2ZKHL 1UM5L 4W9HC 1BM7A 4H0IA 2VW7A 3GO1H 4E41B 2WYZA 1XZ0A 4KKZA 5BO1H 4WUUB 5JJJA 3HBZA 4B0MM 3WEBA 2WXNA 5IJVA 1FNHA 1F5WA 4NO5A 4JR8A 4Q9BA 2YMOA 4E41E 3WMPA 5BVPH 3DSFL 2YFNA 1BPVA 2BFGA 3JQOB 4B3EA 4EI5D 2DJSA 3L3JB 5JIPA 2HMIC 1QEWA 4FQCL 2IH1B 3NFPA 3I9IA 1ZE3C 3SE8L 5DEGA 5DK2A 5I74B 2EE2A 1QFOA 3FTSA 3U6XA 5I8OL 4RIRA 4TLSA 5EBWB 8FABB 4U6TA 3K91A 1J5HA 1OGTA 4XBPA 5F7EH 4MJ5A 4P3CL 3AQDA 2F1AA 2X88A 3O3AA 4H88L 1UM6L 2WXLA 4NQDD 3TBSB 4BSWB 4DPAX 4UTAL 4TL4A 3TIDA 4PJFF 2K6YA 3S5ZA 3UAJA 1CBVL 1JZ5A 2DD8H 1OSZA 1YSOA 3FSWA 3MNDA 4XP4H 1RZ8A 4G6KL 1R3LA 3V9CA 5IQMA 4ALAH 4HIJB 1YVLA 3CZFA 4ZAKD 4NHUB 5B38A 2DWTA 1OW0A 4CN1A 1UZGA 3G3LA 4MCZB 1SLWA 4ZDHA 1SJEB 5KJ7E 4OIIH 2NY0B 1FFOA 2DJ4A 2LLGA 2AQTA 3QBLA 3S34L 3MLUH 3V9EA 3KL5A 4JREC 3ORJA 4JFWA 1U93B 4L9DA 5KBPA 1FO0H 1U93A 2D3VA 3GDBA 4HCRL 1OE1A 1NC2D 4JCMA 4IS6B 3K6IA 4NZTL 3GXNA 3SYOA 5KYWA 4BHUA 4HW6A 2WUCL 1H8LA 2D7TL 5DHYA 1CXEA 4G7VL 4TYUA 3FB5A 3V10A 4I0PA 1RZKH 4LSQH 5C0CE 3MV7D 3QWNA 1JHTB 1ZVSA 5J9PA 1RIVL 3PWJB 1NA8A 3CXDH 5IB3B 5DURB 3PLYA 5TE7H 1WBXB 4QHMA 3MX0A 4R97B 1FVDA 2H0EA 2C3GA 4LCIH 4FNTA 4LVNB 1G5GA 3ZO0A 2CLVB 1I8LC 4MD4B 3TA4D 5B2NA 3C60A 1FP5A 1QRKA 4LQFL 3LB6C 4TTGA 3AT9A 2F74B 4OZIB 1XF5A 1IC4L 1BJMA 2EDYA 5E99L 2NY7H 4QXVA 3UZEA 1INQA 4MXQD 1JGDB 4MAZA 4FHKA 4PJFB 3KHOA 1E6OH 4S2SB 2C4FT 4NGHH 4PJ5A 1U2YA 3BEWA 2DICA 3RBSA 5TDPA 3G6DH 2ADIB 3ZE0F 2NQ3A 2V17L 3D39B 1KTLA 3A47A 1D7DA 1I8AA 3ARWA 3ZKXC 1KXVA 2RACA 5DT1H 3H85A 1ZA6A 2F7RA 3HZMB 3MRKB 2DI7A 2NY1C 4PP1D 5K59F 3VE0B 1RK0A 4MNHA 5IHZB 3DRTA 1YEEH 1FCCA 2OTUA 1I3GL 4FQ2L 4J12A 1JUFB 1S5IH 4UM9D 1FAIL 4XWOD 5BRZD 1I82A 4F2MB 1B4JH 1HL8A 3TCLA 3BIBX 4PY8I 1A14H 3VXNB 1RUKL 3NJLA 3Q6GL 3KPRB 3IDJB 4NM4L 5FYLE 3WFCL 1TZHA 2FYYA 2MWCA 1YLBB 4PRHD 4RNRA 1CF1A 4BH8A 4RISL 4HKBB 2WD0A 2ZXAA 1Q0YH 1H0DB 3MLZL 3VGDA 3RFZC 4OF7A 3QNYA 3GIZH 4FG2A 3HMWL 1S7RB 4RFOH 5JPNC 3WNIA 5I1DA 3WIAA 4L8SC 4WHYG 3F05A 4MB4A 1RLBA 3EADA 3C09B 1E7UA 3HNSH 3KYNA 2VH5H 2V3FA 1J8SA 1PG7W 2Y36L 2YD3A 3QZNA 5IQ7H 3ES6A 5LQBL 3MROB 3IFNL 1J87A 3V8CA 3IAGC 1A3RL 4BA0A 5F3BA 2VXUL 3FRPG 2X1QA 3D85B 3GMNA 4MJJA 2CNZA 4Z76A 4L3EB 1BFOB 1R3KA 2Q2LA 3JT0A 1OTTD 3L4CA 4BZ1L 1JBJA 3VD2A 1CQYA 4CNIB 3VFTA 2IOMA 2NXZC 2VISA 3RWDB 1SOXA 2A9BA 2ZD0A 3U4EA 1KUMA 5AG8A 5DO8A 2OZ4H 3FCGA 2P9RA 4NNPL 4OCWL 4CU8A 4G7SB 5B0WA 4XBGB 2YA0A 4YOKA 5FYKH 4X7SH 5CEYA 4PTUA 2HJFA 5GISH 3GFUA 5I15H 2K9UA 2CALA 2R69L 2V2WB 1AO7B 3W37A 4EZLA 1ORSB 3QAZB 2VN4A 2FUQA 3K2KA 3H9HB 4MVBD 1UKQA 2OYLA 5IV2A 3NZUA 3ARPA 4LVOB 3SQBB 2V5TA 5IP4A 1MFCH 4YPJA 2XACC 4F7PB 4NWTH 4Z7WF 2YPKA 1MJUH 2QHRL 4J6RL 4UOW0 2EVHA 2JLLA 1KENH 1HSBB 4AIXA 4B50A 1JL8A 4QEGA