4G7QB

Structure of recombinant cytochrome ba3 oxidase mutant v236l from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant V236L from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4g7qB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4g7qB02
1IW9A 1P8IA 3RZEA 3NJIA 2FT8A 2Y02A 5H2PA 5D4HA 3NS0A 4QIDA 2I1XA 3COCA 5F7BA 3TASA 1CURA 1KV7A 2VMJA 3WG7B 2VT4A 1FWXA 2KSAA 1AS7A 1RCYA 3MBWB 3OMNB 1OE3A 3WKQA 2RACA 4W9ZA 4BDVA 2Z55A 2YDVA 2DYRB 4LDLA 2VSMB 3OE6A 1CUOA 1XMEB 1NIBA 5B35A 4AKPA 4YVNA 2PPFA 3CVDA 3PAUA 3QJTB 5B1JC 4E9VA 5ETZA 1UATA 2X88A 4PCYA 1UCQA 4BWUA 5B7MA 1WA2X 3QBGA 3EH4B 3AZUA 3MX0B 1T5KA 3KW7A 4DP0X 5F8UA 1IBZA 4EA3A 1VLXA 2GC4C 5H2KA 3IEAA 5I26A 1PLBA 4E9TA 3X1GA 1FBKA 4ZK8A 4YL4A 1X0I1 1I53A 1QHQA 1TN0A 4UAHA 4MBSA 1F4ZA 1KGYE 1CWQA 2Y04A 5B1KA 2NRDA 2XV0A 3OD3A 2X72A 5DHHA 5G54A 4Q8BA 3UTVA 4HWLA 3AM6A 1BXUA 2BP8A 3VVKA 3ZPQA 1CC3A 5AZUA 2TSAA 3BVDB 3PWHA 1VGOA 3X1EA 1JXGA 2X87A 1W6WA 4IB4A 2EINB 3KJ6A 2OJ1A 4KNTA 2WJLA 2XWZA 6PAZA 1JV6A 5J7AA 1P8HA 1F50A 4BVNA 3OE8A 3G5WA 5B6WA 1JZFA 5TGZA 2IDQA 4AKOA 1R1CA 1ZV2A 1IXFA 4L0PB 3SBRA 1L9HA 2UX6A 1NINA 1V10A 2IWEA 3V9EA 2QPEB 1E12A 1PAZA 2FQEA 4G72B 1C8RA 4HHGA 1L9OA 2B3IA 4Q89A 1NIEA 2CAKA 4TXVB 3SBPA 1PLAA 2WO3B 1A65A 4XT1A 5B34A 4AMIA 2YAEA 1J5DA 4AI7A 4YSSA 4HYXA 3SBQA 4DP9X 2N0MA 1M9WA 4YSQA 3PDSA 2TSBA 2CCWA 1TEFA 1GY2A 1OV8A 2KSBA 1QKPA 4UHRA 3ZIYA 3ASNB 6PCYA 3QBKA 3MBVA 5DYSA 3IBOA 1E0PA 4IAQA 1S54A 1NTDA 1ILUA 1BM1A 2GIMA 5B1AB 1FA4A 2UXTA 1BXAA 3NJHA 1ASOA 1ZIAA 2YCWA 1BXVA 1AAJA 4F7KA 1JERA 3QAPA 3CAPA 3S3DB 4F2EA 1L9TA 4PXKA 2YAHA 2XUWA 4BWBA 4GBRA 4KNFA 1E65A 1SDDA 1JVOA 2J55A 4WAVA 4L35A 4DJHA 1E30A 3NJJA 4WTQA 3ABMB 1AACA 4BXSV 1AT9A 1A4AA 1IKOP 2FT7A 1R84A 4KO6A 4QI1A 2AFNA 3HEIB 4M3HA 4BUOA 2FQGA 2CUAA 2YAFA 4E9WA 1GY1A 2AZAA 4KO5A 4YSEA 3T6XA 1GS8A 1F56A 2NTUA 3WQJA 3X1BA 1BRDA 2DY2A 2Y1AA 3T9WA 3SN6R 1J9TA 3ZEVA 2HLEB 4DP7X 4PAZA 4XT3A 3PXLA 3QQXA 2JAGA 1RKRA 5BR5A 2FJSA 3UADA 1X9RA 4AKQA 4QRYA 2I21A 3X3BA 1W6LA 3UZAA 2GHZA 3VGAA 2XX0A 5ITCA 4DKLA 1BQKA 2RH1A 1EZLA 1V55B 2YXWA 3AG2B 2FQFA 4P5RA 5I6OA 3AG1B 4XXJA 1DZEA 1PMYA 4BDVB 1AZCA 1SF5A 3KW8A 3NSCA 3NSFA 1CYXA 4E9SA 1O0AA 1JVLA 4A2GA 4A67A 5AFAA 4LDOA 3QJVB 2PP7A 3VW7A 1DZ0A 3IN0A 3UACA 3ZBMA 1L9PA 4GP4B 2Y00A 1JV7A 5H2LA 1AZUA 2AZUA 2YDOA 1PXRA 4HHWA 5G28A 1GSKA 5B7FA 1M0LA 2UXVA 2YCYA 1PZBA 5DHGA 4TL3A 3NY8A 3UONA 1A4CA 3ABLB 3EHBB 4KO9A 1SHXA 2DWTA 2HX9A 1HAUA 4BWTA 5I5IA 1J5CA 3U25A 1TKWA 2OCCB 4FA7B 1AZRA 1E5ZA 1KGBA 5H2HA 1S51A 4IARA 3NJKA 3OQRA 3HB3B 2ZIYA 3PBLA 2XV2A 2UXFA 1JXFA 4G7SB 2BP8B 2HRGA 2Z73A 1QNIA 5TK2A 4X32A 2FQDA 5B6ZA 1AR1B 2L6XA 3NSYA 3CVBA 3QDCA 5FJGA 4KOBA 3FSAA 1H68A 4YSPA 2JFCA 1AG0A 8PAZA 4DPCX 3QAKA 4PXFA 4EJ4A 2HZHA 5AHZA 2BW4A 2CALA 4Y9HA 1TEGA 1OE1A 4YSUA 2HPYA 2FNWA 4JKVA 3T6WA 4ENZA 3FQ1A 1BYPA 1KG8A 4JHVA 3X1NA 1X9UA 2YQBA 2H3XC 3FSWA 1C3WA 1TN5A 4MD2A 4A4MA 4HZ1A 3CZUB 1X0K1 4L6RA 2YARA 4E9YA 2AT9A 3DIVA 2AVFA 2EIJB 4OV0A 2GBAA 1DYZA 4KOCA 4A2DA 3V9CA 7PCYA 1PF3A 3T6VA 4JR8A 3RFMA 2PCFA 3FSZA 3PAZA 3EH3B 3C9MA 4X1HA 5H2OA 1ASPA 1SNRA 4LDEA 2YAPA 5PAZA 2CBPA 2B08A 2JKWA 5PCYA 1KDIA 1GS6X 1SDDB 3REYA 3AW5A 1PCSA 7PAZA 3OE0A 3NP4A 1AZNA 1PY6A 5KKHA 3SQRA 2HXAA 2BHFA 3FU8A 2PLTA 5AX0A 1L9RA 3S8GB 1WS8A 1BQRA 1KYAA 2F95A 4HYJA 5G2DA 4BEZA 2GC7C 3C9LA 5AWZA 4E9QA 3CDZA 4RH4A 4XTNA 3GYRA 5B0WA 1JGJA 4A2HA 3D4SA 3WNIA 5JJEA 1L9QA 2J57A 2Q9OA 2IWKA 1P8UA 1BEXA 4M4RB 5TK4A 3ABWA 5B6VA 3FU7B 5B3SB 1AANA 5I6KA 2FWLB 4E9RA 5ANHA 4N4YB 1S8JA 1MGYA 3UTYA 1OCRB 2VM4A 5AKRA 2PPEA 3TBCA 2VSKB 1U19A 2FTAA 1HFUA 3OM3B 4KNSA 3NY9A 3ZX1A 2EILB 2IDFA 2J5WA 2OV0A 5B1JA 3NJLA 4YSDA 5BR2A 2PCYA 4A2FA 2PEDA 1BYOA 2IH8A 5H2IA 2M3GA 1ILSA 5FC9A 3FQYA 2GSMB 4DP8X 2VW6A 5I6MA 3AY2A 1QHJA 2JXMA 3QBIA 1ADWA 1JZJA 4YSOA 1QKOA 2YAQA 3JTBA 4AX3A 1NWPA 4XTLA 2XYBA 3ERXA 1NICA 3NSBA 2ZZLA 1RZPA 1GZMA 5I6NA 1OCZB 3S3CB 1M0MA 4UF7C 1AZBA 1GYCA 4MQSA 1SJMA 1TU2A 3N2JA 1A3ZA 2KSYA 3NJFA 3TBBA 1L9SA 3FU7A 4HAKA 3UAEA 1PZAA 3QJSB 3AG3B 3NYKA 4MD1A 3RYMA 1XIOA 1ET7A 3ODUA 2XU9A 2J4YA 3QJUB 1ET5A 3VHZA 4QLWA 5I5JA 3ZPRA 1JOIA 3AG4B 4YSCA 1PNCA 2I7SA 1IBYA 4JHUA 4KNUA 1AIZA 2UXGA 2W8CA 5A44A 2QDWA 5G53A 4KO7A 5H2JA 4BEYA 4BXVA 4G71B 2P80D 2Y69B 4FPDA 3IE9A 4DP2X 2IDUA 3OAXA 3T71A 4K9JA 1XJIA 1L0MA 1JZIA 3DDLA 1ASQA 1OF0A 3L45A 3BQVA 4HCIA 4HIPA 1GS7A 3FPXA 3T6ZA 2ZFEA 1J9SA 2PP8A 2GI0A 4GP5B 1KBWA 5G2CA 3CVCA 3ZDWA 2WO2B 5A8EA 2XV3A 4BK5C 1PXSA 4HCFA 1LN6A 2IDTA 1XB6A 1S53A 2I85A 4MQTA 4CSPA 1CYWA 1ET8A 4YSTA 4E9XA 1AQ8A 5E9NA 1MZZA 3AYMA 3FYIB 5B7EA 3UTWA 3NSDA 4N4WA 1IUZA 2BP0A 4YVUA 2MRYA 3UABA 4HCGA 2HX8A 3HARA 3QBLA 1KDJA 4G7QB 2WSDA 1X0SA 4X31A 2R7EA 1ID2A 1SHWA 2R4RA 3CODA 3OMAB 4A66A 1B3IA 3WKPA 2AANA 1J9RA 1PNDA 2VW7A 5B6XA 1AOZA 2BZCA 3NP3A 5A45A 3ABKB 2I35A 5AZDA 5C1MA 1OCCB 5JJJA 1SFHA 2EIMB 4F2FA 1W8EA 3DKHA 5LDUA 1OOWA 3QPKA 4BWWA 1URIA 2YAMA 3NYAA 1FBBA 3A7KA 1E67A 4HALA 3D12B 1PZCA 1JXDA 1KCBA 3H4FA 1IC0A 2YAOA 1S52A 1GU8A 3NT0A 2F93A 5G2AA 2PP9A 3VG9A 1JZGA 3UG9A 2VN3A 3CDZB 1QM8A 2DYSB 5D4IA 2ZXWB 2BWIA 2ZWNA 1HZXA 4A68A 4YSAA 1NIAA 1MG2C 1WA0X 2YCZA 1NIDA 3HASA 4W1TA 2MTAA 1AP9A 1UAZA 2QPDB 4GP8B 2IAAC 4DAJA 1M0KA 3X1FA 3PQRA 5ITEA 2JAFA 5JJNA 1MZYA 2PPAA 2BWDA 1JZEA 1M57B 4G7RB 4G70B 1OCOB 4N8UA 4WKXA 3HAOA 4MFHA 5EHFA 1GW0A 2J56A 2PPDA 1MG3C 2WJKA 3DTUB 3H4HA 4JQ6A 2ZONA 2I7OA 4FAAB 2ZOOA 2BO0A 3T45A 1F88A 1NIFA 3ABGA 3FYEB 1YLBB 3IN2A 5F7AA 4K5YA 3VI0A 3CG8A 2R4SA 1M56B 4P5SA 2XX1A 1Q5IA 2Y01A 1E5YA 2P80A 4EIYA 5LWEA 3S8FB 1H2SA 1KMEA 1Q5JA 1MDAA 2LLNA 4X4KA 1V54B 3FS9A 2W88A 3NJGA 3PLYA 3NJMA 3UAAA 1A4BA 1NPNA 1SFDA 2Y03A 1KBVA 2HRHA 2FT6A 3TU6A 1PY0A 1BQ5A 4NAJA 3HAQA 1EHKB 1HAWA 2DWSA 2Q5BA 2QT6A 4JKNA 1A8ZA 5B2NA 4DPBX 3UTXA 3TA4D 5A7EA 1GUEA 1WAEA 3N55A 4DPAX 4GYBA 4GY4A 2G87A 2BW5A 3UZCA 4DP6X 5I6PA 3EF4A 1KCWA 1BAWA 4QKTA 4A2EA 3FU9A 1AS6A 4N6HA 4NC3A 2EIKB 1NZRA 4KLYA 4DP5X 2YCXA 2DV6A 3EH5B 1C8SA 4FBZA 1KG9A 3PPSA 2KS9A 5D4JA 4J4QA 1J9QA 2I20A 1VJMA 3DQBA 4UG2A 2VW4A 4XTOA 4GYCA 5AX1A 1ZDSA 2NTWA 1JZHA 2BZ7A 4NERA 2CJ3A 3QJRB 5AHYA 3S3BB 3OMIB 9PCYA 2E86A 1R2NA 3UGEA 1NDTA 2EI4A 2LNLA 2YXVA 4AZUA 2IDSA 5EN0A 5I6LA 2GB2A 3JT2A 1XB3A 4GRVA 3C75A 1PLCA 1ZDQA 2H5UA 3NJNA 4DP1X 3HAPA 1AG6A 3HANA 4GXFA 3GXUB 3FT0A 1FFTB 3AYNA 4UANA 4EF3A 1N68A 4NB7A 3PCYA 2BP0B 5B1BB 1BRRA 3V2YA 3ASOB 2R7EB 1WA1X 1ZPUA 1WS7A 5B6YA 1NWOA 3X3CA 5I28A 1BRXA 5G36A 1QLEB 3QJQB 3FPYA 2XVBA 3PXOA 4BV0A 1NPJA 3WIAA 3WI9A 4AMJA 2UX7A 3FQ2A 2A3TA 3OE9A 4CSZA 2HX7A 2BRDA 1ZIBA 2QDVA 5I5MA 2VM3A 3H56A 5H2NA 1SF3A 4GPOA 5H2MA 2XLLA 2IWFA 1JFPA 3GDCA 1AS8A 1OE2A 3P0GA 3WNJA 5IY5B 1IW6A 1S8LA 4WW3A 1N70A 2PPCA 1ETJA 2XXGA 2XXFA 4YSRA 3EMLA 1GR7A 1RZQA 3PAVA 4DP4X 3V2WA 1XB8A 2IH9A 3X2QB 3FSVA 2H47C
chains in the Genus database with same CATH superfamily
1QW9A 1FNEB 4DWHA 2V9UA 3RL2B 1NGWB 5AUMB 1TVHA 2NY5L 4IU3A 1P53A 2IXQA 2Z3FA 3KJ6L 3QEQB 3HC0B 3RWJA 3GKWL 3K4DA 5EIIA 4ZMOA 3MUUA 4WUUB 3MRIB 3UROR 4XX1E 2B0SL 4OJFH 5C7ZA 3EDKA 3QZOA 1UUSA 2C4FU 2UWEB 1OGPA 2RJMA 2PWHA 5DEZA 2NY0D 3HCVA 2X88A 2BNRA 3E3QE 1T1WB 2NR6D 3VQ1C 1EH9A 5IM7A 5IBUG 5DHVH 2VXQH 2XG4A 2CCLA 5CHNB 3VWKD 4JFOB 5I26A 4A2LA 4HK0A 3NAAL 1N59B 4XODA 3WKMH 1UOWA 2J20A 3DDFA 3BEVA 2ZKWA 2E4FA 4MBSA 4AIZB 1D5RA 5I1IH 2MNJB 2XV0A 3S5YA 1S7SB 5LB1A 3RA7L 3FULA 1MLBA 4KHXL 2VDRH 5AVUB 2WQVA 2XETA 5HPMB 4LL9A 3RLSA 1CLVA 2J1ZA 2WKOA 5D8JL 5GS1C 1KB5A 1K8IA 2YMXH 4UT9A 5J7AA 1RZFL 3WL9B 2H2PC 2WXIA 5DRXA 2X1PA 4E41B 3PF2A 1KB3A 1IXFA 4QHPA 2OFQA 4YEEA 2BP5M 3O41A 1NINA 4IOIA 4CDHA 4M62L 4LXFA 1YO4A 1PAZA 2VIRA 5AB1A 4WI5A 4TXVB 2XRAH 1Z9NA 4GW1A 3DO3A 1FAIH 3IKCB 5F1IB 1TCRA 5GIRB 4XP5L 5J1SC 4YSQA 2F7OA 3PDSA 2WIIA 5HHNB 5I8EB 1QKPA 3R1GL 4F7EB 3WY1A 1X5GA 3ASNB 3FTGA 4L9DA 4HCRH 2H32B 5MHSE 4ZJ9A 1OAUH 1CG9A 1T04B 2GCYB 2UXTA 5JQ6L 5JZ7C 3QJFB 5CJOL 3FRUA 3MNWA 1AQKH 1KGCE 5E6IA 5DJ0A 1AAJA 1NCTA 2MHAB 1H6UA 1U2CA 3G7TA 3BJ91 4PXKA 2EADA 4WW2A 3VXRE 5BPPA 3PP3K 1ACXA 3ZHNA 2GJ6D 2W9DL 1ORQA 3BP6B 3OC8A 1R6VA 2AKRB 3SCMA 1PX3A 1X5AA 1EJOH 2Y7LA 3HEIB 3L5JA 3IDXH 5FCSH 3UTZA 1DSYA 1EJ6A 4UOW0 4XX5A 4DO4A 2ITCA 4FNUA 5BJTA 4OLXL 4YE4L 4QNPE 1MXGA 1OSYA 4X5XB 2NT0A 1Z0MA 3MV8B 3K6SA 3QQ4B 3EJYC 4G59C 2A6IA 5AW5B 2CLRB 1HOCB 3NGBB 3JWOH 4OKDA 2COVD 2ICES 1JGVH 3JWNH 1G0DA 3LQAH 2V7NA 4ZOAA 3ECQA 4FXKA 5HD8D 4OM1H 5HGAB 2IBZY 1HHIA 3RJOA 1OVZA 3LXBA 3NSFA 5FHAH 3KLAB 4G7VH 1O0AA 1J1OL 3C12A 1NKOA 2DL9A 4JFUA 3UBXB 5IMKA 3OMZA 1F90L 2EKJA 3O3EB 5AFAA 4PWHA 4YDZA 4K55A 5F9WB 1BFOB 2QVIA 4C47A 4DOHB 3ALWA 4FQXD 4U31A 2OS7A 4GP4B 3BPCB 3V4PB 4QRPA 4J8QA 2YDOA 1I9RL 2CIKA 1AXIB 1EVTC 1WZAA 3BFOA 1KJ2L 1KT2A 2AEOA 1R46A 4PRHB 4Z7NB 5IT2H 1N18A 3FQNB 1A7PH 4MZ3A 2X4TB 1YUHB 3MJ9A 3OB0K 3AY4A 4AQAB 2D2CC 4E5XA 4W9FC 4GW4B 4FQ1L 5GGVH 3L3IA 2UVEA 3WXVH 3DOSA 4A7TA 3H9SD 4ZSOB 3TC9A 3EYFB 1JJUA 4QOKA 2ZUXA 5FO8B 3AWGA 5DHYA 4FABH 4I3SH 1WP6A 5DJYB 3FH8A 3UYPB 5TK2A 1LJMA 3QYNA 1G1YA 4R7LA 5D2NA 4ZODA 5FM5O 4EUPB 3PDDA 1KN4L 1ZHNA 1KCSL 4MB3A 1FO0B 4NNPL 3SE8L 1Y0LB 2DD8L 2NUPB 2X4QB 3A67H 4HF5L 2VDLB 3MQIA 5DC4B 3RGHA 4Q6IA 1GKEA 2QSVA 4E42A 1U8PB 1IQWH 1JK8A 4NZRH 2CJTA 3ZTCC 4P2OB 4PUBL 3S5ZA 3GK8L 1AXTH 3WFHA 3LOWA 4XO3A 4X6CB 1ETZB 2RB8A 2J3SA 2H26B 2BMKB 3WJLC 3BLKA 3MN8A 3LIZL 4KMQA 3F7VB 2O26U 4EN3C 3BGFC 4WLCA 1MVFA 2QJDA 1QO3B 5HDBF 3RKDD 3TM6A 4B9JA 2GQHA 3QORC 3TEZA 1NFDE 2YRBA 3IJYB 4PVNA 1UOLA 1SVCP 3LTVA 3BRFA 5CLWA 4XPTH 1BZEA 5JHMA 1ZANL 4P48A 3QIWC 4G8FA 4PGBB 1V3KA 3RX7A 2KT6A 2B1AL 1PY6A 3W9DA 4YLQT 5L8KB 3FMGL 4WCYL 1I8IA 4I85A 1JV5A 2VCOA 3C9LA 3CDZA 1JBJA 5EORH 1U3JA 4YNYB 4ANKA 5C0RL 1CGVA 3RWDA 3IK2A 3QIBD 3VWJC 2O72A 3OKDB 4MVBC 1T66D 1KGJA 2F7IA 4D9RD 3OZ9H 4JM2A 4E9RA 2MNUA 3MRRA 5KSBF 3TBCA 4JVWA 1RH8A 3WFDL 3QWRA 3TH3T 3HI1B 2GT9B 4KX8A 3HS8A 4I1RA 3VD3A 4YQXH 5GJTH 5SV4A 2GSMB 1FGVH 5LG6A 1CFNB 1KIPA 3QHZH 3QBIA 4QJ5B 3MLXH 3FUFA 2H2SC 2Z93B 3QK0A 5FA3A 2E9WA 5IB1A 1AP2B 1NICA 1N10A 2ZXCA 3I75A 4MJIE 3GUFA 4EQ2A 2G60H 1OCZB 3GB7A 3LVTA 2YKLL 4XGZB 2WVSA 2ZKXA 1HZHH 4LASH 4DUXA 5AG8A 5L0QB 1DUZA 2DQDH 2J4YA 5DEJA 5TDNA 3MBXH 5L7XL 4WJG3 1ZLUH 4EE2A 1DEEB 5AALA 1N6QL 3VYOA 4GKLA 5E1GA 5AL0A 3FRPG 4X5PA 5AB2A 4I0PB 5G53A 2C5DC 2O4EA 3O6MH 2VDPH 2Y69B 3O6FA 3GBEA 1XJIA 2AGJL 3C8HA 3DDLA 1DE4A 3RY5A 2NY5C 2GIXA 3Q13A 3BIAX 5BZZA 1DVYA 4IRJC 4XCEB 4JE4B 3ZDXB 1TT6A 2V37A 3ZE2F 1RZ7L 1SJXA 3PUCA 1E0OB 2WAQA 3OX8B 1JPFB 3ARBD 1Q8MA 3KNBA 2CHDA 1XD0A 2WGNB 2VJ0A 1MQKH 1QSEE 4W81A 5GGTA 1RMFL 2MEJB 3NSDA 5DD1H 1HH9B 2HX8A 2YEZB 3QQ3A 1E2VA 2GFBA 2V33A 5CF3A 1H3VA 4X8JA 1SHWA 5HDWA 2GITA 1I1FA 3U9PH 4DK3A 1WC7A 3BT0A 5JLZA 2ZUYA 2EDOA 3EBHA 5DYOB 1JD7A 4BZ1A 5C8JA 4HETA 5FF6B 5F6IB 3DKHA 3W39B 4HALA 3D12B 5TDPA 1UA6H 1S52A 1R9FA 2BFVH 1A22B 4JZOB 5G2AA 2WXFA 4AZ8B 2CM5A 3MJ8B 1SQ2N 1XGPB 3T8VA 2OLDA 1M7XA 3ESUF 4XNUL 5FHBH 2OYPA 5L4MA 1GYAA 2QSQA 2Y7SA 3O8XD 3ILQD 2IBZX 3HASA 1AP9A 3V8CA 3AB0B 2OMUB 2HTKC 2C1OA 4JRYB 3PQRA 2Z7YA 2QGEA 1NJ9B 4UU9B 4F57L 1DBBH 3FO2B 2V3EA 3QRGH 3KD4A 3IE4A 2AC0A 1DQJB 3PQYE 4UQIM 3A4FA 3OG4B 2F1AA 4Y7MA 4TRPL 4TNWK 1HIMH 3ARRA 2JTYA 5ILTL 3MRCA 5KW9L 3EYUH 2VITB 1W0VA 1UZ6F 3GSXA 4ZD3H 3TESA 3B7RL 1H2SA 1AD9A 3FQTB 4PJCB 1JFQL 1C8PA 1H8LA 3T2OA 3TZVC 2XZQL 3GD1C 4IIQB 1KBGL 5LGHL 1LO3H 4L4TE 2A6KA 4XWOC 3CQFA 3S5LB 3U4EB 2ED7A 1PY0A 3B2VH 4ZX3A 3DGDA 3FHEA 1AGEA 4DPBX 4M8VA 4EI6A 2YQ2A 1KCRH 5LGYA 2OMTA 4EAEA 4JBSA 5BXFB 3UBXI 4Q9CA 3O2VL 4FFVC 5AKTA 2SEBA 4X7DC 1G1KA 4NWTL 4JFYA 2DPKA 3D3VA 1YA5A 4HPOH 1DEDA 2M83A 5FV2A 2DV6A 4FBZA 2Y6SC 4DGYH 5ANMA 3O81A 4AVKA 4JK0D 3LAFA 3RVUC 1QP1A 2YIHA 1BAFH 2VLME 3MHZA 2VL4A 4I4WA 1ZKAA 4OFQA 4ES8A 1PJWA 3O3DA 3PP3H 2GW5A 3DARA 4JPVL 3L7FB 2CJ3A 2PXYA 1IAKB 4M43H 5IMLB 1QFOA 1B0GA 4PRPA 4AZUA 3DLQR 1MCHA 4EO5A 4YZFE 1Q9OB 5DMIL 4DGIH 5C0IA 3HB3D 2C9PA 4GRLA 3I9IA 3UC0L 4X50A 3IU4H 2W80C 3ZKXB 1AG6A 2CNYA 1N9PA 1XH2A 3F01A 4GXFA 3HR5A 1I7UA 3FDWA 4I5BB 2AQQA 4M6MH 3O2WL 1HHJA 1YNTB 3FBKA 5ICXA 3LN5B 5I0DA 3QUYA 3NEXA 2XYCA 4PRBA 1G5GA 1E3FA 3OZKA 1CS6A 3X3CA 1F4WH 4BBWA 2CGRL 3PHOB 3QO1B 4NQED 3DVGA 5KVDE 1T83C 1MAJA 3V55A 3DMMC 3Q44A 4R96B 2DMBA 4YN3A 4HLEA 1XBRA 4LGPB 3LPGA 2UX7A 5FYJE 2KLTA 3FSOA 3HIZA 4NENA 5JHDA 3SE4A 5DJ2B 3VD2A 1P4LA 5DD3H 1OAJA 3A4DA 4Y1AA 1A1NA 3STZA 4G8GE 3QEUB 2XXGA 5JORB 3DTDA 4GBXC 1VFBA 3EMLA 3SBWA 5L6YH 4ZMXA 4P2OC 2PMZA 4WJ5A 3OB0H 3RKPA 3ROLB 3RPBA 5GGUB 1A14H 1IW9A 4IRSC 1JMXA 3ECBB 2XXMB 4HK0B 2E27H 1UWGH 2HLAB 3IS1X 3L1OL 3UZEC 4C56B 5EIIG 3RDTD 4UT9L 2BVUA 3QG7H 2KSAA 3OKEA 5H94B 3TBVA 1WFUA 2WC7A 4FL4B 3V0WL 43CAB 2F8XC 3F58L 4R83A 5DD6A 2XWJA 2Z31D 2X4RA 2ESVA 3GMMA 3TN0A 3QT2A 4MD0B 3DPDA 4XVSL 4PJIA 5FYJL 3EJPA 4KKCD 3FK3A 3HG3A 5E99L 3BX7C 4DETA 3CXDL 5ABDE 2P46B 3W57A 4EVNA 2GC4C 3MACL 3S37X 5MP6H 1FBIL 4OJEH 1UG9A 2J44A 2Z35A 3O11A 1YYMH 3I9PA 2E75C 1WQVT 4P2RE 4FQ2L 1GGCL 2AK4B 3QFDA 2WTPA 3GGWA 1TTCA 4IB4A 2EINB 4N28A 3FTGB 1X5KA 4YMPA 1MFDH 4OJCA 2H0JA 1JWUB 3NCYP 5DRZA 1GIGH 3WIHH 3KEDA 1MRDL 1R1CA 3MNWB 3K74B 1IAIM 1L9HA 4XMZA 2L7UA 3HNVH 3QNXA 2UX6A 5ESAA 1IAIH 5SV3A 3RB5A 3DUSB 3TO2B 4NQCB 4GQ9L 4WWOA 2VLRA 4AV4A 2VO5A 5I1AB 3D4CA 4HSAC 3LN4B 4QOKE 5D1ZA 5D71H 4FJYA 5D1XD 3DSFH 3LEYH 3DIDA 4IGBC 1RUKL 2MCPH 5B34A 2Y22A 5C0BB 4AI7A 2W07B 4IOFD 1P5UC 3T08A 4NQSA 5D2NE 4UM9D 4HYXA 5TE6L 2VDNH 2TSBA 2CCWA 3W11D 4ATTA 1YZZA 1CBVH 1D9KB 4TVSa 1N6VA 2IOIA 1WRFA 3GMRA 3MFGB 4EIUA 5IFJA 1OK8A 4I2XB 1HCZA 2GIMA 1NCBL 2A6IB 4RVBA 1G9EA 5I23A 1BXVA 1G1CA 4JFPA 4KDWA 1M3IA 3ZTEA 5CU9A 4KDTC 3LKOB 1NDMB 4KNFA 1L0YA 1CFTA 2ZNXA 5FDWB 1TPXC 2VDML 1MXDA 1V7NH 1PZ2A 3MJ9L 4BEIA 3L3DB 1IKOP 1TJGH 1KXTB 3N0AA 5KS9F 2HLFC 1UD2A 3GSNH 3B2XA 4HKBA 4JAMA 4MLSA 3LD8C 4NRZB 2QVFB 4G9FE 1WJ3A 4ZXBB 2RHEA 2OI9B 2XTJD 2IJ0C 2UYLA 3SN6R 5DJXB 1MW3A 2IH1A 1A9EB 4XT3A 1QZ1A 5EG6C 3ZRCC 1IRAY 1W6LA 4NFDA 1CE6A 1SOXA 2X2HA 1TCMA 4X6BA 5ELIA 3IJSB 4UOJA 2WNGA 4AJVA 2OXHA 1MCDA 2RH1A 2FDBP 3CFCL 5DJDB 4AG4L 2FQFA 5C7XH 1SLXA 3EBAA 1F8TH 1I7RA 2JCCB 5LCVH 1SF5A 3KW8A 3NSCA 4M5ZH 2WD0A 4Z1PA 2DQGH 3WY2A 4F27A 2ZCHL 5BNXD 2PR4L 4PGJA 3P30L 1UM5H 3IDMA 4NJAH 3ZBMA 4B0MB 3ZW3A 3L7EA 5IKCB 1JV7A 1AZUA 4XN7A 3VI3A 1ZHNB 1MCRA 1R3IL 2VLKD 4TUUA 3MYZA 1EK3A 5CEZE 3MLTA 4OCSH 3D2TA 1CU4H 4YXLL 5C9JB 3R06B 4KX7A 3GSVA 3ABLB 4O58L 1U8CA 1FF5A 1EZUA 2R51A 4P5MB 1JK8B 4HS3A 1E5ZA 4NPYB 3FCGA 4ZW7A 3T0VA 3U0TA 1QG3A 3NJKA 1YEIH 3KVPA 4J3OG 2PTVA 4QHLB 1F42A 1H3XA 2P8LB 2ZOLB 4UT7H 4M5TA 2EDJA 4G7SB 2YGVA 3P73A 2O5XL 3AB0C 1CI5A 3PHQA 4X80L 4LOEA 1S7TB 1PU0A 4U0RC 1XF4B 2HSIA 2OBGA 5EDXA 3GM8A 2WLLB 4KOBA 5IVXB 1T2QL 4EJ4A 4KRPC 5BUAA 3N40F 5AHZA 5FO2A 5GXBB 5JA9A 2F19L 1M7IB 2XPZA 3HW7A 3L3GB 4Q58C 4JO8A 1KPUA 1S7RA 1ZE3C 4FP8H 3MRNA 1PJ9A 4NHCL 3SKUD 5J11B 4QAMB 3BSGA 3GNML 5CEZL 1S3KH 1TQUA 4YFLI 4ENZA 2CLZB 3ULVE 1QFHA 3TCLA 1EJ8A 1GSMA 3GI8L 4PRDA 5GQBA 5A40E 4ABWA 4GQPH 4OKVB 2FJGA 4X99A 4ZUVA 2XJKA 4MA3A 1BIIB 4ZDHA 1MOEA 1MIML 4PJGB 1CDYA 4Y5VC 3TBWA 1TYJA 2EYRB 4B97A 4Y88A 3AS3A 1SNRA 4R0LA 4Z7WA 3TO4A 4A39A 1W72H 2OJEA 4M7ZC 1ZHKB 2F54B 2CK2A 2B08A 1AVAA 1O6SA 4LEOB 1OAZH 3CIQA 1DHKA 3FN0H 5DHVB 1RUML 1H3WM 4KXCA 1M71B 1NPUA 4OCYH 3DO7B 2JJVA 2WSPA 4F9LA 3JUZA 4AW4A 4XTNA 1PZDA 2WM0A 5FCUL 2J21A 5EA0H 1CT8A 5T1DL 2VDRB 3PJSA 2X9YA 3OLIA 1JGJA 3AITA 3VCLB 2AJ3A 5HHPA 2IWKA 2QQLL 3MRDA 2ZF8A 1N7ML 2ZX6A 4GKSB 3AFLA 4KITB 3OJMB 4N4YB 1DSWA 1OCRB 2TRYA 1D5IH 1UASA 1NCDH 1Z9OA 1LK3L 2EILB 2F1BA 3BE1H 4N0RA 2GKIA 2PCYA 3ROOB 3DX2A 2VW6A 1QTPA 3QJHA 5F0MB 1JZJA 4LSQL 1QKOA 4TNVK 4HIXL 5I0WA 1HJBC 3LS5L 1CL7H 1GZQA 3H2WA 1K3ZA 5A3IC 3S96B 5GGTL 5EC1B 1MVUA 3WEMA 2CBQA 4MXQD 1QLRA 5DJCB 5T1KB 3QEQD 4ZMAT 1ET7A 1KSRA 5IW3A 3CV5A 3ODUA 4UDTA 4NLHA 4UOW1 1UM4H 2DMHA 4WUUD 3I84A 5EN2A 3ZR5A 4KK8D 2A4ZA 3KNBB 1Y18A 5E9DE 1ETB1 2I7SA 2Y7NA 5INCB 5KVFE 4BZ1L 1G7QA 3DECA 2J43A 1YEEH 2W8CA 2XFGB 3JVGA 4LEEA 3CDFA 2FEDD 3T0WA 3QQ3B 3BRDA 2YGPA 4IOSD 4OFKA 1LMKA 3JWOL 3VM7A 4WNJA 1CJYA 3DDGA 4AMWA 4UTAH 3ISRA 4HV8A 1KULA 3MCKA 3U36A 5F93C 3SPCA 3HAEG 5E2VH 4F91B 1QEXA 5ISZA 1INEH 2QMJA 2XIDA 1CGWA 1KBWA 4P9HL 1Q9KB 4QXUH 4MZ2A 2I85A 1J8KA 5D6DA 3Q9QA 2G30A 3D3VE 3ZGIA 5H8DA 4DKEH 2VM9A 4UV4L 2BP0A 3T8XB 4PJ7A 4PLNC 1KDJA 4G7QB 2ZWLT 1SMOA 3D18B 4XPAL 1BOYA 1T80A 2EZ0C 3UTSE 4E41D 8FABA 4RWYL 1HZLA 1TTBA 4JX0A 5KVFL 3GXPA 2JWYA 3RURA 1OCCB 2EIMB 3BKJH 3QEGL 1RU9L 1OOWA 4Y1TA 2IGFH 4XMXA 3KDMA 3N04A 3SKNA 4AENA 3FU5A 3D69B 4ZG1A 4JGMA 5E6IC 2P8PA 1GU8A 2G9KA 4WW2C 1G6RH 5L8JB 5DD0H 3ZE0E 1W9XA 2XIBA 3SCMC 3A67L 2XWBB 1RSYA 1NFIA 1WA0X 3ETBJ 2FIRT 2PKDA 3D9AH 3HZKA 5D70H 1UAZA 3CTTA 3NCWA 2IAAC 4WFHE 3VXUA 2JQMA 5IIEB 3PPEA 1PZ3A 4HQQL 4BUHA 4IBSA 5EF1A 4HIJA 4TULH 3IAGC 4TVPL 1M57B 4N3UA 5TE7L 2NW3A 4OFYA 4EI6B 1HINL 5DVKA 4XN5A 5JHAA 1IGCH 1USZA 1N67A 4MB5A 1AQDA 5DQDL 2I7OA 1T7ZA 3E80A 1MI5B 4FXKC 2V5SA 5J7CC 5J1AA 3LVEA 3T45A 5FLVA 3NIFB 1BHGA 5LN4A 5F7AA 3L9RB 2BOLA 2R4SA 4ZMTA 3CFUA 3C08L 4BKTC 4DZ8A 1Q5JA 4X4KA 2DH3A 1V54B 3FS9A 5TFSL 2YJQA 4TKWA 1FZKB 2BIOA 4G43A 1FL6A 4YOKA 5I1GL 1C7SA 4L4VB 5I66A 1B0GB 2ED8A 3JTTB 4PRPB 1BQ5A 3APCA 3VDAA 4CKQA 4RMTA 5B21A 2HKHH 3FUEA 1HEZB 3AY4C 4DQAA 1GUEA 3NCMA 2Q8BH 4UNUA 3CHSA 3UP1A 1MCNA 2IQ9L 1CLZH 5ICXB 4J3OC 3WTYA 4JLRA 4N6HA 2IGTA 2VUKA 3PPSA 4JKMA 4PRHD 3DVGB 4UG2A 5D2NC 3QZPA 4ABUA 5C2UB 2EDRA 2ICEA 4HMCA 4NUMA 4O4YH 1JZHA 4HJUA 4D9QD 5LDSA 4I1PA 4BFIB 1NDTA 1JD9A 2O5ZL 3GJFK 4NENB 5JHDB 4QCIB 3WOVA 3O4OB 1QHPA 4UQ2A 2MCAA 4C4UA 3MLXL 4D0DB 4Y1AB 2EDTA 4AEEA 2FEEL 1CD9B 5A2KH 4Q6IC 3ARGB 4LSUH 5BUGA 1A9BA 1AO7B 4Z7QE 3WTXA 1E6OH 4WJ5B 1DUYA 1Q1JH 4CN4A 2JB5H 3HLAB 4Y4FB 5I75C 5H4ZA 4FQCH 4F5CA 1F3JA 3MV9E 4LASL 4M7LL 3FQXA 5G36A 3UZQB 1HHHB 2C4FT 3PXOA 4LKCA 2C9SA 5JXEA 3AJ7A 4PJDA 2WTOA 4LHQB 3EFOA 1XGRA 1WAAE 4JO2H 3P9LB 3FH7A 4I3GA 1RV6X 1C9SA 4ZS6D 2Y24A 3VXMB 3UJTL 3FB8B 2CO7B 4GAJH 3BT2L 4NRYB 5DJAA 1D3CA 4GRMA 2XLLA 3FW6A 1JWSA 1LEIB 2OQJB 2X4RB 4WGVB 1EO8H 3TIDB 3Q6GL 4WU7B 4PJ9D 1INQB 4XCFH 4FA6A 2DKUA 4BGLA 1DDHB 2P24A 1HKLL 4YSRA 1CD0A 3T0ED 3Q7JA 2AAVA 1S7XA 2V9RA 4O5LH 1P2CB 4DP4X 2H47C 1W0WA 4EVNB 5GZOA 2AK1L 2Y02A 1QEWB 3JZ7A 1LO2L 1T3FB 4M1DL 4UCFA 3TBYB 2VDPB 2Y1VA 4P3CL 3AWFA 4FNSA 5EOTA 2E8ZA 2HWZH 2EYTB 1OE3A 2D7TL 5KBKA 3O11B 1S6NA 5CP7A 2GHWB 2YC1B 4MQXC 3ZE1B 2HCZX 4S1QH 4IKLA 2LVCA 4XBMA 4JM2C 1GKOA 2O5NA 1NIBA 2QZ5A 2Y36L 3IDIA 4FFYH 3ZT5A 5J4MA 3CVDA 3BD5A 4HG4J 4ZAKB 3QJTB 2PO6B 2Y3AA 1TVBB 5ETZA 4PCYA 2J5LC 5CLXA 3RE0A 4YHYC 4HU8A 1E2ZA 1EEQA 3U30B 1E9OB 2ZXAA 4XNQA 3RGBA 4CILA 3KW7A 3VU2A 4EIGB 5H2KA 3KLHD 4MS8C 4O2CB 3X1GA 4ZK8A 4YL4A 3KXFE 1XCTA 1BZOA 3ARZA 4EZLA 4AJ0A 1IM9B 1F11B 2BFVL 1RK7A 3GXIA 2F5AH 2PTTA 4PIRF 4KAQH 4AOFA 1DBML 4K3HA 5G54A 4XC3L 2WNXA 5ALCL 1JGLH 4K7FA 3AM6A 1FC1A 3WELA 1WV7T 3GIVA 4L5FH 4ZX4A 5C3LD 5FYLL 3MRGB 3ULUE 2ZYSA 3KJ4C 2OJ1A 2ZOKA 4HDIB 1NCGA 3GMRB 4JQVA 3V5KA 5FKAA 4A7GA 4HHAA 1MUJA 1UT9A 3D4GA 5BS0A 3TA3B 3WBDA 2IG2H 2WLHA 2K6WA 3EO1B 3T2NL 4XOEA 3H9HA 2AV7B 2G2RB 1V10A 2YD6A 2ZSWB 3QRGL 4PMFA 4UI2A 3V9EA 3TJEH 3L13A 5GS0H 3BSZA 2QV4A 5FKPA 3IDGA 3O6FC 4KJQD 1MREH 4ODBD 4A6YH 2C3XA 2DBJA 1HIML 1A0QL 4H2AA 4AMXA 4I1NB 4ZUSA 3CMGA 3GS0A 4M00A 5K9OA 1DO6A 1OV8A 1ZY9A 1HWWA 4I0PD 3QG6A 2AMUA 3OC5A 2NXYB 3MVSA 2WZ6A 3LHPL 3E1ZA 2PW1A 3RWCA 3WEOA 4OF3A 1BXAA 1ASOA 2B2XH 3EOBB 4LAQL 5D1QE 5LGKA 1BZ7B 4LLUB 2FX8L 4X5QA 3SDDA 3SD2A 1TLKA 1HEJC 2B9BA 3FKUS 1AT9A 3IU3A 2VDKH 2HVBA 5KSUA 3IDMB 35C8H 4G2AA 3ATBA 3UAJD 3VH8G 3SQBA 2FATL 5GISL 4TNFA 1OP5H 3TNNB 1SVBA 1BX2B 2OSLA 4XAKE 2C3VA 3PREA 4B9CA 3KLQA 5E8EA 3G5VA 1J1XH 1IGJA 4OZHA 2FJSA 3D7PA 1HL9A 2B5IB 3NZ8A 1W8OA 1EZLA 3U0TB 1KYOK 4JG1L 2KLRA 4I87A 2IPTL 3IU4L 3LZFH 4P9HC 5F1NB 1MAKA 4BDVB 1AZCA 1HI6A 3CN2A 4EIBA 5JW3L 4M6ML 4P2QE 4K71C 4PBWD 1KIRB 4PFEA 4ICWA 3BMVA 1Z9SA 3M45A 5T3ZH 4N8VB 3UACA 2FUQA 1I8LA 2H41A 4YDNA 2N7BA 4PGZA 1A6UH 3I02A 5DZAA 1IE4A 1JDDA 2D0FA 2JE8A 1MHCB 3D07A 1SYVB 4G8EA 5DHGA 5LXVA 1XGQB 4N0FB 1LE5A 4R5XA 5K93A 1MCOH 5I0YA 1AKJD 1KC5H 2Z7ZA 5ACZA 5MEPA 1UUNA 2V5YA 4JRYD 4R2GC 6CGTA 3VXTB 4R90H 5E4EC 3C8KB 2YD7A 2MCG1 1L5GA 1SXCA 4PRDB 3MUGA 3B8SA 3RTQB 1KY6A 2BP8B 2CDGB 1IBGH 1OAKH 2D03L 1A14L 2JCWA 4JY5L 4IKNA 5CZVH 3U4BL 4N26A 4CC4A 2JKLA 3C6LA 3NPSC 3MNVB 3ZZLA 3VI4F 1SEBA 5E56A 1A4KA 1UWGL 1KIUB 5FJGA 5GRJH 4W6XB 3L08A 1E4WL 4KWUA 3LS4H 4XB7A 3FB7A 2ZUQC 2XWTB 4BD4A 5L2KD 3S35X 3DOHA 3P0VH 4OW6A 4YSUA 3A6BH 4FCAA 4OD3H 3QZWG 2D7MA 1CF8H 1G1OA 4M1CD 4Q9BA 5I16B 3PE9A 3ZT7A 2E7HA 2PXYC 4AH2B 1II4E 4KQ3H 1EDYA 3G5YB 4FFTA 4ZNEA 1T0NB 2AT9A 1N0LA 3NA9H 3PJSB 4FFZH 1U8NB 5E8PA 2GK0B 4QR7A 5BRZB 5AB0A 4GRLC 5CBEB 3P4LA 2X53A 4MCMA 3EH3B 3U9UB 4M9PA 1FORH 3CQQA 2AXGB 4GSXA 4JPIB 1U92A 4J3TA 3RWIB 4Z3HA 1R4XA 1OW0A 4HGWB 5F7FA 3HVDA 4OCRH 4YUEH 2JKWA 5F70A 5ISZE 1A1OA 3QUYC 3HBGA 1GS6X 1KPRB 1Q94A 5D2LB 2HMID 2DLFH 1PCSA 3OE0A 2VZ3A 4RA3A 1KIQB 2I60H 5IJVB 2EDXA 5ADPL 5F7NC 1FVEB 2AJYL 5DVLA 5EPMA 4ODWA 2NXZB 2FR4B 4YDLB 4HT1H 1JHLH 3SE4C 1CFMA 3IDYC 3HNVL 1VFMA 4XR8C 3D4SA 2IANB 1NC2B 3O3BB 3NSXA 4QRUB 3W1ZA 3N42F 2DQTL 2VMEA 3SBWC 2FEEI 2DQMA 1QLRB 2P47B 3IF1B 4Y7OC 2D9QB 2YUZA 3CXFA 3N43F 4FTVA 4YIQB 5DDHB 4TQPA 1A66A 2GYSA 3C6SB 5BR2A 1JZ6A 1J8HE 2PEDA 1KZQA 1FNSL 3CLFH 1D5XB 4PR5B 4IBWA 1YJDL 5D7HA 2YAQA 5IREA 3JTBA 4QXWA 2P3YA 4MKTA 2P52A 3EIFA 2XYBA 1DJGA 1YECL 5F7YC 3J07A 3O2DA 4HU2A 4AEHH 2VDNB 3I6LE 1UB5A 3TN0C 3BVNB 3VXUE 2YK1H 1UACH 5EBWB 4RDQF 3GJFH 4U1IA 5CEXA 4C56D 3QFGA 1U8MA 5MERB 3TF7C 3RYMA 4AC4A 1TJGL 1DN0A 2BHYA 1G7MA 2XU9A 2YQ3A 4S1DD 1KXQE 4AYFB 4ZMYA 3T8MA 2FO1A 1WWCA 3AG4B 5C0GA 3QYCA 3PFQA 2EDHA 3P2TA 2DLIA 4N8PA 1E3XA 1SY6H 1E4XH 1IGFH 1FG2A 2R2HA 3DBSA 4WEBL 1DVUA 2P80D 3GSNB 8FABB 5IJCC 1GMIA 3O9WA 3KPNA 4PJ8A 3AAZB 3HZMB 1AR1C 5LCVL 2DQGL 2W81C 1BDYA 2P45B 4HXBH 3IAQA 3NFPB 4M6NH 5F8QC 5LQBH 3HMXH 5IJBC 1ZLSL 3VRLF 1NGXA 5M94B 3LNGA 1LN6A 5MENB 1AQ8A 4AEFA 5TQ2H 3MJ7A 4P5TC 5D1ZC 2AK4D 2DYPB 3WFEL 3KLKA 3RPKA 1HEHC 3O3AB 5TJWK 2QR0B 4GT0A 1VA9A 3GTNA 4KVPA 3KMDA 5IHLB 3HUJA 1S8DA 3CLEL 4LDEB 3K5SA 4JFED 4CW1B 2R4SL 3VX1A 4R7NB 2OCJA 4NQCD 3ZOAA 2HUEA 4YHZH 1LO4L 4V1DB 5AQ0A 2FX9H 1ND0B 3A7KA 1OY3B 2Q3ZA 5ETUB 2HN7B 1YEFH 1ZTXE 3KH4A 4GG8A 3PWJA 5DHDA 5C0BD 1E7VA 3OSKA 5MEOA 2DAVA 4YHIB 4XOAA 3ZZSA 2J88L 3D5OF 2X4SA 2ZXWB 2BWIA 4OZIA 3K5RA 3G9AB 4F5CE 1D9KD 1M53A 2UWEF 2X4PA 5CFAA 2YWZA 5EO1B 4E9LA 3KPOB 4FP8L 3KE0A 1XDTT 1HXMB 4W1TA 1S9WB 4MHHI 4ZFZA 4NNXB 3NCJL 5JDSA 1TF4A 1CZ8H 2AI0H 4GNKB 2ENYA 1H8OA 5JJNA 2FECL 4ONGH 4GAYB 4F15C 5AW1B 4S1RL 4QUOA 2EXWD 3ABZA 4OZGE 1GW0A 2E47A 5FUCE 2FIKB 4D3CL 4URTB 2XFXB 1VPOL 4OCNC 1FZJA 5TTRA 4WFED 4K5NA 2R0ZH 4AYID 4LVOB 3VFUA 3NH7H 4ZXBD 4MX7A 5IHUL 3AACA 1EWHA 4RFEB 3N06B 4OLEA 3BLPX 3HAEH 1ZTXL 2JB6B 2NNXA 1OAZL 3BEWA 3HN5A 4WI6A 1NPNA 1ZPLA 4Q0XL 4BRJA 5AD0B 1DP0A 1DL7L 4Z7VB 3X3GL 3BHBB 4RMVA 2GJPA 2HRHA 1ML0A 2G75B 2K6ZA 4G80A 2PYEA 2ZCLH 2YGOA 4GMSL 1HAWA 1RUPH 2MCMA 1W72B 3KYOB 2E9IA 5J3HC 3TCTA 4NXSA 4H88H 5ERWB 3WY4A 4E0RA 1XXDC 1HXYB 3JV4B 1CF1A 2BW5A 3G6DL 4DKFH 3QA3A 5EWIH 3UZCA 1ZHLB 3PWLA 2UZPA 3R0NA 1RI8A 1YUKB 1P6WA 3KPRA 3DXAA 3MREB 1UQSA 2W0FA 3FB5B 2W9EL 4EZKA 2F8VA 3FQXB 5D4JA 2BNQB 2P4AB 1IC1A 4GYCA 2BNUA 2BZ7A 3BE1L 3CD4A 3K72B 3RFZA 3VFMA 4MNQB 4ELME 4D0CA 4CSSA 5JOFA 3L1FA 3WIFA 2IO5A 2KUTA 5FX3A 1E5UI 2VUOA 3MRJB 1KLUB 3NJNA 1C1EH 4Q2ZB 5B8CB 4QY8A 1R3JA 3DGGA 1GPOH 1A02N 5EU7E 1LDSA 1HX0A 4UANA 5C0DB 3IVKA 1FYTE 2IQAB 1U21A 2DQJH 1U91B 2FHFA 5BS0E 3EYVB 1EHNA 3FUKA 1IMHC 4KTDL 1ZXQA 2R1WB 4UUJA 2R7EB 4TF4A 5C07B 3MC0A 5B6YA 1D6VL 3O4LE 3FUJA 1HILB 4U2ZA 5IHZB 3D0VA 4NUGH 1L7TL 5E9AA 4LSSL 1DQDL 3KPLB 3DJTA 1J8RA 2HJLA 2C9RA 1CR9H 2HPOA 4GH7B 2E46A 4ACPA 1YEEL 4AQEB 3JV0A 4R0LC 3TO4C 4OLUL 4LCUA 3IDIB 4JB9H 5FEBA 5TQ0H 3KR3H 1H0DA 1DTUA 1CLYL 3PAVA 2CXKA 4HWBA 3L95B 5EU4B 2YD1A 4EI5A 5DFVD 4WGWB 4F9LC 4LEBA 5E2VL 3EBGA 4F8NA 3CZJA 3EBIA 3KL0A 3A6CH 3HE7A 4N2LA 4PW9A 1XCTB 3W38A 4Z7NF 2F54D 4L37A 1GOGA 2O1AA 3E6HB 4WDIB 2Z34A 4ZMPA 3VNZA 3W2DH 3EGDB 5GRVK 1QQDB 5F3HA 3SKJH 3WFBL 1H3PH 3GIVB 3EYQC 1KF9B 3BP4B 5B35A 1A7RH 3BSZL 3QO0A 4DZBB 5I0VA 1KLFB 2P42B 1BVKA 4MAZA 3PAUA 1ED3A 1WDAA 3X13B 3FNKA 3WNOA 4TTDC 5B7MA 1WA2X 3T1WA 1OTSD 3BUQA 4MA7L 1JN6B 3WE6A 1Z1WA 3B5TA 4QHKJ 2YPVA 1NEZA 2EO7A 4GAFB 2YPKB 2J6EA 4W9CC 1ONQA 2OK0H 1TN0A 1MAMH 3MR9B 4JCLA 3CMOH 4WU5A 1I3GH 2H8PB 3LYRA 3QUXB 4YPGA 1BQUA 4HEPA 4LMQI 1IAII 3T0AA 5JPNB 5CN1A 1Q9WA 3T0BA 2TSAA 1HCFX 1GHFH 3AT0A 3X1EA 3ZKSD 4MCZA 3QDME 5DMGD 3W0WB 5MI0C 3LXAA 4X6CF 3UXFA 2J12B 1TETL 6TAAA 2DRUA 3D25B 4AWJC 1QPXA 4HSCX 1CGSH 1G6RB 5AW9B 1JZFA 1OAQH 4JRXD 3WUZA 1IT9L 3JVGC 1ZRUA 4NCDA 4OGAD 2DM2A 4MA1C 1NMAL 4OLVL 1VZIA 4U1SB 2EIZB 3QQ9C 3O45B 4QPEA 3SDDB 4HMDA 1KFAH 4AGQA 4HFUH 1P4BH 4X4XB 4F2MA 4K8RH 1QR1A 5CGYC 1YDPB 3FFCB 5M7QA 2EP6A 4PP1C 3S88H 3ZSTA 1TQBC 1J5DA 4P59H 4X4YB 3M8OH 4LP8A 3R0MA 5C08A 5EO0A 4DP9X 1VEPA 1YJDC 2HRPH 3OKLB 5F9DC 2WXQA 1GY2A 3GJEB 1TZHA 1ACYL 3BP5B 3KH3A 2NY1C 4KTYA 1PKQB 5TDOB 3QULB 3VFGH 3MBVA 3RL1A 3U82B 3V7MA 4OZHB 2Z4TA 5D9SA 1HU8A 3DHUA 1CB4A 1RUAL 3FO0H 4HW6A 5B1AB 4P4KA 1NFDB 5IMOB 3QB7C 4F7KA 2TRHA 4LLMA 5E5RB 1URLA 3TYFA 3L5XL 5EUOE 4QYOA 3U7YH 5D7LA 1QZNA 1S7WA 1S7QB 3OVUB 3HVNA 4LCWA 5HGHB 2BVQA 4FNLH 1OB1B 3WNMA 4JN2B 3V0JA 4IEFA 4BFKA 2DM7A 5F3FA 4ZNEE 2BOBB 4I9WE 3MLVL 4LE8A 1BF8A 1J8SA 2P9RA 1QX1A 4MWFA 5FGSA 4ILDA 4OLYH 2Y1AA 1SXNA 2ZXDA 5CINL 1SBBA 1QYGL 2EC9U 2H4EA 2HLEB 4L8SA 1A6WL 3B2UC 5J57B 5GSVA 1UB6A 4NNYB 5ITCA 3BZ4A 4KGJA 3QPXL 5I6OA 1V55B 4D94A 1UVQA 2R9HC 2X1WL 3QNYA 1NOLA 1IBFA 4H25A 1Q1JL 1BQLH 3VD7A 5KSVB 1J18A 3L4UA 4NHUB 4HUUA 3C9NB 3DUUB 4KKAC 2XN9A 1U3ZA 2ZG3A 3Q8BA 4YBLC 4DT2A 2KZWA 4BJLA 5C0JB 1FDLL 1S5IL 4BFNA 2HKFL 1JNNL 1GC1H 3VYPA 1N8ZA 1QSFE 4RGND 3VG0L 4FTVE 2HX9A 4MJIB 1U3NA 1QFUH 4ZYKA 2OMVB 4OGXH 1I8MB 4TSBH 1FVDB 4NFBA 3NIGE 1KGBA 5TF0A 1XBDA 1H3GA 1U8IB 2A73A 2XQYA 3PABA 4XCFL 1BM3L 3C6EA 2GUYA 4B50A 3PAYA 4FX5A 4X4ZA 4G6FB 3II2A 1EZVY 1MI5D 1OARL 2WLYA 4ZUTA 4LCCB 5A2IH 3FSAA 4Y9GA 1F58H 1YMHA 3BXNB 4AQ1B 1QAWA 3BC9A 4K94C 1JDAA 2HWZL 5ICZB 4XP6L 3I3BA 3DI2B 4S1QL 4L4VD 3S6CA 1KJ3H 4GB9A 5HHOA 3VMPA 1OSEA 3DHPA 5IB4B 4B41A 1T0MB 3BAWA 2ICEC 3RWGA 4GO8A 1EVUA 5EPMB 3TOPA 1IAOB 4ONHA 3AWEA 4UILH 3WN5A 4ODWB 5K1NA 1IC7L 3P3SA 1TSRA 1JNJA 2CKBH 1BGXH 2WW8A 4GI8A 4LKXB 3DIVA 1YEGL 3IT8D 4ZX5A 3MA9H 3FZUD 4PGEA 3HBQA 4WJKB 4LLDA 4KPHH 2VKXA 3LKRB 3P9WB 3AU1B 3UPRB 4IMLA 2CDEB 4TUOA 5IQ9B 5I19H 1KTKE 3G5ZB 2R69H 3ES6A 3O2DL 4RISH 1LO0L 2NW2B 1E90A 2EE3A 1N4XH 5GGSY 4MAYA 3KGRA 5AX0A 3S3SA 2DIBA 2VQ4A 5GHWH 2VABB 5JXEC 3ULUH 2VDQH 2GJJA 3RB7A 2VISB 4RH4A 3ARGD 1KBPA 4Q14A 2EKSA 3OAUH 5SWZA 1XIWB 1AO7D 5DLMH 4MD4A 2OXGB 3QAZB 2VNCA 1ZSDA 4Y4FD 3QRFM 5FUCC 1EZSA 3TJEL 5E4OA 4Z23A 1XX9C 3EO9H 2HUHA 1PTZA 3SJVA 4XBEL 1SXSA 1CL7I 4PJCF 3UZVB 2R2EB 4Z7AA 4UQ3B 4Y2OA 1GVIA 1SXZA 1L3WA 5GZOC 5KBDA 4N25A 5LXGH 4NQDB 3VXMD 2Z91A 3GMOA 1J11A 1ZXKA 1FL5B 4YFLF 1SUJA 5C9KA 3U6RB 4JFHD 4A6YB 5E8DH 1ZCRA 1AE6L 3WIIH 3WXWL 2R2HB 3JZYA 4GUOA 2FRGP 5D72L 4XVTL 5CD5D 5KSBA 3DYMA 43C9A 1J9CT 1PG7H 3S3CB 3CSYA 1BQHA 2BVPA 2OJZH 5INDA 3X3FH 4AJYV 1L9SA 3TV3L 5IROD 4S0HA 2AQNA 4LPWA 1V27A 5JW5A 5IB2A 4L4TB 3DX8B 1NGXB 2PCXA 1T7VA 1IZJA 5C0EB 3FOMB 2WINA 4X0KB 2NLJA 4LHUB 1FLRH 4DPRA 3MDJA 4QXTA 3GMNB 4NIKB 3FTZA 3U46A 1HSAA 1OZTG 4XP4H 4ZAKD 2VDKB 2PO6D 5JPMB 1AZZC 1O6TA 3S34H 4OUUA 4FLRA 1S8DB 2Q2EB 3QDGA 1X5IA 1WBXB 1YNTF 4K9JA 5GRUH 3LZFL 5IQOA 2OR8A 4Q74A 1RIUH 4G42B 4DQOH 3L45A 2A6JB 1UD6A 3HS0B 4JQVC 2PYEE 1T20B 4Z76A 2WN3A 3VFTA 1TZ8A 3RP1A 1IM9D 3N44B 3LSOA 4XBGA 2WO2B 5T3ZL 25C8H 2WNKA 4NKQB 1QBMH 1AHWB 3OHXA 3MRLB 2EYSA 3BCFA 3K2KA 1DJZA 2DQUH 3BGAA 2R2BA 5FO9A 3UTWA 3STLB 5EU3A 2H9GA 2JMRA 2JLLA 3DROA 4LNRB 3ARUA 1CD1B 5ICYB 4HOZA 1GYVA 1T6VN 4CRPA 1A6PA 4KQ0A 3QRBA 3A6OA 3TPKA 4ZZKA 3K1KC 4L1BA 1KCVL 5I8CB 3TBTB 1ZT4B 2JKSA 2FJHB 3NP3A 3WSQH 5SWQB 1MPAH 5C1MA 5LDUA 2X4OA 2ATKA 2X6VA 3DYPA 4OCWH 4KMLB 5F7DA 2LVEA 3GS4A 5HGGS 2VN4A 5TE4H 3TNMB 1HC1A 3LPOA 5CZVL 4RX4D 2CLVA 4FNPA 2P7TA 5AW0B 5CWSA 2H2PD 3OXSB 2VN3A 1T5XB 2XZZA 4R7DB 3SDDC 2CA3A 3CFBB 4KMTL 1ACCA 1CPUA 4G8GB 3V6OE 3VXSA 2LU3A 3MYJA 3VE0A 3ETSA 2NXYD 4W6WB 4AL8L 3PGDB 1U3HB 2Q7NA 3ZQWA 5ACMA 3MOQA 1WICA 2J4WH 4HS6B 1SXBA 3RZCB 5AVTB 3WLWD 3VTMA 3UOAB 3VGGA 2JAFA 2I27N 4QTHA 4XNDA 3WTUA 1OIOA 1OCOB 4G7RB 4KQ3L 4Y2DA 5F1KC 3QEHA 2Y3NA 3UG3A 4AW7A 3H4HA 4FFZL 1U8JB 2ZICA 4YX2H 4C57C 5KYWA 3FYEB 3G9VA 3WFCH 2L04A 4NQQA 1FZMA 1P7QA 4MYPA 3VI0A 1FRGL 3ZUNC 3KPRB 2E6PA 1MCEA 4OZFG 4HPHA 2HYMA 4ZUUB 1E4JA 4ZPTB 2LLNA 3KYNA 1U8KB 2ZKYA 3N1GC 1I8LC 3NJMA 2BNUB 1MDTA 4Y19A 3VFMB 3QXAA 4M56A 1CDHA 3LQZB 3FFDA 2WWMD 5KEZA 3BYTA 3UTPD 3RNKA 2ZD0A 4JFFE 2WLIB 5DFAA 3VB9A 2UY7A 1N6UA 2C34A 3LNIA 4MNGB 3MBEA 1JYWA 1CFVL 2QV2A 3IGUA 2FE0A 1YY8A 4Z8FH 4TUKH 5G4MA 4F3FA 4C55A 4DUVA 5BOZG 3S36H 4NC3A 1Q38A 1QLEH 4HS8L 5CO1A 4PS7A 1YEDB 2A83A 3QR1A 3VXPB 5CSBA 3H54A 3ML8A 3EXLA 5EZJA 3TLRA 4CC4C 3WDIA 3C6LC 3H7BB 5I8KH 4UOQA 4HWBL 4JO1H 1RVFL 4BFJA 4PWIA 5IUSA 2JI1A 4PB0H 1F4HA 4ZI8A 3VXNA 5IESH 5BVJA 5E51A 2XACC 4OM0L 4IS6A 3RTQD 5LKNA 1SLUA 3L4TA 1PW3A 1FFTB 4GRWH 1Q0YH 1HNFA 1MIEL 1MRFL 2DWEA 2WLZA 4AT6A 5H37A 3N9GH 2A4CA 1W15A 5JHLH 3V2YA 2NY6C 4NOBA 5GJSH 1ZPUA 2ZG2A 3ZKQD 2HFGH 3KGTA 4FGMA 3FPYA 2XA3A 1X4YA 3QQDA 4JDZA 4Q9RH 4F2ME 3RVWD 5HYSG 4JHBA 1X6LA 4CSZA 5L88L 1XGTB 5F3HB 3GJFB 4R9HA 2IWFA 1OW0C 2YPVL 3E9UA 2J6EL 2JCCF 4IJ3B 3VFRA 5K5YA 4X7SL 5EZOH 4F7CB 5DTFA 4BZ2A 3OKNB 1K85A 2H0PA 2X3BA 2XWEA 5F89B 1I1RA 4JM4H 1ZV9A 2JH2A 4G9FB 4KJWC 5BRZD 3VD5A 3RZEA 4G8IA 4PSRA 3DV6B 2I1XA 3IFPA 5CJXA 2IADA 3C5SB 2ROYA 2Z8RA 4K3JH 2VE6A 4HJTA 5HVGB 4ZFGH 4XRCA 5F7HA 4YPGB 4K23H 1CIUA 1HYRC 3QI9B 5TQ2L 2UZXB 2EDMA 1P7KA 3O0RL 1KELH 5HJBA 2A9MH 4Z95L 2CWRA 3EJTA 1EGJH 1EAPA 4N22A 2NXZD 1K2DA 3A21A 1BOGA 1QABA 5AVZB 4P2CG 3SKOB 3EH4B 2WOYA 2H3NA 1TMCB 1BPVA 3D2UB 1IE5A 2IAND 1NC2D 1P84K 4OLZL 3K0WA 3NFSH 4LU5L 3IFNH 1NEZG 2WYIA 4DAGL 5IVXF 2WSKA 1KENL 1MJJB 2L3BA 4HKZB 5CS7A 4NX0A 4L3EE 4R4ND 4PB9L 5ESVB 3VGFA 4HEPG 4UQCA 4FMKA 1CFSA 1HHGB 3KEHA 3X12B 4RGMB 3MGTA 4GSUA 2DDQH 1JXGA 4KNTA 3NEEA 4KZDH 1FAKT 1NKGA 2OMWB 3QR0A 1GJUA 1UT1A 4NQXA 3HG0A 1ZV2A 1BD2A 4YHKL 2AXHA 4HLJA 1SDYA 2FGWH 4ONGL 1L9NA 3KPMB 5CZKA 5BVPL 1A5FH 4ZQTA 4NKDA 2BC4A 4NAMA 1DN2A 3ELQA 1JGDA 5C09A 3O9WC 1F3DH 4N6RB 1FNFA 4PJ8C 4XNZC 5CP3H 1BAGA 3OLDA 4FHKA 3S37L 3NH7L 4U6VH 5KVEE 4MWFB 3ZIYA 4PI2A 2X6AA 5FFGA 2LGNA 2XTSA 1EEYB 5DO2C 1E0PA 2XXCB 1ILUA 4GG6E 3CPLB 2YCWA 2AQPA 4R3SB 3S3DB 1DJWA 1PS3A 5HHOE 4CVZA 2XUWA 3HAEB 3WO4C 4PMEA 4WAVA 3DJ9A 2PWGA 3CZNA 4DKFL 3RJQB 1JP5A 4H25B 4XNBA 3U2SA 1FFOA 4BYHA 3MFFA 4F8QA 5MEND 3P0GB 5E8OB 1N26A 2VDOH 4FE9A 1KCUH 2J2ZB 3REVB 4MMYB 1FFPA 2NR6A 1A7BA 2DYPD 1JWMB 4CVXB 2DI8A 4LOUC 4HBQA 5LNEA 3VWKA 4PV1C 5CD3B 2HVJA 2ZE0A 2I21A 5FM8A 1HSBB 3VGAA 1UYWL 4ZYKB 3M1OA 1KN2H 5AKSA 1C1EL 1YG9A 2PNDA 4Q4IA 5KS9A 4JFDB 2COQA 1U95A 4V1DD 4L23A 3LKQA 2XC8A 1MLCB 2YBGA 3IN0A 4KZEH 5G4OA 2AJVL 3LKNB 5JOPD 3B9DA 2WZPD 2X1QA 4HD5A 4M7JH 4OLWH 1MCJA 4ADIA 4APXB 2XZCH 5I1CH 4XI5C 5E4IA 3NY8A 3TCXA 4OD2A 2CK0L 3SJVE 4DKTA 4JRFA 3WD5L 1SHXA 4WTZA 3ZQ9A 4QWWC 1TKWA 3MLRH 2R15A 1AZRA 2DQ6A 3DV4A 4JB9L 3BUBA 3P9MB 4APQB 1YY9C 3UTOA 3OQRA 2XQYG 1SN0A 4PS4L 4XWGL 1U6AH 3MXWH 2DI9A 4HJSA 1JTPA 4NBZB 2DBLH 5E9DB 2NQDA 2Y7QB 1EAOA 5B6ZA 1JUFA 5J1TC 3JYCA 2HVKB 3REWB 3B3IB 4WNSA 4H13C 4PGEB 1A1MB 1G0XA 4LLDB 5C6TH 1H68A 4AL8C 4PGDB 2JFCA 2O6EA 4XPHL 1AG0A 4ZS7L 1XSJA 3QAKA 2CQVA 3P11H 2W0KA 1NBYB 2WUCL 3KPPA 5FO7A 1DLFH 5JO5B 4ODSL 4H0GA 4R7XA 1Z5LA 5JYLA 3IXTB 4WFGE 4ENEC 4PVLA 1DQLH 2GJ6A 4KHTH 1QACA 2WXMA 3EOYG 1PAMA 4NN5B 4AMKH 3RFZC 1OGAB 1WGOA 2R29H 5SWZB 2VWEC 4HZ1A 5DGRA 4XPGL 2NSMA 5DVPA 4S1SH 4U3CA 3QDGE 1IGTA 1IGYB 4OQTH 5ADOH 4D8OA 2V2WA 1I3RA 1VACB 3GBNL 2CNZA 4PCSA 2BNQD 3CMOL 2E7MA 3C2SA 4HWNA 4QHUA 2YAPA 3UTSB 2JI3A 1DSFL 2YOCA 4JNXA 1ERNA 4MNQD 4J3BA 1L7IL 7PAZA 4WFFE 2APXA 1EX0A 3OGCB 1GHFL 3LEXB 4NDMA 3DX7B 3OLEA 4I8DA 2GSIB 1U30A 4N2AA 5G2DA 2X70B 2XJLA 4FQXA 1QVOB 4QO1B 1R24B 5DMJB 2I5YH 2E9JA 3QUZB 5HJ3A 1A7QH 3LPFA 4PLJC 5F9JB 4B9PA 1UZ8A 2CIIA 3TEXA 4HWUA 3NIFF 1P0SE 2VRKA 4IU2A 5E5MA 5C07D 4YLCA 2P5PA 5IK3A 3TEYA 1E27B 2NQCA 5I6KA 1SDAB 4OR1A 2XQBL 3V4UH 1UH4A 4OIFA 1YEKH 2IFGA 4G5ZH 3NUKA 4U1JA 4U2YA 1KGCD 3H9SA 4G5AA 5D7IE 4EI5C 4UQBA 3WEXA 3Q2VA 3RWHA 3HE7C 1UXWB 1MF2L 4XVJH 3L17A 5AYQA 4YAQA 4TQ8A 3VXSE 5ESQB 5HHXL 3K3QA 1B6UA 4WWID 3MO1B 5F7LB 5HGDA 3NSBA 3DMMD 3LZQA 5DUMH 4NKIL 3L3OA 5L8LB 1HXKA 4X8GA 1WFMA 3ARFB 3CBJB 3RTLA 4JJ5B 5HXMA 1BQHG 4RGNC 5EUKA 1E4XI 2AW2A 4AM0Q 2WQUA 3CVIL 5T1MA 1EEUA 3TBBA 4B7LA 4AIXA 1UJ3B 3VFTB 3QH3A 3DETD 1W0YT 4XXDA 3LPPA 3L4YA 5ID1B 4FQQB 4PJAE 4GW5A 3WTVA 3HHRB 4XVUD 1I82A 4YSCA 1TQCB 1C12A 2P5WB 2UXGA 5T3XL 3WHXB 4R4FH 3G5XB 4BEYA 4LFHD 4Y4HB 5DS8A 2R2CA 4DP2X 4XO9A 4FMVA 3V9FA 4X6EA 1MHEA 3UJIH 2HRLA 4AXWA 4HIPA 5C1MB 2DIEA 3HHMA 5L4JA 2NQ3A 5F7DB 4GKNB 1K5NA 3QUXD 1UZ6E 4IKJA 1OALA 2YSTA 2UY6A 3BD3A 2EH8H 2NNCA 3QUMH 4H26B 5E9NA 2XI9A 1VKXA 3DOIA 1X5LA 3W0WD 3QIBA 1EUTA 4HLZH 4OVVA 3X11B 1QTYT 3DVNB 2PCFB 4HIHA 1QFUL 4DH2A 5EOCJ 4HZLB 5K9KA 3V0GA 3WEBA 1M6OA 2K45A 1SGKA 1O5PA 3MV9B 4MXVF 2WJ7A 3CZKA 4PD4K 1BFVH 3Q5OA 4QRSA 1P1ZB 2QSTA 1XSOA 2J1KA 5I76B 3ZYZA 2W91A 5EN3A 5AOLA 3OKOB 2EDYA 1T4KA 4X6DE 5LAXA 3FFCD 4CMMB 4P4KC 3EJZD 2XKUA 4GAGL 3BW9A 1BJMA 4WKZB 5CILL 4H5SA 1D6EA 4IHOB 5J9PA 1OTTD 3G08A 1Q0XL 5J89A 3ZE1F 1CLOH 1F58L 1UCTA 3B7TA 1OM9A 2APVA 5ITFA 5IG7B 4YXKH 4YSAA 1JXKA 4HBCL 4TUJB 2DW5A 4HUMB 4KKNA 5E6RB 1KJ3L 4KU1A 4HG4K 4RAUA 5J6SA 1HQRB 4K2UH 4DAJA 4BA0A 2YJLA 3SYCA 2LABA 1I1AB 3MRFA 4L8SC 2BRRL 1JZEA 3N85L 1UWEH 4OI9A 4JJOA 1F4YL 2J56A 3FB6B 2X10A 2L7EA 1TTFA 3L5IA 3MA9L 1SEQH 5DT1H 1PZ5A 5GGVY 3ZO0A 2BCKA 3IMTA 2XX1A 1H9DA 5HP5A 3NCYS 1AQMA 2A83B 3TIEA 3ZTNL 4IDLA 2CKBB 5AAWA 1DQQA 1W91A 4GJTB 1C8QA 2D0GA 5FPIA 5I19L 1R3HB 2DIJA 2F53E 3L1EA 4R8WH 1ZWIB 4W9HC 2Q1EA 3N1PC 2Y07L 3UCRA 3C5XA 3D0LA 4FFWD 5HY9A 4U1MA 3KXFB 2VC2L 4GS7C 2DWSA 2WQWA 4NSKB 3JWDL 5B2NA 4PJHB 3ARBA 2AQ1A 2XKSA 3I9GL 1IO4C 2G87A 5DQJB 1JZ2A 3LPWA 2ADJA 1TTAA 2WVVA 5J12C 2WBJB 1OTUC 4QKTA 4XE5B 4LBEA 5AW7B 4LT7A 2YO3A 4NGHH 1E40A 2VDQB 3JV6B 4WNQA 1RJZA 2K4WA 4Z77A 4PJBB 1XEDA 1QBLH 2JELL 2I20A 1GAFH 2M1KA 3K2UL 2WXNA 4XTOA 1PY4A 2B4CL 1R19A 4RRPG 4MJID 4XTRC 3OMIB 1FIEA 2XOTA 4BZ2L 2Y06H 4UIKH 4O02H 3U4AA 2DJUA 1LEGA 3KWXA 3A4EA 4RAVA 3C60B 4ODVL 2X2UA 3LIUA 4EKXA 2XHNA 1XB3A 1Z0NA 1U8LB 1ZDQA 1U8HA 1H15B 5E8DL 4B9IA 6FABL 3HANA 4PG9B 5FW6A 1J12A 1J0YA 3ATAA 2UZYB 4G6FD 1G7PB 1FL3A 5H37G 3RBSA 1N2RA 2AQ3A 2CO4A 3O8XA 5CKAA 2AJSH 2NYZA 5BO0D 1RK0A 3HZYB 1BD2E 1WA1X 4NZJA 3WN5C 1YAIA 4B9KC 3DX9A 3HFML 3NK3A 5I6XB 5AENA 2Z0BA 2HTLD 4CC0A 5I73B 12E8H 3UPAA 3B34A 1E28B 1B6DA 3WI9A 5D1QB 3CX5K 2OZ4A 3OE9A 4OJYA 5F7KC 1I9IH 4QTIH 2VM3A 3H8NA 3UPCA 3IJ7A 5ITBH 2WXHA 1BJ1H 3Q05A 1JFPA 5EBMB 3ME0B 1G43A 4GO6B 4OZFH 4S2SA 2BVOA 4WY7L 5DS1A 5IY5B 4YGVA 1S8LA 1MHPH 4BQBA 3CFDB 2HT4C 1PVHA 4IRZH 4B9YA 4MAYC 5CSZA 2K78A 3DHJA 4M6OL 5B22A 1DVSA 1KWGA 3BPNB 2EIDA 3IXAA 1RZKH 3Q8AA 2IPKB 5E2JA 1V05A 4HJ0C 4NN6B 3OL2A 3MODL 2GJRA 3OPUA 3TT3L 3CSTA 2OMXA 3CSGA 4GXVL 3MV7E 2DTMH 1A6AB 3MGTB 4P2QB 3B9AA 3GHEH 4XHJD 1NGQL 4JANA 2H1PH 4FQIH 4P0DA 4YVNA 3KBFA 1IBHA 1Q9LA 1UD5A 3RGVB 4DVRL 3CHOA 3RIKA 4TOYH 1T89A 1FFQA 1XIWD 4FXGA 2YRPA 4LLQB 5HHVL 4JHWH 4RBPK 3FCTA 4O51B 5E4AA 1SMDA 1NGPH 5ECGA 2EQDA 4DERA 5ID0B 1D5BA 4LP5A 4NKDB 2FH6A 3HNTL 2OSXA 4BSVB 5C09B 2AS5M 3QCVH 1CWQA 4KNQA 3J7HA 4OTXL 3PJNA 3KS0J 5G5DB 3V4VA 4JG5A 3MROB 3GUTA 5IVZB 2BIQA 4NQDD 5EMYA 4PJ5E 5GS0D 5AYUH 4HISA 4X8CA 2NYYC 1JF1B 1M6UA 1T1YB 1CQKA 3OAYK 4FI7A 2WJLA 3HE6B 2Z4QB 1MWAH 1P4IL 4G6KH 2GBTA 4PJFB 4JGUA 5SWSE 4EJ1C 5B6WA 4NQEA 3FCUB 5E2TH 5IR1A 4L0PB 2R1XA 2IWEA 4X83A 4PV9A 2QTEA 2Z9TA 2EECA 3I50L 1GYUA 2EC8A 4Q89A 3CH1B 4YZWA 2WO3B 4L4TD 2P26A 4G3YH 2EC9T 3MFFB 3VX0A 4U1LB 2YZ1A 5D2LF 4LHUD 3UYRL 3ZKNC 3ENEA 4H8HA 1OAYH 1RL1A 3SOBH 4BGDA 5HYJE 2KSBA 1ZA6B 2VMFA 4G7YH 3QBKA 3T65A 3OHXC 5E2UL 5MEQA 4W70A 3NIDB 4UT6A 3NJHA 3V95A 1L0PA 3RDTA 2WQ8A 2VR6A 1UKTA 3MLWH 3QSKB 2IAMB 1R47A 4DEPC 2C1PB 2GJ6E 4AGNA 4X9BA 1ZVSA 2J55A 1RJCA 5HI4C 4MB4A 5D93B 2FYYB 2FJFB 1A4AA 4ZMLA 1UWXK 3V5HB 2Z31A 4M3HA 1KGUA 5ICUA 4JO3H 3GPSA 4ZPVB 3SPHA 1FZOA 4ZMWA 3I6KA 3BPOC 1FIGH 4PWGA 3LCYA 1GS8A 1F56A 1KJMB 2AABL 4HKXB 1UTDA 3WQJA 4UIMB 2C9QA 3PWVB 3ZPDA 4LB8A 4YDJA 4ZUWA 1FN4B 4OD2B 5DZPA 2V5TA 3FT2B 5A6MA 3INUH 2CM6A 4YDIH 4UTCA 2ITDA 4M4RA 5IW6A 4IDJL 4POZC 2DZEA 3X14A 1OM3H 4FLOA 4M8QA 1ORSB 4XXJA 1F41A 2DLGA 3EJJX 4L1HA 2CDFB 3BRGC 4O2FA 5F9OH 3QJVB 1R5IA 1J8HB 3H3PL 1RURH 4JQIH 1TEYA 1NQBA 4YLBA 1IL1B 2VR7A 2X3AA 3IDJA 5E8NB 5H2LA 2HFGL 9CGTA 5G28A 1VJSA 4G8GD 4Y2DC 1O6VA 4YO0B 4Q9RL 2DQHL 2G4GA 3PWUA 3APDA 4GRWB 4JY6A 4P3WA 1U3HD 3B6SA 3DX6A 4WTZG 4GLRH 2H6PB 1K4DA 2Z65C 4HKJB 3RZCD 3ILPA 5T33L 2JNZA 5D1XA 2OX5A 1BLNA 1ZJAA 4P4RA 1GZHA 2PTUA 4KJYA 4YWGL 4LSTL 3MRQA 1O9WA 4UM9A 4HX1A 3TJHD 4U1NA 3MLZH 3KPQA 3F05A 1NC4B 3T3ME 1QKZH 4A2MA 2R0KH 1TZIA 1ZEAH 4E36A 3VXQB 3B2DC 1DCEA 4ADGA 4FG6D 3MBEC 1JI1A 5E00B 1BBDH 3Q2LA 3FCSA 3U7WH 2Y5TA 2BW4A 2CALA 2CHNA 4XNXL 4L2LA 4Z7UB 4R26H 1X5XA 4RIRA 4C4BA 2HPYA 5I15L 4PREB 3BIKB 4H8WL 3X1NA 1THAA 1CDGA 1ZTMA 2ADGB 2G5RA 2XV6B 4MLIA 3RNQA 4RMBA 4YPJA 3HC3L 4P2RD 1F6AB 4Q52A 4FNRA 2C9XA 4ZTPH 1E7UA 4A2DA 4HWEH 5I2IA 1VADB 4FERA 3K0YA 5CGTA 3PAZA 5DK2B 1CD8A 5EEUA 4JFQB 4OBRA 2PR9A 4F7PA 3D39E 4GPVA 3SDAA 1KGWA 1GA2A 2P8MA 1SDDB 4QTFA 3ZUCA 1X7SA 4FKKA 3WEXB 4LLVB 1UZGA 3JWDC 3FONA 2YBRB 2LTQB 3HC2A 2DDQL 5FUZL 4FEMA 1ODAA 2V3FA 1L9RA 3S8GB 3CDYA 4KZDL 4HYJA 3B43A 3C5ZB 4KROC 5D4QA 4QLRA 3RWEA 3S35L 4UQEA 2ITEA 5HBBA 4AUJA 2VLKA 3ISYA 4XP1H 2Z8VC 5HGDB 3KZ8A 3PGCB 5IV2B 4I48B 1NCCH 5I30H 4LSRL 4Y2NA 3LZPA 2WUBH 3BKCL 5T1MB 5B6VA 3STBA 4OAWB 2B4CC 2FWLB 1MGYA 2CO2A 3EOTL 7CGTA 4WV1A 4XXDB 2Q86B 3VGHA 3QQNA 3BQUB 4LRNH 4O9HH 2LW3A 3HPJB 4Z7VF 2IH8A 3SODB 1TENA 3IETB 3BAKA 5CJXC 4J23A 5JR1H 4QJ4B 3BZFB 3INOA 2Z7UA 1A6ZB 2R4RH 5E2WL 3U1QA 4D9LL 1MH5B 1SM3H 3PY9A 5BRPA 3QNZB 2YWYA 2Q76B 4HIIA 2XY2A 3H9ZA 3OKYA 4YHPA 5DS8B 2XG5A 1JPSL 3DURB 4G9FD 2X6CA 1AGCA 5DRWB 1M0MA 1CFBA 1EAQA 1AZBA 5DU7A 4AUYA 3N2JA 2IF7A 2B8OT 2WCGA 3AG3B 3TEWA 2BSRA 2R8SL 4IBVA 3LDBC 1DVQA 2XNAA 3LJ3A 4K0OA 3VFWA 1Q72H 3QI9D 3D06A 2NUTB 3NEOA 2H6OA 3L6FB 5KTEL 5A44A 4GSRA 5AWNL 5A2AA 3IMBA 3IPBA 5AZ2H 2ZCZA 5DC9B 5KYYA 1ZJBA 1NH6A 1KB9J 2IBBA 3LNHA 2FD6H 3U2IA 2VDOB 2Q7YB 3D2UD 3GMPA 4MQXD 4HCIA 5C0AB 4K3DH 2ORBH 5H35A 3C2AH 3F7QA 3MRPA 4ELMB 1OSZB 5I5RA 2XV3A 1K8DA 4QGTA 4BZYA 2CO3A 2P48B 4M7JL 5D96C 2RQ8A 4JZNA 4RCAA 3M7FB 2XZCL 2Z92A 3O6LH 1MZZA 5ITFB 1T1XB 1KXHA 1RFDH 2WXJA 5IB3A 2WBWB 4YVUA 1FYTB 1RJLB 2WGXA 4UV7L 1Z3GL 3GO1L 1IEBA 4JMNA 4LBAA 3CODA 2VZSA 3VFPB 3U0WH 3O4LB 4KV5E 5DGQA 4EDWH 4MJHA 2XN1A 2VL5B 5T8IA 3SZ6A 5C6PB 5JXAH 1AGBB 2I69A 3R8QA 2C7UA 4BWWA 3BN9D 4UQAA 4LIQE 4CUCA 1WBYA 4AIEA 3ULVD 3VG9A 2ZT9C 4ATWA 4TSCH 1XGUB 5DHEA 4I77H 1YPZA 1JE6A 2CBMA 2M26A 2Y5EA 3PHAA 3MOAH 4RBPH 4Y16B 5IF0A 2I9TA 1F18A 3RWFB 3U6XS 1DLFL 3WCYA 1XZ0B 3MRHB 5AOJA 1FNEA 2ZPKL 1MG2C 3RL2A 1NGWA 2MTAA 4L8BB 3LKPB 4R7VA 5AUMA 2NY0C 4A7GF 5JIIA 3VDBA 1T1ZB 4WK4B 2V8LA 2NR6C 1TYRA 3QWOB 4KHTL 5HY9B 2DQFB 1RIHH 3HC0A 2WV3A 3QEQA 1LL1A 1J0HA 3K80A 3ZKMD 3V8OA 4AMKL 4WUUA 2PPAA 3D48R 3NTCH 4MBOA 1YYLL 3VWKC 5DK0B 3GRWH 4WKXA 4JVUA 1WZ1L 1MG3C 4ZMNA 3VGAC 4QHKI 3DTUB 3OAYH 4JQ6A 2UWEA 3ZDYB 1I8KB 2ZOOA 2FVNA 1KTCA 4PJXE 1Z9LA 1DVZA 2PN5A 2XZAH 2I07B 1T1WA 4IOSA 3C09B 2B39A 4AEIH 3D4YA 1N3NB 4DW2L 1QI3A 5CHNA 4JFOA 4MQSB 4JZJB 4NM4L 4YC2B 1N59A 1U8QB 4EOWH 3CFTA 3GRGA 5CSGA 3MRMB 1CICB 3TU6A 3ZT6A 5A2LH 4AIZA 2J73A 4M93B 1S7SA 1R0AH 1U8HB 2VAAB 4JFDD 2YEQA 4FQPA 2X44D 4HJJL 4IBQA 5TF1L 5HPMA 3FTSA 3JBG7 1WUNT 1MFAH 4HUNB 1FL3B 2D3JA 2IDCA 2OZ4L 2E59A 3I6SA 4OB5H 1YEHH 3O8XB 3UJJL 3FU9A 1SVZA 4DIXA 4F37K 1RZJH 3QDMB 1U2YA 2Z1KA 3CVHH 4HPYL 3WL9A 5EDSA 1BVOA 3DX9B 4E41A 3BWAB 4N20A 2EVJA 4L9LB 4AE0A 1EEZB 3CK0H 1KTDB 4OZHF 4NERA 3QJRB 1GOFA 5BUPA 2EEBA 2KHAA 1NFDF 1UWXH 1F6LL 1KYFA 2ICWB 4XVJL 4APQD 1NMBH 4HAFA 3IKCA 5F1IA 1PLCA 3JQOB 4Z78B 1MFBL 4LOVA 3KHOA 1V7MH 1ADQA 5AOZA 2ZX5A 5GIRA 3OGOE 4W9JC 2GBVA 1VGKB 5I8EA 1B2YA 5E9DD 4NB7A 1LQSR 4F7EA 2R0WL 1ESOA 4XZ4A 4NQEE 1WEJL 1WS7A 2H32A 1GXEA 1A7NH 4PHXA 3HHSB 1IM3B 1T04A 2GCYA 3L1GA 4QKXB