4G7QB

Structure of recombinant cytochrome ba3 oxidase mutant v236l from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Structure of Recombinant Cytochrome ba3 Oxidase mutant V236L from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4g7qB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4g7qB02
1WA1X 1WS8A 4A2GA 1SDDB 2R7EB 2F95A 4BWUA 2YCZA 3NJKA 5DHGA 1CUOA 3RFMA 1S8JA 1TU2A 4RH4A 3GDCA 2PPAA 1UATA 4F7KA 5I28A 1Q5JA 1L9SA 1PZCA 1Q5IA 1MZYA 1W6LA 2YCWA 3TA4D 1JV7A 5LDUA 1V54B 1X0K1 4AKOA 2GI0A 2PCFA 1NPNA 2I7SA 2BW5A 1XJIA 2AFNA 1AQ8A 4N4WA 2BZCA 4WW3A 5FJGA 1A8ZA 1X9UA 5H2HA 3C75A 3TU6A 2PCYA 3X3CA 1ASOA 4X4KA 2VW7A 3T6XA 1AOZA 1XMEB 1J9SA 3NSBA 2ZOOA 4JKNA 4EA3A 3OE8A 1AZRA 4DP5X 5I5MA 3ABWA 4WKXA 4N4YB 4DP6X 3QJRB 4AKQA 7PCYA 2Y69B 2QDVA 3D12B 4DP8X 4YVUA 1P8IA 3NS0A 5A8EA 1QNIA 1SHWA 3FU7A 2CJ3A 4KO5A 1J9RA 5FC9A 3SQRA 4KO7A 5H2JA 3UG9A 3VW7A 1QHQA 3DKHA 1XIOA 5B7FA 4L35A 2UX7A 2H3XC 1S53A 1ET5A 1OE2A 2YAPA 3AW5A 5JJJA 3QAKA 2CAKA 3QQXA 3RYMA 3IE9A 1I53A 3V9EA 2B08A 1AT9A 1ADWA 3AG3B 1GW0A 2ZONA 1EHKB 2YDOA 1OCZB 1TEFA 2MTAA 2YAMA 5H2NA 4LDOA 5DYSA 3ABKB 5I6NA 2YAFA 3QJVB 1AR1B 4DP2X 1ET8A 1E30A 2ZWNA 1E65A 1RZPA 1QM8A 2KS9A 2VSKB 4DPAX 4GYBA 1KG9A 1ZV2A 3FT0A 2GC7C 3CDZA 3FPXA 1IXFA 2XYBA 3HEIB 1JXFA 3DQBA 1XB6A 1SF3A 2NRDA 2MRYA 3JT2A 1OOWA 2VM4A 1PNDA 4GBRA 1BXAA 5G28A 4DP0X 2PP8A 1QHJA 3AG4B 1AS7A 1SHXA 4DP1X 4JHUA 4YSPA 3FSZA 1F56A 1MG3C 1SDDA 2CALA 2R7EA 5I5JA 2YQBA 2GIMA 2IAAC 2XV3A 1S8LA 1BQRA 2HZHA 2IDTA 1KV7A 7PAZA 4JR8A 5D4JA 5B0WA 3WNJA 4KNFA 3G5WA 4QI1A 4BUOA 4CSZA 4YVNA 1BRRA 3FU7B 4KNSA 1UCQA 4NERA 2WO3B 3PAVA 4AX3A 1KCBA 3NJHA 3WKQA 4EF3A 3MBWB 2Q5BA 4L6RA 1AIZA 3S8FB 3CVCA 4BK5C 1AZUA 4E9SA 4HAKA 5AX0A 1DYZA 1AS6A 2EINB 5ITEA 5B7MA 3OE6A 4LDLA 1GS8A 1BQ5A 1FBBA 1NIDA 4YSSA 1L9HA 5KKHA 3WG7B 4JQ6A 3FQYA 3VGAA 1V10A 2I1XA 2CCWA 3X3BA 2CUAA 2XX1A 3T6WA 2FQEA 1A4BA 1NZRA 4NAJA 2XVBA 5A44A 2LNLA 5AWZA 2PPDA 2EI4A 3HAQA 3X1NA 2H5UA 1IKOP 1FFTB 3DIVA 4MBSA 1PY6A 2J57A 3DTUB 4UAHA 5G53A 4K5YA 4KNUA 2HX9A 3OMIB 4DPBX 4KOCA 3UAEA 2VT4A 2XXGA 5B6VA 4Q89A 4XTNA 4BV0A 1CWQA 3OD3A 1MGYA 5H2OA 3CZUB 2I35A 2JAFA 4MQSA 1A4CA 1URIA 3BVDB 1AAJA 5JJEA 4WAVA 5B6ZA 1GYCA 2NTWA 2H47C 1W8EA 4GP5B 3QAPA 3DDLA 1HZXA 2DYSB 4HHGA 4YSQA 2IWEA 4BWTA 2I20A 1PLAA 3L45A 3T71A 5G2CA 4IB4A 5H2MA 2X72A 1GZMA 3ZDWA 2QPDB 4G71B 3WIAA 1L0MA 3REYA 4QRYA 3V2WA 4F2EA 3GYRA 3H56A 4E9RA 1QKOA 3NJGA 2HRHA 3UONA 2UX6A 1H2SA 1PLCA 3AG2B 3FS9A 2KSBA 2PP9A 5I6MA 4W9ZA 5I6OA 2FNWA 4ZK8A 3SN6R 3MBVA 1AACA 1R2NA 1M0LA 3ODUA 3QJUB 3VHZA 1NIAA 2YCXA 1T5KA 2EIJB 3KJ6A 4BXVA 2IWFA 1L9RA 2G87A 2PPCA 3FQ1A 3OE0A 5ITCA 2DY2A 1KYAA 4AZUA 2YAHA 2VW6A 1PZAA 4N8UA 4CSPA 4BDVB 1L9PA 1S52A 1CURA 4MFHA 2I85A 3WI9A 2PPEA 1C3WA 5BR2A 1PY0A 3HARA 2AZUA 4Y9HA 3ZEVA 1NIBA 1RZQA 2JFCA 4W1TA 3QJTB 1XB3A 2EIKB 4MD2A 3UGEA 4TXVB 4HWLA 4DJHA 3EH3B 5I6PA 3SBPA 1M0KA 5AKRA 3FSAA 3OMAB 4KOBA 2QDWA 1F88A 5JJNA 1H68A 4XT3A 1OV8A 2FWLB 2XU9A 3UTWA 1HAWA 4HCGA 4YSAA 3NJMA 3UTVA 1OF0A 2FT7A 1BYPA 2ZXWB 1BM1A 2ZZLA 2JKWA 2W88A 3NJIA 1GS7A 5F7BA 5G54A 4BXSV 3FQ2A 1BXUA 1BQKA 2BHFA 4L0PB 4GRVA 5I6LA 2B3IA 1X9RA 4JKVA 1YLBB 2P80D 1VGOA 2E86A 1FWXA 2XV0A 1JERA 2W8CA 2XLLA 5F7AA 5B1AB 4G7SB 5E9NA 5B1KA 4BWWA 4A4MA 4ENZA 5B1JA 3EF4A 4FA7B 1KBWA 1O0AA 4DP7X 1A4AA 1GSKA 4XTLA 1ETJA 1M57B 8PAZA 3FSWA 1NPJA 3V9CA 1S54A 2WSDA 4OV0A 2X87A 1PCSA 1JXGA 2GHZA 4PXFA 1J9TA 3C9MA 1VJMA 3T9WA 5LWEA 5B1JC 1KG8A 3AYMA 1KDIA 2VMJA 5D4HA 2IH8A 2WO2B 4PAZA 4A67A 3WQJA 2BP0B 4GP4B 4UF7C 3V2YA 1PLBA 1ZIAA 2BZ7A 3IEAA 1OE3A 3QBIA 4HCFA 4DPCX 4IAQA 5BR5A 3ZPRA 1J5DA 4F2FA 3PDSA 3VG9A 2DYRB 4HALA 2Z73A 2FT8A 2DWTA 5B6WA 2F93A 2J56A 2OV0A 3CODA 3OMNB 1NINA 3X2QB 2I7OA 1NIFA 3UADA 3X1EA 3PWHA 2BWIA 1JVLA 1PF3A 4DAJA 5PAZA 2IDUA 1B3IA 1RCYA 4HIPA 3ERXA 5TK2A 4NC3A 3T6VA 2Z55A 1PAZA 1KDJA 2GC4C 4LDEA 4DP9X 3SBRA 3SBQA 5PCYA 1LN6A 4BDVA 3QJQB 4UHRA 2Q9OA 3FPYA 1GS6X 2RH1A 4E9VA 1SFDA 2YARA 1J9QA 3ABGA 2WJKA 5TK4A 1OCCB 1GY1A 2OCCB 4YSUA 5A45A 1AANA 2FTAA 3TBCA 3BQVA 1TEGA 1PZBA 1JZIA 2LLNA 2BRDA 2UXFA 2PEDA 3C9LA 4AMJA 2HLEB 4BEZA 2KSYA 1KBVA 1AG0A 3UABA 4EJ4A 4YSRA 2I21A 4AKPA 1TN0A 5H2PA 2DWSA 1E12A 4GXFA 3CVBA 4KLYA 3PAUA 3PCYA 2WJLA 5B6YA 2VSMB 3GXUB 3NSCA 1JZJA 5AFAA 2GB2A 1WAEA 5H2LA 2M3GA 2RACA 3ASOB 4QKTA 4JHVA 5TGZA 2GSMB 2Y02A 3MX0B 4UANA 3ASNB 3ZIYA 2IDSA 6PAZA 4GP8B 3UAAA 1JFPA 1OE1A 2JXMA 4G7RB 4P5RA 5C1MA 1MG2C 3NSDA 1CYXA 2Y04A 2AVFA 4BVNA 1C8RA 1M56B 1M9WA 5H2KA 3QBGA 1MDAA 1N68A 4A2EA 2IDQA 1AP9A 1SJMA 1HFUA 3PXLA 4GPOA 2N0MA 1IBZA 2PP7A 4E9TA 4FPDA 1BXVA 1PNCA 4G70B 1SFHA 2BP0A 1NWOA 4YSEA 4NB7A 1IBYA 3NY9A 2TSBA 3HASA 5ANHA 4Q8BA 1DZEA 4TL3A 3T6ZA 2A3TA 2Y00A 3N55A 3OM3B 1JXDA 3HAOA 1P8HA 1GUEA 5B1BB 2HXAA 5I5IA 4M3HA 1F4ZA 4DKLA 2BP8B 5B35A 1NIEA 4IARA 1KCWA 2YAOA 2X88A 4FBZA 1GY2A 4QIDA 1JGJA 3S3BB 1GU8A 3NJLA 4K9JA 3QBLA 3AM6A 2IH9A 3HANA 2UXVA 4MQTA 1L9TA 2IDFA 1BAWA 2HPYA 1SF5A 1JZEA 2J55A 2VN3A 4A2DA 3X1GA 4E9XA 1R84A 4YSDA 3AYNA 4A66A 3FYEB 4FAAB 3N2JA 1WA0X 1UAZA 3NJNA 2CBPA 5AZDA 3QBKA 1NDTA 5B3SB 3QDCA 1E5ZA 5F8UA 3WNIA 2HX8A 5I6KA 1JVOA 2DV6A 4MD1A 4YL4A 1JOIA 3H4HA 4AMIA 3NT0A 2OJ1A 1BRDA 1W6WA 4E9QA 5G2AA 3S8GB 2ZFEA 1C8SA 1AG6A 3NP4A 3EH5B 3ZX1A 3S3CB 2XV2A 2J5WA 4HYJA 2QPEB 4J4QA 5ETZA 5AZUA 1F50A 2AANA 3IN2A 2UXGA 2XUWA 1TKWA 4E9WA 3PAZA 2VW4A 4GY4A 1L9OA 1NTDA 3FU8A 3OAXA 1PXRA 2NTUA 1EZLA 3ABLB 5AHYA 1IC0A 3AG1B 5G36A 3PBLA 4A68A 1DZ0A 4DP4X 1ZDQA 4YSTA 1X0I1 3PXOA 1NWPA 4G72B 3FSVA 9PCYA 6PCYA 4EIYA 2BO0A 4X32A 1KGYE 3HB3B 4X1HA 2HX7A 1NICA 3JTBA 5J7AA 4G7QB 4WTQA 3UTXA 1ZIBA 1BYOA 3FU9A 3VI0A 1QKPA 5DHHA 2EILB 4XXJA 4BWBA 2VM3A 1PXSA 4GYCA 1WS7A 2AZAA 4XTOA 1AZCA 2P80A 4AI7A 2Y1AA 3X1FA 3NYAA 1ASQA 1JZHA 2FQGA 3IN0A 4UG2A 2R4RA 1A65A 1OCOB 4HCIA 2YAQA 1BEXA 1JZFA 3FYIB 1MZZA 2PPFA 1VLXA 1E67A 1M0MA 5AX1A 3NSFA 1IW9A 3AZUA 1JV6A 4HHWA 4BEYA 3NP3A 1FBKA 1U19A 1ILSA 1ID2A 2BWDA 1BRXA 3RZEA 3QJSB 3NY8A 1IUZA 3AY2A 1P8UA 4KO6A 4KNTA 3HAPA 3S3DB 2QT6A 3CG8A 2XXFA 3NJFA 1ASPA 3UZAA 3ZPQA 2TSAA 2BP8A 1CC3A 5IY5B 1ILUA 2R4SA 3EH4B 5G2DA 2YXVA 4QLWA 1J5CA 3PPSA 3T45A 3IBOA 2HRGA 2EIMB 1SNRA 3KW7A 1E0PA 2YAEA 2GBAA 5EHFA 4E9YA 5D4IA 5B6XA 3A7KA 3OQRA 3WKPA 2Y03A 1FA4A 1ZDSA 2FT6A 3NSYA 1PMYA 3KW8A 5B34A 3EMLA 2PLTA 1A3ZA 4PCYA 1N70A 3EHBB 1E5YA 3H4FA 5I26A 1XB8A 2XX0A 3NJJA 1KMEA 3UZCA 2AT9A 1WA2X 1ZPUA 3NYKA 3X1BA 3PQRA 3CVDA 2IWKA 2ZIYA 1AZNA 4A2HA 1L9QA 2L6XA 3D4SA 1V55B 2FJSA 5B2NA 1CYWA 5H2IA 1R1CA 1AS8A 2FQFA 2Y01A 3CAPA 2J4YA 3UTYA 4P5SA 1GR7A 2BW4A 3P0GA 4HYXA 3U25A 3UACA 2YCYA 2XWZA 1QLEB 2UXTA 4YSCA 4M4RB 4A2FA 3QPKA 2KSAA 3ABMB 1ET7A 2YDVA 4HZ1A 1IW6A 5A7EA 3COCA 1OCRB 3CDZB 4N6HA 3VVKA 3PLYA 5EN0A 1HAUA 3ZBMA 1AZBA 1X0SA 1JZGA 3TBBA 3OE9A 4YSOA 4X31A 1TN5A 1RKRA 4PXKA 2YXWA 1KGBA 2FQDA 4KO9A 2JAGA 5B7EA 3TASA 1S51A 4XT1A 5AHZA
chains in the Genus database with same CATH superfamily
3Q13A 4PJFA 5EO1B 1SJEA 4DQAA 3LN4A 5DJCA 1FFPB 3D18A 4JR9H 1ESOA 1DBBH 1NCCL 3LNDA 4AH2A 3BGAA 1WUNT 2CIKA 1TQSA 4R7XA 4HMCA 4WNQB 3OMZA 4AEEA 1ZLEA 1QZNA 1W15A 5M94B 4PJ5D 1FAIL 1PZ5A 3D34A 3SKMA 2CKBA 4GIOA 3DVFA 4MD5A 4TUUA 4NKOB 2AFNA 3P3TA 4RVBA 4ODTH 4OZGA 3TA3C 1R24A 5JPNC 1Y6MR 1V7NH 1ZANL 1QEXA 1NBZA 2VW7A 4JBSA 3T6XA 4ZUSA 1SVCP 2ITDB 4JY4A 1MIMH 2ZOOA 3VWKD 3OC5A 4JHZA 5FO7B 4U05A 4YGVB 5I73B 2YBRA 1CDBA 3IU3A 3CQPA 1OGTB 3LHPH 2HJFA 1MCHA 1RZJC 1XL6A 2OMUA 3O3AA 5GGSA 3VFGL 2W0FA 4IBQA 5KBPA 3BW9B 4HOXA 2OMBA 3MLSL 1Q9LA 1SLWA 1XIOA 5E9AA 1TZOA 4WKZB 3SDCA 1AH1A 3G6DH 3AC0A 5DMGC 4HJIA 4QTFA 1Y6NR 5CWSB 3ELAT 1MCOL 1WWCA 2F7PA 3AQDA 4OVVA 1QTPA 2PXYB 3CSYA 2ZUUA 1GAFL 3INOA 1NGZB 3CVHB 4KQ3H 1OSPH 3ZTEA 3VRJB 4JY5H 4QNPF 3IJ7A 4YXHL 1MI5E 5LNGA 3K8LA 1G9ML 2KS9A 5F88B 5LBSL 4Z7AA 3ZE1B 3Q2CA 2NXZC 1WWAX 3LIZA 2D2OA 1I9RL 5JXAL 1ZV2A 4HUXB 7TAAA 2GC7C 3RU8L 4MAUH 1GPOL 1RZGA 2XYBA 4KY1H 1J8HA 4NQDB 4CN4A 1AIFA 3NPSB 1J1OH 4WJKB 1IEBA 2NRDA 3SQOL 1I7TB 3H2WA 1ZHNA 3L9RA 4GBRA 2AXFB 3KEHA 4AT6A 5ACLA 4HUCA 1AS7A 3FSZA 3GI9H 4U1KB 4OGQC 2FBJL 3C2AL 3S5LA 3TNMB 1HOCB 3US9A 3HI6H 4GAGH 4FFZH 3X3GH 2X9ZA 4L37B 4X9YA 5EH1A 3HUJE 3NIDE 7PAZA 2VXQA 1BPLB 4B9IA 3FB7B 1FNSH 5AW9B 1IM9B 1UCQA 4NERA 5DD1H 3W37A 5B4MC 3MBWB 2RR3A 4FQPA 4W9KC 3ZW3A 4BK5C 3GJEB 4PREB 1B4TA 5EU4B 4LDLA 2A9MH 3HAEG 4Z5RB 3FUEA 2VC2L 4JQ6A 1RSYA 4ZS7H 3SQBA 2WNWA 4O02H 1OANA 2XZZA 2Y2WA 3D51A 3QRBA 3TBYA 4KJWC 1HH9B 3CZFB 3V6OE 4BEIA 1N3NA 2LNLA 2CUMA 2EABA 1H5BB 3MGTA 3S96A 3VCLA 3JV0A 5AD0A 1AQMA 1QFWL 1N59B 1UZ8A 3ZN6A 4DEPC 5EC1A 5A6MA 3UAEA 4OD1H 4U33A 5C0JB 1KPUB 4KH9A 2Y0SA 2CO7A 3MRIA 3N40P 4M61B 4WI0B 3ULVC 4XNMB 3LMJH 4L9LA 2I35A 4YLBA 5EEVA 2QPUA 4UIKH 2QZQA 1AAJA 2R2EA 1S9YB 3MUY1 1FZMA 2BERA 2GI7A 3IJHB 4BGLA 5B39B 2NR6D 1RUMH 3VSQA 3EOBA 3GJFK 4ENED 1HIMH 4GMSH 4R4FL 4EVNB 5JQIB 4GBXA 4I5BA 1FYTA 4XVTH 5IBUG 4AYID 4LL9A 1IVLA 1U8MA 4KXCA 5A40E 2AK1H 4U3CA 2HRHA 2RA1A 3UONA 1QSEE 3FTGA 3AXLB 5IMKA 1VFUA 1SJVA 3VX0A 4PGBA 1JIBA 3AFLA 1CLZH 1K8IA 2WQVA 2YEVB 2P5EA 1AACA 3QXAA 1IAMA 4ZODA 2HG5B 2WN2A 4C4KT 4RGNC 3A6CL 3VFRB 2QR0A 4OZHF 3QDHA 3TJHC 5HDQH 3LX9A 3WFCL 4L48A 2R69H 4PRHB 4HWEL 3WI9A 3MI6A 1DJHA 4JM0A 2IIJA 2JFCA 2MPAH 5EOCL 4PLNC 3FFDA 2VERN 2YPVA 4J8QA 2Q6WB 2LOEA 5DUBA 2R4RH 3F5WA 4OU3A 1BVLA 2QGEA 4XN9A 4AEFA 2CR3A 1V8HA 5HD8D 1A1MA 2SODB 4LMQI 4B9PA 1I1AD 2ZX7A 1S9VA 2EYTB 4LSVH 1ZVNA 4L8SA 1HILA 1EJOL 1NGWB 2PR4H 2Y3AA 3TO4D 2WOBA 5F7BA 4POZC 1DQVA 4HWZB 1ETZA 5CHNB 4AUJA 5TF1L 1DSFH 4QJ5B 5ECGA 4X50A 4OBRA 4JKVA 1T4KA 3QDMA 4U6XA 2BH0A 3HAEA 1I1RA 1OTSD 1HT6A 5F1OB 3H0TB 1AJ7L 5GJTL 4TNVK 5DHYA 4L8BA 4IGBD 5EUOE 35C8H 3P0YL 4N2KA 3UTSD 5J3HC 5B1JA 4BFIA 1N19A 4DPRA 1O0AA 1ITCA 5A7BA 1ETJA 3EZJB 1T89A 5CCKH 3FSWA 2CGZA 3QULA 3QO1B 5K9KB 1S54A 1G6RH 4G7YH 1UWGL 3AT0A 3FO2B 1J9TA 1PD6A 2GY7B 2LAGB 2GK0A 2UVEA 3L95B 3KM1A 2VMJA 3W82A 1CDYA 4P9HL 4LK4A 4MS8C 1PLGL 5AW4B 3VD4A 3FCSB 4A67A 1BJ1J 1G0YR 2LTQB 1IGTA 4KVNH 4U3SA 1BBDL 4C8XA 1PLBA 4LIQL 3S34H 2K3TA 6FABL 2K6ZA 5E24E 1F97A 3QUHA 3S0PA 3GBNL 4N3TA 3VG9A 3D1MC 1AKJB 2WOYA 3SE4C 2DEWX 4AMKH 4DQOL 3TEYA 1IGML 3TNNB 5EUKB 1MQ8A 5IB3B 4JQIL 5I76A 4UOJA 3L08A 4HH9A 4LCVA 1R17A 4K94L 3LEVH 5E5UB 2BVQA 4FQLL 4PP2A 4S1QH 2LVEA 3CSFA 4GIPD 4M1GH 1FUNA 1KBBA 4ANKA 5TK2A 4OZHB 4PH8A 2Y07L 1TYRA 5IROD 1JRHI 3O4LA 2Y6SD 3SBRA 3PHOA 1BLNA 1E4WH 1FZKA 2CK0H 1IBFA 2NUTA 1YN7B 4HDIA 3HFML 3X13A 4OTXL 4H8UA 2WJKA 3MRHB 4FJ6A 1LP9E 1ZOXA 2FLMA 4DFHA 1Z3GL 2V5YA 1DVZA 3BQVA 4X4YB 5D2NB 4R3SA 1N7MH 4XNZC 4FQCL 1OAYH 1UXSA 1RZJH 2VC2B 1UACL 1SXBA 4WO4A 4GW1B 2ZWSA 1XWVA 3MJ7B 1QASA 1RK0B 4JM2F 2YD8A 4KKAD 4TSAL 4PJXA 4KLYA 1JVKA 2ZAHA 2WJLA 4CVXB 1IKFL 3GMMA 2EXWD 4XNAA 4P4RA 1HU8A 4QXGH 3D25B 4OCSH 4ZAKA 4QKTA 4JHVA 5TGZA 4IKNA 5MERA 3UAFA 1DBJL 4UT7H 5F1SA 3FT3A 5IR1B 3BESR 5EZPA 4ETQA 4G7RB 4FFZA 3R1GH 3NPZB 2E7LA 4M7KH 2RCSH 3WDJA 3K6OA 2AQ1A 3U0WH 1BG1A 3BFOA 3R0MA 1DQIA 2Z4QA 1VDGA 1C5BH 2Z1PA 1NEPA 1YEIH 2BHUA 4MQXC 1LO5B 1SBBA 2JKRM 3LPPA 2G30A 2G5UA 2VR4A 4DZBA 4JFHD 3NCFB 4G70B 1SFHA 3GMNB 4ZPTB 4ZFGL 2WLMA 2BX5A 2P5PA 1IGFL 4H88L 4M9PA 5ANHA 2VR9A 1F11B 4RISL 5IVZB 1HHJA 3SDCD 5JHLL 4DKLA 2AJZA 2ZOUA 4ZOEA 2FATL 3ZGIA 4NOBA 1KCWA 1WSST 4O02A 4XNUL 4Z9KB 3F7YA 5IT2L 4NO3B 4DAGL 3JZ7A 4JB9H 3WE6A 3BP6B 3D7PA 3MFFB 5BVPH 4R5TA 1T1ZA 1NGPL 2DD8H 2CXKA 5BQDA 3VD1A 5IBLC 2FB4L 2WXQA 2I07B 4N5ED 3X1GA 3ILQC 3QWRA 4PTTA 4FAAB 1KLFA 5KSVA 3ETSA 4HIIA 5IOKA 5TDNB 2BNUA 4QRAA 5I0VA 4PB0H 5BRZE 5ESQB 1J8HD 3GPEA 3QDGE 2NNAB 2J8HA 1GCFA 1JTTA 1U92A 4WGVB 3P0GB 1JYVA 3NP4A 2WZAA 4PU2A 1E9QA 2J5WA 5DS2A 4LVOC 3FT4B 5CINH 4BHUA 3QIBC 1F50A 2AANA 4F1SA 3TF7C 2EDXA 1U95B 4WU7A 5HDLA 4TUOA 2BOCA 1LEKA 3CIQA 2F8VA 2F18A 4JM2B 4K71C 4MWFA 2LQRA 3ULVH 2CKBL 4FQ1H 1IBDA 5C70A 2AI0L 4JHWL 1B4RA 1JDAA 4AGNA 4IIQC 4ZFOB 4YSTA 2JVUA 4IU2A 1SBSL 4G72B 3BKYL 6PCYA 3KPRA 4XCEA 3Q9PA 3DV4B 1MY7A 3MRGA 1F4HA 2EECA 2R69A 3FRPA 3NFSH 2K7QA 1AZCA 4BE5A 3AU1B 2MJWA 5TE6L 1KZYA 1IGJA 1Y0LA 1IQWL 4EJ1C 2R4RA 1G1YA 1OCOB 4HCIA 3GS0A 4KJQD 4K5NA 1WD9A 4J1UB 4HWBH 5IKCA 4IKJA 5FECB 1M0MA 3GBML 1ID2A 4R5VA 3B34A 1MFUA 2I9TA 3NY8A 1W0WB 2X2JA 3UAJA 1RD6A 1V3JA 1E5UI 2TSAA 3ZPQA 2BP8A 3CDGB 4KC3B 4U1LB 2X4UA 2DM4A 3PPSA 4TVSa 3IDYB 2OPCA 1XXDC 3JBG7 4N6RA 4L18A 3A7KA 2DMGA 2HJKB 2ZOWA 5HHXL 5CD3A 1FA4A 1G9EA 4GBXD 2VJXA 1FYTD 3PJNA 5CXPA 4JAMA 4Y5XA 3KCPB 1MRDL 1F1DA 1C7SA 5F7DA 1G6RA 1YEGH 3HLAA 4KKRA 3I85A 3B6SA 4TNWK 1ZPUA 4X6DF 1XGUB 2OTWB 1C16A 1NCAH 1BQLH 4O58H 5JMRA 2P5ED 1DJYA 1TQUA 1CK0L 1WRFA 1YRKA 2RGSA 3P77A 2B15A 2O5ZH 4P5SA 1BBJA 4RFNC 4AVHA 2UXTA 2IPKB 1YJDL 2QLYA 3FUMA 5CJ8A 4ZTOL 4IRSA 3CDZB 3D4YA 5KOVC 4M5ZL 1X0SA 4YXLH 3BVTA 3NAAL 4IGBB 3RP1A 1EHAA 4ZMYA 3R18A 3VFVB 4PXKA 1U30A 1WT5A 3F6IA 2JAGA 1QD0A 3L3HA 3DYOA 3L48A 2J73A 5I1IH 4N1CA 3FTUA 1JS4A 1T66D 4NN6B 1TZHA 4YE4L 1SHMA 3HE7B 1A4JB 2WZPA 5JPNA 5KJ4A 3SE6A 4ANXA 2DYPA 3QUKB 3PWLB 3QDMD 4N8CH 3VG0L 5IHLB 3CPUA 3C5SA 2EDFA 2W07A 2EEDA 2F53A 4WGKA 2LR4A 3ZDZE 4NQSB 4XP6L 4YAQB 2ZYSA 1EJ6A 3R19A 3PNWA 2DDQL 2YMTA 5T1KA 4WKXA 5A6IA 1BJ8A 3C5ZB 2YMXL 5L4IA 2BSTB 32C2B 1X3DA 4BM7A 1PW3A 1BDYA 2Y5QA 3SSGA 4JPIA 2F5AH 1AR2A 1QYGL 1EBPA 3VUAA 2CRZA 2E0PA 2EEXA 4GAFB 2EQDA 2ICWA 3EFOB 1XAKA 2IADA 5I6XC 4L35A 5C0IB 3E3QE 2Y06H 1G4MA 3I75B 4Y2OB 2VWEC 3R7RA 2DN7A 3V0IA 1QSVA 4X6DB 1JYWA 3REWB 4UDTA 3ZT7A 1CLOL 3J2PA 4B9FA 5I17A 4JFEE 2MTAA 3CFKB 2JTDA 3HC2A 5K1VA 2CGYA 5AYUH 4EI0A 1RP8A 2YPLA 4GLRI 2MCMA 3HJEA 4X7SH 2RALA 5FPIA 2ZUTA 1QX1A 4H26A 2YQ2A 4JGJA 4MA7L 4N0FB 1Z5YD 4GYBA 3O4LD 4U7SA 2XHNA 5JPMB 3GB7A 3BEVA 2JJUA 2DLIA 1SF3A 2WKOF 4JO4H 4PCTA 2ADGB 2VM4A 4UI2A 5D71H 4NXKA 3IFPB 4F7PB 5E94B 3ZE0F 3ZKXB 5AVZB 2FLBT 3WUWG 4WUKH 5C9JB 2CALA 2OMVB 2L04A 3HZMA 4DGVL 2CHWA 4NNPL 2IXQB 5FA3B 1AOHA 4D7PA 4WO4D 2YBRB 5T1LA 3ARYA 4BK5A 2DB8A 5ADPL 1I9JH 1IIIA 4LCCA 4HJEA 1ED3A 1JD7A 1LD9B 4RAVA 2VAAB 2Z31B 3LB6C 2X0UA 4G9DB 4XC3H 5C6PB 2W60A 2VDMH 4RFEA 3LS4H 4ZAKD 4YC2C 5BO1H 5CEYA 4FFWC 4FXKA 3OJDB 3VYNA 3ZPDA 1IB5A 3RIAF 3R7QA 2PF6A 1QFOA 1HZHH 5IF0A 3DSNA 4LSQL 1OGAB 3GC3A 2DQHH 2ENSA 4N85A 2QJDA 4B27A 1RHFA 1S2EA 3QORC 1TPXB 4FJYA 5C2BH 1E0OB 4LQFH 5I18H 1NCDH 3ARFB 1XGPA 2FQEA 5EV7A 2HUHA 1R3JA 1OHQA 5CZVL 3A4FA 2PPDA 3X1NA 3T3MF 1KEGH 4W4OC 3VI3E 4ONOA 2FYVA 3B9DA 2HX9A 3EO1A 4FKEA 3MLRL 1V7NL 3LZQA 4WAFA 1OSZB 4Q89A 1RZGB 3NZ8B 3S98A 1MIML 2G9HA 2V9UA 4JGNA 1H3XA 1IEBB 1P4LA 3BDYH 1LWJA 1WBXB 3OQ3B 4J28A 3LRGA 4H2CA 5B6ZA 2E7MA 1O9ZA 3AWFA 1HZXA 3MRPA 4HWBA 3CZGA 3PWVA 3MBEB 3P4OB 1IGIL 5F96H 2E9IA 2XIBA 1U8NA 1D3CA 4IB4A 1QHOA 1W9XA 2MHAB 4L2LA 3WIAA 1LEIB 4QRYA 3IS1X 4Y4FB 2MQGA 2BSSB 1I8KA 3QWRD 4QRRE 5EF1A 4G6FD 1QLRA 1D7CA 4MJ5A 1A5FH 1E43A 2X4PA 3K74B 1AD0A 2WLLA 1JWSB 2Y1YA 3FB6A 1G1CA 3WXVH 5IG7B 1X9QA 1BZ8A 4H25A 4PJAE 2ZD0A 1PSKL 2XPZA 2BVUA 4HIEB 4W6WB 1Q94B 3HVNA 4JY5L 5AYQA 4F8LA 2AVGA 4KTDL 1KIRB 3FQRA 4BDVB 2N1KA 3DYMA 3Q8BA 5DK0A 3CBJB 3STBA 1MNUH 4LPWA 4MB5A 4Y9HA 2DI7A 3TBYB 3ZTJH 1DANU 1S6NA 3BVVA 4NI6A 1XB3A 4KY1L 4BH8B 1ZLVK 4DVBA 4UTAH 3UO1H 1J1OL 1ECZA 5TGBA 4GUCA 3S5YA 2BMKB 2XA3A 4EUPH 3MV7E 1PFCA 2P8PB 1AGDA 4YPGB 2C3VA 2M26A 2CGRH 3ZYZA 5F1NB 3RHWF 4FI8A 1FC1A 3KPRD 1RK7A 3QQ3A 5DJ8B 3HI6L 1PDKA 1HSBB 4GAGL 3X3GL 4FA8A 1BXUA 4F5CE 1NDGA 3B1TA 4GRVA 3MXWL 1YLBB 1FNSL 4M7LT 3W39A 5E03A 4BINA 2R4SH 5SX5K 5GZNC 3Q6GL 3ZUCA 5DD1L 4FQ2L 1FYTB 4CJ1A 1E7VA 3SOTA 3T3MB 1U8MB 3QZWB 3VFNB 5BZXA 1UT9A 1L9NA 3EBAA 3KVQA 1HQRB 2EJ1A 4H0IA 1EAQA 2A9ML 3SGJA 3UAJD 3VXNB 4EDWH 4QHUB 4MA1B 4I2XB 5GQBA 2OXHB 1RPQA 2HT4C 3CLFH 1LO2L 3MRJA 4WFFE 1KG8A 5HYJE 5F71A 3SE4A 3QJHB 2Q7YA 3MJ8B 4OF6A 4RA0C 3CMOH 4ZMVA 1TDQA 3NGBB 3SDAA 2WKLA 2Q76A 2BXYA 1J9CT 5F9JA 1OE3A 2JK5A 5J11B 3LZFH 1K85A 2OBGA 1OP3K 4G8GE 4N26A 4HALA 4QWWD 4ZMOA 4QXUL 4FS0A 5F9DC 3DPBA 3DETD 2FZ3B 3MLTA 1JK9A 1PX4A 3KDMA 3UADA 1AHMA 2NY2B 3BP7A 5F3HA 4XPHH 3FTWA 1A6TB 3PHQB 3K6SB 4I1PA 2XN1A 1A1MB 4RETB 4KVCH 1RUML 2JIXB 1FGVH 1HIML 1MFCH 2GABA 3OSKA 4ZMAT 4YHOL 4B9KC 2CR0A 3I6GA 1SEQH 2AK1L 1ZA6A 4IRSD 5F1KC 3ZKSD 3WXWH 3QDMB 1T4KB 4U6XB 2A83B 2OMWA 1ZS8B 4WV1B 2A4ZA 3HW7A 3LS5L 4Y19E 5GISH 2PWHA 5KZCB 1GY1A 2XY1A 5AB9A 4B95C 2OM5A 1XVSA 1JZIA 3ES6A 2UXFA 2FYYA 1WCQA 4AMJA 2BHYA 3GMPB 4WUUA 1EV2E 5F97E 3SE8H 1VF5C 1TTAA 5HDQL 3DROA 5KYXA 4NGHH 3WSQH 1R3LB 4G3YL 4AKPA 6CGTA 2WZPD 5IMOA 4XVOA 2ZXDA 4FQIH 4Z3HA 4FMFA 2Q3AA 2DYPD 4LSDA 5I1AA 4GIAA 3T2PA 5H2LA 2H1PH 2RACA 1XAUA 2R56L 2BPBA 3M45A 1EANA 2F53D 4LB8A 3VRIA 3ZTJG 4LAJH 3CHSA 4UOW1 4YIQB 1FFNA 3QDAA 2Z92A 3UYRH 3WMSA 1KENH 4G8IB 5JLZB 4EUPG 3V0VA 4LSVL 5CILH 5AVQB 3BMVA 2P8MA 2PR4L 3IMRA 5D1XB 1F3JA 5T1KD 4X6FA 1S7RB 2H9GA 1ZT1A 2NY7L 2CBQA 3WY3A 4AM0Q 3G04A 2I25N 2UY6A 2A7BA 3U36A 4GXUM 5EZOH 3VMNA 1A9BA 1BXVA 5DXWA 2H3NA 3L7EB 2EIBA 35C8L 5HDOA 3O4LB 5BNXD 5CCJA 1IBYA 3NY9A 2HG0A 1BLNB 3QNZB 1J88A 2OMYA 1SY6L 5T1JA 4P3DA 1P7BA 4TL3A 4OFYA 3T6ZA 4FYRA 4HDIB 4WEUD 1Z3RA 3TPKA 3U1QA 1JFHA 1G6RL 4G7YL 3U7WL 4IHOA 3SDXA 2QPFA 2NXZD 3QBLA 2GFBB 1DJZA 1JHTA 2YSSB 3K72A 3LAFA 5HVFB 2O26U 3FT1A 4AZ8B 1U9KA 4DIXA 4OM1H 1X7QB 2JTYA 2AW2A 5EPMA 4KVNL 1T7YA 2YPLD 1F3RB 1JSYA 4Y89A 4YLQT 5E23A 3CFCH 5T3XH 1EDYA 5CJXC 3QIBA 1JCVA 5DI8A 5IP4A 1A9EA 3SE9L 2OMZB 3IU4H 4AMIA 2C9PA 3LEVL 5MERB 1U8IB 3DO7B 4ZXBA 4IBZA 2ZCZA 4M1GL 3P4MA 5CM1A 2OCFD 4NPYA 4NIKB 5JW4R 5KVFH 2ENJA 2APBA 3KPOA 3IAQA 4XCFL 2AXGA 2H45A 2Y7SA 3LZLA 4GY4A 4I3SH 3QJFA 3CBKB 1IIKA 4J8RB 3SO3B 3MRFA 3SGEI 4PJHA 5BOPA 3IGLA 3AG1B 4XH2B 2FO4A 3UTZB 3B7TA 5I1DA 4HK0A 4PJDF 5AZ2L 3FQXA 3ZZLA 1S4IA 2WNXA 3VGBA 4ECNA 4HGKC 4KJWD 1RZJL 3EGSB 4HOMA 4ZQTA 3GSRA 5DHHA 5KEZA 1MCSA 2Z1KA 1M3IA 2VLKE 4ZUVB 1N0LB 1BOYA 5DDHA 1JZHA 2FQGA 2B59B 4G1EA 4JKMA 4OR1A 4J3UA 4UTAA 2GTWA 4EUPA 5BZZA 3W2DH 5KJRH 3ULVD 2HTLC 4QXGL 3QNYB 1ZVSA 4JFDA 3NP3A 3AT8A 4XHJC 4R96B 4UT7L 3DX2A 4HIIB 4HPYH 1XGYH 2MOVA 2XIIA 3ILPB 4L1LA 3AY2A 2XWTA 4KNTA 3R1GL 3CBRA 4NCDA 2ZX9A 2RCSL 3I6LD 1QI5A 3F62A 2ENQA 2NLJA 4K3EH 4F8TA 2R4SA 3KPLA 3PABB 1YEIL 4MJHA 4Z78A 5FFLA 1NGXA 2Y5EA 5GGTL 3TWYA 1QFWI 3M86A 1L3NA 3KW8A 4TVPE 4JLRB 3LTVA 4WF7A 5JIMA 1FVDA 1A3ZA 4AVKA 1OTUD 4AJ0A 5J13C 2GIYA 3TJHD 4DKEL 1CB4A 1AZNA 2V5RA 4LVNC 4DZ8A 3BWUF 4TOYH 2P44B 4PPTA 2NTSP 3O8XC 1MJ8H 4JB9L 5DEZA 4FLRA 5JQ6H 3X14B 1DBML 3IPEA 2FR4B 4AYMC 1ET7A 43C9A 4KXDA 4POYA 3HNVL 3Q2VA 4WDIA 1OCRB 2OLDA 3ZHDA 3WJMB 4XAKD 1E40A 2NY1B 3PWPB 4JZJC 1KFGA 1IGJB 1Y0LB 4NO2B 1M1XA 2KZKA 1WIUA 2J12B 4PB0L 3PIQA 4OCXL 4QRPA 2R0ZH 5IKCB 5MENB 1LDPH 1NCIA 1TZIA 3GZQA 2R7EB 3CX2A 4H0GA 2UZYB 2VXUL 3OXSA 4QMEA 4OB5H 4PJDB 1QEWB 2AAVA 5B3JE 3RDTC 4XB3A 5ESAB 1D9KC 2CKNA 5DFTA 3TH3T 4AE0A 4KDWA 3E6HA 5KANI 5J3HD 1BM7A 2CM6A 2HH0H 4BFFA 3KE0A 1JV7A 5GRZA 2EXYC 1RJCA 1TOXA 2PCFA 1XH0A 5I24A 3L1OH 2BW5A 1PU0A 5HHOE 2XVLA 4WZ9A 3MLZH 4CDHA 3LKNB 1Q1PA 2APWA 4WW3A 1HOEA 1W72H 2ZNXA 2QVKA 4KV5F 3ULVL 4FQ1L 4ZSOA 2MQ0A 2VO5A 1CXKA 3M1OA 2QLVB 2X4RB 3RPIA 3UCRA 3GRWH 5C7ZA 4GG6F 4MS8D 3G9AB 3GSOB 4B5EA 4EA3A 3L5HA 3BZ5A 1H15A 1RHHB 2EEAA 4HGWA 4PJ9C 4GO9A 1JV2A 3NFSL 1E5AA 1WZKA 3BP4B 3Q5TA 5HVHC 2GY5A 5L8LB 2IVFC 4AEIH 1A7PH 5LDSA 1BBJB 4RFOH 4XWOD 1OPGL 4L5FH 4KO7A 4X5XB 5DC0A 3SDAD 5IHBA 2EYSB 1UM6L 3TBVB 1M7DA 1UWYA 1ZEAH 3FBQA 5D70L 3SD5A 3T77B 1JN6A 3U30C 3TEZA 4UT9H 5JDSB 2APFA 4NQEE 4WWNA 1IGYB 3EYFB 4PWKA 2V33A 3PDOB 3N1FC 2VLME 3AS1A 5E8OB 3LRHA 3WTXA 2EE9A 3L3HB 3GHBL 4ZI8A 2GTZA 3IYLW 1FFQA 5AL8A 1WCBB 2MFNA 2NZIA 2WWMD 1F4WL 2C3GA 4TVUA 4PGZA 3TA3B 2VSKB 2OW6A 3C6LC 3VFPB 4U6HA 3WFBH 5JPNB 1EHLL 3FB8A 4MCZA 2IALA 2VMEA 2BSDA 5AW1B 3HVDA 5C0CA 2DYPB 4JO3L 1EGJA 4R4BB 5FX3A 5DLLA 2AQPA 4MMXA 3TTSA 3K3QA 1OOWA 4YOKA 1NCAL 1B6DA 3AROA 5IB1B 1YC7A 2HJLA 1S7TA 3GMOB 4MQ7B 2DWEA 4O58L 4G43A 2Q10A 4KKCD 4W9LC 4YSPA 5C6TH 2VXVH 5I5JA 4P5KB 2O5ZL 1C12B 1U4EA 4NM4H 5DO2C 2VSCA 1JZ2A 4JG0H 4WUUD 2V2TA 4OQ1A 1QA9A 1RIVH 2GVYA 2FO8A 4UT6L 3U82B 1E6JL 4BUOA 1TQCC 3NSJA 5D5MF 4YXLL 3A6OA 5JOPE 1CD8A 2AJ3A 2Y1ZA 1KCBA 3FF7A 5EO9B 2ZWZA 1WE5A 2J3SA 4DKFL 2ZUYA 5AG8A 3QXTA 1JJUA 5FW6A 5AX0A 1DYZA 2X4NB 2N3JA 3NTCL 4MQXD 5E1HB 1VFBA 4XBGB 1V05A 1X5GA 4LCUA 1E3XA 1I1YA 4GG6B 1NEZG 4ZX5A 4W4OA 1NIDA 1L9HA 2VLRB 2NXZB 4GI6A 2XKNB 5CEZH 3D48R 2V7HB 2LU4A 1B0RA 4DOHB 2COQA 1S7QA 1UD3A 2YPLB 3SGDH 5EFIB 3PL6A 3LD8B 4IRZL 5B21A 2IBGA 3OLEA 4H26B 1E8YA 1KV3A 3GXIA 5L4JA 4KMLB 4KOCA 1T7WA 3MCLH 3J07A 3GB7B 2QKIC 1BECA 2X4QA 4OFYD 1ZKAA 1T4WA 4AENA 4MQSA 2F61A 1A14H 4K9EC 3V79C 4DTGH 1KTBA 3CJJA 2DJMA 1W8EA 2F19H 4RQQA 5IMLA 3FQNB 1M9SA 4U6YA 3NJVA 1YMMA 4LSSH 5LXVA 3HZMB 3T71A 2J8UE 1YPZE 3ESMA 4ADJA 3LXBA 4GQPH 5A43C 1ONQA 4F2EA 3KPNA 4AQ1B 1L0YA 1BF2A 5DTFB 1KFAL 1JDDA 3BSHA 4XP5H 3KL0A 2Y06L 1KIQB 4HLJA 1DQDH 2OK0L 1U8LA 4XNXL 3QIBD 3QJUB 2JKTM 4HKXB 3H3PH 5BZWA 1FV1B 5IQMA 2YFNA 4ZXBD 4G5ZH 5IMMB 5L2JB 3EG9A 2DY2A 3ARGA 1RH8A 1IT9H 2VW6A 1KTLA 4N8UA 4LEEA 4CSPA 4X7SL 1BV8A 2F68X 4DEPB 2G4GA 4TL4A 5E1AA 3HR5A 1BIIB 1YEEH 2JJVA 4Q56A 1WITA 2DQCL 3U4EA 4UNVA 4HKBB 5D5MB 2DTML 1RVFH 5I1HH 5TJWK 3WV0A 5I6PA 1HEJC 1M0KA 5D71L 4XMPL 4QHKJ 2QDWA 3GZOA 2N56A 4RZCB 1HAWA 1XZWA 4WUKL 3QEQB 4ZFZA 3WJJC 4ZNCD 4M6NH 4NNXA 5G54A 5KN5A 3VXUB 1XF4B 4PM1A 1VHPA 2PTTB 1I9JL 5HJDA 1SEBB 2B3IA 4GKOA 5KVEE 1I1FB 1NEZA 4OKVA 3NQIA 5CUSL 3NN8B 3WS3B 4Z95L 1I8MB 1I3GL 1CFQA 4OD2A 1I7UA 2GJ6E 4XO4A 5HYQA 3LS4L 4RGNB 5DWUH 5BO1L 5D7IE 4JFDD 4HFWB 4OLZL 3OB0K 3L7FA 4R83A 4PQXA 1PCSA 2DQHL 1WBZA 2GHZA 1ZD6A 1AD0B 1T1WB 3GXTA 4HFUH 4PW9A 3KMDA 5ANMB 5C2BL 3GFUA 3AYMA 4BSVA 3P0VH 4LQFL 1NCDL 3MSPA 5I18L 4H25B 5EN3A 1W72A 3UG5A 3ZSTA 1U8KB 2NCEA 1FVEB 3AM8A 5D1QB 4L3EE 3EYVB 1PZ3A 3GRWA 3V2YA 1MJUH 4GAAA 4UB0L 3FQRB 3QQ4B 5EU7C 1HKLH 1DQJA 1E4KC 4LHUG 2VDPB 1AMXA 1R5IA 1R33A 2YLKA 3HG1E 2V2XA 3OMNB 4JQXC 3T4YA 2YRBA 5EOTA 5CAYB 3BDYL 1QWHA 1UUNA 4MQTB 2O4EA 5L2KA 4MDIB 3FU6A 3RWFA 3GM8A 2WXIA 2Z55A 4XN4A 5ABZA 5F96L 5DZPA 1VSCA 1X6LA 5GGSY 4I3RH 1MJJA 4UT9A 4JDTL 1NDGB 3WMPA 1DN0A 3BSGA 2MQ3A 1OGSA 5IBTL 2WYZA 1MRCH 1ULVA 4MKMA 2NTFA 4JFQB 5E99H 1A5FL 4LMQE 2BRRH 2AJUH 1FBIH 2RFXA 5INDA 2FTAA 2NY5L 4FULA 4QRPD 3TT1L 3V4VL 3WXVL 4P2RB 2YR3A 1M1SA 3QZNA 5CZXC 3R0NA 2X89A 1LO3H 1FC2D 1ZLDA 4M3JA 2HWZH 5FM5M 2ED8A 3MLUL 2WLNA 2EVJA 2ZWLT 1T0NA 2KLRA 1X5KA 2GITB 2VSMB 2X1PA 3DSFL 4IRJB 4JFZH 4OCWH 3T3PE 2CHZA 2ATKB 2OMXA 5CBAB 1KELH 3OAUH 3DHUA 3QEUB 4LEOA 4XPFH 2JK5B 2VZOA 2BP5M 4W6XB 3T0VA 2VIRA 3MRNA 4FA6A 1KPVA 2K45A 3LN9A 4LOUC 4YNYA 5I75C 5IESH 3O9WC 1M9WA 2YJQA 1LNUA 1YY8B 43CAA 2VGLM 4UTBL 3PRZA 5I15L 1T22A 3MLXH 4P5TA 3SKUD 1IBZA 5E0QA 2FE0A 2AJXH 5GGRA 2YGVA 3RL2A 1UQSA 1Z9SA 4PRNA 1C5DA 4YDJA 2Y00A 2FIKB 2B8OT 4PRBA 5CJOL 2HT2C 5DRWB 1KLGA 2VLJA 3QISA 2V2WA 1QZ1A 4EDWL 4M1CC 1F6LL 1JGJA 1SHSA 4YZFE 1CVRA 4EZJA 3DRQB 4LHUA 2WBJB 2OFQA 4WLCA 2J72A 3ES6B 1S7SA 2IDFA 3LNFA 5CJXA 2PKDA 2CHXA 3RUGA 4GUQA 3CMOL 1HKFA 4FZ8H 4KUZL 2CO6B 4Y2DC 3SYCA 1W2KT 1XDTT 5IFJA 1W0YT 4EXKA 1P1VA 3NESA 3LZFL 4WEEA 4QRTA 1P7KB 3OKEB 5C0CD 4CW1B 3MV8B 3MV11 5C07E 4X5WA 3QR1A 1Z5HA 4YL4A 4UM8A 5LAXA 1CFTB 5FB8A 2CHNA 1CICA 3H4HA 2X09A 2V3EA 3DX8B 2ESVE 4RBPK 2JQAA 3BUIA 3GJFB 3W5MA 3B2UC 5E2VH 4V1DE 4J4QA 1OAQH 3LB6D 4LKXA 3EJTA 1FGVL 4NUGL 4LLQB 1MFCL 2XN2A 3TPUA 3K2KA 2XUWA 2D3LA 5IUSA 5GPRA 4YHMH 4X8JB 1TYJA 3PAZA 4K7FB 3O6LL 4E9WA 1JZ3A 4FFWD 5DR5H 2PYEA 1SEQL 3EDFA 5T3XD 4AV4A 4NZJA 3WXWL 2IQ9H 4UQ2A 2F7OA 5GRWA 1UJTA 5HVGB 1XMWA 3IF1B 2H3NB 3CZEA 3ARTA 2O6EA 4A2MA 4K9EH 2HLFC 1P0SE 3CH8A 4NENB 4XX5A 1UM5H 4EIYA 3FU5A 3MRQA 4X1HA 2WQWA 4WGWB 3P9LB 4CRPA 2WUBH 3CUPB 3KLAA 4S1SH 1NFDF 1HHIB 4M6OH 4RMSA 4Z7QF 2AEPL 1N6QH 1ASQA 2HKFL 1BREA 4QT5A 3RTQC 2NY3C 5DRZA 3UPAA 5DK3A 3CFJA 2PTVA 4PRDA 2QV4A 4JRYB 5EWIH 5E2UH 2R23B 2G60H 1GVIA 4MA3B 5AX1A 3LV3B 3K2IA 3AAZB 4S0SD 5E5LA 1W16A 1KEMH 3DX3A 5D2LE 3VRLE 4LVOB 3RDJA 1QRNE 3LCYA 2RTTA 4OIFA 5BOZG 1TVDA 5KAQG 3CG8A 2Y36H 3E9TA 4G7VH 3JWOC 4QHNA 5DURB 5IY5B 1JD9A 1R3HA 5L8KB 3IXAB 4M43H 4APQA 3P4MB 2H6PA 1YMMD 4NQXB 3SKNA 1PMYA 4IIQB 5EEZA 1G0XA 4LLVA 1OOAA 3HZVA 1R19A 4Y1AB 4ZTPH 1MCBA 1XB8A 2A6KA 1NCGA 5D1ZC 4N28A 1KIUB 1QFWM 2BCKA 3GSVB 1AGBB 1T1YA 2DIEA 1CDUA 1EGJL 3V4VB 4JN2B 5GRJH 4JFYB 4P07A 5FYJH 4LASL 3T0DA 1JGEB 1U3YA 4JZOA 2E6PA 1UURA 5LVEA 3SPCA 1FRGH 4LHQB 4MSWA 3NDZE 3W38A 1D6VH 4LRIC 2IC2A 3VGAC 3QG6B 3ARGD 4PJIE 1Q8MA 3IRZA 4NKDB 3W9EB 2XQYK 3NIGF 2BP3A 3TBBA 3ARWA 3RDTA 3CFCL 2IV8A 1JGDB 2XN0A 4Z3TA 4TULH 4XE0A 5FLUA 2YBGA 3FOMA 3WNPA 4IKIA 1G7IB 4Q74A 1SDDB 5E7BA 2XYCA 3U79A 2ZOKA 5IWLC 1GYVA 4N22A 3UTTE 2V3DA 4F7KA 3G08B 2ERJC 4MNQA 3WN5C 4IOIB 5KVFL 1MCWM 4N0YL 4WIQA 1NFDB 1TCRB 4Z7QB 3F64A 4KI1A 5HHMB 4XN8A 4I3SL 3ZHNA 4PJ9A 1YZZA 1M71B 1J10A 4LRNH 4YLCA 1X9UA 2ZAIA 2Q87A 2HT4D 2PCYA 3HN5A 5CFAA 2NQDA 1ASOA 3TO2A 3LKQB 4ABVA 5BUPA 4J3SA 1LMKA 2KS0A 3OKKA 3RNKA 5DJ6A 4HS6A 4UNIA 4DP6X 3B9KA 4QXTA 4JL1A 5IEKA 3WNKA 5FHAH 1WBYA 4ODBD 5E1IA 2C9VA 1SHWA 4LL1A 3W2DL 5KJRL 3OG4B 1MFDH 4OV6F 3DKHA 4XPBL 4WDIB 2IH3A 1E9OA 4K23H 4HVBA 2XBTA 3HLKA 5JJJA 3QAKA 1P5UC 3MLVH 5I19H 4U1GB 1IL1B 2ORBH 1JTPA 4X6CA 2XXCB 3AVEA 3OV6A 3RWJB 1GW0A 5FKPB 3P2BA 3H55A 5DT1H 1GZQB 1U3HC 3QJVB 3L9YA 4G6KL 2BCMA 5J5EA 3VVVA 5L2KD 1ITBB 4NC1C 4Q9CA 1YUHA 1NSNH 1G9NC 3E6HB 2AJYH 2YEZA 4XN7A 5I16A 4MNGE 5IK3A 3OC8A 4X6BA 3BKMH 1BQHG 3BIBX 3BSZH 1HINH 5ISZE 3NIGB 1FORH 2MRYA 1AYOA 1UWXK 2CLVA 3T2NH 1I3UA 4ZSOB 1BXAA 1NFIA 2NSQA 2OSLB 2PP8A 1QHJA 3JXAA 3RPIB 4K55A 5HHQA 1J18A 1XIWA 2IANE 4D8PA 1OD7A 2X89D 5AL0A 4BHUI 2LE9A 4WJ5B 3ML9A 2RBLA 3DIDA 2ATPB 3B3BA 2KZ1B 2ODHA 3FTYA 5HJ3A 2Z7UA 3OR6B 1GHFH 2MKLC 3U9PL 1IFHL 3F12B 3NJHA 2P5WE 4OZIA 4QHLA 4PJGF 1CG9B 3MRLB 3QI9C 4KQ4H 1AZUA 4X5QA 1KCLA 1XGTA 3JSSA 3R06A 3RVWC 5KG9B 4YSSA 1CDIA 1QW8A 1R75A 2J88L 3NIDF 4U7MA 4ELMA 3MV9B 3P69A 3TF4A 3GRBA 4HX1A 1JTOA 1U8HA 1A4BA 4WVRA 2QKIA 2J43A 5L9DH 3VM7A 4XVSL 3L1OL 4N2EA 2JJTC 4KROC 3MLZL 4P5TD 4XXWC 4FHBD 3JV4A 4D0BA 3EOYG 2IALB 5IVXA 1EZSA 5K59F 3LKOB 1TTCA 5H2OA 5T3ZH 1CMOA 4WW1A 2VLJD 4HQQH 5CEZD 4ISVB 1S7TB 3B2VH 1EAPB 5T5NF 4XODA 4X7TB 1A7PL 3CSTA 3L3GB 4JMXA 4LHUD 1JNNH 4GAJL 2NW3A 5C86A 2ID5A 1QTYT 1CD1A 1L0MA 3G6JF 4X99B 5C2UB 1IM3A 3F58H 4Q6YA 3MZGB 2NMSA 2D9CA 2P26A 2XBZA 4MMZC 4X9GA 1MIEH 2XWBB 3OB0H 2PP9A 3QORB 2JQZA 4Y7MA 3OR7A 3UYPB 5I1JH 3QP3A 1BQHA 1CICD 3W5NA 2D9QB 3ISWA 3W9DA 4I48B 3FULA 2CUIA 1KIPA 4LDEB 2AQTA 4BQCA 3A6BH 3BKCH 4B41A 2V5MA 4BKSC 5G55A 4MJ6B 2I85A 3WFBL 3WFHB 1EEYB 5L88H 5BR2A 2XTJB 1RJYB 4KKPA 1PKQB 1GZPB 3CCHB 1RJZA 3ULSA 3VU2A 2PYED 3PGFH 1Q9KA 4ZUTA 1A02N 4DJHA 2WZ5A 4OH2A 3II2A 4UQ9A 5KVDE 2DQFB 1P69B 1YEFH 4PJGB 1EVUA 4XT3A 2GT9B 5KUMA 3U0TB 2OTUB 3GINA 2WCPA 2FT7A 3UC0H 2VXVL 2ZSWA 4HS8H 4NM4L 2WVSA 3CTTA 4JG0L 2HTLD 5KW9H 4ESKA 2NX5A 3CLEH 3OSVA 3FSOA 4XHJD 4RQQB 3WTYA 5IMLB 2FJHB 1C08B 2QADC 3KLSA 4YX2H 2CLZA 1R3KB 3SYOA 4BWWA 2VABB 4IEFB 2EUVA 4EQ2A 4A4MA 1XCQA 1PVHA 1DJGA 2YLHA 4XR8C 4KAQL 1PZUB 5EBLB 4R97C 5GSRB 4HJJL 4PS8A 5IBLD 2DWXA 1GSKA 3D50A 1S3KH 3OKOA 8PAZA 2WWNA 4KZEH 1NPJA 1Y18A 5F89A 5F0JB 4Y4KC 4AGOA 3FT9A 4JDVB 1D5XB 2OR9L 3MV01 4XNQB 2KPNA 3KNBB 5FW8A 1E4KA 2YMOA 5CEZL 1BGXH 3JWNC 1NA8A 2GTQA 5IW6A 1UZ6F 1CBVH 2VM9A 3KDPB 3DX4A 2MNUA 4APQD 1P7QB 4WJG3 5HYEA 2X70B 4Y9BA 4HCFA 4H44C 2FGWL 3O8XD 3G6JB 5JHDB 1VA9A 4P4KC 2QEJA 4WI4A 3RWEA 2IPUG 3DXAB 5JIQA 4R26H 4NQVA 3L4XA 2J4WH 5GGVH 2BIHA 4JQVC 4XBEL 1OLZA 3MNDA 1JVLA 2VO8A 4HS3A 4HKJA 2WYIA 5PAZA 2F19L 1RCYA 1RZKL 4ZFZB 3BAJA 3VE0A 3NFNB 4LSSL 1JYNA 2O6DA 3D4CA 5K9OA 1R9FA 1D6EA 4I88A 1KG0B 3P11H 4BZ1L 1B6UA 4XP5L 3PWNB 4FABH 1EUUA 2A6IA 1J9QA 3ABGA 3RDTD 3ZE2B 2R15A 5CMAA 2WP3T 3MACL 1F2QA 4XTRD 2XZAL 1G7QA 1PZBA 3H3PL 4X2UA 4I18B 2EXYD 2VDLH 2PEDA 3ZE1E 2HLEB 2ZNWA 4G5ZL 4HPOH 3B9EA 3EUUA 3IK2A 1O75A 1V5JA 2X38A 4FQQA 2WHVA 2R2HB 4JDZA 4NQDE 2XJKA 3BSZA 3DJZA 4GQZA 4MNQD 3TT3L 1AP2B 1T03L 4Z0BH 5ALCL 4XO3A 1OVZA 2AQRA 2JB6B 5D7LA 2F1BA 1ZK5A 1S5HB 5DZNA 3O9WA 1RVFL 4O2CA 4PJ9D 4UANA 5I1HL 5ELIA 3HFFA 2FX7H 4YBQD 3SJVA 4M1DL 5D72H 4MDJB 5FYLH 1SQMA 1J87A 3NEXA 3KHOA 4U1JB 3DHPA 1HI6A 2E9WA 2HKHH 5GIRA 1NM9A 4B9JA 4M6NL 2JCCF 3MAWA 4E9LA 5EOTB 4Z3GA 5LQBH 4YGAB 1JWMB 3B9KD 2AQ2A 4UQIM 1JPFA 3S8WA 4GG8B 3MRDA 1XHHA 3N91A 1HEZA 2BJMH 4KTEH 4WK0B 5H35A 5FK9A 3BOVA 3IKKA 4KJYA 4F3FA 2BP0A 1MEXL 2H7WA 4YSEA 4NB7A 1EXGA 3HC0B 1XF1A 3IJEA 3O45B 3POCA 4P23C 4PJEA 5DWUL 3V6ZA 4BFNA 3SDDA 1BYNA 4F7MB 3E0GA 2NTFB 4Y2DA 5A1AA 4AIZB 4KX8A 4HFUL 1KYOJ 4M6ML 4QXVA 2DMBA 3HANA 4GKNB 1A2YA 2NY6C 3P0VL 4MCYB 1E27A 1SF5A 4TLKA 2EDQA 1AGCB 1DVFC 2P8LA 3IMUA 3FUHA 4GSUA 4HIHA 4A66A 4PRAA 1NAMH 5J12B 3F7KA 1V3LA 4FJZA 1F6FB 3ROLB 5JYMA 4Z7IA 4YDKH 5HDBF 4M5YL 1T0NB 1DUZA 2A74C 4IDJH 4ZMNA 5F8UA 1TQVA 4B0MB 2C26A 1ZLUH 3VYOA 5DO2D 1MHCB 1T0MB 3CDFA 3JTSA 4DESA 5FDWA 3FO1B 4WQOA 2OMXB 3NUKA 3ALPA 4K7PX 1WC7A 3ZDYB 4ALAH 3S8GB 3QDJA 4ZUUA 4QNPE 3WN6A 3MRNB 1XIWD 2IG2L 1PBYA 2ATAA 1XD0A 1KPVB 4F93B 2ZKHH 4Z7VF 3D87B 1PCXA 4I3RL 4XO9A 3UGUA 1HH6A 3HN3A 4HIJB 5I0DA 5KSBF 3CGTA 5EU5B 5AVVB 5KYWA 4JKLA 3VWJB 2C9AA 5E4EC 3P2DA 5GGRB 1VCBC 5LNDA 3PAYA 2J20A 4I87A 1KY6A 4YDJB 4XO8A 5HI4C 4PRHE 4LBAA 1BYOA 5AVTB 2P49B 1CD9B 1KJ2H 4HWUA 1P4IH 2VM3A 2VLJB 4NP9A 4QOKB 1X44A 3HBPA 5DO8A 3BXNB 2JCCB 1BFOA 1F3DH 5ITBH 2D0GA 3CXDH 1DJWA 1I9IH 4JJOA 4OCWL 4TSBH 3APNA 4JFZL 2VJ0A 4M02A 4BYHA 1NM4A 1BFTA 4OLWH 3EFFA 5MEOB 3AZUA 1KELL 3OAUL 4U1HB 4M93B 4H0HB 3KPQA 2YQ3A 2Z64C 4UU9A 1G94A 1S7UA 2ZKMX 4GRMA 2DQDL 3GMQA 3GMRB 2ZX5A 4FGMA 1U93B 3BVXA 4NZFA 5IESL 3IDXH 1MFBH 2V9QA 4L05A 3V52H 3FN0H 3B83A 3GSNL 5D1ZA 3OKNB 2EICA 2ZG3A 2VXTH 1K4CB 4NCC1 4Z0XB 4D9LH 5EOQH 1FH5H 2VUOA 1U58A 2FJGB 2W9EH 1A21A 4HAFA 5CKGA 5A2KH 4K3DH 3GD1C 1YECH 3KGTA 1IM3D 4XVUC 5HDBB 3NYKA 4LRIA 3PQRA 2B9AA 4RMRA 2ADJB 1Y6KR 2VZVA 2Z3FA 3KG5A 1AS8A 5SWZB 1F5WA 2A6JA 3ZJAA 4Q2ZB 2BNRB 3BWAA 3D39B 3P73B 1H9DA 1KTDB 1AO7D 4CILA 2CIIA 4ODXA 1ADQH 3BPCB 4FZ8L 3VFUA 4PJCA 5BS0D 4X0KB 3UZEC 1KYOK 4PN6A 4Z7VB 5IWLA 2YA2A 2I5YL 4QF1A 2X6UA 4X31A 3D69B 2IQAA 1HXYB 2CBMA 5KSBB 2BIOA 3A24A 3L4ZA 3DUSA 5FYJD 3ULUL 3JVGA 5FS5A 3PWUA 1RUKH 2O1AA 4OZHE 4A2GA 1URLA 4NCC2 5EU3A 2EUZA 1O6TA 3ZKNC 5E2VL 3MFGB 3ZTDC 3DVNB 4YUEH 1GGYA 3MNVA 4GQ9L 1MZYA 5H2BA 1FG9C 5GS0C 5LDUA 2NX5D 3QE5A 5J13B 5LGJA 4HBQA 5D2NE 2VDKL 1OPOA 2DQUH 1WIPA 3GK8H 3BH8B 5FJGA 3QR2A 1R5WA 3Q1SH 4L1TA 2Z8WC 3O8XB 2WVVA 3IJSA 4K9EL 5DJDB 3GSUA 3MPCA 4FZEH 4F8NA 3D4GA 4QO1B 3SOBH 1F8TL 3QJRB 1MOEA 2XPYA 4PGDA 3P4LA 4PV8B 3FONB 1XF3A 4JFUA 1NGQH 4JZJB 1U8JA 1X5HA 2W5PA 5FGCB 4LSPL 5CO1A 5D9SA 3FU7A 3IFLL 3BGFC 4NHCH 1J9RA 3TVMA 4RRPG 3VW7A 4PRIB 4GT0A 5EWIL 2XFXA 4LSTL 5E2UL 3ZDZF 5FLVA 1VADB 3HTLX 2UX7A 4RNRA 1VACB 3WO4C 1WVZA 1U3HA 2WW8A 3Q01A 1NLBH 3RDTB 3QZMA 3FH8A 3VDAA 1D9KB 3RYMA 2WKGA 2R8SH 5CIPB 4G7VL 1MCJA 2X42A 1MJ7L 1P53A 4CC0A 2YAMA 1THAA 3EGDB 4Y0GA 1X6NA 1NANI 1CFVL 3MUZ1 4M43L 3RLSA 1J8SA 1I8IB 3SE3C 4FKHA 3ULUF 2AEWA 1N12A 2QSVA 4ZTPL 5SWQA 2HVKB 4HZAA 4V2CB 1JCKA 3LKSB 5CZXD 2BINA 3JT2A 1DN2A 3A4EA 4O2EA 3QCTL 4FQJH 4PJ9B 1G84A 1PNDA 2CNYA 4W70A 3FN9A 5FYJL 4F57H 3FDWA 3W0WA 1XF2A 1S5IH 5LCVH 1DDHB 3JYCA 3I02A 1T83C 3G5ZA 3TO2B 1NAMA 2NNRA 3OKKB 3PXHA 3RNKB 2E46A 1I85A 4X4XA 5EIIG 3RJQB 4DF9A 4C4UA 3DJSA 3QI9A 4ANWA 3V0HA 4NSKB 5DJXA 2IAMC 3G5WA 3V5HA 2XWJB 2CO1A 4I0KA 3QRLA 1QW9A 4TQEH 1T04A 3QEHB 2EKSB 4CGTA 2WJ5A 5JOFB 5EBGA 5IHWA 5DJ2B 4HK3N 2Q5BA 4LOUD 1KCSL 4TULL 3O9WD 3ORJA 2IH3B 3QWOB 1ZLWK 1G7PA 1DE4A 1UVQA 3OE6A 1A6AB 3FQ4A 2DM3A 4Q6KA 3SJVD 4XXWA 5E4AA 2WK2A 1IKNC 3VMOA 5KKHA 3C6LB 3GSNB 2NY0C 1ZT4B 1D5BB 2H41A 3T6WA 1V10A 2FAUA 3O3EA 2CCWA 4AK1A 5EEXA 2JKIS 5C71A 2ILLA 5LO7A 2WZ6A 2FECL 3ELQA 1FIGL 5ACZA 1RJLB 2HT2D 5DHXB 3CHRA 3QUXC 4HJ0C 3FRUA 3NZHH 5A2CA 1OTTD 4Q6IA 3OMIB 2A9BA 2KPWA 4OF0A 4DPBX 4Q58C 5TDOA 3GMLA 1KJ2A 4YXKL 3TBWA 3OD3A 3PP3H 1PQZB 4OV5A 4GQQA 5FF6B 3SDDD 3ZQXA 5E2JA 5F6IC 2YQGA 2YS4A 4LIQE 2RAMA 4Y2DD 2WWKO 2NTWA 1JGUL 3EYUH 4PGEB 5M7QA 5MEQB 2GK2A 3ARQA 1TQCB 4MMZA 2LT9A 3QIUA 2V6HA 4D8PB 2MEJB 3M8OH 1P6FA 4K73A 4PYHA 1KXTB 1MFDL 2FVNA 4FN0A 4KMQA 5K93A 2IFGA 2ZWKA 1E9PA 1LILA 4HMDA 5CLWA 2QQKH 1MAMH 2ZSVB 4K23L 4XBPB 5F0PB 1G87A 5T3ZD 2G2NA 3U4BH 4P0DA 4DFIA 5I19L 1E2ZA 1HK6A 1Q72L 3E2HC 1F41A 1K2DB 4YDLC 1R2NA 1M0LA 4K5PA 5GSVB 1FHGA 1U2YA 2BZDA 1XD1A 2VAJA 4ELKB 3QAZB 5FA4B 3QDJD 5DT1L 3STLB 5TQ2H 3BZFA 3QEGH 3BUBA 3RWIB 4D0CB 5E5MA 3OKYA 2EUXA 1MPAH 3UH8A 3AGVA 3QXDB 3U46A 5EU6B 2AJYL 2R0KL 1UT1A 2UYLB 2HLFD 2VDKB 5I8CA 2K8MA 4PMFA 4HU8A 5FM8A 2R0LH 3BSZL 1T7ZA 1HINL 5EIIA 1FORL 4AXWB 1MFMA 4YO0A 1OAXL 4IJTA 3JTTB 2X2IA 3K46A 3NFPA 3OZ9H 1A1NB 1UA6H 4M6AA 3NJMA 1EDHA 2NY3D 1ADQA 2AAAA 3NMEA 3D0VA 4ONHA 1NCWL 2ALAA 3BN3B 2ZZUT 2BY3A 2BC4B 3IDUA 5TDPA 1D5ZB 1L0XA 1FDLH 3BZ4A 4KMTL 4ZQKA 4HEMA 1ACYH 1GHFL 4JG9A 1CD1B 3CV5A 1ZPLA 3IETB 2AV7A 3HG2A 2YD0A 4UZGA 3MQIA 3QIWA 4HJSA 1FZJA 2FSEA 4L8DA 3V9CA 5KSAC 4W9DC 5BVJA 1JHKL 3WS6A 1TLKA 2R9HC 1YN6B 3M46A 5LWEA 1PAMA 3FO9A 5D4HA 4X8GA 4P4KA 2IH8A 1J48A 5EN2A 2XN9B 3VFWA 5HYIA 1RU9H 4NZUL 1CIUA 1AO7B 1F18A 1RULH 5D1ZD 4W9JC 1IBHA 5BS0B 3BCFA 4JQVA 1MVUB 2E6JA 2TRHA 1U3NA 3FFCA 1GMEA 4DPCX 4ZO9A 4IAQA 5CN3A 1LE9A 2GPZA 2QQLH 1FO0H 5DJ0B 1CQKA 1Z2KA 2ZUQC 5AB1A 4AIEA 4ES8A 2B1AH 3PWJB 4HQQL 4XCCH 1PF3A 3B2VL 3L16A 3V4LA 3BVNB 1EO8L 3IFOA 2ZSWB 1JNNL 1YEKH 5JW5B 2PCXA 3X17A 4PJBA 4OBSA 1ZHBA 4O51B 4UOZA 3T8VA 2DI8A 4X6DE 1MFAH 4FL4B 1U8CB 1CE1H 4FEMA 1A64A 3BAYA 3GPSA 4F8PA 4PJ7A 1W0VB 1TYEB 1HYSD 3H9SA 4TLTA 4TUJA 5I1JL 2R51A 4LCIL 1DQQA 3OKOB 1ZVHA 3BLKA 2B20A 3RA7L 4Z3JA 4N9GB 1J1PH 3D0LA 4U2YA 5C08A 5C8JA 5I8OH 4AC4A 4ZD3H 2ZOLA 2G2RB 2DPKA 4K8RC 4EJ4A 5J8OA 2DWSA 3AJ7A 3HPJB 5L88L 4ZOCA 1P84K 2P47B 1UZGA 4GEIA 4W9CC 2GB2A 4EIUA 1MDTA 5J6HB 1T6WA 3G9VA 3HRZB 4NKMA 5LCVA 4GRWB 1RXLA 4JE0A 4LCWB 3S37L 3JWOL 6PAZA 4GP8B 5HGHB 4EI5C 1CGUA 1GH7A 1MW0A 3NCBB 2L7EA 4JY6B 4NQVB 3UC0L 3B5TA 1ZMYA 4HS8L 3HBGA 1UXWA 4URKA 5MHSD 4Y1TA 4P23A 5KW9L 1MDAA 3CLEL 4JFHE 4JRXB 5KBMA 1N68A 3FZUD 4YHKH 5DSCA 4FI6A 2N0MA 4RMVA 1Z0MA 4NLHA 1QQDB 3ETBF 1H6TA 4LBEA 1EX0A 1D6EB 2D3VA 1OGAE 4GO6B 5FYLD 1JPGA 2B77A 4HEPG 1U3HD 2QPSA 5LGKA 1DVFA 4FNQA 4KZEL 2IMMA 4ORZC 3FQUA 1NUGA 4XT1C 3O41A 2BM3A 4HC1H 4N8VG 5IJVB 1GY2A 3RB7A 1HXMA 3NJLA 4P5MB 2DQEH 1E28A 1I3RA 4PY7B 5HHVL 3TIEA 4ES9A 2HPYA 1JZEA 3QFDB 1SXZA 3GSQA 2N7BA 1XR9B 3FYEB 4JDZB 3C60A 2WIIB 4D9QE 3FCTB 3NBNA 1EPFA 2BVOA 3CIAA 1J1XL 2B5IC 5ICXA 4R26L 2F7RA 5I6KA 2D73A 1EERB 2AJSH 2HN7A 4ODUA 1CF1A 2J4WL 5JIIA 1XF5B 4BKLA 1PG7L 1E4XH 3SBWC 3O6FC 4CNIB 5ERWB 3SJVB 4KPHH 1DBAH 3PGCA 3W0WD 4OLYH 1AD9B 3X3FH 1U8QB 4Y5VA 3BUYB 3QH3A 5GIRB 4KK5C 2G75A 4M8QA 1BX2A 2W9LA 4OCYL 3M1BA 4QYOA 1TKWA 2GJZA 3C08L 4HUVB 3ETBJ 3QI9D 4MXWH 3U48A 3P11L 2IO5A 3NEEA 5T5NG 4KTGA 1ZGLM 4ODWA 4TYUA 3KYMB 4HF5H 3VB8A 7CGTA 4FABL 3HPLA 1MQKH 4JO8A 5FK9B 3RVWD 3EH2A 4WHDA 4A68A 4M7JH 3RPBA 1AXTH 3C6SB 3PXOA 5LAPA 1M6OA 1QNZH 3X12A 4X32A 1A7RL 3VDCA 4AQAB 2QSQA 4G1MA 1ZIBA 2Y7LA 4NN5B 4R5XA 4ZG1A 4HPOL 4KROD 4NHUA 4XCNB 2WGNB 3B7RL 5J57B 5AZEH 4NJ9L 5DK2A 4LU5L 1TIUA 2NYYC 2XZQH 2AEIT 1F1AA 3Q9QA 4YHIA 2DMCA 5HYSG 1QBAA 4JKPH 1IQDA 4M48H 1YEHH 4F2MB 3E3QC 4HHWA 1HDMB 4KU1A 3UJTH 1FBKA 1NDMB 5E4OA 4H20H 1DDTA 1MI5A 5D72L 5FYLL 4KO6A 4PG9A 1L4IA 2HKHL 2J5LC 2AGJH 2XXFA 2Q8AL 3H7LA 1CC3A 4FNRA 4TNGA 4TRPH 5G2DA 3LQZA 1G9NL 2CG9X 4LKCA 1FYTE 1BWWA 3C8KA 1J5CA 2WLJA 1SNRA 3T3ME 4FNTA 1DQLL 4KTEL 2JF1A 4N8VA 2LVCA 4I0PB 1N5YL 4GXVH 2MIZA 3C5JA 1P4BH 4WCYL 1BVKB 2XX0A 3SKOA 4B6ZA 4I2XE 2R2CA 1UD2A 5JUEL 3ARBC 3X1BA 3HUJA 4JANA 2C1OA 4RAHA 5E8EB 1TVBA 3UZEA 2XPGB 3WHXB 3KEDA 2FJSA 3WEMA 4PJ6A 1IFRA 2A73A 2HVJA 3RTQB 1IJ9A 4R7DA 4KH2A 4F9LC 2YKLH 4I1RA 2VDQH 3SPVA 3NCMA 3D52A 5G5DB 3BAIA 3QPKA 3ABMB 2PCPA 4UYQA 1SJHA 5IB2B 3IVKA 4LSUH 3MUUA 2YXMA 4HZ1A 1FO0A 2D7NA 3VGFA 4IBWA 2LHAA 3MDJA 1S8DB 4HUMB 2IOIA 2M2DA 4UMSA 1H0DA 5AAMC 5JHMA 4YDKL 5FM5O 4D3CL 1BZEA 4IDJL 3RWCB 3REVB 3EBIA 2X5PA 1M05A 4KI5F 4ODHH 3DRTB 4BUQA 2GSGB 4I9WE 5SX4H 4BWUA 2A99A 1VZHA 4KKLD 4N2NA 2YCZA 3DJRA 3I6SA 2VR8A 2Y7QA 3QQDA 1S8JA 3AS0A 1OP5K 1WD8A 5ICZB 2QADD 1SM3H 3U0PA 4WY7H 3VJ6A 5HDWA 3QDME 3RILA 4CVWA 4K2UL 1IAIM 1MW1A 4MD4B 1JGIA 1LJMA 2D7PA 3G5YB 5D1ZB 5DA4A 4UQ3B 1U58B 3APDA 3F6LA 5LG1A 3T1FB 3DHJA 3EO9H 3P4NB 3M17B 4X4KA 5A6LA 4DWHA 3ATAA 3QS3A 1S3RA 5MEPA 1RIUL 1GSMA 3QIWD 5HYSA 1MCRA 2FX9L 3IKCB 4AM0A 2WYHA 3VGAB 5I1GH 2X9WA 2C4FU 1L5GB 4OJFH 2AQSA 4LNRA 1NOFA 2A6JB 5ITBL 2VDRH 4P4KD 5J4MA 3ECBB 2CJ3A 4TSBL 2WAHA 4CN6A 5T5FL 5C0FA 4RRPM 1M7IB 4YHYC 3CU7A 2ZPKH 2CBOA 4R8WH 2YD6A 1WGOA 2P7TA 3QRGH 1HHKA 5D1XE 2MH4A 3IAGC 5AB0A 3MA9H 2ERJB 4F7TB 3WN5B 1FSKB 3JUZA 1BZOA 3SE3A 2RHEA 1JV5A 1XZ0A 25C8H 4YDNA 5DEGA 3TIDB 1OCZB 2DKUA 3IDXL 4HBCL 4K8RH 3V52L 3ZY7A 3GZKA 1C1EH 3O4LE 1AR1B 1ET8A 1I7ZA 1KJVB 1FH5L 4D9LL 5JNYA 1OARH 3MRKB 2QVFB 1T83A 5EORH 5GGRY 3NK4A 4K3DL 4XPTL 1YECL 3BN9C 5C0EB 1RMFH 4HC1A 1HZKA 5LGJB 1B0GA 2YEQA 1Q9OB 2GHWB 3D2UB 1NH6A 3F05A 3DK0A 4FNSA 1BD2B 2IAMA 5D6CA 3VWKC 2BHZA 3ATBA 4WFHE 3H9SD 5KBNC 5EUOA 4GSQA 4ABUA 2GIMA 3VNZA 2FWOA 3CFMA 5D7SL 3V7AE 4XPGH 1G7MB 2O6PA 1KV7A 2CSPA 1J05B 4KNFA 4MYPA 1P5UB 3FU7B 1Q9WA 5FUCC 3DX1A 1IKNA 2I9LB 3HMWL 3MROB 3HNTH 5F70A 3WKQA 3L6FB 2X0WA 1AIZA 4E9SA 1CT8A 4HAKA 4JGMA 3VI4B 1U3HB 4EXPX 1JPTH 1D2PA 2ZUSA 1AQDA 4EN3A 1NCUA 2AMUA 5GRVK 4YUEL 4LLYA 3O6MH 5DMJB 5IQ9A 5ESVA 1L0QA 4XWGL 5A2JH 4P23D 3A67H 3N6YA 2EDNA 2BSCA 2OX5B 4I4WB 1D5IL 1I1CA 1J5HA 4LLDA 1HL4A 1O7DC 5G53A 1OB1A 3Q1SL 3MA7A 2ZP9A 3LIUA 3O3DA 5E8NA 4FNLL 3P40A 2NY6D 4DNLA 4XTNA 2FUQA 5SWQB 1CL7H 3ARDC 4IYKA 2JAFA 1DVFD 3QG7H 4O2EB 3SOBL 1AFVL 4JPVL 3S4SB 3W0WB 1NGQL 3T0EC 3DDLA 2EE3A 3IFNH 1T5XA 4KRMB 4DGWC 3VXQB 1LP9A 4NHCL 3KS0J 1BSIA 4BSJA 2IPTH 4OVUA 4LOEA 4OZFH 2XG5B 4WWID 3QQ9C 5HY9A 3U4AA 3C60D 4KUCD 1H2SA 1PLCA 1A7QL 4OAWA 3Q7JA 2BIMA 2C9UA 4A6YH 5HP5A 2KSBA 1NLBL 2QHRH 2LAAA 2GQHA 1KCRL 1TJIH 3NA9H 1NIAA 4HHAA 3J27A 4PRPA 1WHPA 3CFIC 3IXTB 2AV1A 1HJCA 1UVQB 2J8UF 1YPZF 3N1QC 2AK4D 4AZUA 2EDDA 5KSUB 2DLFL 1KT2B 1CDGA 3TYGH 3ZTNL 1BPVA 2D4FA 5I1LA 5D7KE 2YUWA 2Y4SA 4MMYB 1Z1WA 3SHSA 3GLZA 5I71C 5IB4B 4OGZA 4YEEA 4MD2A 4MX7A 5F0MB 5F9OH 3RWHA 5HI4D 2E7BA 4APXA 3AUVA 2DICA 3NQKA 2Z0UA 4C4KO 4KOBA 1H68A 4P9MH 3H9HB 1S5IL 5LCVL 1EEZA 1F45A 1S9WB 3UTVA 4BSWA 4YSAA 1UJ3C 3PWPE 4A7TA 3H9ZA 3TEUA 1XSJA 3LYRA 2DLTA 3I50L 2AKRA 2VSDA 4PV9B 3HBZA 2VZ1A 5KSAA 1TNMA 5J9PA 1YNTF 5MENE 4M03A 3KYOB 5B1KA 3IJ8A 1VESA 2JJWA 3K5RA 4PJDE 4QHMA 2KQMA 5E95B 1W8NA 4PWEA 3JV5A 4H7VA 2DI9A 3GBEA 2O72A 2WZ0A 1MI5D 1OM3H 1H3GA 4JRWA 3GQFA 1IEAB 4JG1H 2BOBB 5JIHA 3HG4A 1MHHA 3BE1H 4OSUH 5JO5B 5BRZA 2OJEB 4ATTA 3ATFA 1QMUA 5E00B 4XVUD 1JGVL 4YHPA 3DMMB 4UF7C 1GJWA 4C56B 1NBCA 1NL0H 4RX4A 3NZHL 1UEMA 4F2FA 2FX8L 5I8CB 1ZHLB 2Z91A 3KPPB 3EZ8A 3MCYA 2G0LA 1KBGH 2F93A 4AGMA 4ONGH 3RZCA 4LARH 2Z35B 4DK5A 4YO0B 1I1AC 4JNXA 1KJMB 1TLMA 3ISYA 2ROXA 3EYUL 4F15C 1MREH 2EE6A 5EIQA 3EXLA 4NFCA 4RIRA 1OW0C 3ERXA 1NC2A 1VCAA 5AW6B 2WTRA 1CFMA 3CXHK 2QHLA 1NC4A 4R97B 2OJZH 1NBYA 3DURB 3CPLB 4UHRA 3L1GA 4CC4A 5I9QC 3ZKND 2WIMA 4Y4KB 1F42A 2WBXA 3U4BL 2HP4A 5AAWA 2OCCB 1AANA 1ORQB 3D3VA 4P46B 2LLNA 4L3FA 3HHSA 3C9LA 4L9DA 1QSZA 1TEYA 3KWVA 3QEGL 1SYVB 3OBAA 2XIDA 2I21A 1MPAL 1KGCD 2KDYA 4C54A 4HUKB 4P4KB 3O0RL 3FK3A 3L1EA 1IAKA 3VFWB 1JZJA 4JFOA 4A7VA 3UYOD 2QVTA 2R0LL 1T20B 3QNFA 1YNTB 3U9WA 4XC1H 2HFFA 1Q4NX 4QI3A 3D33A 3SPHA 2XZCH 1ES0B 1JFPA 1N10A 1T3FA 1OAUH 2JELH 3NZUA 4N2LA 4QD2E 5HGAB 5DQ9A 2WXKA 4BVNA 5L6YH 1C8RA 5GS1B 4P57A 3CFBA 1ZSDA 3D08A 2QSTA 2MMXA 3O2DH 4NM8H 1TNNA 3S35X 5F7HA 2PP7A 3U4KA 4KV5E 1JPEA 1ACYL 5DJYA 4KUCF 1OCWL 1NWOA 4GG6E 3VAEA 4N1EA 4WHTA 4RSVA 1COBA 2ZYRA 2VLRE 3LKPB 4KHXL 5EA0H 1JG9A 4IARA 2OL3L 3HI5H 1ZLSL 3D85B 2X4OA 2Z8SA 5CSGA 4BFKA 3F7QA 4DOHE 3GUTA 4YR6B 3UBXG 4N0UB 4YHZL 2APSA 2YPLE 4J3XA 1A3LH 3QCVH 1WWWX 4X98A 4XGZB 1GC1H 1RU9L 1AXSB 4GUOA 4HJGB 3N9GL 2Z8VC 1LEGA 3RI5K 3RAJL 1ORSB 1J0KA 1JUFB 2NZ9C 2YWYA 1SN5A 3GTNA 5AZDA 2N01B 2WXOA 5DQJB 5J89A 1FO0L 5I8EA 1MCIA 4AUYA 1JVOA 1FN4B 1X5YA 1RZFL 1RPKA 4NZRH 4E9QA 4GI8A 4NQQA 2B1AL 2IAMD 2BY2A 4GPVA 4U0RC 4XCCL 4HYJA 3LN5B 5GS0L 4OZFA 2A1WH 5T33H 1YEKL 4X7FC 5IEKB 4MCMA 4P23B 5E2TL 4A6YA 4XRCA 2CDFA 1MFAL 2P46B 2NW2B 4FTVB 4HCRH 4JJ5A 4BZ2L 2EDWA 3SDCC 1DZ0A 3T4AA 3U2SA 4F8QA 2NY6B 3MR9A 4K5LA 4GT7A 4J3OH 2HX7A 1DVFB 3PV7A 1KJ3H 1KYUA 1J1PL 3CC5A 3DGCR 5E1GA 1QBBA 3FQUB 4BWBA 3U2IA 4GYCA 4L4VB 4U0QB 4EN3D 4S2SA 3W1ZA 4HJ0D 4YDVB 3ZU8A 5D5ME 4WTWA 3DVGB 3IN0A 2A74B 3ZR5A 3K7UA 4HOZA 4KXZH 4ORGA 5K9JL 4F92B 1IRAY 2ARWA 1Z5LA 2BSEA 4JFEA 3MTRA 3QEQE 1JV6