4G7YH

Crystal structure of voltage sensing domain of ci-vsp with fragment antibody (r217e, 2.8 a)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
212
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVSSSSIHWVRQAPGKGLEWVASISSYYGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSYSWSYAIDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragment antibody heavy chain
publication title Structural mechanism of voltage-dependent gating in an isolated voltage-sensing domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 45
structure length 212
sequence length 219
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g7yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g7yH01
5K59F 5A2KH 3NBNA 3ZSTA 5KTEL 5C3LD 2WZPD 4Z7UF 3UYRL 3VXSE 1GSMA 5KAQG 1FFNA 1H5BA 3QG7L 4PRIE 2B39A 4LMQI 5FECB 1PKQE 2VDLH 1JGLL 1MCCA 5CZVL 3TYFA 5KW9L 3I6KB 4KZDH 2O26U 4CUCA 1G6VK 1MJ8H 2GW5A 4LCCA 3S35X 4JZNB 2BNUA 2LQRA 3U1SL 1I1FB 3SKMA 1MIMH 3ARBA 2JB6B 2YPLA 3LZFH 3ZHLA 4DGYL 4YDJA 2Y6SD 5FA3A 3UPAA 2W65A 3QDGB 5D6DC 2RIKA 2IG2L 1UACH 2D4FA 1IT9L 1WZ1H 4P4RB 4CW1A 2AEWA 5T1DL 1ZHKB 2BNRB 4JFFE 3NCEB 3BPCB 3SQOL 4ZXBC 2X1QA 3VFRB 1FO0B 1VCAA 5E03A 5EIQA 3WKNA 1FZOA 4NCC1 4L3AA 1FFRA 5I8EB 4BSVA 1TQBB 3ULVH 1A6AB 3CLFH 2GCYA 3S88H 5C0IB 3T65B 4C83B 3OKLB 3PV6B 3C5SB 1EBAA 4FQCL 3N1GC 4PFEA 1V3KA 1U8PA 1WICA 2BSSB 4X9GA 5L7XL 2XV6B 3QJFA 4PV9B 2BX5A 5D9SB 4G6JH 4Z8FL 3MCG1 2SEBA 3LS5L 3CAFA 4OLXH 4X7SL 4LQFH 5BS0B 3LEVH 1MNUH 3L5JA 3STLA 3TFKD 3GI8L 3QUXB 3RWIA 3QCVH 4OFYD 4RAHA 3WXWL 4W6YB 1K85A 3CCHB 1MVFA 15C8L 3T4YB 1T1ZB 1N4XL 2AXGB 4DKDC 5JIIA 1UM5L 4XP5H 5DK0A 2NXYC 3H0TA 3TA3D 4P2QA 1CICD 4F9LC 5KSBA 3S35H 4HIJA 3VFUB 2NW2A 3QIWA 1ZMYA 2OK0L 1CD8A 5HYJE 2H9GB 4PJFA 1JNHA 1JUFB 4NCC2 2HAZA 4PV8A 1B0GA 1CQYA 4Z7OF 3KPLB 2P8MB 2I60H 4OZHF 1XFPA 3HZKB 32C2B 5H94A 3NA4A 1QD0A 2MKWA 5EU7E 1PKOA 2YOCA 3GRWH 1YNKL 4PGCB 4HBQA 4LSVH 2D31A 3MRRB 1AJ7H 3MACL 4XMLH 4QT5B 4U1NB 4TTDD 1JYNA 4XMKL 1Q9KA 2B5IB 5IG7A 3A6OA 3EDDA 2F58H 2BRRL 3GSUA 3PDGA 1P1ZB 4GO6B 3CFEA 3J8F7 4H1LG 1MJUL 5EU6D 4MNHB 5DF0A 4G42A 5E8DH 1MPAL 2DJ4A 4NKDA 3ZE0E 5KS9E 1HIMH 1NC4B 1BD2D 4ZOCA 1B3JA 2YD9A 2OX5A 2P8LB 5I1CH 5JW5B 4P59L 4XPHL 4G9DB 4IDJH 4NUGH 2A38A 3HA0A 4GAFB 4PJHF 1UJTA 5EIIA 1EXUA 2EE6A 4MJ5A 4DCQA 1H0DB 1MHEA 5E4EB 3NGBB 4WTZG 4OCSH 4BELD 3FFCD 5F70A 4KUZH 5I1DB 5EU6E 5J7CC 4GRMA 3BZEB 4GQ9L 3BKYL 1BF2A 2Z9TA 1XR8A 3EOBA 3PP3H 2F53D 1TJGL 3W0WA 5EIVA 5E8PB 5IESH 4PRPA 5ABDE 6FABL 2H1PH 1S8DA 5GGQL 1J86A 2JCCE 4ZUVB 1HZHL 4MAYD 5I1AB 3VFPB 1DBJL 3DUSA 1A1MA 2A9MH 3B9DA 3SHSA 2YMXH 1TENA 2PW2A 3CIQA 4HJJL 1IEAB 4BSWB 3QXUA 5CEXA 4BQ9A 1GZQA 4JDZA 1A7QH 4HXBL 4WW1A 3SBWC 5MENE 1EEUA 4U31A 2F53E 2DQHH 2IPTL 5IIEA 1S5HB 5FO9A 2DQEH 4TOYH 1RFDL 4KKAD 3QUYC 1FNEA 3VFGH 3TT3L 2FZ3A 4ZSOB 3IJYB 5ITBL 4HCRA 1OAXL 3BN9D 2APWA 4FQPA 4TVPH 2BDNH 5J6HB 1YQVL 4NKMB 3DVFA 2XWTA 4U33A 4DAGH 1TQCB 2HFEB 2VLLB 1QBLH 5HHNB 2N1KA 1KENL 4R0LA 3RDTA 3QG6B 4AL8L 3UBXB 4YHZL 2V7HB 1TNMA 3X11B 4Z6AT 3O4OB 2QADC 5SX4H 2ZCKL 5GRVK 4TSCL 3RHWK 2WINB 4O58H 1GC1C 4RFNC 4DTGL 1KB5L 1QYGH 4KHTH 1JZ8A 1DQMH 1TLKA 5M94B 2VABA 1WEJL 1MLBB 5D7LD 5DD1H 1X5GA 1Z9SA 3BIAX 3V6ZA 2JJSA 2QEJA 3FB5A 1PX3A 2FLRT 2YD2A 2EZ0C 4JANB 5EOQL 1NBYB 4D2NA 4BFGA 2P44B 4PY7B 2PNDA 4OD2A 1IC7H 2HTLD 2A74A 2J88H 5A2LH 2BSED 3HE7B 4N1CA 3RGVA 4Y4HD 1FVDB 1MWAB 3P11H 3ARED 3B9KA 1KIPB 4WI6A 4XHQA 4F7PA 5D7LE 1DEDA 1X5AA 1XGTB 3SO3B 4O5LL 1R5WA 3BI9X 2XWJB 3VXTA 4XCYA 3IDYB 3BP4B 4NQVA 3LKRA 5IBUB 2A6DA 5CBAB 2P5EE 3G5XB 3VGAC 3VG9B 3FO2A 1FZMB 1V7NH 2WBJC 4K3EL 1EMTH 2ESVB 5HDBF 2G60H 1M4KA 4JPKL 4L9DA 2CSPA 5F1IB 1W72H 4NP4H 2BNQD 1UJ3C 2CGRH 1J0YA 2EE9A 1LD9A 4K3HA 1MRCL 3CK0L 4MD5A 1F11B 4Z9KB 2GKIA 3V7MA 4L4TB 1A5FL 5C86A 3UTTA 1OY3B 5DHVB 3GMRA 1HSBB 4XBGA 1Q9WA 3T2OA 1U6AL 1R3KA 5D5MB 3TZVC 2V9RA 2J8UA 1NGZA 5HHXL 3MA9L 1Y6NR 3VXQB 5GS0L 5B8CC 4MB4A 4OD3H 4L3CA 4C56A 1K8DB 3NCBB 2P5WD 4GXVL 2LU7A 4FZ8H 2BNQE 3ZDXE 2YSSA 2XYCA 3O6KH 1IVLA 3MRHA 5EO1B 1S9VA 3JUZA 3HE6A 2I5YL 3E3QE 1UCBL 4ODTH 3ORJA 1HQ4A 3GMOB 3QNYA 4TQEL 5TDPB 3GJEB 2E8YA 2ITCB 1OWRM 2BVUA 1I3UA 1A4KB 35C8L 5FUZL 5DJDA 3WEXB 1SVZA 3CNKA 4G7YL 4I0PA 3PGDB 3BKCL 1XGYH 4OIBA 4U0QB 3IFOB 1UYWH 3TVMB 4JPVL 4KK9D 4R4BB 4M6OL 5L2KA 2X4OB 4KV5F 3EFFB 2FO1A 4N0YH 2ZSWA 5ALCL 4FABH 1JVKA 3SE4C 4GQPH 4HS8L 2HFGH 4YJZL 5DD3H 4OGYH 2H41A 3QEQE 1ZGLM 2BERA 2W60A 3DXAB 4BQCA 4TSBH 4ELME 5KSVB 2VKWA 1IGMH 3DBXB 1DVFA 5CWSA 3EGSB 5H37H 5A3ID 3EYOB 2F54E 4PBXA 2OZ4H 2IJ0C 3NN8A 4LK4A 5I18H 3GJFA 3BP7A 2B8OT 3C9NB 1V3JA 4P3CL 3VDAA 5EZIH 5KN5B 3NIFF 1T7WA 4CMHB 5GS0D 2XXMB 5C1MB 1T7ZA 2VLRB 3UO1H 5SWZB 3MV11 3Q5TA 2NY2D 1RZ7H 2BHZA 3ARSA 2EDXA 4IOFD 4M6ML 3VMNA 1ZT4A 1T0PB 2YEZA 1F8TL 1OTTC 4Y7MA 4JAMA 1FO0H 2VKXA 4R4FL 4WHCA 3DX8B 4HZAA 3T8XA 3ULSB 3V5HA 5IHUL 3UJIL 5D7KE 4XPFH 4DOHE 4P2YA 2VSDA 2NZ9C 1JGUL 3FQRA 1OP3K 3ROOB 5D1ZA 3VXSB 5F1OB 2HRPH 1UB5A 4PRIB 4MB5A 1G9ML 2XA8H 5AG8A 1EFQA 1PKQB 2I25N 1DBKH 3CDYA 2W91A 4ZUWA 1RVFL 4NZTL 3EDKA 5I71B 3VE0B 4BFIB 4X6BB 1CTOA 2OQJB 3BIKA 3HI6L 3LH2H 1ZT1B 1DE4B 1NC2B 3MZTA 3DX7A 4UUJA 4MDIB 3W81A 1NCBL 2G9HA 1H3TA 4NC0B 4NBYB 5GS1C 3BEVB 5I1LB 5IBTL 4HKJB 3O4LD 5EU4B 3O3EB 1LO5A 1FVCB 4QXGL 4P3DB 2GJJA 3RWFA 3TH2T 5KJRL 4TUOB 1FHGA 4BZYA 1J1XL 4YBQD 4QRSB 4ZUSA 2VE6A 4GH7B 3RIFF 2AQ1A 2ICCA 4RISL 3RWHA 3D9AH 3WJLA 1QO3A 4XNYL 4WDIA 2HA1A 4PJ7E 1CFTB 2QHRH 3X3GL 2AVGA 4R7NA 1IC5H 4DEPB 2EIEA 5GZOD 2EDRA 5DFVD 1OCWH 2GTZB 5AD0B 3MJGX 1T7XA 5F8RC 4I0CC 3MRPB 1QKZH 3G5YA 5F93C 3O0RH 1VB9A 3SDAC 1U8KB 1JHLH 3PWVB 5DJZB 3F7QA 3OB0K 1GAFH 3EJYD 3HTLX 5DUPH 3D18A 2YR3A 1KLUB 2Z92A 4FMKA 2ZKHL 2EEAA 1H5BC 2WIMA 1AC6A 4OSUL 4U7MA 3WLWC 3KR3H 4OI8A 1F6AA 2XZZA 2E8ZA 1A7OH 4RQQB 4M5YL 4O2CA 2Q20A 2NPLX 4NHUB 3SKNA 1XF4A 2Y1VA 3AS3A 2ZCHL 4LCCC 4P49A 1Z0MA 1G7LB 4HUUA 1HYSD 1SVCP 4YBLC 3LV3A 4GOSA 4EI6A 3ARBC 4WO4A 2DQTH 3DHJA 3IDXL 1K2DB 2NY6D 3EFDH 4MNGE 4IS6A 3H9SA 5IMLB 3ILQC 3ZYJA 5E6IA 4M6AA 3TA3B 1CICB 1NL0L 1NFIA 1QA9A 2OTWA 1F3RB 1CDBA 3IFLL 3OWEA 2R2HA 3VWJA 3JBG7 1MI5D 3RIAF 3H3PH 3T2NL 4PJ9D 5BOPA 4UOW1 3WE6A 2HN7B 3GBMH 4LSTL 1FV1A 1MCBA 5L8KB 5LWYL 4Z7UA 1H8SA 1U8HB 3QI9D 3IDGB 4QRPE 1EZVY 2OTUB 3UZVB 4ZFOA 1HSAB 4HJGB 4FZEH 4HPOH 3MXVH 3MOQA 4J3VA 4JQIL 1N0LA 1DBML 1T6WA 3BT2H 1J9CT 5DJ0B 5F6HI 1VERA 5KVEH 4S0TD 3UBXG 1MI5E 4N0FA 4U7SA 3CLEH 5DT1H 5E56A 3RUGE 1EERB 3TN0A 5EU6B 3HC3L 3C09B 1KLGA 4U1IB 3Q5YA 1E4XL 4NN6C 4DN3H 4FXKA 4JCMA 1BD2B 3ZE0F 5KS9F 3MA7B 3QIWC 4U0RB 1WWCA 4RWYH 4UBDC 4F2MA 4GBXA 4HZLB 2K3TA 2AJXH 1X9QA 2GT9B 4TUKH 4LSDA 4M43L 3O8XC 2VDQH 1KBGL 5I1KH 5E6ZA 3DUUB 4JDTL 1CGUA 3MJ9L 1ITCA 3L6FB 4JZNA 2J6EH 4U1KB 4PJGB 3B43A 3KYKL 5JW4Q 2F53B 2R4SL 1QR1A 2P47B 4PJXE 2JB6A 1LP9E 2I9LB 2FIKB 1NCDH 3MV9D 3QDGA 3WNNA 1ZOXA 4Y88A 5EBMA 5C0RL 2ILLA 5KANG 2JCCF 4MAYB 1TITA 1KEML 3ARFD 1ZHKA 4LCUB 5F7UA 4J4PD 1MWAH 3RVWD 3K80A 4FQQB 5JPNB 5DSCA 5I6XC 3OAYK 4I3RH 12E8H 4HK0B 4O00A 4PREA 3B8YA 5LBSL 4M1CC 2AK4A 3T65A 3FN3A 1NCAL 3CFBA 5CP3H 5CEZL 3MCKB 3PV6A 3C5SA 5EUKB 2FWOB 1XGQB 2BSSA 3FRUB 2R8SH 5D9SA 2KZWA 4ZDHA 5CKAA 4XBPB 1AKJA 2H2PC 3LS4L 4G9FD 4FNLL 4Z77B 1GJIA 4K23L 5IV2A 4OZHA 4N8VG 2Z0BA 5MHSD 2ADGB 4X4ME 4K71B 1KJVB 2CDGB 1S78C 1BHGA 3LSOB 1I7RA 3CU7A 2YA0A 2VXTH 1ZSDA 3G04A 2XKNA 5FDWB 3PWPD 4PRDA 1WK0A 3VFUA 3BDBA 3HZVA 4U1LA 3N9GL 4G9FE 3TJEH 2H9GA 4Y5VB 5I15H 2UZIH 2YD1A 1JUFA 5IB2A 3VD4A 1M7IA 1Y0LB 4YXLL 4MQ7B 3KPLA 2DQJH 3KPPB 2P8MA 2CDEB 1M7XA 5DD6A 5JMRA 1KEGL 32C2A 5FHBL 4FQLL 1Z0NA 5D7LB 5JW4M 1D6EA 2XXCB 5GRJH 4PJHA 5T1MB 3CZJA 3O6LL 5T3XL 4DVBB 2CD0A 4U1NA 3IFPB 4HMDA 3SKUD 5CEZD 4I4WB 2P5EB 2E27H 4Y4HB 2H2SC 3EYVB 1RJLB 2YA2A 4G8IA 5JA9A 4QCIA 4UIMB 1I9IL 3F5WB 5GSRB 5IP4A 2JJTC 4B50A 1U8JB 1CU4H 3W2DL 3H42H 4NN7B 4CNIA 4ODHH 1NC4A 2OJZH 3L3JB 1JNNH 1J88A 2P8LA 1OTSD 3RL1A 3TJHD 2FJGB 3GMMB 4G9DA 3MRMB 1G0XA 3VI3F 3C6LC 2EH8L 4LASH 4NC1C 1IGYA 5EA0L 5C0EB 1HHIA 5EBGA 5C9KA 3IDIB 1S5IH 3UTSE 5C07D 4MQTB 4G8GE 2DBLH 5DWUL 2JJSC 4X5LA 4FQXA 4Y1AE 3BZEA 2VDKL 1C5DB 5ICXB 2BNQB 4J3TA 3I75B 4PYGA 5AYUH 1KSRA 1H15B 5E8PA 3PE9A 5F7WC 3WIFB 3I3BA 3RGVC 1ZHBB 3FQTB 4ZUVA 2CKNA 1JYWA 4FXGA 1ZK9A 5I1AA 4G3YH 5ACMA 5T3XD 3ULVC 2P4AB 3CH8A 5IVOA 4BZ1H 3S3SA 2VO5A 3CFJA 4KRLB 4RFEB 2YRZA 2YUWA 1A4JB 2P5WB 3EHBC 4QHKJ 5K9KB 5EU3A 3SDDD 2BOCA 2ICEA 5HVGB 5IW6B 5GHWH 4UTAL 3JWDH 4QRTA 4CBPA 3MYZA 4PGJA 2EXWC 5JA8B 4ZSOA 1SM3L 1AGDB 4KAQH 4JY5H 3LKOA 5JUEH 4ELMB 1EEYA 1HNGA 5J6HA 5T3XE 3CH1A 2VLLA 2F54B 5JXED 3KWWB 3MTRA 5DRNB 4PLOB 1PY4A 3OXSB 3RTQD 5L6YL 4QHLB 3WIIH 3QG6A 4GMTH 1HILB 5I1HH 3B6SA 2Z93B 4UZGA 1AO7D 1J8HE 1LNUB 3EJZD 4IOIA 4MJ6B 1DUYB 1YC7A 5GGTL 3WD5H 3DSFL 2FD6L 1ZVHA 1BOGB 1K4DB 2AEPH 1AR1D 1FNSH 5C0AA 3LQZB 2NNAA 3U7WH 4DOHB 4ELMF 1JTOA 1YC8A 3NPSC 5D2NE 3GHEH 3QIUD 3OR6A 2PUQT 4HX1B 1I9RL 1EJ6A 1AO7E 1ORQA 3H7BA 1NBYA 3K3QA 4Z7VE 2FECL 3PXJA 5CS7A 2NY2B 3IGAB 2YHGA 2X6MA 4Z7NE 4D8PB 3TO4C 1JF5A 1CLOL 2PYEE 3OZ9H 5HI5C 1QLEH 3P4OB 1FVDA 1CD0A 3SE9H 4L8CB 2QQNL 2PF6A 1CFVL 1GPOL 2F8VA 4PJ8D 1KN4H 1CXFA 5F7EL 1MY5A 3QEGH 5D1XC 2LTQC 4RMWA 1CWVA 1F45A 1P4LB 1T0MB 3WS3B 5CGTA 4BH7A 2NY1C 5BVJA 2RFXA 4KFZC 2BVEA 5KTEH 3KPOA 3P9MA 3UYRH 1DVFC 1LE5B 3QG7H 1PZUB 1AGCA 5DK3A 2ESVA 1JGLH 1RUAL 5CZVH 3BZ4A 4POUB 3ZDZF 3GM8A 5J11B 5T5NG 4PLJD 2FDBP 2YWYA 2VMFA 5KW9H 4KVCL 3O4LB 5FUCC 5CJXC 1D5ZB 2V7NB 4JHBA 1F11A 4WFFE 3HNTL 1WC7B 3RWEB 1PYWB 1K5NB 5DHVA 1E6JL 1HSBA 4LDLB 3UCRA 4G6FD 4DGYH 3DX6B 1WWBX 2VAAA 1WZMA 4J7RA 4Q74A 4JKLA 2IG2H 4MLIA 1D5IL 4DGIL 3UAJC 4KJYA 4PJ7F 3SQOH 4FFWC 4O2EA 1AQKL 1KOAA 5E6YA 3L5WA 2K7PA 4NM4L 5ESQA 1KJMB 4FQCH 5TDPA 5A2IH 1AFVL 2R0KL 2JJVA 4C54A 3LS5H 4MVBD 5IB5B 3QT2A 4X7SH 5CHNB 3TBVB 3PGDA 2H32A 5E99H 3QXVA 1PSKL 1TJIL 2K1MA 3GI8H 4QTHB 3IFOA 3TVMA 4R4BA 3WXWH 5GRYA 2UVFA 2WV3A 15C8H 1F6FB 3GSNL 5J12C 2XWBB 1N4XH 1IRAY 1UM5H 2YXFA 3FQNA 3SEPA 1IAKB 1TMCB 4F8TA 2V6HA 1X5JA 2FHFA 2BVQA 3DXAA 4PD4J 3CVIL 4OCNC 5KSVA 3ETBF 2GJZA 2IH3A 2OK0H 2NY6B 4M02A 2HJKA 3RBSA 1CGSL 4YIQB 5E7BA 4RX4D 3EYOA 5EZJB 4AMKL 2W9EL 3L5XL 3C9NA 4JR9L 1ZS8B 3AUVA 4XVUD 5FYJL 5SWZA 1QSED 1EAPB 1MI5B 5C0NC 4KKBC 2NLJB 4PJ9B 2BXZA 3SDCD 3MACH 4XMKH 3DX8A 2DQDL 3PWJB 3ILPB 1S9YB 2BRRH 4UT7L 2AERT 5T33H 3QI9B 3L7FB 4YHML 2DIJA 2V17L 1MJUH 3OKDB 3VXSA 1CDGA 1L7TL 4MSWB 5I0DA 5EOCL 1MRFL 1SYSA 1MPAH 1PKQA 5ESVA 4XPHH 1G1YA 3QXAB 4BFIA 3UBXI 2HH0L 4YK4B 3RUGF 4HWBL 5JZ7C 2OR7A 1ZT1A 1RSFA 1DE4A 1NC2A 4B0MM 1I1AD 1TTGA 4HPYL 1JNLL 3QNXA 1KTLB 4PJXB 5I1LA 3BEVA 3EOYG 2NXZD 4OZ4B 4HKJA 5I1GL 5IJKA 5IM7A 4KJWD 4PGEB 2CRYA 3PNWB 5E8NB 3O3EA 3LB6D 4GQ9H 3BKYH 2GK0A 2AJZB 4P3DA 1HEZA 1MCWW 2D7OA 1X5LA 1TJGH 2QLVB 4QRSA 4JFFA 3I50L 1AGFA 1JI2A 1F97A 1YMME 3BUYA 6FABH 5GGQH 1QFWL 5FYJD 4M7ZC 3Q6GL 1FYTE 3KS0H 3GGWB 4NQXB 1HZHH 3R8QA 1DQLL 2CDFA 1DBJH 4AM0B 1QOKA 4KJQD 4PJXF 1NUDA 1LP9F 4F3FA 2YC1A 3MV9B 1SMOA 1T1YA 2GTZA 5AD0A 3C5ZB 4HXBH 4OGAC 2AS5M 4IIQA 4M62L 3Q5OA 5KANI 1U8KA 1P7QA 2ARJB 2IC2A 2PTTA 3PWVA 3OTTA 2FGZA 1QEWB 1MHHB 3ZTJH 1YEJL 1CQKA 3DETD 4U1SA 4LGRB 3KXFE 3D87B 4JCLA 3SCMC 5FUOL 5FYJE 5ITBH 1KLUA 1ZHLB 4NT6B 1EH9A 2BZDA 4ONHA 5D6CA 1TCRA 4IRZL 3T4AB 4EKXA 4KHXL 3BVNA 4JFEE 4YLQT 1YQVH 5GS2H 3GZKA 5INDA 2L7UA 2JJWA 4LDOB 1KENH 2X09A 4RRPA 4UNUA 4G9FB 1OB1A 1NBQA 5HYJA 4AL8H 4YHZH 5I8CB 3S37L 4YXHL 4OFYA 1NAMA 4LF3A 2ZCKH 4IHOB 4U05A 3RL2B 4TSCH 4M7LL 1SYVB 2JIXD 3BQUD 5IF0B 1SJVA 4DTGH 4V1DE 1IJ9A 5E95B 1KB5H 3VW3L 2ADJA 1YEIL 3MRQB 3PWPB 4CN1A 3TA3A 4DZBB 1SQ2N 1X4YA 1FNHA 1WEJH 4PRNA 3SGJA 4S1RH 1KB9J 4NZRH 5DDHA 5EOQH 1KIRB 1BFOB 5JHLL 2NY4D 3OKYA 4FQIL 4XXDA 1TQBC 1WBZB 3PDOB 5F8QC 5KS9A 2ZSVB 5FB8B 3L3OB 4PB0L 1U8HA 1IEHA 5HD8D 3G6AB 1CYGA 2OTUA 1YPZE 3FB8A 3QWQB 4HJGA 3EW3B 3QUXC 4XBEL 4NRXA 3RBGA 4XP4L 5TQ0L 4P99A 4O5LH 2F8OA 3NOIA 2XG4A 5EU6A 2C3WA 2XRAL 4Z95L 1J1OL 1W0WB 1J0KA 1OAUL 2DM4A 4DKEH 1KXTB 4JFHE 4K3EH 4P2RD 4YHNB 4OM1L 1VKXB 2JCCA 3RP1A 4WEMB 4GAYA 3WNLA 1K3ZA 4LSQL 1UT9A 2MQCA 3VRIB 4AQ1B 5FF6A 2ZOKB 1CD1B 1I9EA 1MRCH 4CL7A 5C07B 4OFVA 1YECL 5BV7H 2C1OB 4QOKE 2XZAH 8FABA 1U6AH 4XAKD 5MENA 2F53A 2LU4A 5HHXH 3MA9H 2EC9U 2B5IC 5GS0H 1XT5A 2FIKA 4J1UB 4P2RE 5ID1A 4UNTA 5I74B 5EUOE 3T09A 1QRKA 4GXVH 1T80A 3QAZB 3X12B 4LCUA 4MQSB 2Y5EA 4FQQA 2I5YH 1HHKA 1UCBH 2RAMA 3O41B 2PN5A 5ESAB 5DFTA 4TQEH 3HR5B 3ARXA 1U58B 4XAKE 4Z5RB 5GS3A 35C8H 5FUZH 3MCKA 3SDDB 4NO5A 4LNRB 2FWOA 4QTIH 3FRUA 4G7YH 5E4EC 1E0OB 3BKCH 3UZQA 3NGBC 1L9NA 3PGFL 3KVQA 5DS8A 4JJ5B 1OWWA 4JPVH 5JOFA 4M6OH 3BH8B 4V2CB 5TGBB 2FX8L 1E6OL 1MHCA 5ALCH 1CF8H 5F3BB 2X9WA 1KJVA 5FCUL 3BDYL 3RTQB 3L95A 4JLRB 3OG6B 1AO7B 1FLTX 4G7VL 5F44A 5CGYD 5ACZB 2UV3A 4Z7VB 4HC1A 5L88L 2L0DA 5IHLB 4RDQF 5GRZA 3U4EB 4Y5VA 4ONOA 5B38G 2X1WL 4P3CH 4M93B 4P9HL 1A6ZB 1F3JA 2CDEA 5ADPL 3RJQB 1XGRB 1HCFX 2APVA 5F9WB 4M6MH 5D7LA 3NZHL 3QHZL 3QIUB 2DKUA 1F8TH 2X1XR 4HUXB 2VZTA 3DSNA 4R4FH 5IHUH 3UJIH 5D72H 2GK2A 2W0FB 4DN4L 4Z7VF 4U7KA 3IFPA 4Z7NF 3ZKXB 3I2CH 1DQJB 5F6IB 4I4WA 2P5EA 3MRDA 4Y4HA 1G9MH 1TQCC 2WWKO 1BZ7B 3BZFA 4F7CB 1RJLA 3MRIA 1HQRA 4N5UA 1IGCL 4PJ8B 4UIMA 2FO4A 1A1NB 5KVMC 5GSRA 1RVFH 1ADQL 5F9JB 2EYTA 4EUPB 1U8JA 1G9NL 3O4OC 1KJ3L 2DQIL 3FT3B 3L3JA 1IKNA 4NPYA 3TO2B 3HI6H 4QLRA 3GMMA 5JHDE 1RIVL 1NCBH 4WEBL 3RY4A 4AK1A 3P0GB 3BHBB 4N0CC 4ALAL 4XGZB 3IDIA 3BE1L 2EC9T 4QXGH 5FIEA 3FT4A 3MLPA 3AMKA 2Z4QB 5KJRH 4BYHA 1Q38A 1J1XH 4NQED 4JRXD 2ATPB 1C5DA 4IRJD 5AWNL 4JN1L 5TE7L 3KJ4B 4RISH 4NFCA 4XNYH 3ARGD 4QRRE 1Z9MA 3BP5A 3HE7C 3PABA 3VFMB 1ZHBA 3KLAA 3X3GH 2DJSA 3O6ML 5ICYB 4G6FB 3O9WA 3HC0B 4MJID 4D9RE 3PWUB 4PLNC 1Z9OA 2ZWLT 1EGJH 4TNWF 3SO3C 4Q6YA 3BYTA 4GW1B 1CR9L 5I1JL 3QQ9C 1N2RA 4LMQE 5SV4A 5J1SC 3P0VL 3IJHA 3F62A 4APQA 1JMZA 5FM5O 3BMVA 3IDYC 5IW6A 3LRGA 3HPJA 2EKJA 1H3UA 4NFDA 4UT6L 2OTPA 1JPTL 1MQKL 3H8NA 3VG9C 1UEMA 1AGDA 3QEQA 3BISA 2DMCA 1XCQB 4GXUN 4MJIE 3RWCA 4M5YH 4G8FB 4X4YB 4ELMA 2XPGA 1JGVL 2ZCHH 5DI8B 5EOTB 3EO1A 3RZCD 2F54A 1EHLH 3QZWA 3CFIC 1MCLA 1PZ5B 2X42A 3OXSA 3ARZA 1BOYA 2C3XA 5ANME 1LNUA 2G5BB 3S7GA 1LK3L 3IDXH 4U3CA 4XXCC 4MJ6A 4CADA 2NZIA 1DUYA 4RGND 3C8KB 4O02H 4JE4B 1JYVA 3DI3B 1IM9D 1BOGA 1K4DA 1NFDE 2D3VA 2YN5A 1NL0H 1WITA 3LKQA 4XB7A 5DJCB 3LQZA 3MRKA 3IFLH 1EZVX 1D5XB 1AXSB 5DJ2B 3T2NH 2YXMA 4H5SA 2WLZA 3VRLE 1QSEB 4XP9H 5BRZD 4RGNE 3UMTA 5LWYH 5FKPA 4KRMB 4UAOB 4JFYA 3DX9B 3P4OA 5DVLA 4L8CA 4GKNB 2H8PB 2EDOA 3E6FA 2VZ3A 4GKSB 4XPGH 3TVMC 3RVVD 4JQIH 1DBMH 3ARUA 2FB4L 4ENEC 4Q9RL 1BVKB 1I8IB 1P4LA 1JPST 2ICES 4WI9A 3WCYA 2EXYD 2HJLB 4NZDA 4X6FA 4ISVB 4NRYA 4TYUA 4N9GA 2J4WL 1U92A 5C7XL 1MCWM 3KPSD 1YY8A 4P5MA 1S7RB 4I3GA 4XT1C 2BXYA 2VLJA 3ESVF 3GSVA 1OP3H 3GSNB 5D70L 1P9MA 4JM2F 3PP4L 1I1AB 4PJ7A 3IDNA 1CLZL 4CMHC 5I66A 4I13B 4WEUD 4M43H 3HAEA 4S1DC 1CXHA 1KBGH 2NXZB 2MHAA 3KPRD 4JDTH 3MJ9H 4XC3L 2EDBA 4M00A 1E28A 5JNYB 1WC7A 2AP2A 3KYKH 1JK8B 4XWGL 2PXYB 3MRGA 1G7JB 2A6JA 1X5YA 1ES0B 3KPSE 5IKCB 3DX6A 2RGSA 3FRPA 3WXVL 5C0RH 1JZ6A 1T1XA 5FM5M 4MDJA 4YWGL 4LPYA 3CDGA 1KEMH 1Q9LA 3JWDC 2FR4B 1XIWD 5C08D 3IT8D 1U3HA 1FZJB 1FQ9C 1J18A 3Q3GB 1GGUA 1ZKAA 2RQ8A 5I71C 5LBSH 4JKMA 5IQ9B 4AEHH 1NCAH 4WW2B 5CEZH 1KJMA 1SHMA 2PW1B 4PGDA 5F21B 2NX5D 1A6WL 5J3HD 5IB5A 2E9WA 4P57A 1FC2D 4FNLH 4MNGA 5IJKC 2GAZA 3PUCA 2IEPA 5SWSD 5CEYA 4XCEB 4U6XB 5C08E 3QRFM 1FORL 4NHCL 3FL7A 3HMXA 4YAQB 1V3MA 3C60D 5DMGD 2BOBB 4E41D 3BGMA 4YBHA 2P24B 3OB0H 4JFOB 3QDAA 5I8OL 2V5TA 2QKIB 3T1WA 1YEKL 5DTFB 3WLBA 3H2WA 1T89A 4GRWE 4DEPC 1Z9LA 2FSEA 3GIZL 3N9GH 2JIXB 3BQUB 5F3HA 1ZWIA 2Y6SC 3V0WL 1YEHL 1EO7A 5EZJA 4QRPA 1LO3H 2CKBB 2V2WA 4Y19D 1V7MH 3V6FB 1ZS8A 3SKJL 1KEGH 3T08A 2EYSB 5FHBH 4FQLH 1A9EB 2IQAA 4YPJA 2CK0L 5CSBA 1UH4A 1B6DA 1JHKL 4MA8H 5E1AB 1WVZA 2NY4B 3U46A 2YWZA 1MFEL 3RUGA 2XNAA 3O6LH 2BSTB 3QWRA 5T3XH 4BQ8A 3MJ8B 3R0MA 3QUML 4ZFGL 4KTDL 4NZUL 1S9XA 3PQYD 3O2DA 3GO1L 3PWJA 1S9YA 1T20B 2ZUSA 4EBQL 3FO1B 3L7FA 4L4VD 1BIIB 1LDPL 4AIZA 2AJUL 3OKDA 2MCPL 4MSWA 2B4CL 2BFVL 3L3IB 1I9IH 1YPZF 3TFKC 4EI5D 3FZUD 4JFQB 5FDYA 1MREL 3RWDB 3HG1D 4NRZA 4S1QL 3WL9B 3QUZA 3FT2B 5TDNA 3VI4E 3QXAA 5EU7C 4IMKC 4QOKB 4LPTA 2EH8H 1RZIB 2Y72A 1KTDB 3PQYE 3OJMB 4I1NB 5EA0H 3TA3C 4PJXA 1CICC 1LP9A 3PF2A 5ID0B 3P73A 2VXSL 1T21B 3SGJC 4YHPB 4P2RB 3BD3A 5E8NA 3PNWA 4K7FA 1C12A 1LWRA 2VDKH 2YUVA 3GSRA 1M7DB 1LGVA 1FL3A 1KTKE 3D0VB 3HG1E 1CFQA 2VISB 3PIQB 3LN4B 5IHZB 4MCYB 2DIAA 1ULVA 1EUTA 5CSZB 1R3IL 5J89A 1P2CB 1IAIL 3QRGL 3VXRE 1I8KB 4J8RA 3GUTA 4AM0A 2UYLA 4TTDC 3VXUD 4LCWE 3ISWA 3VH8B 2ATKB 2I07B 1K8IB 4WFED 3NA9L 1UWGL 5TH2B 3C5ZA 4R7DA 2QJDA 4Z0XA 2IALA 1GZPB 2ARJQ 5EUOF 5IGXL 3PL6D 3C09C 4HXAL 4LAJH 1MLCB 1U9KA 4J4PA 4UTAH 2IFFL 4YDIL 1BVZA 3QJHB 2VDNL 4LPUA 4X4MA 5INCA 3WO4B 2RR3A 1S9KC 1CDIA 1SM3H 1ZHLA 4U0RC 3UTQB 2DWEB 4NT6A 4EUPH 3T4AA 2FYYB 3HLAB 3KAAA 4OV5B 4GG6B 3VXUE 4QYOA 2YS4A 1BWMA 2YK1L 4WFEE 4Z78B 4OD1L 1SBSL 4G9FA 2YBRB 5L6YH 1JN6B 4C4KO 1EHNA 3OAYH 1KULA 1OL0A 4U1MB 4X5XB 4YDLB 5I8CA 3D48R 1KN2L 3UTZA 4TULL 4WFGE 4WY7L 3VU2A 5F9OL 5GGTH 4M1DL 3RL2A 2Q76B 4LSUL 5I73B 1A7PL 4HIIA 3NFSL 5IF0A 5LGJB 5BOZG 5D93B 2VLME 4ZUTB 5JOEA 3AY4C 4DZBA 4GMSL 4MAYC 3GIVA 1AC0A 2OP4H 4YHIB 1I7UA 4QNPE 1I9RH 2D7TL 1KIRA 1MIML 1UZ8B 1HOCB 1W0VA 2Z35A 1CS6A 3PDOA 5C3TA 1CLOH 3WHE1 3P77A 4F7EB 5J9PA 4OGZA 2ZSVA 2Z8VC 4JFPB 4KKAC 3I9GL 1PLGL 2OBGA 3BPLB 2QQNH 5JHDB 3QDHA 3G6AA 1GPOH 2ZNWA 3BN9C 5DO2D 1OGAA 1J0JA 4ZO7A 2Y07H 3MGOB 5F7EH 4LL9A 4D0CB 1UKQA 2CK2A 3DRQB 4OZFB 4W6WB 1RHHB 4K71C 1JWSA 3UTSA 1UC6A 3X14B 4G8GA 4BQBA 3FB7B 4Y5YB 4ETYA 4PP2B 4GKZA 4Y1AA 1N59B 4C58B 2NTFB 3CSGA 4I8DA 3RNQB 4MAUH 5H2BB 4O4YH 4LFHD 3NVQA 1RUAH 1NGWB 2J3SA 1X7QB 2VQTA 3QCVL 1YDPA 1OSPL 2VQUA 3C87A 3CGTA 3ZZ1A 1MH5B 1MHPH 3NCYS 4KVCH 2ZOKA 1CD1A 4X99B 3C5JA 5E2UL 3GSWA 4LVOB 3HNTH 1I8LA 1NBZA 3RI5F 1E6JH 4NQEB 4JRXB 4IRJB 5D2LB 4NQSB 4LKXB 2Y9RT 2AV7B 4AQOA 4JKPL 3QEHB 1EHXA 3BD5A 2HTLC 5GGSY 1KJ2A 1ZLWH 3ARGB 1R24B 4J1UA 4RNRA 1D5IH 1XCTB 4X0KB 4Y4HC 4DGIH 2I60L 5EFIB 4HS3A 2B1HL 4XNMA 1S7QB 4MJIB 1NAKL 4HUWB 3VXMD 4UV4H 1KNOB 1AQKH 1T3FB 4JPIB 1HHGB 5T1KD 4NC1E 1TXKA 2MWCA 2Y06L 3LRSA 4NN7C 1HHHB 1IKNC 4LSVL 1NJ9B 3O41A 2Q8BL 3HR5A 2VC2H 3G08A 1AFVH 4RBPH 1U58A 2R0KH 3B8SA 3ARDD 3E8UL 1J8HA 5ANMB 3S5LB 3SDDA 4LNRA 5JDSB 4O51B 3STZA 4H25A 1OSZA 4MQXD 1PSKH 4FQ2H 1KIQB 3MLZL 3ZLQC 1TJIH 1FFPB 5F7DB 3G5VA 2X4RB 1I8MB 5IBLD 1NFDB 4PJAE 5J1AB 3VXME 3LEXA 3BH8A 4M8VA 5MERB 3KNBB 3WSQL 5K9OB 5KSUB 2YD7A 3BH9A 4XTRD 5D2NA 5FKAB 3DV4B 3RZCB 4OM0L 3E3QC 3ULVE 4JLRA 5LGKA 1DBBL 1QQDA 4GW4A 1AO7A 1SJHB 3CVIH 4JFXB 4B7IA 3U2SB 5ACZA 2YKLL 4JHWL 4Z7VA 4R9HA 4RGNB 1CGSH 5CD5D 2AJ3A 3GEWB 3QIBD 1U8NA 2AGJL 2PYEA 5MEQB 1BF8A 4U1JB 1IM9B 4AMKH 2W9EH 3L5XH 3FQUB 4JR9H 1JFQL 4M6NL 2ED7A 1YY9D 1NFDF 1VFBB 1A6ZA 4Y16D 1F2XK 3ZYIA 1XGRA 1OLLA 4OF7A 5DVNA 3ZE1E 1OVZA 5DEFB 1WT5C 5A16B 2EKSB 2DQDH 3PJSB 4UT7H 5FYLL 3K8MA 3VRLF 5BRZB 2HVKA 5L9DL 5C2BH 2GTWA 4YHMH 1SEQL 1M05A 2JB5L 2V17H 4EQ3A 1L7TH 5DC9B 1B88A 5EOCH 1OHQA 1NDGA 1MRFH 1X5KA 1BZ7A 1FP5A 1R3JA 2VB5A 1PBYA 3F7RA 3FOMA 4RFOL 1T4KB 2I27N 3AVEA 4KK9C 2FJHA 2DQEL 1A1NA 2ZUYA 4HWNA 1AHWB 5F9JA 4JQXC 5EBLA 5HDLA 5T5FL 2OXHA 5C0DB 1B6UA 1S7UB 4HWBH 2RJMA 3JV6B 3D0LB 4HWZB 4PG9A 3CFKA 1RI8A 4HPYH 1RIUL 5E2TH 1HH6A 3LPWA 3PHSA 4WNQB 4DAGL 3S37X 3BHBA 3O2WL 3KPSB 3SGDH 3BKML 3MROA 1QNZL 1BZ9B 2PCPB 1M6OB 4LGPB 2W07A 4C57C 5EBWB 5GS0C 3EO0B 4Y2DD 3I50H 2D9QB 4GW5B 2OLDA 3KPRB 4NM8L 2NY2C 5EO0A 1HNFA 1QFWH 3Q6GH 4IOFC 5LG1A 1DQLH 4JRYE 3WUWB 3VFMA 1DQML 2X4NB 5BO1L 5CLWA 4R96B 3HC0A 3LKNA 5DD1L 1G6RA 3KYNA 1CBVL 3PWUA 1Z6JT 3JTTB 3TNMB 4GW1A 1DN0B 5F71A 1GXEA 5C08B 1IQDB 2DI8A 1RV6X 1YEGL 1IC7L 1YEJH 1II4E 4P5TD 1JRHI 2EIZB 5FUOH 3LKSB 3MBED 3P11L 4LLWB 3ES6B 5CD3A 4L8DA 2CR3A 4KHXH 3CX5J 1H3GA 1EBPA 1E27B 4LLAA 2B1AL 4XPTL 4I9WD 4HUMB 2NX5B 3OGCB 5T1LA 4X4YA 5J11C 1QLRB 1N3NB 5SWSB 5DI8A 4PD4K 4DZ8B 1EK3A 1I7ZB 3S37H 4YXHH 2R23B 1MCOL 3KPQB 2G5BA 3C60B 4YBQC 4DUVA 1YN7A 2ENYA 2QQLL 4M7LH 1IM3B 5D96B 4HEME 3DI2B 4TRPL 3CDCA 3BGFB 1QSFD 3QPQD 3CVHH 2J2ZA 3UDWA 3VW3H 1YEIH 3MYJA 3KLHD 2GY5A 3NFPA 4TVPE 1JZ5A 1VEMA 2Y7QB 5GZOC 4IOSD 1GGYA 1EO8L 1ZTXL 4GRWF 5DFVC 1AXSA 5BJTB 4RX4A 5JR1H 4X6DE 4X4ZA 5E1HB 5JHLH 4Y19B 4WJ5B 2MQ0A 3D69B 1LO4H 3T0WA 2AI0L 4BH8B 3LEYL 3IXTA 1ZV5A 4PJIE 3RQ3A 3BPOB 1G9MC 4PB0H 3OF6D 1QSFE 3EJYC 2HYMA 1U3JA 3MOBL 3DX9A 3M17B 4JM2A 4M8QB 3PQYB 4XBEH 1J12A 4XP4H 5TQ0H 4J3SA 3P40A 4ZPTA 4Y4FD 2XY2A 5HJ3B 1FL6B 4L4VB 4MNQE 4K9EH 1J1OH 3I6LE 1T5WB 2WMPA 2ZUWA 4X9IA 1HYSC 4OBSA 4WWKA 4EI5B 2O5XL 5CP7B 3TBYB 3HG1B 1OAUH 4P23D 1T89C 1MSPA 3ZKMD 1YMMA 2APBA 2NY6C 1YNTA 5SWQA 4OM1H 3VI4F 1UYWL 1FYTA 3GSNA 4LPWA 4LSQH 4Q0XH 1NLBL 4FABL 1SJEB 2VH5H 1A7RH 4HKZB 4OQTL 4LCWB 4WUUE 3U4BH 1YECH 2AXHA 4UDTB 5DD3L 4OGYL 4LRNL 3P9LB 3HHRB 4OZGB 1JK8A 4PJ9C 3D2UD 3WUZA 2PXYA 1TZIB 5BQ7A 3F12A 3LKPB 2OR9L 4QF1A 1EV2E 25C8H 2N56A 1ES0A 1NPUA 4E0RB 2IFGA 5IKCA 5FO8A 5D1QD 3KXFA 5FHAL 3QI9C 4EN3D 2AV1A 4UU9A 4ODXB 3V6OC 3F7YA 1RZ7L 4JFEA 4ONGH 2FR4A 3REVA 4TTGA 7CGTA 1E4KC 1MFBL 3VXUB 5E8EA 2APTA 3GSOB 4YDVB 3NABL 3RAJH 1ZGLP 2HWZL 5IOPB 4YK4C 3PL6B 2VOTA 4UDUB 4C59B 3WIHA 2PW1A 3LQMA 4HAGA 3AAZB 1MCSA 1T2QL 4AT6A 3BJ91 3PGFH 2HRPL 1LILA 4JQVC 5BZWA 4PP1D 4ZXBA 3IDJB 4V1DA 2FX8H 4ELKA 4OFPA 1E6OH 3MRLB 4AZ8A 5BZDB 4PJEE 1IAOB 1P5UA 4GXUM 5FCUH 3BDYH 3L9RB 1OOAA 1L7IL 4H88L 2H45A 2P24A 4JFOA 3O6FD 4G7VH 1OM3L 4POZD 4Y5XB 2QKIA 1B2WL 5L88H 2ADFL 4HS6B 1DQQB 5JMOC 1MCQA 1T04B 3QO1B 4P9HH 2CKBA 3C5ZC 4S2SB 4G6ML 1NEUA 3V6FA 1YPZA 5ADPH 1JE6A 2EYSA 4J4PC 3NZHH 3DROB 1WTLA 3QHZH 3RVWC 3VXNA 3S5LG 1TVHA 4QNPF 5E1AA 5HYSG 4JGUA 1IC5L 2BSTA 3INUH 3W5MA 1F02I 4OKDA 1R5IA 4B53A 2CUHA 3IB4A 1B0RA 3N1QC 3FCTA 1QKZL 5F72S 4HGWB 3FO1A 5F96L 3PHOA 1IGCH 2N7BA 5I1IL 3L3IA 2IH1A 1ADQH 2DS4A 4NJ9L 1INEL 1G9NH 1VGEL 1KJ3H 2DQIH 3LDBB 4K8RL 3BPNB 1WSST 4RMQA 1GRWA 3IS0X 3LIZL 4RZCB 3U0TA 2W38A 3H9HB 4H20H 4BZ2L 1RIVH 2BVPB 4QOKA 4ODUB 4WEBH 5IFJA 4Z76A 3W11D 3LQAL 3D3VD 3V79C 2QSVA 3QA3A 4ALAH 4TNVF 2E5EA 1UFUA 1ZXQA 3BE1H 4P4KD 5ID0A 2D7PA 1T21A 3JV5A 4HH9B 1INQB 2EE3A 1AY1L 5EUOA 2P8PB 1MFDL 1M7DA 5DVMA 4JN1H 1KELL 1EPFA 5TE7H 5C8JB 1T2JA 5JW3H 3EFDL 1HI6B 2VISA 5BS0E 4X7TB 3LN4A 4MCYA 3IJSA 3S4SB 5CIPH 2BC4A 2ZOLA 5EN2B 43C9B 4N0RA 3O6MH 5E9DD 3FB6A 3D3VE 1SY6A 4CVZB 1QFWM 3MLTA 2WUBL 4KZEL 2WLYA 3VH8A 4QHNA 1CR9H 5I1JH 2CLZB 4G80B 3WFEL 3P0VH 5J6GA 1QSZA 4X4XB 3N1FC 3VXMB 2CR6A 2F19L 3GB7B 5T1KB 4UT9L 4UT6H 3HAEG 2P1YA 1JPTH 1I75A 4LLUB 4X8JA 1MQKH 4Z7QE 3T1FB 4K8RD 1OTSC 3UTQA 5KAQF 1HYRC 3TJHC 3EDJA 3LN5B 3ARDB 3R06A 1G7PB 2Z8SA 3EUUA 2FYYA 3HLAA 1RUKL 4OI9A 4WTXA 1JGVH 4L3ED 3B3IB 4HV8B 3IDMB 1QACA 4ZMAT 4N8CL 2YBRA 3V5KA 1I8LC 3BO8A 4F58L 3QUYA 4U1MA 4X5XA 1LK3H 4PJAF 4YGVB 3QQ4B 4X6CE 4U2ZA 4GAJL 4QXTA 3HRPA 5EC2B 1ZANL 5CJ8A 2NYYD 4AH2A 2Y5TB 3BOVA 3DUHA 2DF3A 5IFHL 1LEGA 3B2VL 5LGJA 3G6JB 2ZUVA 4Y2OA 5I74C 3ULVF 2HFFB 2VZSA 3QAZC 5CMAB 4X5WA 4L3EE 1VESA 5I76B 3RZWA 3QDJD 3QIBB 4N68A 4YHIA 1AXTH 5C6PB 4PG2C 5H35B 3QR2A 3SGKA 3AFLA 1HOCA 2VQ1A 4Y16B 4OF5A 2MQ3A 2H3NB 3SDDC 4F7EA 3ZE1F 1Z3GL 3C2AL 4NQUA 1AIFB 3O3DB 3P4MB 5I30L 5JHDA 5D7IB 4OLEA 2IAMD 3QBTB 2AQ3A 2NTSP 3HMWL 2Z91B 2GYSA 4D0DB 4HLZG 3MGOA 4KMQA 4CVWA 4U1GB 4RA3A 1Q72L 4Q9RH 5TF0A 1WCBB 4MD4A 1FC1A 4OZFA 1RHHA 2P7TB 1J7VR 5JXEC 5IEHB 3EDFA 3CUPB 1IZJA 4Y5YA 3RTQC 1G84A 3DVNB 4PP2A 2QSTA 2LAGB 2J4WH 2KPNA 3RPIA 4HLZH 3EJZC 4TUJB 3KYMA 5C7XH 2VIRA 3RNQA 4KQ4L 3OKEB 2B20A 2A6IA 5D70H 4W81A 2C3HA 5GIRB 4QRRA 4FP8L 4H1LB 4KTEL 1I3RA 2FATH 1G1CA 3BKJL 1NGWA 2C7UB 1AGBB 1CLZH 3K7UA 1AR1C 4M93C 5F1NA 3KPMA 1TETH 3V5DA 1JWUB 1MH5A 3OKOA 4X99A 4XC3H 5F9WC 1QFWI 2DOCA 2IGFL 1F5WA 1KIUA 5F7FA 1QG3A 4UILL 3QIUC 4HD9A 4XWGH 5F88B 3U7YL 2DLFH 4Y2DB 1U8LB 4NQCE 1OPGL 2WBJA 3IKCB 3QEHA 4L8SB 1YEEL 2UZIL 3EJJX 1RJZB 1BJ1H 3ZKXC 5F6IC 4YWGH 1UJ3A 5FGCE 1XCTA 2MPAL 5EFIA 1B4JL 1NBVH 1LO2L 1G7IA 1S7QA 2I26N 4MJIA 3AB0B 4KMLB 4J3XA 4PJ8C 4P0DA 5IUSA 4NUJB 5TDOB 4JPIA 2KUTA 5EU5B 3HCVA 3W9EB 5GRJL 1UKSA 3UPCA 1XR9A 3MNVB 3HNSL 3WV0A 5D4QA 4WU7B 5B8CA 5F89B 3ZKND 1A6WH 1J0HA 4P5TB 1CIDA 4NQDE 4O51A 5KZCD 4HKBB 2OSLB 3MBEB 2XTJD 3PWNB 3ELAT 4I2XB 4PTTB 2E7CA 3BN3B 5F7DA 3CFCL 1FORH 4NHCH 3TNNB 4D3CL 3P9WB 1IGIL 3ME0A 1NFDA 1S7XB 5J1AA 5M95B 3BUTA 5C0CD 3KNBA 5JO5A 5K9OA 1JNNL 4S1SL 5I2IA 4PLJC 4J2XA 3RVXC 3MUZ1 1A3RL 5I8OH 5FKAA 4NYLA 3RZCA 3KJ4C 3RFZC 1AD0B 2GSGB 5E5UB 2X4PB 4ZFZB 3AXLB 3MJ7A 4N1EA 5FEBA 3WYRA 1YEKH 1SJHA 1BECA 1RK1B 1RK0B 5ISZD 1J0ZA 1IL1B 2WNGA 3V0WH 2EE2A 1YEHH 1QSFB 1BM3H 5CJOL 5ENWB 3EYSL 3SKJH 3SE4A 4YZFE 4LBEB 2D0GA 1BPVA 1RZKL 2CK0H 1JHKH 4MHHG 4X6DF 4OZIB 2FBJH 3QUMH 3C8DA 1RZ8B 2AK1H 2DTML 4KTDH 4NZUH 5DEFA 4ZFGH 5A16A 2EKSA 3GO1H 3PJSA 3MFGB 5AG9A 2DD8L 4EBQH 5ISZE 4PJIF 1BAFL 1FG2B 3ARYA 4MVBC 2F15A 3JTSB 4LARL 2X4UA 1LDPH 4FG6D 4H26B 1JWMB 2AJUH 3JWOC 2VDPL 3U9UA 1ZA6B 2IBGA 1YMHA 3QXDB 5D5ME 2B4CH 2BFVH 1EEZB 4M7KL 4ZG1A 3UYPA 1MREH 5GHWL 4Y4FB 4OLWL 2J8OA 2VXVL 1XGUB 2X40A 5C0DA 4JN2A 4E9LA 4QWWD 1S7UA 4R90L 3JV6A 3MUJA 1A7BA 4CRPA 2E7LA 3IAQA 4TNVK 4P23B 3VFNA 2VXSH 1R0AL 4I18B 1BZ9A 3WIIL 4NNYA 5I1HL 4WI2A 1OP5K 4KRPD 4R2GD 1VADB 4HIXL 2JK5B 4PJDB 4XVUC 3IF1A 4JG0L 4RAUB 3M45A 5HGBB 1QFOA 1R3IH 1NEZA 3HZYA 4U6VL 2EIBA 5AEAA 2RBLA 1YN6A 2O5YL 1IAIH 3QRGH 1HH9B 1S7TA 4I48A 5GS1A 4H8WL 4UAOC 1Q0YH 5JW4N 3D2UB 3VFOA 3Q6FB 2EIDA 5C0FB 4I5BB 4HT1L 2ERJB 1LEKB 1KPUA 2CIIB 4MXQD 3VD9A 4R96A 3WJJA 3L7EB 1UB6A 5D1QB 1RZJC 1OTUD 3NA9H 4LNVA 3CD4A 1UWGH 4B5EA 3DO3A 2FX7L 4EN3B 2BY2A 3JTTA 3TNMA 3JV0A 5IGXH 4NQTA 1SBBA 3U9PL 3BP6A 4HXAH 1CFNA 5C08A 1IQDA 2HT2D 2IFFH 1NCNA 3RGHA 4HUVB 4YDIH 2AJYL 2VDNH 1HKFA 4HWEL 3WKML 2EIZA 2ICWI 4BFEA 1JGEB 1DP0A 1V5JA 4WHTA 5FA4A 5SV3A 5KVGL 1EDQA 3W39B 2VLRE 5EO9A 3S96B 3D85D 5JIPA 2GSIA 1I1AC 3F58H 4YR6B 3OGCA 3VDBA 3U82B 1QLRA 3SDAA 1DSFL 4OD1H 1SBSH 1KF9B 2NXZC 3MR9B 4ZOEA 5IW1B 3QWOB 4D9QD 4KJWC 3TH3T 3ARRA 2X7LB 5IQ7L 3LB6C 1I7ZA 1XF2A 1KN2H 4TULH 2R23A 4WY7H 4ZTPL 5DUBB 2PXYC 3KS0J 5F9OH 3C60A 4M1DH 3S4SG 1CGYA 4PJEF 4MA3B 3ARBD 2X4QB 4LSUH 2NY0D 1A7PH 1IM3A 2F9BT 2V9TA 2D0FA 3NFSH 3KGRA 3FQXA 2EDWA 3OX8B 4UIKL 3O6FB 3ECBA 2P45B 3SJVA 3CU1A 3MLRH 4GMSH 5E8OA 4P9ML 4CDGC 2BK8A 4HDIB 1ONQA 2Y7QA 4KJQC 4D9QE 4RDQG 4ZQKA 2D7TH 3U36B 3I6GB 5BJTA 5LJYH 4R4ND 3UJTL 4WJ5A 3D69A 4WW2C 1RIHL 2D9CA 5JQHC 5LGHL 2YUZA 3I9GH 1PLGH 3DETC 4IM8A 3VGEA 3AM8C 4LLMB 4F7TA 5A40E 3MLWL 3QHTC 3RVTD 1CGXA 4DVRL 4LLVB 3K46A 3EO9H 5IB4A 3REWA 2F74A 1ED3A 3HZMB 4N9OB 3ZO0A 1FL6A 1WFOA 3IU3B 2WWKT 3WHE0 1LK2B 2N4IA 1UXWB 1D5MA 1T5WA 3EIFA 3MREB 1CLYL 5E2VH 1A6TB 1VA9A 4EI5A 3TBYA 4CU6A 5ETUA 3TPUB 5E99L 4P2QD 5C09D 5L2JB 2DAVA 3ZE2E 1B4RA 4Z7WB 3BQUC 1J1PH 1NQBA 3CZFA 1OSPH 1KCKA 3D3VB 3FQWB 3VXRA 1QVOB 5J13B 3IXAB 3NACL 4G6KL 1BFTA 1SJEA 2EDDA 2CLRA 3KYOA 5E2UH 1F2QA 4P4KB 4HKZA 5DJYB 4UQ2A 4LCWA 1AE6H 3P9LA 1CT8A 3G5ZB 2NY4C 2A83A 1JF6A 4CAGA 1U0QA 4JKPH 3OAZH 5DHYB 4GS7B 3LKPA 5C09E 5HHPB 5KVDL 5KSBE 2WBKA 3BXNB 4Z18A 1Y18A 5DRWA 5GGUA 2DQGL 3QFJA 5CZXD 4I3SL 1MCIA 5HD8C 2B1HH 3O8XA 4LHUA 5E94B 1NAKH 3SKOA 4ODXA 1YEDA 4XRCA 3IVKB 2Y06H 1FNGB 2PYFA 3BZDA 1KCUH 1X5HA 2DTSA 5GSVA 2Q8BH 4MLSA 2H6PB 5DRZB 3E8UH 5IOPA 2EDTA 5JOPD 4UDUA 4UNVA 4X6CB 4XWOD 3GJFK 5T33L 3AAZA 5DJXA 4N90D 4PY8I 4IMLB 1TCMA 3MLZH 2W0LA 2ZUXA 4RAVB 4Z7QF 1I4FB 1UWEL 4KXZI 4ORGA 3WSQH 4NZJA 1MCHA 3MRBB 1DLHA 5BZDA 4U6YB 2Q7YA 3DO7A 4L3EB 4H1LH 2LVEA 1ZT7B 3W0WD 4OM0H 3SGEI 4PRPD 1DBBH 2CH8A 2A77L 5JOPE 2YD4A 2R1YA 1JMXA 3CC5A 2YKLH 4N0UB 4JHWH 4Y5XA 4P3WA 4N90E 1KC5L 4X6CF 1HE7A 4HS6A 2AGJH 1MJJB 2Z8WC 1JFQH 3IRZA 4M6NH 2P48B 1T83C 1I3GL 3DIFB 3M07A 1BD2E 5HBBA 4LSPL 4XNQB 3QDJB 3DROA 3DOSA 1JPFB 5IR1A 3WO4C 2ZZUT 3K2MC 4G43A 2GJ6A 2NR6D 5FYLH 1H8NA 3FFCE 5L9DH 1PQZB 1SEQH 2JB5H 1OQOA 5MEPB 2L7JA 4PJGE 1T0NA 2Q1EA 3MV7D 5IEKA 1U93B 1XF1A 2XICA 4RIRB 4RFOH 1UM6H 2IAMB 3RDTD 1FIEA 3CMOL 4YDLC 5IMMB 5FM4A 4LDEB 1NGQL 5T5FH 1NGXB 2JJUA 5HDQH 4YQXH 3MC0A 2FHBA 4NBXB 5I73C 1VEPA 2BVPA 1RZFL 5D93C 1RIUH 4ZPVB 2JELL 1BQHB 3A67H 3FKUS 5CGYC 3O2WH 4NQCB 3BKMH 5F1KC 4YXKL 2RHEA 3DYOA 3AROA 1QNZH 3MV7E 2NY3D 2R1XB 4HH9A 2OL3H 2JJTA 2E9IA 1INQA 2LV4A 2IBBA 5FGCB 4HJ0D 3S6CA 3MMEB 4B41A 3SGKC 2P8PA 4RGOL 4LEOB 4RWHA 4JZJB 1JV5B 4NKOB 4NM8H 5EC1B 4GG8B 1RZGA 1XZ0A 3C6LA 3JVGA 5IROA 1YUHB 4XMPL 4U1HB 4AJ0A 2AKRB 1JHTB 2UWEA 4QRUA 1WV7T 5EN2A 3BPLC 43C9A 1O5DT 5BO1H 2CXKA 1U8OB 3B9KD 1CBVH 4S1RL 4NZRL 2FNBA 4NQDB 4Y8AA 1FVEA 1IAIM 2RCSL 2VTFA 2X05A 4G80A 1H9VA 3OSKA 1T5XB 5FOBA 1YEGH 2QV2A 4Q9QH 4PJAA 4X4XA 4Y5YC 1OP9A 3VXMA 4HKXA 3MFFB 2X9XA 2R69H 1BLNB 3GB7A 5T1KA 5CJBA 1AD9B 4LLUA 4WGVB 3WNPA 1MF2L 4OLVL 3DYMA 3MLSL 1U36A 4XPTH 2B1AH 3LN5A 3VD3A 2A9NL 3ARDA 1G7PA 1P5VA 4TN9A 2F8XC 5FOJA 1IEBB 5KZCB 5GS2D 2XTJB 3MNZA 3B3IA 4F15B 4MGXA 4AG4L 4LVOC 1MCOH 2VL5B 4NO2B 2QQLH 3O3AA 2G75A 4IRJC 4NCDA 4DKEL 3L3GA 5K93A 4TRPH 1ZGLA 4P9HC 5C6WH 1E4JA 2Y5TA 1CXLA 3TIDB 1HDMB 3ARGC 3MZGB 2R0LH 4WI7A 4C56D 4WI3A 2DMBA 4N8VB 1EO8H 1ZTXH 4P2OD 4X7CC 5ISZB 4XI5D 5I76A 1A2YA 1T1WB 1CCZA 5BV7L 1NKRA 2XZAL 1S7VB 3U83A 5H35A 4ZUUB 3HE6D 3D25A 2AI0H 1P6FA 5F7MC 3W9DB 3LEYH 4BK4A 1CDYA 4YZFF 3MUY1 3OKKB 1A47A 3FFDB 2DRUA 2HG5B 3PWLB 2H3NA 4PJBE 4R3SB 2J8UE 3DV6B 5B39A 4MHHI 3MOBH 5D7SL 3M1BA 1ZVSA 3GRWA 4I0PD 1AIFA 4CN6A 1G9NC 3P4MA 4A6YL 2B2XL 4C56E 3MUGB 1XF3A 3VGGA 5FGBC 1LEIB 1ITBB 3QO0A 1KPRB 1I9JL 2DQFB 4OLYL 1RULL 5AZ2L 5CBEA 4D0BB 1GIGL 5H8DA 5IW3A 1LE9B 4D0DA 5L2KD 1JCKA 1WCBA 2VAJA 5TE6H 4M1GL 2I9TA 3RZCC 1OD7A 1BQLL 5D5MF 2DWDA 3TO4A 5IEHA 2WIIB 4I77H 1U42A 2O5XH 3WN5B 2KZ1B 1SEBB 3DVNA 3OR7B 3WNMA 4QTIL 3KPNB 1T2XA 3EYUL 4KI5D 5DA0B 1C1EH 4RGNC 1A6PA 2P5WE 2HKHL 5AZEL 5C0JB 2CLVA 4JRYA 1ACYL 4W70A 3K0WA 5D1XA 1NLBH 1AGBA 1CF8L 4MS8D 4PTUB 3DTXB 4OQTH 3OKMB 1JWUA 3ULUL 4LRNH 4O9HL 2DL9A 1UVQB 1TZHA 3VFTB 3QEUB 2ZNXA 1IAII 1CFSA 3QNZB 4KRPB 5F88A 4R2GB 2OR9H 3GMQA 1U8LA 2APXA 1FL5B 4JGJA 1TFHA 4KI5E 5C71A 2ADIB 5LQBL 3SY0B 2EYRB 4L8SA 1OF2A 5EPMB 5FHAH 2DBJA 4OQ1A 1T03L 5D1ZD 1RUML 3T0AA 4J3UA 5CJXA 1MFBH 1WIPA 3QXWA 3CX5K 4NUJA 1N8ZB 3VFSA 5JQ6H 1AHWC 1KPVB 3HS0B 3NABH 3TWCH 5GRVL 2HWZH 5D72L 1VACA 3TP4A 5ADOL 5GGRY 3MNWA 5BXFB 3HRZB 2E7LC 1T2QH 3I2CL 1VHPA 3KYAA 1C7TA 5E00B 4OCRL 2ZJSH 1Q94B 1PY9A 5FAAA 1U91B 1ORSB 1HHJA 1KCRL 3D85B 3TBSA 3UTPD 1VFAA 4Q2ZA 2A0LD 4MA7L 5HHQA 1MUJA 2KL6A 4QKXB 1L7IH 3WS6C 3MJ6A 4H88H 2R2EA 4X6DA 5DK2B 1OM3H 4C4KT 2X4PA 3ULUD 3AXLA 2CIKB 1B2WH 2ADFH 1KG0A 4LP4A 1MCPL 1IGTB 1GHFL 4F8QA 5LKNA 4PJIA 2NY0B 1RK0A 3P2TA 3WJJC 1J05A 4YDJB 1EAJA 1QSFA 5FA3B 3V9FA 2ZG1A 2W65B 4G6MH 5ENWA 3VMOA 3OB8A 1INDL 1C08B 1XIWC 2R0WL 4HIHA 2Y23A 1KFAL 4HIEA 5CLTA 2M26A 1N5YH 1FZOB 2YD3A 3RWGA 1DZBA 3SOBL 4MNQA 1RZ8A 4BSVB 3O4LE 5ERWA 5JW4R 3O11A 1EGJL 2XFXB 4KQ3L 5J3HC 3QJFB 5F96H 3O45B 1WQVT 3DNKA 1JWMA 1J8KA 2HJFB 4LRIC 1ZA6A 3EDEA 5E08L 3MRJA 5I1IH 5BW7C 1EEZA 4HBCH 5IT2L 1VSCA 4NJ9H 1INEH 4YUEL 2OS7A 1VGEH 3STLB 4K8RH 3RWIB 4Y4FA 3C60C 3QULB 5DMGC 2FEEI 3MODL 4LIQL 3LIZH 4KKNA 4WO4D 4WUUA 4RMVA 5D96C 4BZ2H 3BGFC 1BZQK 3LQAH 2GEEA 2NW3B 5IWLA 4Z0BL 5DK0B 5E6ID 3RY5A 1CDCA 4XC1L 5C09B 4P23A 5KSBB 1EHLL 5F7NC 2NW2B 1ACZA 3ZE2F 1AY1H 5A43C 3RX8A 3HN3A 1MFDH 4DFIA 3VWJD 1ETZA 1JNHB 3OV6A 1U8IB 1KELH 2UY6A 3HNVL 4PV8B 2C5DC 5DJAA 5MI0B 5GJTL 2IPKB 2R2CA 2JE8A 2JK5A 3QISA 4O02L 3G9VA 1T66D 5CJQL 3T0BA 1W72A 5H94B 1BMGA 1QUNA 5IVNA 3BPOC 4RAUA 4W6XB 3TESA 3U0PB 1HH9A 1B90A 2FH8A 3D2UA 3RA7L 4I5BA 2D31B 4OFDA 2WUBH 1LEKA 4M3JA 2CIIA 4CU8A 4KZEH 2AW2A 3C8HA 3L7EA 5D1QA 2V5YA 3U79A 3WFEH 1FCCA 3GSUB 4XB8A 4YX2L 5ILTH 1K6QL 2EDJA 1QLFB 3GMLA 5C9JA 4XP9L 4M4RA 4YHOL 5FV2A 3TN0D 2F19H 4UT9H 4HUVA 4WTWA 4EI5C 3FZUC 4PJEA 2HT3D 3MXWL 1BQHG 4Q9CA 4Z7UE 4XPGL 1RUKH 5DQJB 5IHBA 1XF5B 5EIIB 1EXUB 4GBXD 4DCQB 4YR6A 4KI1A 1MHEB 4N8CH 3MR9A 3QWOA 4F58H 4JO1L 1EJOL 2X7LA 1CIUA 1WBXA 4LCIL 3SCMA 4GAJH 1ZANH 2X4TB 5DUBA 3EOBB 1XR8B 3G6DL 5F97E 3UP1A 3V6OE 5IFHH 3W0WB 3B2VH 2EH7L 3OX8A 4PRPB 5FECA 3E2HB 3P3YA 2GQHA 3FFCB 3I6KA 2DM2A 3DLQR 4HDIA 1RAMA 4JFZH 3DUSB 4YEEA 2QTEA 1HCVA 4XH2B 3U36A 1I1FA 4IJ3B 1A6UL 2OZ4A 3MLYL 4JDZB 4JM4L 1EHAA 2DLHA 4EVNB 3PL6C 2AK4D 3TH4T 4HFUL 5IIEB 4JGMA 5HPMB 1Z3GH 3C2AH 3SPVB 4LLMA 4P4RA 4S0SD 5I30H 1AKJD 2BNRA 3BPCA 1CGWA 2FZ3B 2HTKD 3HMWH 1Q0XL 4KRNA 4OCWL 3VFRA 1FO0A 1Q72H 4LLVA 2DM7A 2KQNA 5I8EA 3MV7B 1M71B 1QFHA 1A6AA 1R5VB 4PJGF 4AEHL 5C0IA 4C83A 2XWTB 3OKLA 1IBGL 1PFCA 1FZKB 1AGEB 2XTLA 3RDTB 1UXWA 1JRHL 4PV9A 3MREA 3MV9E 4Y5XC 2IQ9L 4LSSL 4KQ4H 3TPUA 3O3UN 4KK6D 5BS0A 1CGVA 5L2JA 1G7QB 4FP8H 2MOVA 4KTEH 3QUXA 1MRDH 3BKJH 4ZS7H 4ERSH 5FYJU 1PX4A 2OMBA 5GQBA 4ZTOL 3CCHA 3T4YA 5CJ5A 1ND0B 1T1ZA 4YFLF 4XP1L 2AXGA 2NY3B 5I8KL 2IGFH 2VABB 2NQCA 4UILH 1HXMB 3U7YH 3V6ZB 3CXHK 3FB5B 5C0BD 1MCKA 1OPGH 4AIOA 4DUWA 1YEEH 1RD6A 5HHPA 4OD2B 3BXNA 1LO3L 5IG7B 3ZT5A 1V7ML 2MPAH 4BUHA 5MHSE 1OQXA 3T04D 1B4JH 1CXIA 3HZKA 3E6HB 1LO2H 5E94A 4IEFB 3B9KB 1UM4H 5DO2C 2XQBH 4EZMA 4PGCA 4MA8L 3LDBC 3NCJL 1U3ZA 3MRRA 1QZ1A 3BPNC 3VG0L 3PWPE 3HNSH 4LEXL 3S98A 1NC4D 2H6PA 4QT5A 5C0BE 5IFAL 4BJLA 5DRZA 3VXTB 4LLYB 4X6CA 4YHLL 1P4IL 1P1ZA 4F37F 2OXGA 4KDWA 3AREB 4NQVB 1Y6MR 4RAVA 3CFCH 4MNHA 1NEZG 4D3CH 5GJSL 4Y8DC 1IGIH 3MBXL 4S1SH 2MCG1 3MRBA 4FQXD 2VITB 4OF6A 5JW5A 1MCEA 4U6YA 4L3EA 1A3RH 1EEQA 3JVGC 5IROC 1TJHL 3BRFA 1LD9B 3B2UD 1EUUA 4MD5B 2CO7B 4PUBL 1H0DA 1U2CA 2EDHA 5B3JE 5CEZE 1Q9WB 3AS2A 1LQSR 1R3KB 4HFWB 3GK8L 5I1DA 3TCXA 4PJBB 2J8UB 1NGZB 4G6AD 5CJOH 3WDHA 5FK9B 3BW9B 3QSKB 1CDJA 3EYSH 3RIFK 1HINH 3K4DA 3DIFA 5HXMA 4C56B 1KB5B 3B9VA 4P2OB 3L3DB 1RZKH 5D71L 4KDTC 2MMXA 4LAQL 2E7MA 1S9VB 2ZPKH 3HE6B 2DTMH 3T0ED 5GISL 3VFPA 1HQ4B 2WM0A 3QNYB 3HB3D 2DD8H 3ARDC 5C07E 4BSWA 1BAFH 1IEAA 3GSQB 4H0HB 4YHYB 3H9YA 4LARH 2YRPA 1C8PA 2VDPH 4MQXC 4PJBF 5DJDB 5HHMD 3WFBH 1U93A 4I0PB 5D7JD 4ODSL 4RIRA 4M7KH 2UY7A 4G8EB 1JTTA 1S5HA 2IAMA 3ZDXF 5IBLC 4OLWH 2VXVH 1KXQE 1VFUA 5L2KB 5IMMA 3D1MC 3IJYA 1F4AA 1OW0C 4XTRC 2ZCLL 4R90H 4ZAKD 3T0EE 3LD8B 3VXOB 4ZPVA 4NKMA 5DHXB 1S7WB 4HHAB 5E5MB 1QPXA 2HFEA 1R0AH 2W60B 5HHNA 4NQCA 1CGTA 5C0AD 2JF1A 2W0PA 4ZNEE 1A3LL 4UV7L 5CD5C 1FIGL 4NOBA 2E7BA 5LCVL 3QIBC 3UBXA 1ERNA 2V7HA 3X11A 3NN8B 1FPTL 3GJFB 3BP7B 3MMEA 3HUJE 4MXVE 4HIXH 1YY9C 3NCMA 4WIQA 4LEOA 4JZJA 2IPUK 2VSCA 4Y16C 4JG0H 2WINA 1OT1A 4U6VH 2O5YH 4H8WH 1CVSC 4JZOB 3VWKD 5BV7B 1QSVA 3MV01 1G0YR 4HT1H 1TDQA 2J6EA 4ZO9A 4JAMB 5CUSL 1MLBA 1U8OA 4L8BB 3RIAK 3T8XB 2OP4L 5EOCJ 3ZHDA 4NQDA 1JZ4A 2FX7H 4JANA 4U1GC 4XCCL 3FQRB 3SE3C 5D1ZB 3U9PH 3S9DB 4HG4K 4PY7A 1T5XA 1UB5B 4QEGA 1ZEAL 2AJYH 3MFFA 3PXHA 3QQNA 4HWEH 3WKMH 1N0XL 4A6YB 3HE7A 1BLNA 1DFBL 1MWAA 1AD9A 2XZCL 5KVGH 2VR4A 3DRTB 3BWUC 1KIPA 2ED9A 3T3ME 2W59A 1KUMA 1OAQL 2Y07L 1XGTA 4NN5B 4RMSA 5CP3A 3ZL4L 4UUJB 3T2QA 1DSFH 2G9HB 1OAKL 2XWJA 1KCSL 5IQ7H 5GRUH 3FN0L 4LPXA 4OCYL 4FQ1H 1U2HA 3BP4A 1LO5B 1PEWA 2VL5A 4ZTPH 4LHUG 4MYWB 3RWFB 5CBAA 4NO2A 4MAUL 4H0GA 3G5XA 4Y2DC 3MV8D 4X83A 4L9LB 1VFMA 4O4YL 1FZMA 3MCLL 4ZUSB 3V2AR 4UIKH 4L8SC 3TIDA 4L5FL 5F1IA 3OJDB 1MHPL 1QO3B 4P9MH 2XQYK 4NKQB 4WDIB 4XPAL 5GRXG 4OCXL 5ISZA 3AB0C 4L4TA 4X9FA 1MAML 3UJTH 4XXCA 2X70B 5D5MA 2E9JA 5HDOA 5SX5K 3W9DA 1RIHH 4XNZB 5LGHH 3VXQA 3MV8E 5IB1B 1MFAL 3VA2C 4P5TC 4M7LT 3MLWH 1K8DA 3MBEC 3VMPA 1CL7L 5B38B 4DVRH 4RSVA 4UV4L 3PGCB 1LEIA 5EO1A 1BJ8A 3OGOE 1KPRA 4D0BA 3GMOA 2ZG3A 3GJEA 2VC2L 2ITCA 3SKNB 3DMMD 1A4KA 1TIUA 4L29B 1CLYH 2G5RA 2WIIA 4KPHL 1P84K 1SEBA 4LPVA 3WEXA 1U41A 1IE5A 3MLXL 3KPNA 3LV3B 1A64A 4FQ2L 4WO4B 3U0WL 1YNLH 5DJ6B 2V2TB 3QPQC 2X4OA 5E2WL 5JTWA 5C0JA 3BGAA 3EFFA 3NACH 3UC0L 3RHWF 3KLHC 5E6IB 4G6KH 4EIZC 3DTXA 2X1OA 3A0OA 3OKMA 1QA9B 4M7JL 5FM8A 2R2HB 4MMZC 2FL5B 3VFTA 3ARTA 1LMKA 4FS0A 4CVUA 3VWJB 5F7HA 1JPSH 2JTDA 3DBXA 3JSSA 3UPRB 3EGSA 1NGPL 5KVDH 4KJPD 1A0QL 1N6UA 2VYRE 2EYRA 2DQGH 1FV1B 4KMTL 4I3SH 4NGHL 5GGRB 5KN5A 4Z7UB 2VLRA 3IRPX 1IFHL 3QH3B 4NIKB 3QCUL 5AAWA 1OP5H 3EZJB 3C6SB 2WQRA 4Y4FC 1D9KD 2YD8A 2BVTA 1KPVA 3HS0A 1G7MB 5DFWH 3ULSA 4N0FB 3RY6C 1GVIA 3TN0B 5C2BL 5IWLC 2CQVA 3ROOA 1J0IA 3UTOA 5DJ8B 3VD5A 4P23C 4PRIA 1U91A 2WWMD 3ZKMC 5T3ZH 1ORSA 1UWEH 2CO6B 4I18C 1T7VA 1QSEE 3D85A 4KH2A 3SE8H 1W8OA 4XHJD 1P7KB 4F2MB 4JY4B 1NAML 4GBXB 3VE0A 4X9BA 4X6BA 1YJDL 2OQJA 3HFML 4LHJB 4OCLC 4JFFD 2A77H 5DK2A 4MDIA 2CIKA 5E2TL 1KC5H 4XPBL 5B4MD 4CVXB 5EU4A 2ERJC 1IGTA 1QR1B 4WHDA 1X5ZA 3N85L 1A6VL 2BVYA 4JREB 1FVCA 2B0SL 5D1QC 4TUOA 1I3GH 4EN3C 5KBNC 4LSPH 5EBMB 2H26B 1DL7L 1C08A 5JIHA 4XX1G 1EA9C 1P7QD 4YC2B 1GCFA 5DSCB 1CFTA 4YHKH 1XAUA 2VUYA 2ICWJ 1KTRL 4Y4KD 4PREB 2WAHA 3A6BL 1QBBA 2AK4B 3CFBB 1X5IA 1KACB 3FHQA 2XFXA 3MRPA 2FIRT 3T77B 3B5HA 3O45A 1BX2B 3ARFB 2HJFA 4ZDHB 1AKJB 4PP1C 4P46D 5HYJD 2DI7A 5DJZA 3CMOH 5IV2B 5D8JL 3ZKQD 2BVOB 4ODVL 1NGQH 4OZHB 4XNUL 3JV4B 3QULA 4POYA 3N1MC 1AXIB 4HMCA 1NMAH 3BMWA 1RZFH 3O6FC 5EWIL 1I7RB 2JELH 4RQQA 3OPZL 4KKCC 2NW3A 4POZC 1DLFL 4UTBL 4XNXL 1MVUB 1ZSDB 4YXKH 3G04B 2XKNB 4NHUA 1I1CA 3KDMB 4PRDB 2Q87A 5C09A 1NH6A 2FBOJ 1G7LA 1IQWL 5B39G 3HZVB 5KVFL 4U1LB 4PJ5D 3ZT7A 4FHBD 4RGOH 4NWUH 3DHMA 2CMRL 1U8IA 3GHBL 3GMNB 5IB2B 1M7IB 1K2DA 4IMKA 2IPKA 1U8QB 3PDDA 4XMPH 5DD6B 4AEEA 5IMLA 3CVHL 1BGXL 1D6EB 3U0PA 1CZ8L 1CICA 5C0BB 3I02B 4PJHB 3VGFA 3SQBA 2OYPA 4K55A 2RCSH 5JR1L 2FRGP 2FLBT 1GOHA 2C1PB 4WGWB 3F7VB 2HN7A 5FYKL 4PJ5E 1LO4L 2R9HD 1QLFA 1D5BB 4G8IB 3ALWA 4QCIB 1R6VA 4OIAA 1WCQA 4XCNB 5HVHB 3IDGA 2WQ8A 3NZ8B 2E7HA 3FAWA 4CNIB 2J12B 1MF2H 4OLVH 3MLSH 1HSAA 2HLFD 3NAAL 2A9NH 3RL1B 2X10A 5DQJA 2D7NA 2X89D 2AJVL 3W11C 5DJ0A 1XF5A 2QQQA 3MRCB 5J13C 1IGYB 5C92A 5IMKB 3TM6A 4AG4H 1HHIB 4K9EL 4P4KC 1T7YA 3ROLB 4U1IA 4XVTL 1YYML 3K8LA 4HC1L 1BD2A 2GY7B 4FQXB 3MA7A 2X4TA 5MEND 4GS7C 2D4DA 3GJFH 1BJMA 2I24N 4HZLA 4Q0XL 5HY9B 2GT9A 5J56B 1F4YL 2VH5L 4IRSD 5B3JF 1A7RL 3FFCA 3OG4B 3U4BL 3DUUA 4FXGB 4JKWA 3L6FA 3UXFA 3ET9F 1GGCH 4PJGA 4U1KA 4ODBD 4FA8A 4XH2A 1CVRA 3CFJB 2I9LA 25C8L 5FYKD 4EVNA 5DD0L 5HI4D 4LVEA 5FGRA 5EU3B 5IB3B 3IAGC 2BOCB 2ICEB 3AY4A 4X9HA 5HPMA 5D7SH 3SPVA 4QRTB 4MAYA 4PY8J 4OTXL 3T0EB 4A6YH 2B2XH 4K8RC 4ONGL 3GI9H 4LP5A 1FCGA 1I9JH 4OLYH 1RULH 5AZ2H 1GIGH 5JPNA 2HP4A 5CSGA 1F13A 3LKOB 2R15A 4OT1H 3RAJL 1EEYB 3MV7A 4HK0A 1M71A 3CH1B 4M1GH 4TSAL 4PRHD 1R5VA 5HHMB 3LQAC 5D7JB 1H3VA 1BQLH 1FZKA 1AGEA 1V05A 5EUKA 4AEIL 1HWGB 5J1TC 4ZFFB 1XGQA 4FFZL 5FYKE 3HUJB 3EYUH 3B6SB 4LU5L 4XBPA 4IOIB 1RUPH 4Z77A 1IGFL 2NYYC 2HKHH 1G7QA 1RJCA 5AZEH 4ZAKB 4DFHA 5K9JL 1ACYH 3EOTL 2ADGA 5C6TL 3N50A 3L3HB 2CDGA 4FOMA 1ND0A 5C0AB 3P30L 3LSOA 3ULUH 2NNAB 2J5LB 1ZHNB 3B5GA 4O9HH 2XT1B 4PRHE 4F57L 5F1SA 1HKLL 4KK8D 1TZGL 1HXMA 5FDWA 4GG6E 4BM7A 3HI5L 3OR6B 4JG1H 1ORQB 3H7BB 4MXVF 3HUJF 5LQBH 3EYQD 5L0QB 1X5XA 2O5ZL 2EICA 1T03H 1QBML 1Y0LA 3ABZA 1URLA 4TPRL 3VWKB 1RUMH 4MQ7A 5HYFA 4R97B 5F7KC 1F4XL 3KPPA 5F7LB 5I1EL 3MUHL 2P5ED 2BRQA 3OL2A 3E6HA 1QTYT 4ZD3H 2NCMA 3RKDD 2IAMC 2XZQH 2DDQH 3FO0L 5HHOD 2V5SA 1CXKA 3V7AE 3CJJA 4XCFL 2R4RL 5T1MA 4GRLD 4DVBA 4NDMB 3INUL 4ONFL 3B83A 5ADOH 3HI1B 4M3KB 5CZKA 3VI3E 2CXGA 5BMFL 1JYXA 4BH7B 4LLYA 1N6VA 5BVJB 2RFXB 4OCRH 2LU3A 2VWEE 3EYVA 1Z5LB 3AREA 2A1WL 3KPOB 2D03H 5EDXA 1KCRH 3P9MB 4Y89A 3X17A 4MA7H 2UVEA 3EBAA 3F5WA 1AGCB 3T3MF 2ENSA 3H7LA 3BZ4B 5HHOE 2VITA 4JZJC 2FJGA 3MRMA 4H20L 3R8BB 4LVHB 5C0EA 1MCPH 1BJ1J 4HQQL 1GHFH 3MV8B 1NCUA 1CXEA 2DKMA 4HFWA 3O9WD 4PJBA 3H6JA 4KK5D 4HW6A 2VAAB 2EDFA 5FK9A 3BW9A 1A3QA 1LDSA 1TPXB 3Q1SL 1L0XA 5ICXA 2BNQA 4F9PC 3I75A 1INDH 4K7PY 1DEEB 2R0WH 5JW3L 3DWTA 1KFAH 1H15A 1KB5A 4OGXH 4PR5B 3NCYP 3L3DA 2PTVA 4KJYB 4P2OA 3NCFB 4APQD 3NFNB 3WIFA 4O2EB 3FQTA 4MZ3A 3AS0A 3SOBH 3DURB 5DVOA 3WDJA 3L5WB 2C4FU 1DR9A 3AU1B 1JF1B 3BFOA 5ESQB 2P43B 3J7HA 3QEQD 4KQ3H 3ZKNC 3GSQA 1AI1L 1NDMB 3WFCH 4RFEA 4NQEE 2XTJC 1A4JA 2P5WA 1IC1A 3NPZB 4JRXE 5E08H 5D2LE 4F15C 1I7TB 3OJVC 2IWGA 5K9KA 2H32B 5IT2H 3FO9B 4G8EA 4YUEH 2F54D 1CI5A 3MOAL 1F3DH 3MODH 4LOUD 4LIQH 4PBWD 1WT5A 1ZVYA 4XZUB 5H37G 3DMMB 4KC3B 3FQNB 4Z0BH 3E0GA 3VXOA 1JGDB 4XC1H 1S7WA 4HHAA 3TV3L 5E5MA 4K7PL 5FCSH 2BVQB 5HI3D 4JHAL 3KWWA 5DRNA 1BFVL 3SDYL 3LMJH 2GJZB 2IH3B 1GH7A 5D7KD 4QHLA 4R26L 1HILA 2Z93A 1MIEL 2HJKB 2NY5L 5KG9B 4MXWL 4JQXA 3HNVH 5GJTH 5HGAB 2KDGA 5CJQH 3DVGB 3DJ9A 5TF1L 4JZOA 3RA7H 4N8PA 3D39D 1D6VL 1KCLA 1UCTA 4PLKD 4L8BA 3IYLW 1AXTL 4ESKA 5JXAL 4HX1A 3ARQA 4YX2H 4FG6C 1K6QH 1K3IA 4YHOH 3IGAA 1UWXK 4D8PA 4MX7B 3BWAB 1ZLVK 3WN5C 2VN7A 1SYSB 5DMKB 1H8OA 3SDCB 4A6YA 1D9KB 1Q1JL 3MXWH 5ESVB 4CJ0A 3EYFB 3DRTA 3B9EA 4IDLA 3ZTNL 2NMSA 5J8OA 3D39E 4QWWC 2W92A 2VLJD 4K3JL 4AENB 1CK0L 3WFZA 3HMXL 4PJCE 5TQ2L 3ZDZE 1ROWA 3VCLB 1T0MA 3QNXB 3T3PE 2J1KA 3WS3A 4JO1H 1EJOH 5IM7B 5BRZE 4LCIH 3TBWB 2C3GA 4OB5L 2VJXA 2GK0B 1HEZB 3G6DH 4KRPC 1LE5A 4R2GC 3KLDA 5E4IA 4L9LA 4JFFB 2EH7H 1AGFB 2FATL 4JB9L 1I85C 3BUYB 3V0AC 2VLJE 1RZKC 3OJDA 1TETL 5E5RB 2AEQL 3UX9B 3O4LA 3UZEA 2CDFB 3ZDYE 1D5ZA 2C4FT 2V7NA 4MXQC 5LXGH 1J10A 5DZLA 2DL2A 3RWEA 1PYWA 1RURL 1U3HD 3S3PA 1K5NA 1FGNL 1OTUC 4F3FB 1A6UH 2W1NA 2YC1B 3RNKB 1T1YB 4X7FC