4G7ZA

Crystal structure of thermus thermophilus transcription initiation complex containing 5-bru at template-strand position +1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 44
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7zA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7zA01
1I50K 4KN4A 2PMZL 4KN7A 2O5JA 5M3MK 3PO3K 3S16C 2JA8C 2VUMC 2A6EA 3K7AK 5IYBC 4A3BK 4OIOA 3S2DC 4BBRK 2R93C 1TWCC 1R9TC 2A68A 3GTQK 5C4XC 2NVQK 3S2HK 2WAQD 4A3MC 2NVYK 4A3EK 1IW7A 4G7OA 3S1RK 5M5WK 1I6HK 3DXJA 4A93K 3HOUK 5IP9C 2JA5K 3HOZK 3WODA 1YNJA 3GTKK 2A69A 3S17K 2NVTC 3S16K 3I4MK 1TWAC 1I3QK 3HOWK 2Y0SL 3H3VL 2NVXC 2R92K 5TMFA 3S15K 1XPPA 3GTOC 4BBSC 3K7AC 3CQZK 3S1MC 5FJ8K 2JA8K 2VUMK 4C3JK 5FLMC 2E2HK 1SFOC 1Y1WK 1HQMA 4MEYA 3RZDK 3PO2C 5C3EC 2JA6K 1TWCK 1I50C 2E2IC 3S1RC 1SMYA 4Q5SA 3GTPK 4G7HA 2JA7K 4A3GK 4A3CK 4ZH4A 3HOYC 4MQ9A 3GTKC 3HOXK 3HOVK 3I4NK 2R93K 2R7ZC 4Y7NK 3HOUC 2PA8L 2PMZD 3M4OC 2WAQL 3HKZD 4AYBD 4A3BC 1I3QC 4JK1A 3HOWC 1TWAK 4A3MK 3S1NK 1TWHC 2WB1D 4YFXA 5C4XK 5C4JK 4Y52C 4A93C 4KMUA 4LK0A 3S1MK 1BDFA 4QJVB 5IYCK 4A3EC 2NVTK 1Y1WC 4A3GC 2JA7C 4C3IC 3S15C 1I6VA 4BXXC 3CQZC 3GTOK 4BBSK 1YNNA 4OIPA 2PPBA 2A6HA 4C3HC 4YFKA 5IP7C 5C44K 3RZDC 5M5XK 2R92C 2NVXK 2YU9C 2JA6C 1TWGK 5C3EK 1Y1VK 4Y7NC 2B63K 2R7ZK 2CW0A 1TWHK 2Y0SD 3H0GC 1SFOK 3M4OK 3M3YK 4A3CC 4QIWL 3HOYK 4X6AC 3S1NC 4C2MC 3RZOK 4G7ZA 1K83C 3GTPC 5M3FK 5C4JC 3S14C 3GTMC 2E2JK 4BY1C 4XLPA 3GTJC 3HOXC 3I4NC 4A3FC 5IYBK 4A3DK 2BE5A 5IP7K 3H3VD 4XSZA 3S1QC 4Y52K 1TWFC 1TWGC 4QIWD 4YG2A 1WCMC 3RZOC 4A3IK 3GTLK 5IYCC 4QJVA 3GTQC 5C44C 4C3HK 4A3KK 3GTGC 3M3YC 4AYBL 4OINA 3HKZL 5IYDK 2YU9K 4BBRC 3S2DK 2NVYC 3FKIK 4C3IK 2E2JC 1K83K 3H0GK 3PO3C 4A3JK 4A3LK 1ZYRA 3S2HC 4YFNA 3GTJK 4C2MK 4BY7C 1I6HC 4BXXK 5TMCA 3GTMK 4A3FK 1Y1VC 2B63C 4OIQA 5M5YK 2JA5C 5IP9K 4LJZA 4LLGA 2PA8D 4XLNA 2O5IA 3S1QK 1TWFK 4A3IC 4X6AK 5FLMK 2WB1L 1R9TK 4A3KC 5IYDC 3GTGK 5D4DA 4MEXA 2NVQC 3PO2K 4BY1K 3GTLC 1WCMK 3HOZC 3EQLA 3S17C 3FKIC 4C3JC 2E2HC 2E2IK 4LK1A 4A3JC 4GZYA 4A3LC 4NOIA 3I4MC 4XSXA 3S14K 4A3DC 4OIRA 4Q4ZA 3HOVC 4BY7K
chains in the Genus database with same CATH superfamily
1I50K 4FZBA 1IE0A 2O5JA 2A6EA 5IYBC 1XZPB 2V6TA 1BJTA 4G0UA 4A3BK 3S2DC 4BBRK 1TWCC 4KASA 3GTQK 5C4XC 1R9TA 2WAQD 4A3MC 2NVYK 3S1RK 1VH2A 4ILDA 3DXJA 1YNJA 1EI6A 2E2HA 2NVXC 5TMFA 3T01A 2JA8K 1PJ5A 4C3JK 3GTQA 3PO2C 3S1RC 1BS2A 1XXBA 1EH1A 3OREA 1IS1A 3HOYC 3V4GA 1JVIA 3GTMA 3HOUC 1AB4A 2PMZD 1XZQA 5IOQA 4JK1A 3S1NK 3BUEA 1TWHC 4Y52C 1WORA 3VA7A 1J6XA 1BDFA 1EK8A 4BXXC 3GTOK 3FOFA 2A6HA 4C3HC 4KARA 2YU9C 2JA6C 2ZFZA 2D6FC 1J98A 1SFOK 2NVXA 3HOYK 5JVHS 4X6AC 2Y3PA 4C2MC 4J3NA 1JQWA 1F7VA 4BY1C 4KB4A 3PIPS 5IYBK 2JA7A 1TWGC 4YG2A 2ZUEA 5IYCC 5C44C 5IYDK 3M3YC 4OINA 2YU9K 4C3IK 1VJEA 1TWAA 5CJ9A 1BGWA 1I6HC 2GAGC 2B63C 3S1QK 2PA8D 2O5IA 2ZJRS 2FQTA 4AH6A 2XCRB 1L0WA 3L4JA 5FLMK 2WB1L 5IYDC 4LR2A 5D4DA 4MEXA 1DCOA 3RZOK 3S17C 1J6VA 2E2HC 3ERED 1WOOA 4U67S 4A3LC 4OIRA 1DCHA 2WAQL 1EQRA 4Q4ZA 4GTAA 4O2DA 5M3MK 2JA8C 5CHPA 1XXCA 2P8TA 3LYWA 1ZQ1C 4BKWA 3GEHA 4OIOA 2R93A 4G0VA 1IW7A 3GDZA 3DLLS 3HXAA 1I3QA 4C45A 3HOZK 3S16K 2R92A 1TWAC 1YX2A 5JFEA 3H3VL 3H0GA 3GTLA 4BBSC 3CQZK 4GTBA 1F9NA 5FLMC 5HL7S 1SFOC 2CFAA 4MEYA 3RZDK 2JA6K 4KDDA 4Q5SA 4G7HA 3AH5A 3BP8C 4A3GK 1IL2A 4ZH4A 1TWHA 4MQ9A 3GTOA 3GTKC 3HOVK 3I4NK 3GEEA 4Y7NK 2R93K 3M4OC 3HKZD 4IOCS 2GSUA 4AYBD 1TWAK 4PAAA 3AQPA 2KPUA 2WB1D 4GT9A 1HI9A 5E68A 4KM8A 4LK0A 1V5VA 2E2IA 1WCMA 2NVTK 4A3GC 4IO9S 2JA7C 1IQ0A 3G4AA 3ADAC 4C3IC 5IOSA 3CQZC 4BBSK 1UV7A 5DM7S 5C44K 2R92C 4WJ3M 1TWGK 2R7ZK 4LOWA 1INNA 1TWHK 3AD7C 3H0GC 4BLBA 1K83C 2E2JK 3GTMC 1ISEA 4XLPA 3GTJC 4KAWX 1O25A 5JVOA 4GTDA 2BE5A 5IP7K 2L5NA 4XSZA 1DD5A 4Y52K 3T00A 4A3IK 1IBAA 3GTQC 4C3HK 4A3KK 3AQOA 2B63A 4BBRC 3S2DK 3PO3C 4LQYA 4P9SA 4GTLA 4YFNA 2ZJPS 4C2MK 3GTJK 1PJ7A 2ZUFA 3QX3A 5TMCA 3GTMK 4A3FK 1B4BA 1Y1VC 4OIQA 5M5YK 2JA5C 5IP9K 4LJZA 4LLGA 4XLNA 1G51A 2JA5A 4A3KC 2P5MA 2NVQC 1O2AA 3EQLA 2CFAB 1ZVUA 3A8IA 4NOIA 3TFJA 2PHCB 3NUHA 4BY7K 2PMZL 4KMHA 3PO3K 3S16C 3K7AK 2YU9A 3LAPA 1WQHA 1XZQB 1R9TC 1Y1WA 3BP3A 2NVQK 4WFAS 3GTPA 3S2HK 4KMAA 3JSTA 5JVGS 1O2FB 5IP9C 2JA5K 3GTKK 2VUMA 1WQFA 1KQ4A 3S15K 3GTOC 5FJ8K 2VUMK 3S1MC 2E2HK 1Y1WK 5C3EC 1I50C 2E2IC 1SMYA 5HL8A 4GTCA 3GTPK 1WOSA 3T02A 4G0WA 1O2BA 2XCOA 3SZZA 4WFNS 2PA8L 4A3BC 2NVYA 3GSIA 4KMUA 5IYCK 1Y1WC 3N3YA 3S15C 1I6VA 3LAJA 1YNNA 4OIPA 3A8KA 1XZPA 1K83A 2RH6A 3Q3QA 3RZDC 2NVXK 1Y1VK 1VLOA 2Y0SD 3MMLB 3M4OK 3M3YK 1ZXOA 4QIWL 3CAGA 4PABA 5M3FK 3GTPC 3S14C 2V6SA 3HOXC 4IOAS 3I4NC 1WSRA 1O28A 1C0AA 4A3DK 3FHZA 3H3VD 2GSOA 1GE9A 1TWFC 3RZOC 1WCMC 4KMDA 1DCPA 3GTGC 1Y1VA 3HKZL 4P5AA 2NVYC 3FKIK 2E2JC 1K83K 1ZYRA 3TTGA 3S2HC 2R7ZA 4BXXK 5L46A 1EFWA 1RU0A 3GTJA 4A3IC 4X6AK 5TJ3A 2L3UA 3GTGK 3PO2K 2EBBA 1WCMK 3HOZC 1O24A 4C3JC 2E2IK 4LK1A 4A3JC 4GZYA 3I4MC 4XSXA 3FOEA 4A3DC 4KM9A 2KQ1A 4KN4A 4KN7A 2VUMC 3CF5S 4KATA 1ZBSA 1O27A 3FKIA 2ZJQS 2R93C 1TWGA 2V6UA 2A68A 3S0XA 3SZYA 3N0CA 4A3EK 4G7OA 1I6HK 5M5WK 4A93K 3HOUK 3S17K 3WODA 3G4CA 2A69A 3GEIA 4WF9S 2NVTC 4WJ4A 3I4MK 1I3QK 3HOWK 3OEPA 2Y0SL 4P5BA 4RMFA 3IPJA 2R92K 1XPPA 1YCLA 3K7AC 3L4KA 3A8JA 3GIRA 1HQMA 1B4AA 1WQGA 3AD9C 1TWCK 1F7UA 2JA7K 4A3CK 1J6WA 3HOXK 4WILA 2R7ZC 4KB2A 1WIHA 3TFIA 5HQHA 1PJ6A 1I3QC 3HOWC 4A3MK 3AD8C 4YFXA 4KC6A 5C4XK 5C4JK 4A93C 5EGHA 2JA6A 3S1MK 4DDQA 4QJVB 4XCHA 4A3EC 5EGEA 3PIOS 3CQZA 2KXYA 1F93A 2XCQA 1I50A 5DM6S 4FM9A 2PPBA 2GSNA 4YFKA 5IP7C 1TWCA 5M5XK 5C3EK 4M1XA 3TFHA 2B63K 4Y7NC 2CW0A 4A3CC 3S1NC 1TWFA 4G7ZA 2GAHC 2JH3A 5C4JC 4WFBS 5IOTA 3GTKA 1FEUA 1XXAA 4A3FC 3S1QC 2KWAA 1USOA 4QIWD 3GTLK 1WOPA 4QJVA 1SFOA 4AYBL 1JOEA 2W7VA 3OPFA 3H0GK 1USMA 3N0BA 4BLAA 4A3JK 4A3LK 1O26A 4BY7C 1VRQC 2FQOA 1X31C 4GTEA 5IORA 4GTFA 1TWFK 4GFQA 1WSVA 1R9TK 4BY1K 1VGXA 3GTLC 3FKIC 2RGRA 1O29A 4WCES 3S14K 3GTGA 3LPXA 3HOVC
chains in the Genus database with same CATH topology
1I50K 4KN4A 2PMZL 4KN7A 2O5JA 5M3MK 3PO3K 3S16C 2JA8C 2VUMC 2A6EA 3K7AK 5IYBC 4A3BK 4OIOA 3S2DC 4BBRK 2R93C 1TWCC 1R9TC 2A68A 3GTQK 5C4XC 2NVQK 3S2HK 2WAQD 4A3MC 2NVYK 4A3EK 1IW7A 4G7OA 3S1RK 5M5WK 1I6HK 3DXJA 4A93K 3HOUK 5IP9C 2JA5K 3HOZK 3WODA 1YNJA 3GTKK 2A69A 3S17K 2NVTC 3S16K 3I4MK 1TWAC 1I3QK 3HOWK 2Y0SL 3H3VL 2NVXC 2R92K 5TMFA 3S15K 1XPPA 3GTOC 4BBSC 3K7AC 3CQZK 3S1MC 5FJ8K 2JA8K 2VUMK 4C3JK 5FLMC 2E2HK 1SFOC 1Y1WK 1HQMA 4MEYA 3RZDK 3PO2C 5C3EC 2JA6K 1TWCK 1I50C 2E2IC 3S1RC 1SMYA 4Q5SA 3GTPK 4G7HA 2JA7K 4A3GK 4A3CK 4ZH4A 3HOYC 4MQ9A 3GTKC 3HOXK 3HOVK 3I4NK 2R93K 2R7ZC 4Y7NK 3HOUC 2PA8L 2PMZD 3M4OC 2WAQL 3HKZD 4AYBD 4A3BC 1I3QC 4JK1A 3HOWC 1TWAK 4A3MK 3S1NK 1TWHC 2WB1D 4YFXA 5C4XK 5C4JK 4Y52C 4A93C 4KMUA 4LK0A 3S1MK 1BDFA 4QJVB 5IYCK 4A3EC 2NVTK 1Y1WC 4A3GC 2JA7C 4C3IC 3S15C 1I6VA 4BXXC 3CQZC 3GTOK 4BBSK 1YNNA 4OIPA 2PPBA 2A6HA 4C3HC 4YFKA 5IP7C 5C44K 3RZDC 5M5XK 2R92C 2NVXK 2YU9C 2JA6C 1TWGK 5C3EK 1Y1VK 4Y7NC 2B63K 2R7ZK 2CW0A 1TWHK 2Y0SD 3H0GC 1SFOK 3M4OK 3M3YK 4A3CC 4QIWL 3HOYK 4X6AC 3S1NC 4C2MC 3RZOK 4G7ZA 1K83C 3GTPC 5M3FK 5C4JC 3S14C 3GTMC 2E2JK 4BY1C 4XLPA 3GTJC 3HOXC 3I4NC 4A3FC 5IYBK 4A3DK 2BE5A 5IP7K 3H3VD 4XSZA 3S1QC 4Y52K 1TWFC 1TWGC 4QIWD 4YG2A 1WCMC 3RZOC 4A3IK 3GTLK 5IYCC 4QJVA 3GTQC 5C44C 4C3HK 4A3KK 3GTGC 3M3YC 4AYBL 4OINA 3HKZL 5IYDK 2YU9K 4BBRC 3S2DK 2NVYC 3FKIK 4C3IK 2E2JC 1K83K 3H0GK 3PO3C 4A3JK 4A3LK 1ZYRA 3S2HC 4YFNA 3GTJK 4C2MK 4BY7C 1I6HC 4BXXK 5TMCA 3GTMK 4A3FK 1Y1VC 2B63C 4OIQA 5M5YK 2JA5C 5IP9K 4LJZA 4LLGA 2PA8D 4XLNA 2O5IA 3S1QK 1TWFK 4A3IC 4X6AK 5FLMK 2WB1L 1R9TK 4A3KC 5IYDC 3GTGK 5D4DA 4MEXA 2NVQC 3PO2K 4BY1K 3GTLC 1WCMK 3HOZC 3EQLA 3S17C 3FKIC 4C3JC 2E2HC 2E2IK 4LK1A 4A3JC 4GZYA 4A3LC 4NOIA 3I4MC 4XSXA 3S14K 4A3DC 4OIRA 4Q4ZA 3HOVC 4BY7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 K;  4KN4 A;  2PMZ L;  4KN7 A;  2O5J A;  5M3M K;  3PO3 K;  3S16 C;  2JA8 C;  2VUM C;  2A6E A;  3K7A K;  5IYB C;  4A3B K;  4OIO A;  3S2D C;  4BBR K;  2R93 C;  1TWC C;  1R9T C;  2A68 A;  3GTQ K;  5C4X C;  2NVQ K;  3S2H K;  2WAQ D;  4A3M C;  2NVY K;  4A3E K;  1IW7 A;  4G7O A;  3S1R K;  5M5W K;  1I6H K;  3DXJ A;  4A93 K;  3HOU K;  5IP9 C;  2JA5 K;  3HOZ K;  3WOD A;  1YNJ A;  3GTK K;  2A69 A;  3S17 K;  2NVT C;  3S16 K;  3I4M K;  1TWA C;  1I3Q K;  3HOW K;  2Y0S L;  3H3V L;  2NVX C;  2R92 K;  5TMF A;  3S15 K;  1XPP A;  3GTO C;  4BBS C;  3K7A C;  3CQZ K;  3S1M C;  5FJ8 K;  2JA8 K;  2VUM K;  4C3J K;  5FLM C;  2E2H K;  1SFO C;  1Y1W K;  1HQM A;  4MEY A;  3RZD K;  3PO2 C;  5C3E C;  2JA6 K;  1TWC K;  1I50 C;  2E2I C;  3S1R C;  1SMY A;  4Q5S A;  3GTP K;  4G7H A;  2JA7 K;  4A3G K;  4A3C K;  4ZH4 A;  3HOY C;  4MQ9 A;  3GTK C;  3HOX K;  3HOV K;  3I4N K;  2R93 K;  2R7Z C;  4Y7N K;  3HOU C;  2PA8 L;  2PMZ D;  3M4O C;  2WAQ L;  3HKZ D;  4AYB D;  4A3B C;  1I3Q C;  4JK1 A;  3HOW C;  1TWA K;  4A3M K;  3S1N K;  1TWH C;  2WB1 D;  4YFX A;  5C4X K;  5C4J K;  4Y52 C;  4A93 C;  4KMU A;  4LK0 A;  3S1M K;  1BDF A;  4QJV B;  5IYC K;  4A3E C;  2NVT K;  1Y1W C;  4A3G C;  2JA7 C;  4C3I C;  3S15 C;  1I6V A;  4BXX C;  3CQZ C;  3GTO K;  4BBS K;  1YNN A;  4OIP A;  2PPB A;  2A6H A;  4C3H C;  4YFK A;  5IP7 C;  5C44 K;  3RZD C;  5M5X K;  2R92 C;  2NVX K;  2YU9 C;  2JA6 C;  1TWG K;  5C3E K;  1Y1V K;  4Y7N C;  2B63 K;  2R7Z K;  2CW0 A;  1TWH K;  2Y0S D;  3H0G C;  1SFO K;  3M4O K;  3M3Y K;  4A3C C;  4QIW L;  3HOY K;  4X6A C;  3S1N C;  4C2M C;  3RZO K;  4G7Z A;  1K83 C;  3GTP C;  5M3F K;  5C4J C;  3S14 C;  3GTM C;  2E2J K;  4BY1 C;  4XLP A;  3GTJ C;  3HOX C;  3I4N C;  4A3F C;  5IYB K;  4A3D K;  2BE5 A;  5IP7 K;  3H3V D;  4XSZ A;  3S1Q C;  4Y52 K;  1TWF C;  1TWG C;  4QIW D;  4YG2 A;  1WCM C;  3RZO C;  4A3I K;  3GTL K;  5IYC C;  4QJV A;  3GTQ C;  5C44 C;  4C3H K;  4A3K K;  3GTG C;  3M3Y C;  4AYB L;  4OIN A;  3HKZ L;  5IYD K;  2YU9 K;  4BBR C;  3S2D K;  2NVY C;  3FKI K;  4C3I K;  2E2J C;  1K83 K;  3H0G K;  3PO3 C;  4A3J K;  4A3L K;  1ZYR A;  3S2H C;  4YFN A;  3GTJ K;  4C2M K;  4BY7 C;  1I6H C;  4BXX K;  5TMC A;  3GTM K;  4A3F K;  1Y1V C;  2B63 C;  4OIQ A;  5M5Y K;  2JA5 C;  5IP9 K;  4LJZ A;  4LLG A;  2PA8 D;  4XLN A;  2O5I A;  3S1Q K;  1TWF K;  4A3I C;  4X6A K;  5FLM K;  2WB1 L;  1R9T K;  4A3K C;  5IYD C;  3GTG K;  5D4D A;  4MEX A;  2NVQ C;  3PO2 K;  4BY1 K;  3GTL C;  1WCM K;  3HOZ C;  3EQL A;  3S17 C;  3FKI C;  4C3J C;  2E2H C;  2E2I K;  4LK1 A;  4A3J C;  4GZY A;  4A3L C;  4NOI A;  3I4M C;  4XSX A;  3S14 K;  4A3D C;  4OIR A;  4Q4Z A;  3HOV C;  4BY7 K; 
#chains in the Genus database with same CATH topology
 1I50 K;  4FZB A;  1IE0 A;  2O5J A;  2A6E A;  5IYB C;  1XZP B;  2V6T A;  1BJT A;  4G0U A;  4A3B K;  3S2D C;  4BBR K;  1TWC C;  4KAS A;  3GTQ K;  5C4X C;  1R9T A;  2WAQ D;  4A3M C;  2NVY K;  3S1R K;  1VH2 A;  4ILD A;  3DXJ A;  1YNJ A;  1EI6 A;  2E2H A;  2NVX C;  5TMF A;  3T01 A;  2JA8 K;  1PJ5 A;  4C3J K;  3GTQ A;  3PO2 C;  3S1R C;  1BS2 A;  1XXB A;  1EH1 A;  3ORE A;  1IS1 A;  3HOY C;  3V4G A;  1JVI A;  3GTM A;  3HOU C;  1AB4 A;  2PMZ D;  1XZQ A;  5IOQ A;  4JK1 A;  3S1N K;  3BUE A;  1TWH C;  4Y52 C;  1WOR A;  3VA7 A;  1J6X A;  1BDF A;  1EK8 A;  4BXX C;  3GTO K;  3FOF A;  2A6H A;  4C3H C;  4KAR A;  2YU9 C;  2JA6 C;  2ZFZ A;  2D6F C;  1J98 A;  1SFO K;  2NVX A;  3HOY K;  5JVH S;  4X6A C;  2Y3P A;  4C2M C;  4J3N A;  1JQW A;  1F7V A;  4BY1 C;  4KB4 A;  3PIP S;  5IYB K;  2JA7 A;  1TWG C;  4YG2 A;  2ZUE A;  5IYC C;  5C44 C;  5IYD K;  3M3Y C;  4OIN A;  2YU9 K;  4C3I K;  1VJE A;  1TWA A;  5CJ9 A;  1BGW A;  1I6H C;  2GAG C;  2B63 C;  3S1Q K;  2PA8 D;  2O5I A;  2ZJR S;  2FQT A;  4AH6 A;  2XCR B;  1L0W A;  3L4J A;  5FLM K;  2WB1 L;  5IYD C;  4LR2 A;  5D4D A;  4MEX A;  1DCO A;  3RZO K;  3S17 C;  1J6V A;  2E2H C;  3ERE D;  1WOO A;  4U67 S;  4A3L C;  4OIR A;  1DCH A;  2WAQ L;  1EQR A;  4Q4Z A;  4GTA A;  4O2D A;  5M3M K;  2JA8 C;  5CHP A;  1XXC A;  2P8T A;  3LYW A;  1ZQ1 C;  4BKW A;  3GEH A;  4OIO A;  2R93 A;  4G0V A;  1IW7 A;  3GDZ A;  3DLL S;  3HXA A;  1I3Q A;  4C45 A;  3HOZ K;  3S16 K;  2R92 A;  1TWA C;  1YX2 A;  5JFE A;  3H3V L;  3H0G A;  3GTL A;  4BBS C;  3CQZ K;  4GTB A;  1F9N A;  5FLM C;  5HL7 S;  1SFO C;  2CFA A;  4MEY A;  3RZD K;  2JA6 K;  4KDD A;  4Q5S A;  4G7H A;  3AH5 A;  3BP8 C;  4A3G K;  1IL2 A;  4ZH4 A;  1TWH A;  4MQ9 A;  3GTO A;  3GTK C;  3HOV K;  3I4N K;  3GEE A;  4Y7N K;  2R93 K;  3M4O C;  3HKZ D;  4IOC S;  2GSU A;  4AYB D;  1TWA K;  4PAA A;  3AQP A;  2KPU A;  2WB1 D;  4GT9 A;  1HI9 A;  5E68 A;  4KM8 A;  4LK0 A;  1V5V A;  2E2I A;  1WCM A;  2NVT K;  4A3G C;  4IO9 S;  2JA7 C;  1IQ0 A;  3G4A A;  3ADA C;  4C3I C;  5IOS A;  3CQZ C;  4BBS K;  1UV7 A;  5DM7 S;  5C44 K;  2R92 C;  4WJ3 M;  1TWG K;  2R7Z K;  4LOW A;  1INN A;  1TWH K;  3AD7 C;  3H0G C;  4BLB A;  1K83 C;  2E2J K;  3GTM C;  1ISE A;  4XLP A;  3GTJ C;  4KAW X;  1O25 A;  5JVO A;  4GTD A;  2BE5 A;  5IP7 K;  2L5N A;  4XSZ A;  1DD5 A;  4Y52 K;  3T00 A;  4A3I K;  1IBA A;  3GTQ C;  4C3H K;  4A3K K;  3AQO A;  2B63 A;  4BBR C;  3S2D K;  3PO3 C;  4LQY A;  4P9S A;  4GTL A;  4YFN A;  2ZJP S;  4C2M K;  3GTJ K;  1PJ7 A;  2ZUF A;  3QX3 A;  5TMC A;  3GTM K;  4A3F K;  1B4B A;  1Y1V C;  4OIQ A;  5M5Y K;  2JA5 C;  5IP9 K;  4LJZ A;  4LLG A;  4XLN A;  1G51 A;  2JA5 A;  4A3K C;  2P5M A;  2NVQ C;  1O2A A;  3EQL A;  2CFA B;  1ZVU A;  3A8I A;  4NOI A;  3TFJ A;  2PHC B;  3NUH A;  4BY7 K;  2PMZ L;  4KMH A;  3PO3 K;  3S16 C;  3K7A K;  2YU9 A;  3LAP A;  1WQH A;  1XZQ B;  1R9T C;  1Y1W A;  3BP3 A;  2NVQ K;  4WFA S;  3GTP A;  3S2H K;  4KMA A;  3JST A;  5JVG S;  1O2F B;  5IP9 C;  2JA5 K;  3GTK K;  2VUM A;  1WQF A;  1KQ4 A;  3S15 K;  3GTO C;  5FJ8 K;  2VUM K;  3S1M C;  2E2H K;  1Y1W K;  5C3E C;  1I50 C;  2E2I C;  1SMY A;  5HL8 A;  4GTC A;  3GTP K;  1WOS A;  3T02 A;  4G0W A;  1O2B A;  2XCO A;  3SZZ A;  4WFN S;  2PA8 L;  4A3B C;  2NVY A;  3GSI A;  4KMU A;  5IYC K;  1Y1W C;  3N3Y A;  3S15 C;  1I6V A;  3LAJ A;  1YNN A;  4OIP A;  3A8K A;  1XZP A;  1K83 A;  2RH6 A;  3Q3Q A;  3RZD C;  2NVX K;  1Y1V K;  1VLO A;  2Y0S D;  3MML B;  3M4O K;  3M3Y K;  1ZXO A;  4QIW L;  3CAG A;  4PAB A;  5M3F K;  3GTP C;  3S14 C;  2V6S A;  3HOX C;  4IOA S;  3I4N C;  1WSR A;  1O28 A;  1C0A A;  4A3D K;  3FHZ A;  3H3V D;  2GSO A;  1GE9 A;  1TWF C;  3RZO C;  1WCM C;  4KMD A;  1DCP A;  3GTG C;  1Y1V A;  3HKZ L;  4P5A A;  2NVY C;  3FKI K;  2E2J C;  1K83 K;  1ZYR A;  3TTG A;  3S2H C;  2R7Z A;  4BXX K;  5L46 A;  1EFW A;  1RU0 A;  3GTJ A;  4A3I C;  4X6A K;  5TJ3 A;  2L3U A;  3GTG K;  3PO2 K;  2EBB A;  1WCM K;  3HOZ C;  1O24 A;  4C3J C;  2E2I K;  4LK1 A;  4A3J C;  4GZY A;  3I4M C;  4XSX A;  3FOE A;  4A3D C;  4KM9 A;  2KQ1 A;  4KN4 A;  4KN7 A;  2VUM C;  3CF5 S;  4KAT A;  1ZBS A;  1O27 A;  3FKI A;  2ZJQ S;  2R93 C;  1TWG A;  2V6U A;  2A68 A;  3S0X A;  3SZY A;  3N0C A;  4A3E K;  4G7O A;  1I6H K;  5M5W K;  4A93 K;  3HOU K;  3S17 K;  3WOD A;  3G4C A;  2A69 A;  3GEI A;  4WF9 S;  2NVT C;  4WJ4 A;  3I4M K;  1I3Q K;  3HOW K;  3OEP A;  2Y0S L;  4P5B A;  4RMF A;  3IPJ A;  2R92 K;  1XPP A;  1YCL A;  3K7A C;  3L4K A;  3A8J A;  3GIR A;  1HQM A;  1B4A A;  1WQG A;  3AD9 C;  1TWC K;  1F7U A;  2JA7 K;  4A3C K;  1J6W A;  3HOX K;  4WIL A;  2R7Z C;  4KB2 A;  1WIH A;  3TFI A;  5HQH A;  1PJ6 A;  1I3Q C;  3HOW C;  4A3M K;  3AD8 C;  4YFX A;  4KC6 A;  5C4X K;  5C4J K;  4A93 C;  5EGH A;  2JA6 A;  3S1M K;  4DDQ A;  4QJV B;  4XCH A;  4A3E C;  5EGE A;  3PIO S;  3CQZ A;  2KXY A;  1F93 A;  2XCQ A;  1I50 A;  5DM6 S;  4FM9 A;  2PPB A;  2GSN A;  4YFK A;  5IP7 C;  1TWC A;  5M5X K;  5C3E K;  4M1X A;  3TFH A;  2B63 K;  4Y7N C;  2CW0 A;  4A3C C;  3S1N C;  1TWF A;  4G7Z A;  2GAH C;  2JH3 A;  5C4J C;  4WFB S;  5IOT A;  3GTK A;  1FEU A;  1XXA A;  4A3F C;  3S1Q C;  2KWA A;  1USO A;  4QIW D;  3GTL K;  1WOP A;  4QJV A;  1SFO A;  4AYB L;  1JOE A;  2W7V A;  3OPF A;  3H0G K;  1USM A;  3N0B A;  4BLA A;  4A3J K;  4A3L K;  1O26 A;  4BY7 C;  1VRQ C;  2FQO A;  1X31 C;  4GTE A;  5IOR A;  4GTF A;  1TWF K;  4GFQ A;  1WSV A;  1R9T K;  4BY1 K;  1VGX A;  3GTL C;  3FKI C;  2RGR A;  1O29 A;  4WCE S;  3S14 K;  3GTG A;  3LPX A;  3HOV C; 
#chains in the Genus database with same CATH homology
 1I50 K;  4KN4 A;  2PMZ L;  4KN7 A;  2O5J A;  5M3M K;  3PO3 K;  3S16 C;  2JA8 C;  2VUM C;  2A6E A;  3K7A K;  5IYB C;  4A3B K;  4OIO A;  3S2D C;  4BBR K;  2R93 C;  1TWC C;  1R9T C;  2A68 A;  3GTQ K;  5C4X C;  2NVQ K;  3S2H K;  2WAQ D;  4A3M C;  2NVY K;  4A3E K;  1IW7 A;  4G7O A;  3S1R K;  5M5W K;  1I6H K;  3DXJ A;  4A93 K;  3HOU K;  5IP9 C;  2JA5 K;  3HOZ K;  3WOD A;  1YNJ A;  3GTK K;  2A69 A;  3S17 K;  2NVT C;  3S16 K;  3I4M K;  1TWA C;  1I3Q K;  3HOW K;  2Y0S L;  3H3V L;  2NVX C;  2R92 K;  5TMF A;  3S15 K;  1XPP A;  3GTO C;  4BBS C;  3K7A C;  3CQZ K;  3S1M C;  5FJ8 K;  2JA8 K;  2VUM K;  4C3J K;  5FLM C;  2E2H K;  1SFO C;  1Y1W K;  1HQM A;  4MEY A;  3RZD K;  3PO2 C;  5C3E C;  2JA6 K;  1TWC K;  1I50 C;  2E2I C;  3S1R C;  1SMY A;  4Q5S A;  3GTP K;  4G7H A;  2JA7 K;  4A3G K;  4A3C K;  4ZH4 A;  3HOY C;  4MQ9 A;  3GTK C;  3HOX K;  3HOV K;  3I4N K;  2R93 K;  2R7Z C;  4Y7N K;  3HOU C;  2PA8 L;  2PMZ D;  3M4O C;  2WAQ L;  3HKZ D;  4AYB D;  4A3B C;  1I3Q C;  4JK1 A;  3HOW C;  1TWA K;  4A3M K;  3S1N K;  1TWH C;  2WB1 D;  4YFX A;  5C4X K;  5C4J K;  4Y52 C;  4A93 C;  4KMU A;  4LK0 A;  3S1M K;  1BDF A;  4QJV B;  5IYC K;  4A3E C;  2NVT K;  1Y1W C;  4A3G C;  2JA7 C;  4C3I C;  3S15 C;  1I6V A;  4BXX C;  3CQZ C;  3GTO K;  4BBS K;  1YNN A;  4OIP A;  2PPB A;  2A6H A;  4C3H C;  4YFK A;  5IP7 C;  5C44 K;  3RZD C;  5M5X K;  2R92 C;  2NVX K;  2YU9 C;  2JA6 C;  1TWG K;  5C3E K;  1Y1V K;  4Y7N C;  2B63 K;  2R7Z K;  2CW0 A;  1TWH K;  2Y0S D;  3H0G C;  1SFO K;  3M4O K;  3M3Y K;  4A3C C;  4QIW L;  3HOY K;  4X6A C;  3S1N C;  4C2M C;  3RZO K;  4G7Z A;  1K83 C;  3GTP C;  5M3F K;  5C4J C;  3S14 C;  3GTM C;  2E2J K;  4BY1 C;  4XLP A;  3GTJ C;  3HOX C;  3I4N C;  4A3F C;  5IYB K;  4A3D K;  2BE5 A;  5IP7 K;  3H3V D;  4XSZ A;  3S1Q C;  4Y52 K;  1TWF C;  1TWG C;  4QIW D;  4YG2 A;  1WCM C;  3RZO C;  4A3I K;  3GTL K;  5IYC C;  4QJV A;  3GTQ C;  5C44 C;  4C3H K;  4A3K K;  3GTG C;  3M3Y C;  4AYB L;  4OIN A;  3HKZ L;  5IYD K;  2YU9 K;  4BBR C;  3S2D K;  2NVY C;  3FKI K;  4C3I K;  2E2J C;  1K83 K;  3H0G K;  3PO3 C;  4A3J K;  4A3L K;  1ZYR A;  3S2H C;  4YFN A;  3GTJ K;  4C2M K;  4BY7 C;  1I6H C;  4BXX K;  5TMC A;  3GTM K;  4A3F K;  1Y1V C;  2B63 C;  4OIQ A;  5M5Y K;  2JA5 C;  5IP9 K;  4LJZ A;  4LLG A;  2PA8 D;  4XLN A;  2O5I A;  3S1Q K;  1TWF K;  4A3I C;  4X6A K;  5FLM K;  2WB1 L;  1R9T K;  4A3K C;  5IYD C;  3GTG K;  5D4D A;  4MEX A;  2NVQ C;  3PO2 K;  4BY1 K;  3GTL C;  1WCM K;  3HOZ C;  3EQL A;  3S17 C;  3FKI C;  4C3J C;  2E2H C;  2E2I K;  4LK1 A;  4A3J C;  4GZY A;  4A3L C;  4NOI A;  3I4M C;  4XSX A;  3S14 K;  4A3D C;  4OIR A;  4Q4Z A;  3HOV C;  4BY7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...