4G7ZA

Crystal structure of thermus thermophilus transcription initiation complex containing 5-bru at template-strand position +1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
226
Chain Sequence
b'SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
total genus 44
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7zA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7zA01
2PA8D 4C3JK 2B63K 3H0GC 3S1MK 2WAQD 2JA7K 1K83C 4A3LK 5C44K 2E2JC 4A3KK 1Y1WC 2R7ZC 3HOYC 3HOXC 3PO2C 1SFOC 2R93K 3GTLC 4LK1A 3S1QK 2JA8K 2VUMK 4A3CC 4LK0A 3HKZL 4XLNA 1TWFC 4ZH4A 4C3HK 2O5JA 1TWAC 4OIOA 1I3QC 3H0GK 1K83K 2Y0SL 2E2HC 2PPBA 2E2JK 1Y1WK 3GTQC 2A68A 3HOYK 5D4DA 3GTOC 3HOXK 1SFOK 2R7ZK 2A69A 3S2HC 3GTLK 3PO2K 4X6AC 4A3CK 4YFNA 2JA6C 3M4OC 1I6VA 4OIPA 1TWFK 5IP7C 3HOUC 4MEXA 4LJZA 2A6HA 4A3EC 3DXJA 1TWAK 1I3QK 4C2MC 4OINA 3I4NC 2E2HK 5TMCA 5M5YK 4Y7NC 2PMZD 3S1NC 3GTQK 2WB1D 1TWCC 1TWGC 3FKIC 4NOIA 3RZOC 1WCMC 4C3IC 3GTOK 4G7ZA 3S2HK 4AYBL 5FJ8K 4X6AK 3H3VL 2JA6K 3M4OK 5IP9C 2CW0A 2NVQC 5IP7K 2E2IC 3S1RC 3HOUK 4KMUA 2NVTC 4A3EK 4XSZA 2NVYC 3RZDC 4YG2A 1R9TC 2A6EA 4QIWL 4XLPA 4C2MK 3I4NK 5IYCC 4Y7NK 3S1NK 4Y52C 4A3IC 3M3YC 1TWCK 1TWGK 4KN4A 3FKIK 3S15C 1WCMK 4C3IK 3RZOK 5IYDC 1BDFA 1YNJA 5IP9K 2NVQK 5M3FK 2E2IK 4A3FC 3S1RK 2NVTK 2NVYK 3RZDK 1R9TK 4QJVA 4XSXA 1I6HC 3S2DC 3HKZD 5IYCK 3M3YK 4A3IK 3S14C 4Y52K 3K7AC 5TMFA 3S15K 2NVXC 1TWHC 5C3EC 4YFKA 5IYDK 2Y0SD 4A3MC 3S16C 4G7HA 4A3BC 1SMYA 1HQMA 3CQZC 2PA8L 4A3FK 4MQ9A 2WAQL 4BY1C 4A3JC 1I6HK 4A93C 3S2DK 1I50C 4A3DC 3I4MC 5C4XC 5C4JC 3S14K 3K7AK 4BBRC 5IYBC 2NVXK 1TWHK 5C3EK 5M3MK 3GTMC 2BE5A 4QJVB 4A3MK 3S16K 4Q5SA 4A3BK 3CQZK 3WODA 3GTGC 4JK1A 2R92C 4OIRA 3HOWC 4MEYA 4AYBD 4BY7C 4LLGA 4OIQA 4BY1K 4A3JK 3H3VD 4A3GC 4A93K 1I50K 4BXXC 3GTPC 5M5XK 3I4MK 4A3DK 5C4XK 1YNNA 3PO3C 5C4JK 3HOZC 2JA5C 3S17C 4YFXA 4BBRK 5IYBK 4QIWD 4BBSC 4KN7A 5M5WK 3GTMK 4GZYA 1Y1VC 3HOVC 3GTJC 4G7OA 3GTGK 2R92K 4BY7K 3HOWK 3GTKC 4Q4ZA 2YU9C 4A3GK 2PMZL 3GTPK 4BXXK 5FLMC 2WB1L 3PO3K 3HOZK 4C3JC 2B63C 2JA5K 3S1MC 3S17K 2JA7C 1XPPA 4BBSK 4A3LC 5C44C 4A3KC 1ZYRA 2O5IA 1Y1VK 2R93C 3GTJK 3HOVK 3S1QC 1IW7A 2JA8C 2VUMC 3EQLA 2YU9K 4C3HC 3GTKK 5FLMK
chains in the Genus database with same CATH superfamily
3ADAC 3H0GC 3GTQA 3TTGA 3GTOA 1J6XA 3PO2C 1B4AA 2JA6A 2JA8K 4C3HK 4XLNA 1TWFC 3GIRA 4G0UA 3AD7C 4WFNS 3ERED 1I3QC 3H0GK 1X31C 1TWCA 1WCMA 3PO2K 1YCLA 2RGRA 1XZQB 3M4OC 1DCPA 3LAPA 2ZUEA 1C0AA 1TWFK 2EBBA 2E2IA 5IP7C 4MEXA 4GTEA 1I3QK 5M5YK 3RZOC 1ZVUA 3FKIC 4C3IC 4AYBL 3SZZA 2FQTA 3H3VL 5HQHA 3M4OK 4WFAS 2NVQC 5IP7K 2NVTC 2V6TA 1BJTA 1O2BA 2CFAB 1R9TC 4KC6A 4XCHA 4Y52C 3JSTA 3RZOK 1TWHA 3FKIK 4J3NA 4C3IK 1BDFA 3CQZA 1IE0A 2NVQK 1KQ4A 2NVTK 1JVIA 1R9TK 3AD9C 3HKZD 4Y52K 4KB4A 1B4BA 3GTMA 4KATA 2Y0SD 4A3MC 4G7HA 1HQMA 4MQ9A 2WAQL 1V5VA 4BY1C 4A3JC 2KPUA 4A93C 4A3DC 3SZYA 5C4XC 5C4JC 2P8TA 1DCOA 4A3MK 3OEPA 4Q5SA 2P5MA 3GTJA 1USMA 5IOSA 4BY7C 4OIRA 3L4JA 4LLGA 4BY1K 4A3JK 4A93K 4A3DK 2B63A 4LOWA 5C4XK 1YNNA 5C4JK 3HOZC 5IOTA 4KN7A 1VLOA 2R93A 1Y1VC 2VUMA 4BY7K 3S0XA 3GDZA 2YU9C 2PMZL 1O26A 3HOZK 4C3JC 3CAGA 3S1MC 1GE9A 1ISEA 2CFAA 1ZYRA 1O25A 2L5NA 3GTLA 1Y1VK 3S1QC 1IW7A 2YU9K 3AQPA 1XXBA 2PA8D 4C3JK 3S1MK 1K83C 4GTDA 3GEEA 1Y1WC 4LR2A 3HOYC 1SFOC 1ZXOA 4LK1A 3S1QK 4P5AA 4KM8A 4ZH4A 2ZJPS 1J6VA 4GTLA 1JQWA 4OIOA 1K83K 2PPBA 1TWGA 1Y1WK 3GTQC 2XCRB 3HOYK 3GTOC 3AH5A 3OREA 1SFOK 3AD8C 3S2HC 4X6AC 2JA6C 4LJZA 2A6HA 4IOAS 3DXJA 1EFWA 3I4NC 5TMCA 3BP8C 3GTQK 2WB1D 2FQOA 1TWCC 2JH3A 3GTOK 1WCMC 3S2HK 4G7ZA 5FJ8K 4X6AK 1PJ7A 2JA6K 2CW0A 1EI6A 2E2IC 3S1RC 1XXCA 4KMUA 4QIWL 2A6EA 4WJ3M 3I4NK 2W7VA 4U67S 1TWCK 1WSRA 4BLAA 1WCMK 5JVGS 3N3YA 5IYDC 3GEHA 1YNJA 1PJ5A 1F93A 4O2DA 1XXAA 3S1RK 2E2IK 1I50A 4XSXA 3S2DC 1O29A 4P9SA 1WQHA 1WOPA 2D6FC 1TWHC 5IYDK 2KXYA 1EK8A 2XCOA 1BGWA 1SMYA 3CQZC 4GTBA 4IOCS 4WCES 3GEIA 3GTPA 1DCHA 4KARA 3A8IA 3S2DK 2JA5A 3TFHA 5IYBC 5EGEA 1TWHK 4PAAA 3GTMC 5M3MK 1UV7A 4QJVB 1L0WA 1O2AA 3CQZK 2ZFZA 4JK1A 3HOWC 4MEYA 4AYBD 5IORA 4OIQA 3H3VD 2GSOA 2JA7A 5IYBK 4BBSC 3GTMK 1DD5A 4GZYA 1F7VA 3GTJC 3HOWK 2B63C 4KMHA 4BBSK 4A3LC 5C44C 4A3KC 3Q3QA 2R7ZA 4FM9A 3PIOS 2R93C 3LYWA 3GTJK 3N0BA 4WJ4A 2VUMC 1TWAA 1O24A 2B63K 5HL8A 1XZQA 2E2HA 2WAQD 1O28A 4A3LK 5C44K 2E2JC 4A3KK 1ZQ1C 3HOXC 4P5BA 2R93K 3GTLC 3T02A 2GSNA 5HL7S 2VUMK 4G0WA 4LK0A 1O27A 1HI9A 4DDQA 1XZPB 1EQRA 2E2JK 3A8JA 2A68A 5DM7S 5D4DA 3HOXK 2A69A 3GTLK 2GAHC 4KB2A 2KQ1A 4YFNA 1I6VA 1WOOA 3HOUC 2NVYA 1JOEA 1YX2A 4C2MC 4OINA 3LPXA 4ILDA 5DM6S 2PMZD 4NOIA 1TWGC 4GTCA 1WOSA 1IL2A 1WSVA 4G0VA 4GT9A 3HOUK 3RZDC 2XCQA 4YG2A 4KDDA 4C2MK 4XLPA 3A8KA 5IYCC 4A3IC 2NVXA 1TWGK 5JVOA 4WF9S 2V6UA 2YU9A 4A3FC 3OPFA 2L3UA 4KMDA 3RZDK 1I6HC 3AQOA 5IYCK 5CJ9A 4A3IK 3S14C 5TMFA 3BUEA 1INNA 4WILA 3S16C 4BKWA 3QX3A 3GTGA 2R92A 1RU0A 4A3FK 1WQFA 1VH2A 3VA7A 3FOEA 1I6HK 1I50C 3I4MC 3S14K 4BBRC 3S16K 2ZJRS 4KAWX 3WODA 3GTKA 1J6WA 3TFIA 4A3GC 1I50K 3GTPC 4KMAA 3I4MK 3PO3C 2JA5C 1PJ6A 3S17C 4BBRK 3L4KA 4QIWD 4KM9A 5M5WK 3NUHA 4RMFA 1WQGA 3HOVC 1J98A 1USOA 4A3GK 4KASA 4M1XA 3FOFA 3BP3A 3GTPK 3H0GA 3PO3K 2JA5K 4PABA 1G51A 3S17K 2JA7C 3DLLS 1XPPA 4LQYA 2O5IA 3HOVK 1O2FB 1VRQC 1TWFA 4BLBA 1VJEA 1IBAA 1I3QA 3V4GA 3PIPS 2JA7K 2R7ZC 2ZJQS 4A3CC 3HKZL 1WIHA 2O5JA 1TWAC 2Y0SL 2E2HC 3FKIA 4IO9S 2R7ZK 3N0CA 1WORA 4A3CK 4OIPA 1IQ0A 1R9TA 4A3EC 1TWAK 2RH6A 3IPJA 3CF5S 2GAGC 2E2HK 4Y7NC 3S1NC 3T01A 4C45A 5JVHS 5EGHA 5IP9C 4GTFA 4XSZA 2NVYC 3FHZA 4A3EK 5IOQA 1FEUA 1ZBSA 4Y7NK 3M3YC 3HXAA 3S1NK 4KN4A 2ZUFA 3S15C 3GSIA 5IP9K 2Y3PA 5CHPA 5M3FK 2NVYK 3G4AA 4QJVA 3M3YK 3K7AC 3S15K 5JFEA 2NVXC 5C3EC 4YFKA 3MMLB 1BS2A 4A3BC 2PA8L 4AH6A 4GFQA 2V6SA 2GSUA 3K7AK 3T00A 2NVXK 5C3EK 2BE5A 2KWAA 1Y1VA 4A3BK 3GTGC 2R92C 1EH1A 4BXXC 5M5XK 3G4CA 4YFXA 1IS1A 1VGXA 1F9NA 3TFJA 2PHCB 4GTAA 1F7UA 3LAJA 4G7OA 3GTGK 2R92K 1AB4A 5E68A 3GTKC 4Q4ZA 4BXXK 5FLMC 2WB1L 1K83A 1Y1WA 4FZBA 5TJ3A 1SFOA 1XZPA 4WFBS 2JA8C 3EQLA 3GTKK 4C3HC 5L46A 5FLMK
chains in the Genus database with same CATH topology
2PA8D 4C3JK 2B63K 3H0GC 3S1MK 2WAQD 2JA7K 1K83C 4A3LK 5C44K 2E2JC 4A3KK 1Y1WC 2R7ZC 3HOYC 3HOXC 3PO2C 1SFOC 2R93K 3GTLC 4LK1A 3S1QK 2JA8K 2VUMK 4A3CC 4LK0A 3HKZL 4XLNA 1TWFC 4ZH4A 4C3HK 2O5JA 1TWAC 4OIOA 1I3QC 3H0GK 1K83K 2Y0SL 2E2HC 2PPBA 2E2JK 1Y1WK 3GTQC 2A68A 3HOYK 5D4DA 3GTOC 3HOXK 1SFOK 2R7ZK 2A69A 3S2HC 3GTLK 3PO2K 4X6AC 4A3CK 4YFNA 2JA6C 3M4OC 1I6VA 4OIPA 1TWFK 5IP7C 3HOUC 4MEXA 4LJZA 2A6HA 4A3EC 3DXJA 1TWAK 1I3QK 4C2MC 4OINA 3I4NC 2E2HK 5TMCA 5M5YK 4Y7NC 2PMZD 3S1NC 3GTQK 2WB1D 1TWCC 1TWGC 3FKIC 4NOIA 3RZOC 1WCMC 4C3IC 3GTOK 4G7ZA 3S2HK 4AYBL 5FJ8K 4X6AK 3H3VL 2JA6K 3M4OK 5IP9C 2CW0A 2NVQC 5IP7K 2E2IC 3S1RC 3HOUK 4KMUA 2NVTC 4A3EK 4XSZA 2NVYC 3RZDC 4YG2A 1R9TC 2A6EA 4QIWL 4XLPA 4C2MK 3I4NK 5IYCC 4Y7NK 3S1NK 4Y52C 4A3IC 3M3YC 1TWCK 1TWGK 4KN4A 3FKIK 3S15C 1WCMK 4C3IK 3RZOK 5IYDC 1BDFA 1YNJA 5IP9K 2NVQK 5M3FK 2E2IK 4A3FC 3S1RK 2NVTK 2NVYK 3RZDK 1R9TK 4QJVA 4XSXA 1I6HC 3S2DC 3HKZD 5IYCK 3M3YK 4A3IK 3S14C 4Y52K 3K7AC 5TMFA 3S15K 2NVXC 1TWHC 5C3EC 4YFKA 5IYDK 2Y0SD 4A3MC 3S16C 4G7HA 4A3BC 1SMYA 1HQMA 3CQZC 2PA8L 4A3FK 4MQ9A 2WAQL 4BY1C 4A3JC 1I6HK 4A93C 3S2DK 1I50C 4A3DC 3I4MC 5C4XC 5C4JC 3S14K 3K7AK 4BBRC 5IYBC 2NVXK 1TWHK 5C3EK 5M3MK 3GTMC 2BE5A 4QJVB 4A3MK 3S16K 4Q5SA 4A3BK 3CQZK 3WODA 3GTGC 4JK1A 2R92C 4OIRA 3HOWC 4MEYA 4AYBD 4BY7C 4LLGA 4OIQA 4BY1K 4A3JK 3H3VD 4A3GC 4A93K 1I50K 4BXXC 3GTPC 5M5XK 3I4MK 4A3DK 5C4XK 1YNNA 3PO3C 5C4JK 3HOZC 2JA5C 3S17C 4YFXA 4BBRK 5IYBK 4QIWD 4BBSC 4KN7A 5M5WK 3GTMK 4GZYA 1Y1VC 3HOVC 3GTJC 4G7OA 3GTGK 2R92K 4BY7K 3HOWK 3GTKC 4Q4ZA 2YU9C 4A3GK 2PMZL 3GTPK 4BXXK 5FLMC 2WB1L 3PO3K 3HOZK 4C3JC 2B63C 2JA5K 3S1MC 3S17K 2JA7C 1XPPA 4BBSK 4A3LC 5C44C 4A3KC 1ZYRA 2O5IA 1Y1VK 2R93C 3GTJK 3HOVK 3S1QC 1IW7A 2JA8C 2VUMC 3EQLA 2YU9K 4C3HC 3GTKK 5FLMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PA8 D;  4C3J K;  2B63 K;  3H0G C;  3S1M K;  2WAQ D;  2JA7 K;  1K83 C;  4A3L K;  5C44 K;  2E2J C;  4A3K K;  1Y1W C;  2R7Z C;  3HOY C;  3HOX C;  3PO2 C;  1SFO C;  2R93 K;  3GTL C;  4LK1 A;  3S1Q K;  2JA8 K;  2VUM K;  4A3C C;  4LK0 A;  3HKZ L;  4XLN A;  1TWF C;  4ZH4 A;  4C3H K;  2O5J A;  1TWA C;  4OIO A;  1I3Q C;  3H0G K;  1K83 K;  2Y0S L;  2E2H C;  2PPB A;  2E2J K;  1Y1W K;  3GTQ C;  2A68 A;  3HOY K;  5D4D A;  3GTO C;  3HOX K;  1SFO K;  2R7Z K;  2A69 A;  3S2H C;  3GTL K;  3PO2 K;  4X6A C;  4A3C K;  4YFN A;  2JA6 C;  3M4O C;  1I6V A;  4OIP A;  1TWF K;  5IP7 C;  3HOU C;  4MEX A;  4LJZ A;  2A6H A;  4A3E C;  3DXJ A;  1TWA K;  1I3Q K;  4C2M C;  4OIN A;  3I4N C;  2E2H K;  5TMC A;  5M5Y K;  4Y7N C;  2PMZ D;  3S1N C;  3GTQ K;  2WB1 D;  1TWC C;  1TWG C;  3FKI C;  4NOI A;  3RZO C;  1WCM C;  4C3I C;  3GTO K;  4G7Z A;  3S2H K;  4AYB L;  5FJ8 K;  4X6A K;  3H3V L;  2JA6 K;  3M4O K;  5IP9 C;  2CW0 A;  2NVQ C;  5IP7 K;  2E2I C;  3S1R C;  3HOU K;  4KMU A;  2NVT C;  4A3E K;  4XSZ A;  2NVY C;  3RZD C;  4YG2 A;  1R9T C;  2A6E A;  4QIW L;  4XLP A;  4C2M K;  3I4N K;  5IYC C;  4Y7N K;  3S1N K;  4Y52 C;  4A3I C;  3M3Y C;  1TWC K;  1TWG K;  4KN4 A;  3FKI K;  3S15 C;  1WCM K;  4C3I K;  3RZO K;  5IYD C;  1BDF A;  1YNJ A;  5IP9 K;  2NVQ K;  5M3F K;  2E2I K;  4A3F C;  3S1R K;  2NVT K;  2NVY K;  3RZD K;  1R9T K;  4QJV A;  4XSX A;  1I6H C;  3S2D C;  3HKZ D;  5IYC K;  3M3Y K;  4A3I K;  3S14 C;  4Y52 K;  3K7A C;  5TMF A;  3S15 K;  2NVX C;  1TWH C;  5C3E C;  4YFK A;  5IYD K;  2Y0S D;  4A3M C;  3S16 C;  4G7H A;  4A3B C;  1SMY A;  1HQM A;  3CQZ C;  2PA8 L;  4A3F K;  4MQ9 A;  2WAQ L;  4BY1 C;  4A3J C;  1I6H K;  4A93 C;  3S2D K;  1I50 C;  4A3D C;  3I4M C;  5C4X C;  5C4J C;  3S14 K;  3K7A K;  4BBR C;  5IYB C;  2NVX K;  1TWH K;  5C3E K;  5M3M K;  3GTM C;  2BE5 A;  4QJV B;  4A3M K;  3S16 K;  4Q5S A;  4A3B K;  3CQZ K;  3WOD A;  3GTG C;  4JK1 A;  2R92 C;  4OIR A;  3HOW C;  4MEY A;  4AYB D;  4BY7 C;  4LLG A;  4OIQ A;  4BY1 K;  4A3J K;  3H3V D;  4A3G C;  4A93 K;  1I50 K;  4BXX C;  3GTP C;  5M5X K;  3I4M K;  4A3D K;  5C4X K;  1YNN A;  3PO3 C;  5C4J K;  3HOZ C;  2JA5 C;  3S17 C;  4YFX A;  4BBR K;  5IYB K;  4QIW D;  4BBS C;  4KN7 A;  5M5W K;  3GTM K;  4GZY A;  1Y1V C;  3HOV C;  3GTJ C;  4G7O A;  3GTG K;  2R92 K;  4BY7 K;  3HOW K;  3GTK C;  4Q4Z A;  2YU9 C;  4A3G K;  2PMZ L;  3GTP K;  4BXX K;  5FLM C;  2WB1 L;  3PO3 K;  3HOZ K;  4C3J C;  2B63 C;  2JA5 K;  3S1M C;  3S17 K;  2JA7 C;  1XPP A;  4BBS K;  4A3L C;  5C44 C;  4A3K C;  1ZYR A;  2O5I A;  1Y1V K;  2R93 C;  3GTJ K;  3HOV K;  3S1Q C;  1IW7 A;  2JA8 C;  2VUM C;  3EQL A;  2YU9 K;  4C3H C;  3GTK K;  5FLM K; 
#chains in the Genus database with same CATH topology
 3ADA C;  3H0G C;  3GTQ A;  3TTG A;  3GTO A;  1J6X A;  3PO2 C;  1B4A A;  2JA6 A;  2JA8 K;  4C3H K;  4XLN A;  1TWF C;  3GIR A;  4G0U A;  3AD7 C;  4WFN S;  3ERE D;  1I3Q C;  3H0G K;  1X31 C;  1TWC A;  1WCM A;  3PO2 K;  1YCL A;  2RGR A;  1XZQ B;  3M4O C;  1DCP A;  3LAP A;  2ZUE A;  1C0A A;  1TWF K;  2EBB A;  2E2I A;  5IP7 C;  4MEX A;  4GTE A;  1I3Q K;  5M5Y K;  3RZO C;  1ZVU A;  3FKI C;  4C3I C;  4AYB L;  3SZZ A;  2FQT A;  3H3V L;  5HQH A;  3M4O K;  4WFA S;  2NVQ C;  5IP7 K;  2NVT C;  2V6T A;  1BJT A;  1O2B A;  2CFA B;  1R9T C;  4KC6 A;  4XCH A;  4Y52 C;  3JST A;  3RZO K;  1TWH A;  3FKI K;  4J3N A;  4C3I K;  1BDF A;  3CQZ A;  1IE0 A;  2NVQ K;  1KQ4 A;  2NVT K;  1JVI A;  1R9T K;  3AD9 C;  3HKZ D;  4Y52 K;  4KB4 A;  1B4B A;  3GTM A;  4KAT A;  2Y0S D;  4A3M C;  4G7H A;  1HQM A;  4MQ9 A;  2WAQ L;  1V5V A;  4BY1 C;  4A3J C;  2KPU A;  4A93 C;  4A3D C;  3SZY A;  5C4X C;  5C4J C;  2P8T A;  1DCO A;  4A3M K;  3OEP A;  4Q5S A;  2P5M A;  3GTJ A;  1USM A;  5IOS A;  4BY7 C;  4OIR A;  3L4J A;  4LLG A;  4BY1 K;  4A3J K;  4A93 K;  4A3D K;  2B63 A;  4LOW A;  5C4X K;  1YNN A;  5C4J K;  3HOZ C;  5IOT A;  4KN7 A;  1VLO A;  2R93 A;  1Y1V C;  2VUM A;  4BY7 K;  3S0X A;  3GDZ A;  2YU9 C;  2PMZ L;  1O26 A;  3HOZ K;  4C3J C;  3CAG A;  3S1M C;  1GE9 A;  1ISE A;  2CFA A;  1ZYR A;  1O25 A;  2L5N A;  3GTL A;  1Y1V K;  3S1Q C;  1IW7 A;  2YU9 K;  3AQP A;  1XXB A;  2PA8 D;  4C3J K;  3S1M K;  1K83 C;  4GTD A;  3GEE A;  1Y1W C;  4LR2 A;  3HOY C;  1SFO C;  1ZXO A;  4LK1 A;  3S1Q K;  4P5A A;  4KM8 A;  4ZH4 A;  2ZJP S;  1J6V A;  4GTL A;  1JQW A;  4OIO A;  1K83 K;  2PPB A;  1TWG A;  1Y1W K;  3GTQ C;  2XCR B;  3HOY K;  3GTO C;  3AH5 A;  3ORE A;  1SFO K;  3AD8 C;  3S2H C;  4X6A C;  2JA6 C;  4LJZ A;  2A6H A;  4IOA S;  3DXJ A;  1EFW A;  3I4N C;  5TMC A;  3BP8 C;  3GTQ K;  2WB1 D;  2FQO A;  1TWC C;  2JH3 A;  3GTO K;  1WCM C;  3S2H K;  4G7Z A;  5FJ8 K;  4X6A K;  1PJ7 A;  2JA6 K;  2CW0 A;  1EI6 A;  2E2I C;  3S1R C;  1XXC A;  4KMU A;  4QIW L;  2A6E A;  4WJ3 M;  3I4N K;  2W7V A;  4U67 S;  1TWC K;  1WSR A;  4BLA A;  1WCM K;  5JVG S;  3N3Y A;  5IYD C;  3GEH A;  1YNJ A;  1PJ5 A;  1F93 A;  4O2D A;  1XXA A;  3S1R K;  2E2I K;  1I50 A;  4XSX A;  3S2D C;  1O29 A;  4P9S A;  1WQH A;  1WOP A;  2D6F C;  1TWH C;  5IYD K;  2KXY A;  1EK8 A;  2XCO A;  1BGW A;  1SMY A;  3CQZ C;  4GTB A;  4IOC S;  4WCE S;  3GEI A;  3GTP A;  1DCH A;  4KAR A;  3A8I A;  3S2D K;  2JA5 A;  3TFH A;  5IYB C;  5EGE A;  1TWH K;  4PAA A;  3GTM C;  5M3M K;  1UV7 A;  4QJV B;  1L0W A;  1O2A A;  3CQZ K;  2ZFZ A;  4JK1 A;  3HOW C;  4MEY A;  4AYB D;  5IOR A;  4OIQ A;  3H3V D;  2GSO A;  2JA7 A;  5IYB K;  4BBS C;  3GTM K;  1DD5 A;  4GZY A;  1F7V A;  3GTJ C;  3HOW K;  2B63 C;  4KMH A;  4BBS K;  4A3L C;  5C44 C;  4A3K C;  3Q3Q A;  2R7Z A;  4FM9 A;  3PIO S;  2R93 C;  3LYW A;  3GTJ K;  3N0B A;  4WJ4 A;  2VUM C;  1TWA A;  1O24 A;  2B63 K;  5HL8 A;  1XZQ A;  2E2H A;  2WAQ D;  1O28 A;  4A3L K;  5C44 K;  2E2J C;  4A3K K;  1ZQ1 C;  3HOX C;  4P5B A;  2R93 K;  3GTL C;  3T02 A;  2GSN A;  5HL7 S;  2VUM K;  4G0W A;  4LK0 A;  1O27 A;  1HI9 A;  4DDQ A;  1XZP B;  1EQR A;  2E2J K;  3A8J A;  2A68 A;  5DM7 S;  5D4D A;  3HOX K;  2A69 A;  3GTL K;  2GAH C;  4KB2 A;  2KQ1 A;  4YFN A;  1I6V A;  1WOO A;  3HOU C;  2NVY A;  1JOE A;  1YX2 A;  4C2M C;  4OIN A;  3LPX A;  4ILD A;  5DM6 S;  2PMZ D;  4NOI A;  1TWG C;  4GTC A;  1WOS A;  1IL2 A;  1WSV A;  4G0V A;  4GT9 A;  3HOU K;  3RZD C;  2XCQ A;  4YG2 A;  4KDD A;  4C2M K;  4XLP A;  3A8K A;  5IYC C;  4A3I C;  2NVX A;  1TWG K;  5JVO A;  4WF9 S;  2V6U A;  2YU9 A;  4A3F C;  3OPF A;  2L3U A;  4KMD A;  3RZD K;  1I6H C;  3AQO A;  5IYC K;  5CJ9 A;  4A3I K;  3S14 C;  5TMF A;  3BUE A;  1INN A;  4WIL A;  3S16 C;  4BKW A;  3QX3 A;  3GTG A;  2R92 A;  1RU0 A;  4A3F K;  1WQF A;  1VH2 A;  3VA7 A;  3FOE A;  1I6H K;  1I50 C;  3I4M C;  3S14 K;  4BBR C;  3S16 K;  2ZJR S;  4KAW X;  3WOD A;  3GTK A;  1J6W A;  3TFI A;  4A3G C;  1I50 K;  3GTP C;  4KMA A;  3I4M K;  3PO3 C;  2JA5 C;  1PJ6 A;  3S17 C;  4BBR K;  3L4K A;  4QIW D;  4KM9 A;  5M5W K;  3NUH A;  4RMF A;  1WQG A;  3HOV C;  1J98 A;  1USO A;  4A3G K;  4KAS A;  4M1X A;  3FOF A;  3BP3 A;  3GTP K;  3H0G A;  3PO3 K;  2JA5 K;  4PAB A;  1G51 A;  3S17 K;  2JA7 C;  3DLL S;  1XPP A;  4LQY A;  2O5I A;  3HOV K;  1O2F B;  1VRQ C;  1TWF A;  4BLB A;  1VJE A;  1IBA A;  1I3Q A;  3V4G A;  3PIP S;  2JA7 K;  2R7Z C;  2ZJQ S;  4A3C C;  3HKZ L;  1WIH A;  2O5J A;  1TWA C;  2Y0S L;  2E2H C;  3FKI A;  4IO9 S;  2R7Z K;  3N0C A;  1WOR A;  4A3C K;  4OIP A;  1IQ0 A;  1R9T A;  4A3E C;  1TWA K;  2RH6 A;  3IPJ A;  3CF5 S;  2GAG C;  2E2H K;  4Y7N C;  3S1N C;  3T01 A;  4C45 A;  5JVH S;  5EGH A;  5IP9 C;  4GTF A;  4XSZ A;  2NVY C;  3FHZ A;  4A3E K;  5IOQ A;  1FEU A;  1ZBS A;  4Y7N K;  3M3Y C;  3HXA A;  3S1N K;  4KN4 A;  2ZUF A;  3S15 C;  3GSI A;  5IP9 K;  2Y3P A;  5CHP A;  5M3F K;  2NVY K;  3G4A A;  4QJV A;  3M3Y K;  3K7A C;  3S15 K;  5JFE A;  2NVX C;  5C3E C;  4YFK A;  3MML B;  1BS2 A;  4A3B C;  2PA8 L;  4AH6 A;  4GFQ A;  2V6S A;  2GSU A;  3K7A K;  3T00 A;  2NVX K;  5C3E K;  2BE5 A;  2KWA A;  1Y1V A;  4A3B K;  3GTG C;  2R92 C;  1EH1 A;  4BXX C;  5M5X K;  3G4C A;  4YFX A;  1IS1 A;  1VGX A;  1F9N A;  3TFJ A;  2PHC B;  4GTA A;  1F7U A;  3LAJ A;  4G7O A;  3GTG K;  2R92 K;  1AB4 A;  5E68 A;  3GTK C;  4Q4Z A;  4BXX K;  5FLM C;  2WB1 L;  1K83 A;  1Y1W A;  4FZB A;  5TJ3 A;  1SFO A;  1XZP A;  4WFB S;  2JA8 C;  3EQL A;  3GTK K;  4C3H C;  5L46 A;  5FLM K; 
#chains in the Genus database with same CATH homology
 2PA8 D;  4C3J K;  2B63 K;  3H0G C;  3S1M K;  2WAQ D;  2JA7 K;  1K83 C;  4A3L K;  5C44 K;  2E2J C;  4A3K K;  1Y1W C;  2R7Z C;  3HOY C;  3HOX C;  3PO2 C;  1SFO C;  2R93 K;  3GTL C;  4LK1 A;  3S1Q K;  2JA8 K;  2VUM K;  4A3C C;  4LK0 A;  3HKZ L;  4XLN A;  1TWF C;  4ZH4 A;  4C3H K;  2O5J A;  1TWA C;  4OIO A;  1I3Q C;  3H0G K;  1K83 K;  2Y0S L;  2E2H C;  2PPB A;  2E2J K;  1Y1W K;  3GTQ C;  2A68 A;  3HOY K;  5D4D A;  3GTO C;  3HOX K;  1SFO K;  2R7Z K;  2A69 A;  3S2H C;  3GTL K;  3PO2 K;  4X6A C;  4A3C K;  4YFN A;  2JA6 C;  3M4O C;  1I6V A;  4OIP A;  1TWF K;  5IP7 C;  3HOU C;  4MEX A;  4LJZ A;  2A6H A;  4A3E C;  3DXJ A;  1TWA K;  1I3Q K;  4C2M C;  4OIN A;  3I4N C;  2E2H K;  5TMC A;  5M5Y K;  4Y7N C;  2PMZ D;  3S1N C;  3GTQ K;  2WB1 D;  1TWC C;  1TWG C;  3FKI C;  4NOI A;  3RZO C;  1WCM C;  4C3I C;  3GTO K;  4G7Z A;  3S2H K;  4AYB L;  5FJ8 K;  4X6A K;  3H3V L;  2JA6 K;  3M4O K;  5IP9 C;  2CW0 A;  2NVQ C;  5IP7 K;  2E2I C;  3S1R C;  3HOU K;  4KMU A;  2NVT C;  4A3E K;  4XSZ A;  2NVY C;  3RZD C;  4YG2 A;  1R9T C;  2A6E A;  4QIW L;  4XLP A;  4C2M K;  3I4N K;  5IYC C;  4Y7N K;  3S1N K;  4Y52 C;  4A3I C;  3M3Y C;  1TWC K;  1TWG K;  4KN4 A;  3FKI K;  3S15 C;  1WCM K;  4C3I K;  3RZO K;  5IYD C;  1BDF A;  1YNJ A;  5IP9 K;  2NVQ K;  5M3F K;  2E2I K;  4A3F C;  3S1R K;  2NVT K;  2NVY K;  3RZD K;  1R9T K;  4QJV A;  4XSX A;  1I6H C;  3S2D C;  3HKZ D;  5IYC K;  3M3Y K;  4A3I K;  3S14 C;  4Y52 K;  3K7A C;  5TMF A;  3S15 K;  2NVX C;  1TWH C;  5C3E C;  4YFK A;  5IYD K;  2Y0S D;  4A3M C;  3S16 C;  4G7H A;  4A3B C;  1SMY A;  1HQM A;  3CQZ C;  2PA8 L;  4A3F K;  4MQ9 A;  2WAQ L;  4BY1 C;  4A3J C;  1I6H K;  4A93 C;  3S2D K;  1I50 C;  4A3D C;  3I4M C;  5C4X C;  5C4J C;  3S14 K;  3K7A K;  4BBR C;  5IYB C;  2NVX K;  1TWH K;  5C3E K;  5M3M K;  3GTM C;  2BE5 A;  4QJV B;  4A3M K;  3S16 K;  4Q5S A;  4A3B K;  3CQZ K;  3WOD A;  3GTG C;  4JK1 A;  2R92 C;  4OIR A;  3HOW C;  4MEY A;  4AYB D;  4BY7 C;  4LLG A;  4OIQ A;  4BY1 K;  4A3J K;  3H3V D;  4A3G C;  4A93 K;  1I50 K;  4BXX C;  3GTP C;  5M5X K;  3I4M K;  4A3D K;  5C4X K;  1YNN A;  3PO3 C;  5C4J K;  3HOZ C;  2JA5 C;  3S17 C;  4YFX A;  4BBR K;  5IYB K;  4QIW D;  4BBS C;  4KN7 A;  5M5W K;  3GTM K;  4GZY A;  1Y1V C;  3HOV C;  3GTJ C;  4G7O A;  3GTG K;  2R92 K;  4BY7 K;  3HOW K;  3GTK C;  4Q4Z A;  2YU9 C;  4A3G K;  2PMZ L;  3GTP K;  4BXX K;  5FLM C;  2WB1 L;  3PO3 K;  3HOZ K;  4C3J C;  2B63 C;  2JA5 K;  3S1M C;  3S17 K;  2JA7 C;  1XPP A;  4BBS K;  4A3L C;  5C44 C;  4A3K C;  1ZYR A;  2O5I A;  1Y1V K;  2R93 C;  3GTJ K;  3HOV K;  3S1Q C;  1IW7 A;  2JA8 C;  2VUM C;  3EQL A;  2YU9 K;  4C3H C;  3GTK K;  5FLM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...