4G7ZA

Crystal structure of thermus thermophilus transcription initiation complex containing 5-bru at template-strand position +1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 44
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7zA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7zA01
5M3MK 1YNJA 4A3MC 3S16C 3HOXK 4C3IK 2R7ZK 5M5XK 3H0GC 4A3JK 2JA5C 2NVYK 1SMYA 4QJVB 4A3KC 1YNNA 2PA8L 4ZH4A 4A3EC 5IYCK 4BXXC 4X6AC 3HOYK 3PO2K 2NVXC 5C44C 1ZYRA 1Y1VK 3S2HC 4NOIA 5D4DA 2NVQK 3S1QC 3GTLK 1I6VA 4QIWD 3FKIC 3S14K 1SFOC 5IP9K 4C3HC 4XLNA 5IYDC 4OIPA 2E2JC 4A3FC 3PO3C 3HOXC 3S16K 4OIRA 2O5IA 3S1NK 2R93K 3I4MC 2E2IC 4G7ZA 3HKZL 1BDFA 2Y0SL 4A3GC 1TWCC 2NVTK 3I4NK 4A93C 4A3IK 4A3CC 3GTGK 3GTJK 5C4JC 4MQ9A 4QIWL 4BY7K 4C2MC 3HOZK 4BY1C 4C3JC 4AYBL 4A3DK 2R92C 4JK1A 5IYBK 3HOWK 4LLGA 3HOVK 4A93K 1IW7A 2R93C 3CQZK 4BBRK 3HKZD 2JA8C 2Y0SD 5FLMK 4A3FK 4A3CK 1I3QC 4LK0A 1I6HK 5IP7C 3K7AK 1TWAC 4BBSC 4C2MK 2WAQL 5M5YK 3S1MC 4AYBD 2JA7K 3S2DK 1TWCK 5C44K 3WODA 3GTKK 3CQZC 4BBRC 4A3BK 5TMCA 4GZYA 5C4XC 2NVYC 2JA5K 3I4MK 3S17K 2VUMC 4A3DC 4OIQA 1Y1VC 1I3QK 2A68A 4BY7C 3S1QK 1TWHK 5IYCC 3S14C 2WAQD 2JA8K 3GTMC 2NVTC 1TWFC 3S17C 2NVQC 3S15C 3S2HK 1WCMC 5FLMC 3GTKC 1I6HC 5C3EK 3M4OK 4LJZA 4A3BC 2JA6C 2BE5A 3HOUK 4BY1K 1HQMA 3S1NC 2E2JK 2WB1L 3GTPC 3RZOC 1TWAK 2PMZD 4BBSK 1TWHC 3GTJC 2B63K 4A3GK 3S1RC 4A3IC 2VUMK 4A3EK 3EQLA 4QJVA 4YFKA 3RZDC 4KMUA 5IYBC 1TWGC 1Y1WC 2E2HC 5C4XK 4Y7NK 4XSZA 3H0GK 4A3LC 4OINA 4C3JK 4Y52C 4Q5SA 5M5WK 1R9TK 2R92K 3FKIK 4YG2A 2YU9C 2WB1D 3GTOC 3S1RK 4MEYA 5C3EC 1WCMK 2A69A 3PO3K 2PMZL 5IYDK 1K83C 3K7AC 5M3FK 3GTMK 4OIOA 5IP9C 1SFOK 1I50K 4YFXA 2A6HA 4BXXK 4X6AK 2A6EA 3H3VL 2NVXK 3HOUC 2JA6K 4A3KK 4C3IC 3S2DC 4Y52K 2O5JA 4KN4A 4A3JC 5TMFA 2PPBA 1TWFK 4C3HK 1I50C 3GTLC 4A3MK 1Y1WK 4XSXA 1K83K 5C4JK 3GTQK 3HOYC 1R9TC 2B63C 4MEXA 4G7HA 1XPPA 3GTOK 3GTPK 3I4NC 3M3YK 5FJ8K 4G7OA 3RZOK 3H3VD 4KN7A 3HOWC 4Q4ZA 3DXJA 3HOVC 3RZDK 2E2IK 2R7ZC 4LK1A 4A3LK 1TWGK 3HOZC 2PA8D 3GTQC 3M4OC 2CW0A 3S15K 2JA7C 4YFNA 3M3YC 3GTGC 4Y7NC 2E2HK 3S1MK 5IP7K 4XLPA 3PO2C 2YU9K
chains in the Genus database with same CATH superfamily
3GEIA 4RMFA 5M3MK 2V6SA 3HOXK 1V5VA 1BJTA 3BP8C 2P5MA 1DCHA 4A3EC 4BXXC 1XXCA 3PO2K 1RU0A 5C44C 1PJ7A 3OPFA 2GAHC 1O2AA 1XXBA 1SFOC 4OIPA 3S1NK 1IL2A 2O5IA 2R92A 1ZBSA 5HQHA 2L5NA 4A3IK 3AD9C 1DCPA 1EK8A 2JA7A 3OEPA 4JK1A 1EQRA 1USOA 3CQZK 2JA8C 2Y0SD 2ZJRS 2W7VA 3CQZA 5IORA 1TWGA 5FLMK 1Y1WA 1IQ0A 2KQ1A 5EGEA 1YCLA 5M5YK 5HL8A 4AYBD 1TWCK 3WODA 4A3BK 4GZYA 3QX3A 2GSUA 3S17K 3CF5S 1VLOA 4OIQA 2JA8K 2NVTC 4KM9A 4P5AA 5FLMC 3GTKC 2R7ZA 3T00A 4BY1K 1HQMA 3S1NC 3GTPC 1VH2A 4BBSK 4FM9A 2B63K 1VJEA 3H0GA 4O2DA 4QJVA 1Y1WC 3GSIA 4A3LC 2FQTA 2KXYA 4Y52C 5M5WK 3OREA 4YG2A 2YU9C 2WB1D 1G51A 2JH3A 4MEYA 3N0CA 4GTDA 3GTMA 5IYDK 2GAGC 5M3FK 4OIOA 5IOQA 1IS1A 3Q3QA 2P8TA 4X6AK 2A6EA 3HOUC 1BGWA 2CFAB 4A3KK 1C0AA 4KN4A 3FOFA 4A3JC 2PPBA 3GTLC 4GTLA 4KAWX 3GTQK 3VA7A 1USMA 3M3YK 3GTOK 5FJ8K 1WQFA 1O2FB 5CHPA 2NVXA 2KPUA 2R7ZC 4LK1A 2V6TA 3TFJA 2ZUEA 2JA5A 1B4BA 3M3YC 4Y7NC 4IOAS 5IP7K 1J6WA 1WOPA 4G0WA 1YNJA 4ILDA 1SMYA 2PA8L 1ZXOA 4GTEA 5IYCK 5DM6S 3GTLK 3S1QC 3FKIA 3FKIC 3S14K 5IP9K 4C3HC 3GTLA 3HOXC 4OIRA 3I4MC 2Y0SL 3T01A 1WCMA 4KDDA 3HXAA 3GTJK 2EBBA 4BY7K 1XZQB 3HOZK 1ISEA 4C3JC 3TTGA 4A3DK 4LLGA 1IW7A 2ZJPS 1SFOA 4LK0A 5JVOA 3K7AK 4KMDA 3S1MC 2JA7K 1O25A 4WF9S 1O28A 3PIOS 2FQOA 3GTKK 4KB4A 4BBRC 1UV7A 2JA5K 4G0UA 1WSRA 3GTKA 2ZFZA 4WILA 1I3QK 1Y1VC 3NUHA 3S1QK 1JQWA 2E2IA 2PHCB 1TWFC 4U67S 1WCMC 1I6HC 4WCES 4LJZA 1PJ5A 4J3NA 4KMAA 1EFWA 3GTJC 4BKWA 4A3GK 3S1RC 2VUMK 4A3EK 1XZQA 4XSZA 3TFHA 4OINA 3FHZA 4Q5SA 3S1RK 5IOSA 1WOSA 2A69A 3PO3K 2PMZL 3GTQA 1JOEA 1B4AA 1WQGA 4M1XA 2NVXK 1F7UA 4GT9A 2RH6A 1FEUA 3S2DC 1WIHA 2O5JA 5TMFA 4C3HK 1JVIA 4A3MK 1DCOA 3GTPA 3GEHA 3G4AA 4KC6A 3GTPK 3I4NC 1WQHA 3HOWC 3HOVC 4KM8A 3RZDK 3FOEA 3M4OC 2CW0A 4FZBA 3GTGC 2E2HK 1O24A 1O26A 4KASA 3PO2C 4A3MC 1VGXA 4C3IK 2R7ZK 1GE9A 3GIRA 2NVYK 4QJVB 3HOYK 1YNNA 1O27A 4ZH4A 4GTAA 4X6AC 5DM7S 1TWAA 3S2HC 4NOIA 2NVQK 1I6VA 4XLNA 3JSTA 3PO3C 2E2JC 4P9SA 4A3FC 4AH6A 3LAPA 3S16K 4WJ4A 3A8KA 4BLBA 2E2IC 5IOTA 3HKZL 3GDZA 1HI9A 4WJ3M 1TWCC 4A93C 4A3CC 3GTGK 4MQ9A 1EI6A 3MMLB 2D6FC 3GTGA 3A8JA 5IYBK 3HOWK 3HOVK 4A93K 4BBRK 2R93C 3ADAC 3HKZD 4XCHA 3L4KA 1I3QA 1F9NA 4A3FK 1I3QC 4BBSC 3T02A 4C2MK 4G0VA 1L0WA 3AH5A 5C4XC 2NVYC 4DDQA 1WOOA 3N0BA 1ZVUA 3G4CA 2WAQD 3GTMC 2YU9A 4IO9S 3PIPS 3S17C 2NVQC 3S15C 3AD7C 5C3EK 3S2HK 1ZQ1C 1YX2A 3HOUK 4PABA 2ZUFA 1XZPA 1XXAA 2E2JK 5JVHS 2B63A 3RZOC 2PMZD 1INNA 1TWHC 3N3YA 1TWHA 1I50A 4A3IC 3BP3A 3EQLA 4YFKA 2E2HC 2JA6A 5IYBC 1F93A 2XCQA 5C4XK 3H0GK 4GTCA 2R93A 1R9TK 4WFBS 3FKIK 3GTOC 2KWAA 5C3EC 1KQ4A 1K83A 1K83C 3GTMK 2V6UA 5IP9C 4YFXA 4BXXK 1F7VA 2VUMA 3H3VL 2XCOA 1TWCA 3LAJA 4KATA 3GTJA 1TWFK 1Y1WK 3S0XA 1IBAA 1BS2A 5C4JK 1R9TC 2B63C 1XPPA 4KB2A 4LOWA 3A8IA 1PJ6A 4A3LK 2PA8D 3GTQC 3S15K 4LR2A 2JA7C 3S1MK 1XZPB 3AQPA 1WSVA 5M5XK 1AB4A 2XCRB 3S16C 4WFNS 3H0GC 4A3JK 2JA5C 4A3KC 2NVXC 2Y3PA 1ZYRA 1Y1VK 3IPJA 5D4DA 4GTBA 4QIWD 5JFEA 5L46A 3SZYA 5IYDC 2ZJQS 4IOCS 2R93K 4G7ZA 1BDFA 4A3GC 4PAAA 2NVTK 3I4NK 5JVGS 5C4JC 4QIWL 4C2MC 4BY1C 4LQYA 4AYBL 2R92C 3GTOA 1I6HK 4A3CK 5IP7C 2GSNA 1TWAC 2WAQL 3S2DK 5C44K 3AD8C 3CAGA 1EH1A 1J6XA 3CQZC 2GSOA 5TMCA 1DD5A 3I4MK 3ERED 1J98A 1VRQC 5HL7S 2VUMC 4A3DC 3GEEA 3L4JA 2A68A 2CFAA 4BY7C 1TWHK 5IYCC 3S14C 3SZZA 3M4OK 4A3BC 1X31C 2JA6C 2BE5A 1R9TA 2E2HA 1O29A 2WB1L 4GTFA 4BLAA 1TWAK 1IE0A 3BUEA 3AQOA 2RGRA 3RZDC 4Y7NK 4KMUA 1TWGC 3LYWA 2L3UA 4P5BA 4C3JK 4C45A 3DLLS 1TWFA 2R92K 5E68A 1WCMK 3TFIA 3K7AC 1SFOK 1I50K 2A6HA 1O2BA 4KMHA 3LPXA 2JA6K 4C3IC 4Y52K 1I50C 5TJ3A 5CJ9A 4XSXA 1K83K 1J6VA 3HOYC 4MEXA 4G7HA 3RZOK 4G7OA 3V4GA 3H3VD 4KN7A 4Q4ZA 3DXJA 2E2IK 1TWGK 1WORA 3HOZC 5EGHA 4YFNA 1Y1VA 4KARA 4GFQA 4WFAS 4XLPA 2YU9K 2NVYA
chains in the Genus database with same CATH topology
5M3MK 1YNJA 4A3MC 3S16C 3HOXK 4C3IK 2R7ZK 5M5XK 3H0GC 4A3JK 2JA5C 2NVYK 1SMYA 4QJVB 4A3KC 1YNNA 2PA8L 4ZH4A 4A3EC 5IYCK 4BXXC 4X6AC 3HOYK 3PO2K 2NVXC 5C44C 1ZYRA 1Y1VK 3S2HC 4NOIA 5D4DA 2NVQK 3S1QC 3GTLK 1I6VA 4QIWD 3FKIC 3S14K 1SFOC 5IP9K 4C3HC 4XLNA 5IYDC 4OIPA 2E2JC 4A3FC 3PO3C 3HOXC 3S16K 4OIRA 2O5IA 3S1NK 2R93K 3I4MC 2E2IC 4G7ZA 3HKZL 1BDFA 2Y0SL 4A3GC 1TWCC 2NVTK 3I4NK 4A93C 4A3IK 4A3CC 3GTGK 3GTJK 5C4JC 4MQ9A 4QIWL 4BY7K 4C2MC 3HOZK 4BY1C 4C3JC 4AYBL 4A3DK 2R92C 4JK1A 5IYBK 3HOWK 4LLGA 3HOVK 4A93K 1IW7A 2R93C 3CQZK 4BBRK 3HKZD 2JA8C 2Y0SD 5FLMK 4A3FK 4A3CK 1I3QC 4LK0A 1I6HK 5IP7C 3K7AK 1TWAC 4BBSC 4C2MK 2WAQL 5M5YK 3S1MC 4AYBD 2JA7K 3S2DK 1TWCK 5C44K 3WODA 3GTKK 3CQZC 4BBRC 4A3BK 5TMCA 4GZYA 5C4XC 2NVYC 2JA5K 3I4MK 3S17K 2VUMC 4A3DC 4OIQA 1Y1VC 1I3QK 2A68A 4BY7C 3S1QK 1TWHK 5IYCC 3S14C 2WAQD 2JA8K 3GTMC 2NVTC 1TWFC 3S17C 2NVQC 3S15C 3S2HK 1WCMC 5FLMC 3GTKC 1I6HC 5C3EK 3M4OK 4LJZA 4A3BC 2JA6C 2BE5A 3HOUK 4BY1K 1HQMA 3S1NC 2E2JK 2WB1L 3GTPC 3RZOC 1TWAK 2PMZD 4BBSK 1TWHC 3GTJC 2B63K 4A3GK 3S1RC 4A3IC 2VUMK 4A3EK 3EQLA 4QJVA 4YFKA 3RZDC 4KMUA 5IYBC 1TWGC 1Y1WC 2E2HC 5C4XK 4Y7NK 4XSZA 3H0GK 4A3LC 4OINA 4C3JK 4Y52C 4Q5SA 5M5WK 1R9TK 2R92K 3FKIK 4YG2A 2YU9C 2WB1D 3GTOC 3S1RK 4MEYA 5C3EC 1WCMK 2A69A 3PO3K 2PMZL 5IYDK 1K83C 3K7AC 5M3FK 3GTMK 4OIOA 5IP9C 1SFOK 1I50K 4YFXA 2A6HA 4BXXK 4X6AK 2A6EA 3H3VL 2NVXK 3HOUC 2JA6K 4A3KK 4C3IC 3S2DC 4Y52K 2O5JA 4KN4A 4A3JC 5TMFA 2PPBA 1TWFK 4C3HK 1I50C 3GTLC 4A3MK 1Y1WK 4XSXA 1K83K 5C4JK 3GTQK 3HOYC 1R9TC 2B63C 4MEXA 4G7HA 1XPPA 3GTOK 3GTPK 3I4NC 3M3YK 5FJ8K 4G7OA 3RZOK 3H3VD 4KN7A 3HOWC 4Q4ZA 3DXJA 3HOVC 3RZDK 2E2IK 2R7ZC 4LK1A 4A3LK 1TWGK 3HOZC 2PA8D 3GTQC 3M4OC 2CW0A 3S15K 2JA7C 4YFNA 3M3YC 3GTGC 4Y7NC 2E2HK 3S1MK 5IP7K 4XLPA 3PO2C 2YU9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M K;  1YNJ A;  4A3M C;  3S16 C;  3HOX K;  4C3I K;  2R7Z K;  5M5X K;  3H0G C;  4A3J K;  2JA5 C;  2NVY K;  1SMY A;  4QJV B;  4A3K C;  1YNN A;  2PA8 L;  4ZH4 A;  4A3E C;  5IYC K;  4BXX C;  4X6A C;  3HOY K;  3PO2 K;  2NVX C;  5C44 C;  1ZYR A;  1Y1V K;  3S2H C;  4NOI A;  5D4D A;  2NVQ K;  3S1Q C;  3GTL K;  1I6V A;  4QIW D;  3FKI C;  3S14 K;  1SFO C;  5IP9 K;  4C3H C;  4XLN A;  5IYD C;  4OIP A;  2E2J C;  4A3F C;  3PO3 C;  3HOX C;  3S16 K;  4OIR A;  2O5I A;  3S1N K;  2R93 K;  3I4M C;  2E2I C;  4G7Z A;  3HKZ L;  1BDF A;  2Y0S L;  4A3G C;  1TWC C;  2NVT K;  3I4N K;  4A93 C;  4A3I K;  4A3C C;  3GTG K;  3GTJ K;  5C4J C;  4MQ9 A;  4QIW L;  4BY7 K;  4C2M C;  3HOZ K;  4BY1 C;  4C3J C;  4AYB L;  4A3D K;  2R92 C;  4JK1 A;  5IYB K;  3HOW K;  4LLG A;  3HOV K;  4A93 K;  1IW7 A;  2R93 C;  3CQZ K;  4BBR K;  3HKZ D;  2JA8 C;  2Y0S D;  5FLM K;  4A3F K;  4A3C K;  1I3Q C;  4LK0 A;  1I6H K;  5IP7 C;  3K7A K;  1TWA C;  4BBS C;  4C2M K;  2WAQ L;  5M5Y K;  3S1M C;  4AYB D;  2JA7 K;  3S2D K;  1TWC K;  5C44 K;  3WOD A;  3GTK K;  3CQZ C;  4BBR C;  4A3B K;  5TMC A;  4GZY A;  5C4X C;  2NVY C;  2JA5 K;  3I4M K;  3S17 K;  2VUM C;  4A3D C;  4OIQ A;  1Y1V C;  1I3Q K;  2A68 A;  4BY7 C;  3S1Q K;  1TWH K;  5IYC C;  3S14 C;  2WAQ D;  2JA8 K;  3GTM C;  2NVT C;  1TWF C;  3S17 C;  2NVQ C;  3S15 C;  3S2H K;  1WCM C;  5FLM C;  3GTK C;  1I6H C;  5C3E K;  3M4O K;  4LJZ A;  4A3B C;  2JA6 C;  2BE5 A;  3HOU K;  4BY1 K;  1HQM A;  3S1N C;  2E2J K;  2WB1 L;  3GTP C;  3RZO C;  1TWA K;  2PMZ D;  4BBS K;  1TWH C;  3GTJ C;  2B63 K;  4A3G K;  3S1R C;  4A3I C;  2VUM K;  4A3E K;  3EQL A;  4QJV A;  4YFK A;  3RZD C;  4KMU A;  5IYB C;  1TWG C;  1Y1W C;  2E2H C;  5C4X K;  4Y7N K;  4XSZ A;  3H0G K;  4A3L C;  4OIN A;  4C3J K;  4Y52 C;  4Q5S A;  5M5W K;  1R9T K;  2R92 K;  3FKI K;  4YG2 A;  2YU9 C;  2WB1 D;  3GTO C;  3S1R K;  4MEY A;  5C3E C;  1WCM K;  2A69 A;  3PO3 K;  2PMZ L;  5IYD K;  1K83 C;  3K7A C;  5M3F K;  3GTM K;  4OIO A;  5IP9 C;  1SFO K;  1I50 K;  4YFX A;  2A6H A;  4BXX K;  4X6A K;  2A6E A;  3H3V L;  2NVX K;  3HOU C;  2JA6 K;  4A3K K;  4C3I C;  3S2D C;  4Y52 K;  2O5J A;  4KN4 A;  4A3J C;  5TMF A;  2PPB A;  1TWF K;  4C3H K;  1I50 C;  3GTL C;  4A3M K;  1Y1W K;  4XSX A;  1K83 K;  5C4J K;  3GTQ K;  3HOY C;  1R9T C;  2B63 C;  4MEX A;  4G7H A;  1XPP A;  3GTO K;  3GTP K;  3I4N C;  3M3Y K;  5FJ8 K;  4G7O A;  3RZO K;  3H3V D;  4KN7 A;  3HOW C;  4Q4Z A;  3DXJ A;  3HOV C;  3RZD K;  2E2I K;  2R7Z C;  4LK1 A;  4A3L K;  1TWG K;  3HOZ C;  2PA8 D;  3GTQ C;  3M4O C;  2CW0 A;  3S15 K;  2JA7 C;  4YFN A;  3M3Y C;  3GTG C;  4Y7N C;  2E2H K;  3S1M K;  5IP7 K;  4XLP A;  3PO2 C;  2YU9 K; 
#chains in the Genus database with same CATH topology
 3GEI A;  4RMF A;  5M3M K;  2V6S A;  3HOX K;  1V5V A;  1BJT A;  3BP8 C;  2P5M A;  1DCH A;  4A3E C;  4BXX C;  1XXC A;  3PO2 K;  1RU0 A;  5C44 C;  1PJ7 A;  3OPF A;  2GAH C;  1O2A A;  1XXB A;  1SFO C;  4OIP A;  3S1N K;  1IL2 A;  2O5I A;  2R92 A;  1ZBS A;  5HQH A;  2L5N A;  4A3I K;  3AD9 C;  1DCP A;  1EK8 A;  2JA7 A;  3OEP A;  4JK1 A;  1EQR A;  1USO A;  3CQZ K;  2JA8 C;  2Y0S D;  2ZJR S;  2W7V A;  3CQZ A;  5IOR A;  1TWG A;  5FLM K;  1Y1W A;  1IQ0 A;  2KQ1 A;  5EGE A;  1YCL A;  5M5Y K;  5HL8 A;  4AYB D;  1TWC K;  3WOD A;  4A3B K;  4GZY A;  3QX3 A;  2GSU A;  3S17 K;  3CF5 S;  1VLO A;  4OIQ A;  2JA8 K;  2NVT C;  4KM9 A;  4P5A A;  5FLM C;  3GTK C;  2R7Z A;  3T00 A;  4BY1 K;  1HQM A;  3S1N C;  3GTP C;  1VH2 A;  4BBS K;  4FM9 A;  2B63 K;  1VJE A;  3H0G A;  4O2D A;  4QJV A;  1Y1W C;  3GSI A;  4A3L C;  2FQT A;  2KXY A;  4Y52 C;  5M5W K;  3ORE A;  4YG2 A;  2YU9 C;  2WB1 D;  1G51 A;  2JH3 A;  4MEY A;  3N0C A;  4GTD A;  3GTM A;  5IYD K;  2GAG C;  5M3F K;  4OIO A;  5IOQ A;  1IS1 A;  3Q3Q A;  2P8T A;  4X6A K;  2A6E A;  3HOU C;  1BGW A;  2CFA B;  4A3K K;  1C0A A;  4KN4 A;  3FOF A;  4A3J C;  2PPB A;  3GTL C;  4GTL A;  4KAW X;  3GTQ K;  3VA7 A;  1USM A;  3M3Y K;  3GTO K;  5FJ8 K;  1WQF A;  1O2F B;  5CHP A;  2NVX A;  2KPU A;  2R7Z C;  4LK1 A;  2V6T A;  3TFJ A;  2ZUE A;  2JA5 A;  1B4B A;  3M3Y C;  4Y7N C;  4IOA S;  5IP7 K;  1J6W A;  1WOP A;  4G0W A;  1YNJ A;  4ILD A;  1SMY A;  2PA8 L;  1ZXO A;  4GTE A;  5IYC K;  5DM6 S;  3GTL K;  3S1Q C;  3FKI A;  3FKI C;  3S14 K;  5IP9 K;  4C3H C;  3GTL A;  3HOX C;  4OIR A;  3I4M C;  2Y0S L;  3T01 A;  1WCM A;  4KDD A;  3HXA A;  3GTJ K;  2EBB A;  4BY7 K;  1XZQ B;  3HOZ K;  1ISE A;  4C3J C;  3TTG A;  4A3D K;  4LLG A;  1IW7 A;  2ZJP S;  1SFO A;  4LK0 A;  5JVO A;  3K7A K;  4KMD A;  3S1M C;  2JA7 K;  1O25 A;  4WF9 S;  1O28 A;  3PIO S;  2FQO A;  3GTK K;  4KB4 A;  4BBR C;  1UV7 A;  2JA5 K;  4G0U A;  1WSR A;  3GTK A;  2ZFZ A;  4WIL A;  1I3Q K;  1Y1V C;  3NUH A;  3S1Q K;  1JQW A;  2E2I A;  2PHC B;  1TWF C;  4U67 S;  1WCM C;  1I6H C;  4WCE S;  4LJZ A;  1PJ5 A;  4J3N A;  4KMA A;  1EFW A;  3GTJ C;  4BKW A;  4A3G K;  3S1R C;  2VUM K;  4A3E K;  1XZQ A;  4XSZ A;  3TFH A;  4OIN A;  3FHZ A;  4Q5S A;  3S1R K;  5IOS A;  1WOS A;  2A69 A;  3PO3 K;  2PMZ L;  3GTQ A;  1JOE A;  1B4A A;  1WQG A;  4M1X A;  2NVX K;  1F7U A;  4GT9 A;  2RH6 A;  1FEU A;  3S2D C;  1WIH A;  2O5J A;  5TMF A;  4C3H K;  1JVI A;  4A3M K;  1DCO A;  3GTP A;  3GEH A;  3G4A A;  4KC6 A;  3GTP K;  3I4N C;  1WQH A;  3HOW C;  3HOV C;  4KM8 A;  3RZD K;  3FOE A;  3M4O C;  2CW0 A;  4FZB A;  3GTG C;  2E2H K;  1O24 A;  1O26 A;  4KAS A;  3PO2 C;  4A3M C;  1VGX A;  4C3I K;  2R7Z K;  1GE9 A;  3GIR A;  2NVY K;  4QJV B;  3HOY K;  1YNN A;  1O27 A;  4ZH4 A;  4GTA A;  4X6A C;  5DM7 S;  1TWA A;  3S2H C;  4NOI A;  2NVQ K;  1I6V A;  4XLN A;  3JST A;  3PO3 C;  2E2J C;  4P9S A;  4A3F C;  4AH6 A;  3LAP A;  3S16 K;  4WJ4 A;  3A8K A;  4BLB A;  2E2I C;  5IOT A;  3HKZ L;  3GDZ A;  1HI9 A;  4WJ3 M;  1TWC C;  4A93 C;  4A3C C;  3GTG K;  4MQ9 A;  1EI6 A;  3MML B;  2D6F C;  3GTG A;  3A8J A;  5IYB K;  3HOW K;  3HOV K;  4A93 K;  4BBR K;  2R93 C;  3ADA C;  3HKZ D;  4XCH A;  3L4K A;  1I3Q A;  1F9N A;  4A3F K;  1I3Q C;  4BBS C;  3T02 A;  4C2M K;  4G0V A;  1L0W A;  3AH5 A;  5C4X C;  2NVY C;  4DDQ A;  1WOO A;  3N0B A;  1ZVU A;  3G4C A;  2WAQ D;  3GTM C;  2YU9 A;  4IO9 S;  3PIP S;  3S17 C;  2NVQ C;  3S15 C;  3AD7 C;  5C3E K;  3S2H K;  1ZQ1 C;  1YX2 A;  3HOU K;  4PAB A;  2ZUF A;  1XZP A;  1XXA A;  2E2J K;  5JVH S;  2B63 A;  3RZO C;  2PMZ D;  1INN A;  1TWH C;  3N3Y A;  1TWH A;  1I50 A;  4A3I C;  3BP3 A;  3EQL A;  4YFK A;  2E2H C;  2JA6 A;  5IYB C;  1F93 A;  2XCQ A;  5C4X K;  3H0G K;  4GTC A;  2R93 A;  1R9T K;  4WFB S;  3FKI K;  3GTO C;  2KWA A;  5C3E C;  1KQ4 A;  1K83 A;  1K83 C;  3GTM K;  2V6U A;  5IP9 C;  4YFX A;  4BXX K;  1F7V A;  2VUM A;  3H3V L;  2XCO A;  1TWC A;  3LAJ A;  4KAT A;  3GTJ A;  1TWF K;  1Y1W K;  3S0X A;  1IBA A;  1BS2 A;  5C4J K;  1R9T C;  2B63 C;  1XPP A;  4KB2 A;  4LOW A;  3A8I A;  1PJ6 A;  4A3L K;  2PA8 D;  3GTQ C;  3S15 K;  4LR2 A;  2JA7 C;  3S1M K;  1XZP B;  3AQP A;  1WSV A;  5M5X K;  1AB4 A;  2XCR B;  3S16 C;  4WFN S;  3H0G C;  4A3J K;  2JA5 C;  4A3K C;  2NVX C;  2Y3P A;  1ZYR A;  1Y1V K;  3IPJ A;  5D4D A;  4GTB A;  4QIW D;  5JFE A;  5L46 A;  3SZY A;  5IYD C;  2ZJQ S;  4IOC S;  2R93 K;  4G7Z A;  1BDF A;  4A3G C;  4PAA A;  2NVT K;  3I4N K;  5JVG S;  5C4J C;  4QIW L;  4C2M C;  4BY1 C;  4LQY A;  4AYB L;  2R92 C;  3GTO A;  1I6H K;  4A3C K;  5IP7 C;  2GSN A;  1TWA C;  2WAQ L;  3S2D K;  5C44 K;  3AD8 C;  3CAG A;  1EH1 A;  1J6X A;  3CQZ C;  2GSO A;  5TMC A;  1DD5 A;  3I4M K;  3ERE D;  1J98 A;  1VRQ C;  5HL7 S;  2VUM C;  4A3D C;  3GEE A;  3L4J A;  2A68 A;  2CFA A;  4BY7 C;  1TWH K;  5IYC C;  3S14 C;  3SZZ A;  3M4O K;  4A3B C;  1X31 C;  2JA6 C;  2BE5 A;  1R9T A;  2E2H A;  1O29 A;  2WB1 L;  4GTF A;  4BLA A;  1TWA K;  1IE0 A;  3BUE A;  3AQO A;  2RGR A;  3RZD C;  4Y7N K;  4KMU A;  1TWG C;  3LYW A;  2L3U A;  4P5B A;  4C3J K;  4C45 A;  3DLL S;  1TWF A;  2R92 K;  5E68 A;  1WCM K;  3TFI A;  3K7A C;  1SFO K;  1I50 K;  2A6H A;  1O2B A;  4KMH A;  3LPX A;  2JA6 K;  4C3I C;  4Y52 K;  1I50 C;  5TJ3 A;  5CJ9 A;  4XSX A;  1K83 K;  1J6V A;  3HOY C;  4MEX A;  4G7H A;  3RZO K;  4G7O A;  3V4G A;  3H3V D;  4KN7 A;  4Q4Z A;  3DXJ A;  2E2I K;  1TWG K;  1WOR A;  3HOZ C;  5EGH A;  4YFN A;  1Y1V A;  4KAR A;  4GFQ A;  4WFA S;  4XLP A;  2YU9 K;  2NVY A; 
#chains in the Genus database with same CATH homology
 5M3M K;  1YNJ A;  4A3M C;  3S16 C;  3HOX K;  4C3I K;  2R7Z K;  5M5X K;  3H0G C;  4A3J K;  2JA5 C;  2NVY K;  1SMY A;  4QJV B;  4A3K C;  1YNN A;  2PA8 L;  4ZH4 A;  4A3E C;  5IYC K;  4BXX C;  4X6A C;  3HOY K;  3PO2 K;  2NVX C;  5C44 C;  1ZYR A;  1Y1V K;  3S2H C;  4NOI A;  5D4D A;  2NVQ K;  3S1Q C;  3GTL K;  1I6V A;  4QIW D;  3FKI C;  3S14 K;  1SFO C;  5IP9 K;  4C3H C;  4XLN A;  5IYD C;  4OIP A;  2E2J C;  4A3F C;  3PO3 C;  3HOX C;  3S16 K;  4OIR A;  2O5I A;  3S1N K;  2R93 K;  3I4M C;  2E2I C;  4G7Z A;  3HKZ L;  1BDF A;  2Y0S L;  4A3G C;  1TWC C;  2NVT K;  3I4N K;  4A93 C;  4A3I K;  4A3C C;  3GTG K;  3GTJ K;  5C4J C;  4MQ9 A;  4QIW L;  4BY7 K;  4C2M C;  3HOZ K;  4BY1 C;  4C3J C;  4AYB L;  4A3D K;  2R92 C;  4JK1 A;  5IYB K;  3HOW K;  4LLG A;  3HOV K;  4A93 K;  1IW7 A;  2R93 C;  3CQZ K;  4BBR K;  3HKZ D;  2JA8 C;  2Y0S D;  5FLM K;  4A3F K;  4A3C K;  1I3Q C;  4LK0 A;  1I6H K;  5IP7 C;  3K7A K;  1TWA C;  4BBS C;  4C2M K;  2WAQ L;  5M5Y K;  3S1M C;  4AYB D;  2JA7 K;  3S2D K;  1TWC K;  5C44 K;  3WOD A;  3GTK K;  3CQZ C;  4BBR C;  4A3B K;  5TMC A;  4GZY A;  5C4X C;  2NVY C;  2JA5 K;  3I4M K;  3S17 K;  2VUM C;  4A3D C;  4OIQ A;  1Y1V C;  1I3Q K;  2A68 A;  4BY7 C;  3S1Q K;  1TWH K;  5IYC C;  3S14 C;  2WAQ D;  2JA8 K;  3GTM C;  2NVT C;  1TWF C;  3S17 C;  2NVQ C;  3S15 C;  3S2H K;  1WCM C;  5FLM C;  3GTK C;  1I6H C;  5C3E K;  3M4O K;  4LJZ A;  4A3B C;  2JA6 C;  2BE5 A;  3HOU K;  4BY1 K;  1HQM A;  3S1N C;  2E2J K;  2WB1 L;  3GTP C;  3RZO C;  1TWA K;  2PMZ D;  4BBS K;  1TWH C;  3GTJ C;  2B63 K;  4A3G K;  3S1R C;  4A3I C;  2VUM K;  4A3E K;  3EQL A;  4QJV A;  4YFK A;  3RZD C;  4KMU A;  5IYB C;  1TWG C;  1Y1W C;  2E2H C;  5C4X K;  4Y7N K;  4XSZ A;  3H0G K;  4A3L C;  4OIN A;  4C3J K;  4Y52 C;  4Q5S A;  5M5W K;  1R9T K;  2R92 K;  3FKI K;  4YG2 A;  2YU9 C;  2WB1 D;  3GTO C;  3S1R K;  4MEY A;  5C3E C;  1WCM K;  2A69 A;  3PO3 K;  2PMZ L;  5IYD K;  1K83 C;  3K7A C;  5M3F K;  3GTM K;  4OIO A;  5IP9 C;  1SFO K;  1I50 K;  4YFX A;  2A6H A;  4BXX K;  4X6A K;  2A6E A;  3H3V L;  2NVX K;  3HOU C;  2JA6 K;  4A3K K;  4C3I C;  3S2D C;  4Y52 K;  2O5J A;  4KN4 A;  4A3J C;  5TMF A;  2PPB A;  1TWF K;  4C3H K;  1I50 C;  3GTL C;  4A3M K;  1Y1W K;  4XSX A;  1K83 K;  5C4J K;  3GTQ K;  3HOY C;  1R9T C;  2B63 C;  4MEX A;  4G7H A;  1XPP A;  3GTO K;  3GTP K;  3I4N C;  3M3Y K;  5FJ8 K;  4G7O A;  3RZO K;  3H3V D;  4KN7 A;  3HOW C;  4Q4Z A;  3DXJ A;  3HOV C;  3RZD K;  2E2I K;  2R7Z C;  4LK1 A;  4A3L K;  1TWG K;  3HOZ C;  2PA8 D;  3GTQ C;  3M4O C;  2CW0 A;  3S15 K;  2JA7 C;  4YFN A;  3M3Y C;  3GTG C;  4Y7N C;  2E2H K;  3S1M K;  5IP7 K;  4XLP A;  3PO2 C;  2YU9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...