4G82A

Crystal structure of p73 dna-binding domain tetramer bound to a full response-element
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
201
Chain Sequence
b'HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein p73
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element
rcsb
total genus 37
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g82A00
5A7BA 3QYMA 3WTUA 3D06A 3D05A 4L0YA 2J20A 2J1ZA 5AB9A 4KVPA 4LOFA 4GUOA 1CO1A 1EAOA 4IBQA 2XWCA 5G4MA 2BIOA 2H1LM 3TS8A 1TUPA 3D07A 4IBWA 1E50A 2X0VA 3IGKA 4IBSA 4QO1B 4AGNA 4AGLA 3D0AA 1HJBC 2J1YA 1IO4C 1KZYA 4AGPA 2PCXA 5AOKA 2J1WA 3WTWA 4IBYA 4AGMA 2MEJB 2XWRA 5LAPA 2J1XA 2IOOA 2VUKA 3WU1A 4AGQA 3VD1A 2AC0A 5AOMA 2IOMA 3WTXA 1LJMA 1EANA 1T4WA 3Q05A 2FEJA 4IBZA 4IBTA 3Q06A 3IGLA 4IBVA 1UOLA 3US1A 4L0ZA 2X0WA 1GZHC 3WTSA 3KMDA 5G4NA 2X0UA 1GZHA 5BUAA 1YCSA 2RMNA 4A63A 4LO9A 3WTVA 4LOEA 3EXLA 5AOLA 4MZRA 2J21A 3WTYA 2BINA 2ADYA 3QYNA 2GEQA 3ZMEA 4IBUA 5ABAA 2BIPA 4XR8C 3US0A 1CMOA 4G82A 1H9DA 2BIQA 3EXJA 3VD0A 2AHIA 3KZ8A 4MZIA 4G83A 1TSRA 2J6WA 3D08A 1HU8A 2OCJA 2YBGA 3Q01A 3VD2A 5KBDA 4HJEA 3D09A 4IJTA 4GUQA 2P52A 5G4OA 2IOIA 3WTTA 5LGYA 1EAQA 2ATAA 1HJCA 5AOIA 4AGOA 2BIMA 5AOJA 5ECGA 4L18A 2WGXA
chains in the Genus database with same CATH superfamily
1LP9A 4EQ3A 3OVUB 4CL7A 4LVNC 3CFDA 4GQZA 4R2GB 1E4XI 4ZRGA 4AJ0A 4BUHA 1D9KB 1CLYH 3MRQB 4CSTA 2BXYA 5D7LA 4PJXF 1KZQA 4PWHA 3FHAA 5B3JE 3WIHL 3FFCD 1G9MH 4P2RD 1A7OL 3T4AB 4DK6A 3HE6A 3MBXH 4OQ1A 3NG5A 2NY6B 3CFJB 4NQDE 2BNQB 3RFZC 3AG1B 5SX4I 1AQ8A 1TZGH 1E6JH 2VXUH 1DEEB 3L5WA 3QUZC 5C0AE 5I73B 3S35L 2BS8A 1TPXC 1FG2B 4RFEB 4BK5A 5AB0A 1FV1B 3D3VD 3F8UB 3V4VL 4LGRB 4PLJC 3CE1A 1J9SA 4JM2B 4PTUA 5JXAL 3IFNL 3A67H 5HDOA 2DQDH 3WDJA 4L5FL 4M48H 4ODBD 4CSPA 4KTYA 5T3ZD 1TETL 2VDOL 5C92A 2FBOJ 2FX8L 2J43A 4QRPD 4BUGA 1PVHA 2ENJA 1K72A 5LAPA 4Z3JA 4JRXE 5LG1A 1NOAA 1HQ4A 2TRHA 4M8RA 2I27N 3NGBB 2HVKB 5DJXA 4YSDA 3V9FA 3WY4A 1Q1PA 5D6CA 4D2NA 2WO2B 1UOLA 1P6WA 2UX6A 3I9GH 4X7SL 4APQB 3WCYA 1MJ8L 2MHAB 1PZ5B 1MLBA 5I8CA 4CVWA 1J5OL 2BVQB 4N24A 3ZDXB 1CDIA 2OX5B 1R6VA 4ELME 1C12A 5AYTA 3RVVC 1PQZB 2E27H 5I23A 4FQLL 1YNLL 3CSYA 1OP5H 2EXSA 1WAAE 3QHFH 4KDTA 1VACA 3OR7A 4FULA 1KULA 4AT6A 2WVVB 4FFZL 5AAMC 4E2OA 2AW2A 4PJBE 5LWYL 1K4DB 1C5DA 3FU0A 3NZ8B 3V6FB 5E5RB 5I1LB 2DYRB 1SNRA 1XXFC 1FNFA 3P3TA 3GSRB 4KK5D 1LNUA 4NQCA 1DDHB 2EDJA 5FYJE 4ETQA 3K2IA 1KJ2H 3MV8B 1AP2B 3BGAA 2XTJB 4XP4H 5C0AA 3PP3H 2WKLA 1AE6L 2VW7A 4YX2L 4AIZA 2ZG3A 5D55A 3RDTC 5CN2A 5ERWB 5IV2A 2WOYA 5D7JB 4NZRH 3US9A 4GXUM 1I7ZB 2JMRA 3V4VA 1ACXA 5C0RL 5DMGD 1NUFA 4MAYB 4PBWD 4KJQD 5JNYA 1LK3L 4I4WA 4K07A 4KBPA 3KW8A 4HHAB 1ZMYA 3IPFA 5H35B 3AAZB 2D2CC 4XNYH 4Y4FC 3UOAB 4U6VL 5EN2B 1RPKA 4JAMB 5DVNA 2VR7A 2PPDA 2CO3A 2XPZA 3IE4A 1B6DA 3P0VH 1R5WA 2G60H 3OKLB 5AB9A 4OM1H 4HJGB 2R69H 5IFAH 2M8XA 5JTWA 1OAQL 1VEPA 4LIQH 4F7EA 1K4DA 1CF8H 1U8MA 2F1AA 2X4SB 3CDFA 1EGJL 5TDOA 3E6FB 1KCUL 4GS7C 4ENEC 1ES0A 2DKUA 3AXLB 4NT6A 2Z7UA 3T0EA 2O5XH 5KSUA 4D9QD 3UBGA 3U0PA 2A6IA 5JHDE 4ZTOL 3L5XH 3ALPA 2ADJA 2ZCHH 2X7LA 2BP3A 4M29A 3TZVD 4HT1H 4YL4A 1UWXH 3WNIA 2ZOWA 5B1KA 2IQ9L 3RIAK 5IHHA 1AGDB 3BJLA 4X8JB 5DEFA 3CUPB 5C0BD 1MLCA 4HWEH 4K55A 5D1ZA 5GS1C 1UA6L 2FWLB 4AVHA 4E0RA 1NGZB 3D3VE 3EGXB 3DVGA 3GSOA 4QHMB 5DURB 3IPBA 1A25A 3X3GL 4F9LC 2FH8A 2GSGB 3GZPA 4M5TA 4C47A 2UZPA 4BQ8A 1S3KL 2F18A 3QIUC 2TSAA 1FSKB 2VWEC 1QQDB 4BZ2A 5C0BA 4Z7OF 2BY2A 1WBYA 2HX7A 3S48A 1T20A 4X8GA 3FB5A 2P8MA 1I3RA 5BUAA 1THCA 4ZTEA 2AEIT 2YD2A 4X4KA 2W95A 3D52A 4HA1A 4NHCL 4NKOA 4XVTH 5GSRA 3VG0H 4MCZA 2GEQA 4PRIE 3QPXH 1IC5L 2IWGA 5TFSH 1TQBB 4KDWA 1BW8A 2BIQA 4HPHA 3GRGA 5EC1A 3QDGE 5KVFL 4ELDA 4N2IA 3U0TA 1HE8A 2DM2A 4NQDB 5D1XD 1F18A 3QUGA 1S7QA 4JG0L 1IGCH 2FJSA 4PS3A 4H20L 1BMWA 2EABA 4K94C 4PJAA 2Z7WA 2OI9C 4NYLB 4K7FA 1UFUA 2VH5L 3F12B 4DVRH 5IK3A 1I3GL 1JVKA 4MJHA 4UQCA 1S7TA 3HZVA 3FB6A 4ODXB 1A4AA 1OOWA 1S5IH 3RWGB 3FSWA 3BKYL 5FYLE 2WY3B 4EPSA 5TF0A 4FE9A 3QG7H 5K59F 1CDUA 4PMEA 5E8PB 1SJEB 1BQSA 1Y6NR 4JCMA 1FDLH 1Q90A 4FN0A 2ZICA 1WITA 3AS1A 3V95A 1NC4A 5SX4H 1KBKA 4GSRA 5J57B 2L7EA 3TWYA 3QEHA 3LKQA 1S3RA 4M7JL 5T1MA 2DLFH 3NACH 3ESOA 5IHZB 4NQCB 5FYKL 1GCYA 1EEZB 3GSNA 4QY8B 3GIVA 1YEGH 5EOCJ 1EJ8A 3KL3A 1H3PL 2VLKD 4KRNA 5IFJA 3R4DA 3OJ2C 5E6UB 1RUKL 4NO0A 3VSTA 4I85A 5E8NA 5IMOA 4F93B 4XWGL 4XX1G 1L5GB 2GFBA 4N90E 2AABH 3EJYC 1IM3A 3V0DA 3LKSB 4Q6IC 2VLLA 5KTEH 3LSOA 3JTTA 1K3IA 2WQXA 2GCYA 1XGQB 5DO2D 1HJBC 1UM5H 1AY1L 2FB4H 3NCJH 3S8GB 5AOZA 4KZEL 3DSNA 4HKBB 5EEXA 1YY8A 2AK1L 4N2LA 4AQAA 5MEPA 3QCVL 4J3XA 2IAMA 1VCAA 2MWCA 1K5NB 3UAEA 4FYQA 4WHYH 5AVVB 3SO3C 3S8FB 5CJQH 1FIEA 3PP3K 1BQHB 4QUOA 4BJLA 4EZLA 4MDIB 3DHUA 1X5IA 3US1A 1P9MC 4LAQL 4OCSL 4PB0L 2V5TA 3FN0H 4YO0B 3GRWL 4UTBH 7FABL 4QCIA 3REWB 3VXRE 4AJYV 4KRPD 4QRPA 5L8LB 1N8OE 2F61A 3BT2L 3BSZH 5AEAA 4AW7A 2OMYA 4NWUL 3UXFA 1BECA 4N8VB 1YMHA 2HRPH 4LO9A 3D2UB 4GQPH 4PJ5D 4JX0A 3MGOB 2Z7ZA 1QSZA 3H9SE 3PDGA 2V5SA 1D5RA 3AWEA 3E1F1 4F7MB 5CU5A 4DKEL 3TJEH 3L3OB 4PWGA 3STZA 2QR0A 1JK8B 3SO3B 1CMOA 3A6CH 1G84A 2EDOA 1MHHB 5JDSB 4ZOAA 3Q1EA 5IVZB 3GSXA 3ULUE 1OKEA 2EECA 3O9WB 1UURA 3PCYA 1OZUA 4P2AA 2HFGL 2P7TA 3I9AA 2QGBA 1XIWB 2J25A 3W5MA 2AJVL 3ZJAA 2BOCA 2MPAH 2PW2B 4FFWD 2Q8AL 4NBXB 3VQLA 4IOFC 2WZAA 4AH2B 1DEEA 3L5WB 1HDMB 1PMYA 4PBDA 4WFEE 3KL5A 2Z31C 1LLAA 5HHPB 3RI5F 3BSZA 2B16A 5IW1B 4JO1H 2W0PA 3C87A 5C08E 1SEQH 5E1QA 1UYWL 1I3RB 5IJDC 4GQ9L 2YRLA 1E4WL 2XQBL 2Y07L 4UTAH 1JBJA 2LU3A 3IXAB 4H1LH 2F8IA 1XGRA 3Q8FA 4AVIA 1RIVH 2OV0A 1OGAA 4GS7B 5A1AA 5DZNA 1U8QA 4KNTA 3ZQ9A 4BQBA 3K6SA 3FMGL 5F8RC 2R39A 1ZA6B 1E9PB 5ALCH 4PREB 3ZQXA 1RZIB 5ABDE 2ATKA 4MCMA 2GEEA 3V6OE 3V0HA 2TRYA 3OAUL 5FYLD 3DX8B 1UKSA 4XNMB 5B3JF 2JCCB 4BFIA 1DQVA 1ZIBA 4YX2H 1X9RA 2AK4B 1I85C 3PRZA 4XNDA 3P4MA 1OCWH 2NNXA 2QPFA 5JXEA 2EVFA 1WZLA 1M9SA 1NIFA 3RUGF 1P69B 5JW4M 1AO7D 1I9EA 5DD3L 3HC2A 1RZPA 1GW6A 3LKNA 2DQJH 3VM7A 3R06B 2ZAIA 1JAEA 5T1LA 2HCZX 2E9WA 3VJ6B 3RZCC 2ITDB 4XZUB 3IDJB 4KKLD 4LEEA 3BGMB 5I2IA 3M07A 2XWRA 4G6AC 3FUFA 4TTDC 2WBJB 1EZSA 4JRLA 3RIAF 2Y69B 3X11B 4Q0XH 4A2MA 1RZ8A 1JI2A 4K23L 2AV7B 1ET5A 1SLXA 3RNKA 3T8MA 4M3KB 2V33A 1QTSA 1N8ZA 3IDMB 3Q13A 2WKOF 1XGUA 4MD4B 4XXWA 5ACMA 4Q9CA 1L9OA 2FUQA 2HVJB 2NY2B 3QZWG 4ZK8A 5T5NF 3Q48A 2CH8A 3GHBH 3VFUB 4Z3HA 3KDPB 3T3ME 5HPMA 3J2PA 1V7NL 4KXZI 4YO0A 1B0IA 4HH9B 3ZRSA 2DQGH 2IBGA 1SN0A 3P54A 2CA3A 4IHOA 3FRPG 2NW3A 1FL6B 2F19H 2ADFL 2FLMA 1CB4A 3RE0A 5HYJD 1BF8A 4XPTL 1FNEB 5EEYA 4LSSH 2VXTH 2Q20A 2B15A 3D2UA 1ZVNA 3ZE2B 4OJYA 4B9IA 5C9JB 1U3HD 1U3JA 4RQQB 5CCJA 5I6XB 5C0AB 3QJQB 4XP9L 4KKAD 2PW1A 2CGRH 4NLHA 2VISB 1JK8A 4NQCE 4MDRA 4TL5A 5IHBA 1WCQA 1JZIA 4PI0A 5IIEB 3V4VH 1PLAA 2DD8L 1FNSH 3AMLA 3HC4L 1MN4A 5EUKA 2WBWB 2ZCZA 35C8L 3LZFL 1S7WB 1MFBL 4U4BA 2OS7A 5TDOB 4OM1L 5FB8A 4WFFE 2X12A 4YMPA 4Z7WB 3G5WA 1WUNT 3NVQA 3EYQD 4TN9A 3T5WA 3DX9A 2B0SL 1K9TA 2CO7B 3BW9A 3V0JA 2XZAH 2AQ1A 2DF3A 2H6PA 3QQDB 4IRZL 3NJJA 1DQQA 3O6FB 1HT6A 1T1ZA 3OQ3B 3RFZB 3MJ9A 3Q9PA 5IHUL 5JIDA 4J2QA 1IAIH 5JIIA 2VLKB 3TNMA 3ARBA 3MCLH 5GS2D 1MCWM 1IQWL 5CLWA 4RQQA 1AVAA 4NNPH 1U8OA 3VXRB 1ONQB 5IHZA 2ZYIA 1Q72H 2NX5A 1QZ1A 2VSCA 5TE6L 3KPTA 3GZQA 4MD5B 4HX1B 4G8AC 4NN6B 3MNVB 3TH3T 1BX2A 3QQ3B 1A1NB 1TR7A 4N0CD 4DP4X 1LNUB 1XH3A 4FXKC 1AJ7H 2RQEA 2WZ6A 4XX1E 4DVBA 4MVBC 1BP3B 5CGYC 5T1DH 5FF6A 5E9DB 2BDNL 1M1XB 4KTGA 5FW6A 5BW7C 2QT6A 2F8XC 2GJPA 1QUNA 1RIUL 1DR9A 1XGZA 3R06A 5DD5H 5EUOB 5F89B 2WLJA 2XA8H 1WFNA 3H2PA 2WSPA 3O4LA 1IQDA 3MGTB 2MCPL 4ZFGH 2WBJD 4QTIL 4FI6A 3ARDB 3U0WL 3MLVL 3PY9A 4IBTA 2YFNA 1NCBL 4S11A 3MUY1 3GSWA 5I16A 3D4CA 3ARZA 3TXAA 3BP6A 2QLVB 3CFMA 2YMXH 2VDMB 1VF5C 1M7UA 2DWEA 1A14L 1YRKA 3QWQB 4ODUA 3TZVA 3FUMA 2CA4A 5FCUH 5D70H 1WWBX 1HCFX 2CU9A 1R3JB 4KJWC 1QWHA 1YCSA 5E4EB 1OGTB 1DBMH 2VN5A 2IQAA 2QVMA 4MXQD 1MPAL 1YEFL 2DQCH 3V0VA 4P4KC 1LO3H 3QNZB 1OT4A 3TPUB 3H9YA 3QWRD 3SBRA 3T6ZA 3CPLA 1QFHA 2FL5A 2UUDH 4UT9A 1TYJA 3T2NH 4R5TA 3I3DA 5IBUG 3OHXB 4HGKC 4PP2B 1O0VA 2ESVE 4NO2B 5KYUB 3GGWA 1CPUA 5I76A 2APWA 1AD0B 3QARA 4PTUB 2YKKA 3S3DB 3O0RH 3AACA 3M17A 3P4NB 5JQ6H 3O4OC 1U58B 1MCPH 3DURA 4HUUB 3QORD 5GGTL 1T2JA 4CVUA 3GXPA 1GJUA 1B0GB 5AW1B 1NFIB 3LRMA 3GKWH 3RIKA 1G9ML 1REIA 2BOCB 5F3BB 2VW4A 1T4KB 3G5YA 1KN2H 5CEYB 2CKBH 4XP6L 3Q9QA 5TDPB 3PV7A 3I85A 3T0VA 5FV2A 2K9FB 4AGOA 1D2PA 1CFBA 4GBXB 4PJIE 2CR3A 1RY7B 2LU5A 1U92A 5C3IA 1PIFA 4PV9A 5IBTL 1NGXA 2F7OA 3LS4L 4QXVA 3VWKB 5D7JA 3QZBA 3FJTA 3I6LE 2RD0A 2VO8A 4UT6H 6FABH 1CIDA 1MNUL 4KVPA 4X7CC 3NPZB 2ENQA 2ZYSA 2IFGA 3EFOB 3D25A 1UWXK 3QIBA 1BIIB 3IXTB 3PQYE 3L95A 3WE6B 2O93L 5KUKA 1JWMB 3V10A 4Q8BA 2ZG2A 4L4VA 3V5DA 1RMFH 5EBWA 1GPOH 4N0UE 3UTQB 3IETA 4P9ML 1AZCA 3OLIA 3HR5A 1RHHB 1RZGA 4FNQA 1XAUA 1S7UB 2DBLL 3PWNA 1CZ8H 2F58H 2F15A 5KZCB 2Z35B 4A1RA 5CD5D 3QP3A 3NCYP 1SOXA 4H44C 2R0ZH 5BUPA 1DVYA 3JUZA 5DJ8B 2E8ZA 2NXZC 2NSQA 2WXNA 4JQIH 2P45B 2Y1AA 1PZ3A 3ZZLA 4DQAA 4RMBA 3TIEB 1PZBA 2Y7OA 2DQUH 3F7QA 2Q8BH 2O61A 3FFCB 4P2RB 5IROD 3MYZA 1U8HA 5EZOL 2NUPA 4QMEA 1J05A 3MYJB 1UKTA 2A99A 3NIDE 1XGYH 1KTLA 5LO7A 3L3DA 4RDBA 4I9XA 3S2AA 1ZPLA 3EYUL 4G8EA 3HN3A 4PJ7E 4QRRE 3MRFA 2OL3H 4JHAL 4POZD 1FFQA 5TTRA 5ESVA 1FJ1A 2CBMA 3O8XD 5FOBA 2VL5B 4UILL 1QRNE 2F9BT 3MLZH 3TIDA 5E2VL 4HIXL 5C6WH 4YDVA 4BXVA 1AR1D 1UB5B 4G82A 1D5ZA 4FQIH 2KBGA 3T77A 4X4MA 1WK0A 2Y7QB 1YMME 4FJYA 4IJ3B 4BZ1H 4JQIA 2CG9X 2I32A 2C9AA 3FB6B 4JFWA 5I6PA 1CE1H 4OGAC 1DBJH 1HNFA 3FU7B 5GJTL 2EDEA 4HFWB 4AMWA 3VTTA 3W38A 1G7PA 1Z0MA 3VRLF 2J5LB 3DGCR 5KYUA 5AAWC 5ACZB 1QSED 4YVNA 2CZNA 3CZUB 5ANMB 2VXVH 3KE0A 4H1LA 3EYOA 3DI3B 3SJVA 5LXGH 3OM3B 3FF7A 5T3XD 1ZEAL 4F92B 3S97C 4U1MA 3MA7B 2CUAA 3VYNA 2DQFB 4JY6B 4N1EA 4TSBH 3FTWA 3HA0A 1QEWA 2GITB 2HP4A 2XBDA 3UYPB 1WDAA 4I87A 4RGOH 3TN0B 4JDVB 5KSVB 4ENED 4OLXL 2AQTA 3TA4D 1J87A 3MRQA 1DL7H 5CBAA 3SDYH 1I8MA 4PV9B 2OJ1A 5HDQL 5ID0A 3ZMNA 3A24A 4KVNL 1SVZA 2JVUA 2CMRH 4N8VA 4IKNA 4R7XA 2B4CC 4ZMPA 3X2QB 4JVUA 1W72L 4X6CA 4Y1TA 1H5BA 1D7CA 2XT1B 4AQ1C 1JPSL 2QKIB 2Y2WA 4X6FA 3D33A 2JNZA 3TO2A 2EUXA 1J8SA 3O2VH 3LNFA 1UZ6E 3OJDB 4PQXA 5EEUA 5FHAH 2KC0A 1FA4A 4FHBD 1INDH 4WU7A 5CJXC 5AUMA 4Z7IA 3QQ3A 3V0EA 1AFVH 3T4YA 1JHLL 4NQEB 4F3FB 1RERA 4TOYH 3FO1B 4KVNH 3GSVB 2EH8H 4PG2C 3UCQA 3BXNB 2MH4A 3C60B 5EZLB 5FK9B 3T8VA 1PG7X 2XVGA 1KB9K 2ZPKH 4HF5H 3K74B 4UT7L 3B2UC 4M6NH 2ADJB 1OO2A 2HYMA 4H0LC 3BRFA 1M2VA 2BXZA 3LMJL 5KYYB 5KBMA 1I3VA 4OFDA 4JO3L 4KKLC 2CBTA 4XNXH 2WXQA 1E27B 3VB8A 3BVXA 1L0QA 4R4ND 3AQYA 2EIZA 3UTTB 5KWYC 5AL0A 2Q5BA 2WIIB 3WTSA 4WV1C 3BP6B 5DDHA 2ESVA 2H1XA 4FYSA 3X3FH 3ZOAA 3HJEA 5E56A 2XFXB 4KUZL 2VXVL 2CK0H 3EZJB 4R4FH 3QRLA 3LRKA 4XPAH 1CFVH 4DW2H 4WI7A 4AT6B 5C97A 1CE1L 5E6IC 4NOBA 5H4ZA 3WJMA 1QNZH 4PBXA 4JZJB 1NCDL 1HQRB 1VRSA 3E3QE 4FQHB 2AK4E 3KNBB 5ICXB 2PETA 3ZKND 3F58L 1URLA 2CJUH 4U7MA 1IARB 1CCZA 2JB6A 1BFSA 3D39A 3T6VA 3IKCA 5I1DB 3G9VA 1PD0A 4GAJH 2I9TA 4PHZA 5H2BA 1CFTA 4YEFA 4WV1A 3FS9A 4C57C 1U8LA 4FADA 4U1LA 2NT0A 3LIZH 4TVUA 2UUDK 5A2KH 3QYCA 3MA9H 4MXVE 2J72A 2WWKO 4P2QA 1XGYL 5FO8B 5B7FA 1NGWA 2BSSB 2VLJE 4NS0A 3WNLA 2F0CA 2XN9D 4YWGL 3VD7A 3MCYA 1QSEE 3RX7A 3CVDA 2XPGB 4J4PC 2HVJA 3D05A 3QUZD 4GIPD 3IFPA 3WIFA 4XCYB 2J2ZA 2YARA 3GSNL 2B1OA 4P23D 4YPGA 3Q8AA 4OZFG 4LGSB 4F8NA 2DB8A 4W9KC 1YQVL 3KBPA 1CO1A 4QEGA 1OL0A 4WNQB 4CN6A 3VWJB 4ICXA 2YPKA 2NSMA 3V7AG 5E2UL 4OT1H 1CT8B 1I1RA 1UHVA 3BD3A 1B4JH 3OLDA 1RP8A 4HGMA 4OM0H 3QE5A 1EAPA 1GCFA 1FBIH 1JE6A 5DMJB 1BD2E 2PCYA 4XBGB 4AE1A 5DJCA 5I66B 2H32B 2OYMA 3V0VB 5L4JA 3QIWB 3QO1B 4P3WA 5I18H 3NJMA 4GP4B 2JKWA 3FB7A 4KK6D 3QJHA 4XO9A 4LAJH 5FPIA 3OHXA 5C0AD 3T6WA 1P7KB 1J1XL 1R3KA 5AVTB 4JPWH 5IJCC 1FYTD 3OB0K 3IJSB 2AC0A 4JPVL 4QR7A 2HLAB 5ANME 4YL9A 5F9WB 3TV8A 5E08H 2VZ3A 1AO7A 2IANE 4ODSH 2CJ3A 3KG5A 2X40A 1MQKH 2LQRA 3OXSA 1I85A 4HG4K 1H5BB 4WUUA 1SBSH 4O4YH 1FFNB 1NKRA 5A7EA 1QTPA 4N0CC 1BZ9A 1YEHL 2EDFA 4DQOH 2RMNA 4WWKD 3X1GA 1PKOA 2H3KA 4EZMA 2Q10A 4OLEA 1NCCL 1CXEA 5JHMA 4P99A 3RWJA 1HC1A 1XR8B 1Y1DA 3P4NA 5F97E 1RFDH 2BIPA 2WXMA 2A0LC 2X1QA 5DMYA 4TLSA 1WC7A 2VCOA 3VD0A 1DBBH 4RAUB 5FO7A 4LQFL 3VFWB 1X4XA 4ZFOA 2P47B 4PJDA 3ML9A 3VFNA 3QUMH 1PJWA 1M6OB 4NC0B 3TWCH 2QSCH 3BZ4A 3GSQA 4V1DE 3LV3B 3H6AA 2AK4D 3U82B 2YMXL 4OR1A 4BZ2H 4CDHA 2P7TB 2MOVA 5K93A 4FQQB 2G9KA 1KB5L 4FNSA 1KB3A 3E3QC 2EJ1A 2A6DB 1HXMA 2FYVA 5J1SC 1J8RA 3SEPA 2YD0A 3MV7E 5CZRA 2VDQH 1JNNH 1G7MA 3HC0A 4ES8A 4KV5F 5DJ6A 3DUSB 4P5KB 3ZN6A 1UM6L 1X5MA 2Y4SA 2J3SA 4DN4L 3S88H 1JNNL 3HZKA 4LLDA 4YQXL 1LK2B 1ND0A 4Y4HB 1CLCA 1BVKB 3M7OA 4JPQA 2OZ4L 4YGAB 3UTQA 4XXDB 1MFCL 2EIKB 2OX5A 1QQDA 1HSAA 3G6DH 3CZFB 5E00B 4OIAA 1U3HC 4UTBA 2I7SA 2B4CH 3BMVA 3LN4B 2EAEA 4KKCC 2P43B 4HAGA 2GABA 3L5JA 5GJSH 3ULSB 4AH2A 3REVA 5BOZG 2CXGA 1LO4L 2QSQA 1FRGL 1CLOH 1DEDA 2BWQA 3N91A 3EDDA 4HC1L 1NCWL 3UZEC 2LR4A 4CW1B 1R33A 2FECI 2YPKB 4NPYB 5FWRA 1HYRC 1QABA 1KTDB 3KWWA 5BW7A 1U8OB 3N0AA 3SKJH 3EHBC 4JRYB 1NBZB 5E0FA 1RI8A 4P57A 3DSNB 1KZYA 4N2NA 4OGZA 3SKNB 4J3OC 2F53B 4R7DB 4LARL 2EE6A 1OTUD 1T0OA 2XZCL 4YXKL 3OLGA 2XJLA 4PJFB 2MRYA 5BZZA 1QPKA 4PJHE 2D9QB 1O7SA 3T65B 4AYFA 4YS4A 4ZPVB 4WY7H 2OCFD 5DTFB 2I60H 3TT3L 5FM8A 1YEHH 3ZDXF 4NUMA 4JHWH 3BI9X 4LPVA 2XG4A 1JCKA 5BV7C 4Y9EA 5C0ND 2A74B 4FTVE 4G9FA 3WNPA 4Z95H 1GKEA 2ARJQ 3CTTA 4TLUA 1XAKA 5F7DA 4KRPB 5HD8C 4WHYG 1BF5A 5C0CD 4NGHH 3CDZA 3CFQA 1NCGA 3AG2B 3SDAA 1KLGB 3JV4B 2EZ0D 3IDMA 4WWOA 2J4WL 2OMUA 2YXMA 2FSEA 3RDJA 3LKNB 3FUEA 4AM0Q 2EDLA 1RCYA 2O26U 2EVJA 1KGIA 4WFED 1ID5I 1TQCC 1FGVH 4WW2F 4AM0A 3DIFA 4XP9H 4YHIA 1UGNA 3VH8A 5IMLA 3KNBA 2VXTL 4JO2L 2ZP8A 3HB3D 4URKA 2ICWI 1EHNA 1A3RL 4W9EC 3RWIA 4DCQB 2H45A 2JIXD 3DJRA 5T1KA 2P5ED 3EHBB 4AQEB 5J1TC 1E8ZA 3WFEL 3BWAA 4KUCD 2IG2H 3O81A 4N0UA 2YA2A 3MBWB 2JJTA 1BZQK 1EZVX 2V2TB 5I5JA 2M2DA 1BWWA 3PV6B 4B9PA 1OF2A 3ULUC 2LLGA 3O4LB 1QFWM 4KNSA 5E2TH 2YPLA 3MROB 3WKMH 4GKNB 3A4AA 5GGUB 5EO0A 5CF3A 2HKAA 5BXFA 4U7SA 2NX5D 3B34A 4JFTA 1QR1A 2P46B 3ZGHA 5BQ7B 1QFWH 2D4DA 4H8QA 1X5KA 4PRPD 3DX6B 3KYMA 1RUQH 4PRPA 3SPJA 1G6RH 3X14A 1EJFA 1XR8A 3MLUL 3VFMA 1JZDC 5EA0H 1ZK9A 2EUWA 2IC2A 1PLGH 1SHMA 4GRLA 4RMQA 3GZOA 5J8OA 4L4TA 1MVUA 1IGYA 3KW7A 1XF3A 2VRKA 4U6HB 2XWXA 3QFJE 4X6EA 4NI3A 4WHTB 1AHKA 2L0DA 4FNLH 4WO4C 4S2SA 3VXNA 5A2IH 2BHYA 5SV3A 3SD2A 3RAJH 3NIGE 3IGAA 3VXPA 1BBDL 4I48B 1P5UC 4ODHL 1K5WA 4N85A 4ZFOL 2NYKA 3BN9D 3IFOA 2COQA 5DWUL 3TEUA 1B9KA 3DMMB 3ASNB 3IJ8A 4UOW1 1RZKC 3L1OH 4I0PA 4KJYA 4NFBA 3FB7B 2VUOA 3CSBA 3L54A 3GHEL 1S46A 2P8PB 1A64A 2YFOA 3I6KB 4K7PH 4ZAKA 5TH2A 5J0BA 5K9OB 2W65A 2Y0SA 2AVGA 4EI5B 4QXUL 2WXJA 4HFUH 2XQBH 3N40P 5FYLL 5I26A 3ZE1B 4C55A 4XCNA 3QZPA 1U3HA 4XVSL 4H26A 4XTRD 4ZUTA 1K6QL 3MLRL 5I30H 5JW4R 5LN4A 5B21A 4P4RB 4XZ4A 5CJXA 1LO0L 4M7LH 1GAFH 1MRDH 5CM1A 1RK1A 1FF5A 3FOMB 1BFTA 2AEQH 4HWBH 4JM4H 4XAKD 4M61B 4N8VG 3W39A 1ZXKA 3E7JA 2X44D 5ACZA 2IADA 3HNTL 4A37A 5IVOA 1KJ2A 4FFWC 2PYED 1EMTH 4PIBA 3DTXA 4YZFE 4WV1B 3BKML 4LF3A 3HI5H 4PJFF 4YNYB 4C56E 1JHLH 4YHZL 1AQHA 4H8UA 1U8JA 4AM0B 2WINA 4P8QA 4RSYA 2UWEE 2VDKB 2EE2A 3QI9B 4DF9A 3NGBC 3DPDA 3C8DA 3DXAB 2H8PB 3HLKA 1F3JB 4JFZL 4BKSC 2VDML 3M86A 2OQJA 5DTFA 1P84J 1VZGA 4MB5A 3BT2H 3CG8A 1M6UA 2VQUA 4H1LG 3VD3A 3WFZA 1DBKH 3NA4A 3GRWH 1DVUA 1KCSH 1PY9A 1HI6A 1R34A 1S8DB 1ZT1B 2BP8B 1BREA 4GAGL 4G6ML 4U3SA 3K0YA 2RJMA 4AUUA 1C12B 4XZUA 3UGUA 1HIML 1DQMH 4FFYA 3UTTE 2NY0D 3UP6A 3T0WA 2NY7L 4HOMA 4K8RC 3RIFF 3DUSA 4P5KA 3AAZA 3IMUA 3QUXB 3PWUA 3N1QC 2P26A 2YGVA 2NY6C 3QJVB 1N19A 5F7EH 4JFEE 2CDEB 1UH2A 3QO0A 5DVMA 4E9YA 3INOA 3VMPA 1LEKB 2YUWA 5TD4A 5F70A 1JGDB 2ORBL 2IBBA 5EZLA 4S1QL 3LRHA 4N0YH 1XTMA 1A7NL 4ZS7L 3HG2A 3SBWA 4AQ8C 4K5NA 2EH7H 4NKMA 4Y2DB 4G8FA 1QBBA 2ZSVB 5C09B 1F3JA 3MXVL 4NNYB 1CGTA 5ISZD 2GTQA 2ITFA 4JFSA 3KDMB 2VM3A 2L7JA 1U92B 4OB5H 4LRNH 4L4VD 4X9GA 3KR3L 1A6VH 4A38A 5EF3A 4HS8H 4GW4B 2FO4A 2APXA 1G9NC 1YEDB 1L7IH 1T7ZA 4QRTA 1M7IB 2VIRA 3DVNA 2UWEA 1WS8A 5AUMB 5DD0H 1XF2B 2NOYA 3EYSL 2QKIC 2NY5C 3QJFB 1BZ7A 2G75A 3QXDA 4IGBA 4QXTB 1ETZB 3DX3A 1DJGA 4LSUL 3GXUB 1QFWI 4ZUUA 3CD4A 2YLHA 2ZT9C 3FUNA 2YD6A 4H0GA 1FVCA 2XN9B 5JW5B 1TQVA 2J88H 1WC7B 4B27A 5EZOH 1U8IB 5IW3A 4HFUL 3Q2LA 4P23C 1ZXQA 1EH9A 4JHZA 1ZLUH 4A2HA 4K7PL 4A55A 5KS9A 1LD9A 1KJ3L 3WY1A 1ZV2A 5JZ7C 2B7DT 2XQ0A 1ZS8A 4RMTA 3RWFA 4ZX4A 2C9PA 1KCLA 5IW6B 3ZMRA 3BUQA 4UOQA 2P42B 4WENB 2XNAB 3EOAA 4ZZFA 5DWUH 2DIBA 2WTPA 2J6WA 5DS8B 3T3PF 1YJDC 2PWHA 3QULA 3ZE0E 4JUSA 1FN4A 4ODHH 3LTVA 5DJCB 1TQUA 5LGJB 1EZVY 3ZKXC 3VFOB 3RWDB 2UZYB 3NIGB 4PWJA 1RJCA 5KYNA 3HC3H 5KVDL 2IWKA 2D0FA 4XMPL 1WFIA 2K4WA 3I6LD 1NGYB 1G7JA 1XF2A 1ZLWH 3IBEA 2Z4TA 4G7YL 4WUUD 1PEZA 3PQYD 4P23A 2E4TA 4ZMNA 4XXCC 1SQMA 2AXJA 1AGCB 1AZBA 3KJ6H 5HSFA 4E41B 3V4UH 2EDBA 2A5UA 1KN4L 3K5RA 1XCQB 4E9XA 4EDWL 2IANB 2X10A 4ZFQA 2HX9A 3D85D 4M4RA 5I6KA 1UT1A 3VI4E 3B83A 3VMNA 2P80D 3ES6B 4EEEA 5FR3A 3WKML 2R9HC 3VAEA 5K9KA 1MHHA 3E9UA 1SVCP 3BP4A 4PCSA 5HVHB 4AYDC 1U8MB 2Q7YB 2VLRE 4RWHA 1HXKA 2GYSA 1CXHA 2VXSH 1QKZH 3CC5A 4CKQA 3GKWL 2NZIA 4OZFB 4I18A 2J2ZB 1DBAL 3NCXA 2NW2B 2X4TB 1PBYA 4ZXBD 5BV7L 4CJ1A 3W0WE 4JL1A 1A3RH 4RMVA 5F9AC 4EN3D 2FSEB 1OAQH 4U7KA 2JELL 2BHFA 3TX4A 1TG8A 4G80B 3UADA 5T3ZE 1ERNA 4X98B 3KDMA 2XVLA 1PD1A 3MOBL 1KBPA 1BYPA 2IIJA 5D1XA 3MRCB 4APQA 2E7MA 5EF1A 1YEFH 2DQCL 1C8QA 1YUHA 3K6IA 4H88L 8FABB 3HRPA 3F85A 3D4GA 1I1FA 4QHUA 4CKVX 1ZTXE 5K5YA 3JV4A 1VGEH 2ZX6A 3CAFA 4Q9QH 3FQUB 1GSKA 2VDMH 1X5GA 5GSVA 1HL9A 3DX9B 1L6PA 3ZDXE 2N1KA 3KLKA 4F15B 4R6UA 1UD4A 4GO9A 4NZ8A 4YR6B 1C5DB 4WI4A 5DS2A 3MUZ1 3WY2A 1UUSA 1OEZW 2W94A 1QHOA 1G4RA 4K71B 3HIZA 3CVHB 3SPGA 3VRIA 1WZ1H 4ZFGL 4TSCL 1FO0A 3FSVA 5FGCE 2JSFA 2IXQA 3FO2B 3RDTD 3VXME 3QJZA 1J11A 4ODTH 4JFQB 4YGVB 1TQWA 3U4BL 5ESQB 4LHUB 5CAYB 1UZ8A 5T1DL 4HWBL 2AEQL 4JM4L 4KKCD 4J23A 2BFGA 4OCXL 3T8XA 4FFZH 3U25A 1IZJA 5E1HB 3SKJL 4BH7A 1MRDL 4UT9L 4UM9D 2IGLA 3QHFL 2DEWX 3T0EE 2O30A 4FXGA 4EN3B 1T4KA 2Y22A 3G5YB 2ATPB 1AYRA 2B5IC 2ZUXA 5FAAA 3IETB 2E46A 1EHLH 3ARGD 4O9HL 2OR7A 3UGEA 2NXYC 1R3LA 4NO3B 1G9MC 1J86A 1JRHH 1AAJA 4NNPL 1W9XA 4ZDHB 4PJHB 2K8MA 1KPUB 5J5EA 2AGJH 3UYPA 5F9DC 3RVWD 5CEZE 4FG6D 1S7VA 3CX5K 3QRGH 3Q44A 4FP8H 2JK5A 4AC4A 3ETBJ 1X5JA 4PRNB 4N5EC 4PRAB 4LMQI 5D5MB 3EO0A 4WW2C 5A43C 1LD9B 2NDFA 4MNQE 1JFHA 3CVBA 5JO5B 4ZAKB 5TH2B 4F27A 1FG2A 2C1PB 5KBKA 2R0KL 4NC1E 1DN0B 2YSSB 3UFIA 1HXMB 2DQEH 2APVA 4XBPA 4EKXA 3KBHE 1FZMB 3BDYH 1AGEA 3NIGF 1DQLL 1NCAH 2MCG1 3ROLB 4LASL 5MENA 2D03L 2OJZH 2XV3A 4GBXC 1MJ7H 4M56A 5TE4L 5HHVL 4G6FD 4QHPA 3KLAA 2XIBA 3NJXA 1KENH 3HRZA 4HPYL 1MFBH 4PG9A 4FC3E 3TH4T 5G5DB 4BCZA 4PJXE 5LLIC 4YHPA 4OGXH 1RK0A 3RX9A 2C3XA 2IH1B 2X0VA 1KCVL 4FLQA 3KWTA 1PF3A 1TEYA 2GI0A 1H3TA 3DJSA 3I6KA 3LEYH 3VXMA 3KH4A 3KPPB 3CFBA 3H3BC 3GGWB 3ATAA 3FUIA 4FXKB 5GZOD 3AY4C 2HG5A 2VLRD 2Y7QA 5E5UB 2J1WA 1J9RA 4PJGB 3BFOA 5SWSB 3W9DA 4XN5A 5J6HB 3DA0A 3V0AC 3PAYA 1QEXA 4HSAC 5AB2A 1FPTH 1HYSC 3O8XA 3SZ6A 4KXAA 1TZOA 2IDTA 3DOHA 1TVHA 3QDJD 4Y2DC 4WIQA 5AOMA 1G9NH 2VZVA 3L3DB 1ZGLP 4G1EA 1JI1A 3H3PH 4DOHB 1SHXA 1EBAA 3B2DC 4KZDH 1W91A 3IN2A 1AZUA 5DA0B 1X7SA 5F96H 1SYSB 1YUKB 4RNRB 3MRFB 5DT1L 3E1ZA 3V5KA 3DX8A 3MA7A 1S9XB 1TO4A 5E4EC 2IBZY 4ZOEA 2NQDA 4H25A 3U4EA 2BP5M 1N5YL 2L4OA 3CSGA 1IGFL 2ADGA 3D7PA 5FIEA 3RQ3A 2VITB 2GY7B 2H32A 5IMMA 2PPFA 2XWJB 1W80A 1OGAD 4OQTH 5HDBE 1CBVL 3EG9B 4NRYB 3DJ9A 4HUMB 2P5WB 4OLZH 2K3HA 4JLRB 4K3GA 2J4WH 4L48A 5SV4A 5I6LA 1QASA 3C6SA 3SPVB 3PGCB 4KHXL 4XOCA 2ZJSH 4OFVA 1X7TA 2YPLB 4L4VB 4NUPA 5DMKA 4NJ9L 3V4VB 3V5DB 2PTTA 2IFFL 4AIEA 2YD8A 4LRIA 1H9VA 4M6AA 1IBDA 4OIFA 1JPFB 1U30A 4BSVA 1VJSA 4OCWH 4QAWA 2CRZA 3M8OH 1OCWL 1NFDE 1S7UA 5T8IA 5CLXA 2W07A 5DMIH 3KBEA 4IU2B 4KKPA 5AD0B 3QXAA 2N01B 3OWEA 1HQ4B 4DN3L 3RZCB 5HYQB 2ETWA 2YO3A 3GSRA 2W1NA 3BH8A 4OLWH 5DJ8A 1FORH 1Z66A 4LQ1A 1E4XL 1FQ9C 2FX7L 2R4SH 4JN1L 2GCYB 2ITCB 3RVTC 5CR1A 4J3TA 1WFTA 5A7BA 1QRNA 1LP9E 4HALA 2O6PA 3OGOE 1P9MA 1WV7T 3DVFA 5DZVA 4YWGH 5A3IC 4UU9B 4GQ9H 1LWJA 2F6AA 4FXGC 4UAHA 1G7HA 1A3QA 3NFNA 3FH5A 2WVVA 3LX9A 3OPZL 2WUCL 4ODWA 2XWCA 3VYOA 4PJEE 1WZKA 2WXLA 1RZFL 3B8SA 5I0WA 1DSYA 2OZ4H 3B2UD 2PPCA 3HNVL 4GAJL 4JFDA 3VWKD 1NFIA 3I9IA 3MRIA 3JYCA 1QA9A 5CSZB 3G04A 1NLDH 4N6RB 1JPTH 3AU0A 4ZNEA 5J1AB 3U9PH 4UAOC 2BSRA 5D7SH 3LD8B 4LL4A 5DJ0A 3SE3A 4R90L 2QQLL 3P11H 3V0IA 4FEMA 1KWGA 1W8OA 2LTQB 5DJ2A 3SKUD 3VX1A 4Y5XC 4WO4B 2ICES 1NC4D 2Z91A 4FXTA 5IB2A 5D71H 1YO4A 2CUIA 2DH3A 5EOQL 3MBEA 2XFXA 3U9UB 3FT9A 1KC5H 1PJ9A 3EF7A 1RZJH 3MCKB 2K70A 1SLUA 2WWKT 4H5SA 2AEPL 1V05A 3V6OA 5E94A 1SYSA 4I0PD 2QJDA 1KGYE 4XMLL 4GW5A 4L1DA 1MVUB 5AAPA 3R4RA 1PS3A 2EQDA 4YFLI 4HUCA 1A0QL 2C9XA 4M43H 4JANA 5DRNA 5TQ0L 3DPBB 3UPRB 2ZSWB 1N59A 3K8KA 4WTZG 1AO7E 2IANA 1XGRB 2IQAB 2XRAL 4A7SA 1Z32X 5F3HB 1XEDA 4KZEH 3DVIA 2IF7A 1WG3A 1KXTA 4UDTB 4PCYA 2HG5B 2Y5QA 4Y1AE 3FB5B 3WJLA 2QKIA 4IGBC 1V55B 3SKOB 2J55A 4WW1B 3IFOB 3GTNA 1WO2A 2UZXB 3HJ0A 3MBEC 1NC2B 1L0PA 1AG6A 4CU8A 4J3OG 3X17A 1N2RB 4BXSV 4ANXA 3L3IA 4AENA 2ENSA 5E08L 5DJ2B 5CBEA 2X53A 5GRZA 4JPVH 3VNZA 4FNUA 4ODUB 3BLPX 1I31A 1KYUA 3VI3A 3ZRCC 5D7HA 3HBPA 1I8KB 2G2RA 4A7TA 4H2AA 1J9TA 1ZA6A 4Q4EA 1NGQH 5AENA 2WUBL 3MUHL 5BRPA 1P1ZA 4AEEA 3VI4F 5IQ7H 3NCWA 2FX9H 2X89A 3DECA 3CFIC 5DC4B 2MCMA 2CBOA 3KLLA 4NP4H 1UA3A 5DK0A 1BAGA 1WAAF 2ICWB 1S5IL 5JA8B 4GUOA 4P4KB 5GGSB 3KJ4C 2G5BB 4OJEH 3DO7B 2KQMA 1V8HA 1BGXL 1XZWA 2NY6D 3VFSB 3WEXB 3ZE1F 2PYEB 3NJIA 2BFVL 3L08A 3PGDB 4PJBF 3UC0L 3IMVA 1HKLH 4RWYL 2ADIA 2ZOKA 4N2EA 4HJGA 3LN9A 4TV3A 4N4YB 4QYOB 3FU9A 1PTZA 1KELH 1QW8A 2J1KA 5EO9A 5DR5L 5K9JL 2NSXA 1QLFA 4HAKA 4PUBL 1DBJL 2R1WB 5BRQA 2JB5L 2VTFA 1TMCB 2F7IA 2VN3A 5GRJH 3C08L 4ABWA 2VL4A 4P46C 2YPLE 3RPBA 2DZEA 3G04B 1MFEH 1NGPH 1HCVA 4HIXH 4ZO8A 5IF0B 4DERA 3S35X 5T3XL 3BZEB 5J6SA 4UILH 3CCHB 2CAKA 2J8UE 2Y6SC 3MNZB 1HVXA 1JNJA 4WKZA 1WWAX 5BJTA 4Z8FH 2IALB 2IPTH 2X4NB 1L3WA 4IRZA 3N04A 2XIIA 3FTGB 4GIOA 2NY0C 4NKQB 4OUUB 1PGRB 2IBZX 4U1NB 4X9FA 4NN6C 1MFMA 3FO0H 4KQ3L 1A5FL 1Q9WB 2OW7A 1Q0XL 3WSQH 1QFUL 2E7BA 1CU4H 4L8CA 1JNHB 2MKWA 1BLNA 1DUYA 4UTAA 4MXWL 1RURH 5FDWA 3EGDA 3Q6FA 4LLQB 1ZA3A 1ZLVH 3QDJB 5C0FB 2V9QA 3OXRA 5D1XC 3QC5X 5EIVA 4JFFA 4OZHB 3VI4A 5DS1A 2QPDB 1NL0H 3C6SB 4GKOA 1MY7A 1YDPB 5F0MB 5EH1A 4HPOL 1AD9B 1XH2A 2C7UA 5A2FA 2D8KA 5JXED 1CZ8L 4DGYL 3SCMD 4MQ7B 3QZWB 4OLVL 1ZTXL 2O5ZL 3T09A 1F6FB 2O6EA 3LNHA 4R8WL 4U1KB 4X4XB 1CK0L 1CTMA 1AGFA 4G6FB 1CF8L 1D5XA 2VDNH 4OF5A 5G55A 3QULB 4E9RA 1SXNA 1PDKA 3ESNA 3L8QA 3V7AE 4LCCC 4LLDB 4MYWB 4KK6C 3I50L 1FVDB 4MLIA 2I25N 4F9LA 1CYXA 1J5DA 1MH5B 1DHKA 4M5YH 1U8NA 5GXBB 2H32H 4NM4H 3LZRA 3OPUA 5LBSL 3UJTH 1EJ6A 1INDL 4TLKA 5INDB 1OB1B 4MMXC 3ARGC 3PHSA 4MMZB 4FCAA 4PB9H 1NBVH 5G5DA 2JTYA 3BHBB 3TJHD 2X4PB 1RL1A 3LXAA 1AS7A 3BUTA 1KY6A 1JPSH 1RP9A 4N2OA 3VXMB 4P4KA 5GGSA 5EPMB 3OV6A 5EZPA 4RRPM 3VACA 1U8QB 3H2QA 2DIEA 3ARFB 3HAEB 1DFBH 3SGJA 1WF5A 1MW3A 1JNLH 1AG0A 1DVXA 1YEKH 2ZF9A 3BLKA 2A1WH 5GZND 4Z7NB 4PS8A 4KJYB 2J1YA 1RXLA 1XCWA 4N8UA 2GITA 3ZR6A 5D7IF 1MCWW 3H4HA 3T2NL 3WTWA 3F7PC 2MEJB 4LEXL 3ILQC 2F5AH 3QORA 2VUKA 2VQTA 1J88A 1MSPA 4PJ8C 1G87A 1P4BH 3C9NA 1T4WA 5L4IA 3WHXA 4P5TC 1LO5B 1M7IA 3WAKA 1E5CA 2IAMB 3PL6C 4KZ0A 2PXYC 2VM9A 3MTXA 2I5YL 2X9WA 3SB3A 3MLTB 4B9YA 9CGTA 2BHZA 3KPMA 3ABLB 1CYWA 1FSKC 4MS6A 1A6TA 1FVEA 1D9KA 1KV3A 2QTEA 4U2ZA 1USZA 3EFFB 2RB8A 4PRHB 3VD4A 3WTYA 3ZDYF 1CD8A 1NPUA 4FNTA 2WB1A 3UPRA 2JI2A 1Q0YL 4MMXB 1N4XL 3QPKA 2VXQH 5I15L 2FT7A 1DUYB 1P6AB 4WTWA 3SIKA 4GW4A 4TM9A 4AQAB 2NMSA 3SQOH 4L5FH 1U8PA 1X7QB 3AG3B 4OD3L 2WAHA 3T77B 3FQTA 4NQDD 4MCYB 2VMEA 3TVMD 5AVZB 2NDGA 1IC0A 1F3DJ 3MOQA 4H8VA 4KX8A 1SEBA 1AS8A 3WFCL 5DD1H 1O5PA 3FCTA 4OLUL 2VLMD 4MQ7A 4PJGE 4KU1A 4XP1H 4PJHF 3VWJD 3IMBA 2FBJH 3VTMA 2V9UA 4LXFA 5EZJB 2ZKMX 3VU1A 4KOBA 3MBXL 3TJHC 1QI5A 2W9DH 3MLPA 3QNYA 1ZVHA 4WW2A 5AVQB 4JZNA 1ULVA 5L8KB 2R0ZL 4OVVA 3QDMB 3EGDB 3Q6FB 2JLPA 4HEME 4TUKH 5FB8B 5HHQB 3QUZB 1IGJB 2Z34A 1A1OA 3IRPX 1E8XA 4I3RL 1TTUA 2D7MA 1W8EA 1CWVA 3RX5A 1D5BB 1OSEA 2X87A 4OZ4A 1F13A 4E42B 1WIPA 2BERA 2Z35A 3AG4B 3H9SA 2WXIA 2VERA 3FU6A 4AMKL 3MJGX 2F54D 3QW9A 2GK0A 3ALWA 4LLMA 4LVNB 3HC4H 4OZFH 3RPIB 1QVOB 4B96A 2DMHA 2NY0B 3L4UA 3VQ2C 1QBLL 2XXMB 2FT6A 4UV4L 1FHGA 4U6XA 4XPFL 4KPHH 4TQHA 5B4MD 3NESA 5D72L 1YNKL 4XCCL 1I75A 5E2WH 5IBTH 3TA3B 3CC1A 4S1DC 5HHNB 3VVVA 5ABZA 4NXKA 1M4KA 2AAAA 3CIAA 1JWSA 3FFDA 4JKPL 4ZXBA 3TONA 3QR0A 1XCTA 1U93A 1KXQE 3NTCH 4J3SA 2X4RB 3S8WA 4AQ1B 4DGUA 4FQ1L 4WUKH 1QYGL 2IDSA 3QVAA 3RBSA 5CS7A 2Q7YA 2P8MB 4F58H 2WYTA 4GB9A 1ET7A 4B6ZA 1S7TB 3HZVB 3P4LA 2QQNL 1EPFA 5J56B 3QEQE 1MAML 4XMVA 4DP2X 1G0XA 3TF4A 2LU7A 4A66A 2P24A 4G1MA 4TQ8A 3W2DH 3EO1A 5BO1L 5HGDB 3TBSB 3RKDC 2ZONA 4FL4C 4U1JB 4HJIA 1P7QB 3PHOB 2IPUK 1VZIA 4NQXB 1KIPB 2KT6A 4JREC 2CRYA 3ZUNC 2YAHA 2EIEA 2A1WL 2V4LA 4P46B 1OPGH 1HHIA 3E8VA 4NQED 5E5LA 3VXUE 4U1GC 5LNEA 2ERJB 3QNZA 4B5EA 3JVGA 3UBHA 2GJ6B 2A0LD 4KKRA 4WUKL 3SGEH 1TVHB 5G4OA 4OF0A 1IAOA 1AI1L 1E9OA 2NY5L 4C56D 4FQCL 5LJYH 1QHQA 2IVFC 1AGDA 4HSQA 2HJLA 4PLKC 4X8JA 4CADB 4N25A 1RIUH 3MMEB 3OKYA 2A73A 1Z9LA 5ID0B 5IR1B 1E4KA 3VFVA 4R4BB 1FH5H 5L2KD 4L1SA 1GSMA 5DHDA 5F0PB 1AR2A 1CDCA 4IDJL 3DVNB 3JT2A 4U3HA 1U8NB 4MJ4A 3CQFA 2LT9A 3P0GB 3MR9A 1X3DA 1G9HA 2BNUB 4BV1A 5EBMB 1UYWH 4GW5B 1IEAA 3S2CA 4AMKH 1AGBB 5C08A 3TO4A 2IAAC 2ZUUA 4XNQA 5CU9A 4XB8A 3T04D 3PFQA 3TBBA 1J0IA 4ZBJA 1A1MB 4U1NA 4NNYA 1LDPH 5C2UB 4BFNA 1DN0A 3EDEA 3L3GB 2VWEE 1S5HA 2MJWA 3CU1A 3HUJF 4FZ8L 3LS5H 1EO8L 5FKPA 4OLVH 5I1KH 4UU9A 1UEYA 4GI8A 5D2NE 4PJ9A 5FYKE 1U95B 4N90D 5AKVA 1E2VA 4AEFA 1VKXA 4FS0A 4RIRB 5INCA 1ASOA 3MBEB 4IRZH 3U9UA 3HG1E 2NCMA 3F84A 3HZ3A 4QRRD 1FCGA 2G3XA 4GJTB 5I74C 3OSKA 4EOWH 1PYWB 4N3UA 3I6SA 5AAWA 4H8HA 4JRYA 4JRXD 4GQQA 3BIKB 1NBCA 5I1GL 3MRIB 1JV2B 4Z7UF 2CBPA 2H6UA 1LJMA 2AERT 2R0WL 5ESVB 3JTBA 3V6BR 3W0WA 1INEL 4ERSH 3PFUA 2BVUA 3MO1A 2YJQA 4V33A 4WCYL 1LO2H 3G5VB 3JVFC 1Q0XH 4J4PD 4OZGA 4IBVA 2YD5A 3B5TA 3LZFH 1FAKT 1TNMA 3VYPA 4MD0A 2G3ZA 4W9CC 4NCC2 1ID2A 1A9VA 5EU6B 1OAKH 3TCTA 1L0XA 1ZOXA 5T5NG 3CMOH 3WUZA 2AXWA 3ECBB 5HHXH 4FD0A 4KFMA 5DVOA 5DUJA 5HVGB 3MX0A 3ZKQD 3GK8H 4LSSL 4U0QB 4NZUH 3K2UL 3KLDA 4XPTH 2VSMB 4IHBA 1ZSDB 1RJYA 4R97B 2H41A 2C9UA 3ECUA 4FABL 1UM5L 2ADGB 4LOUD 2ADIB 5C0IB 3TZVC 4LLWA 5C6PB 4UQAA 2A38A 4FXLA 1ETB1 1TJIH 3WHE0 1IGIH 3D87B 5E8OB 4G5ZL 4M8VA 2BO0A 1F1GA 1MEXH 5B39G 1ZV5A 1UXWA 4RRPG 3LJ3A 1BIHA 3RGVC 1JYNA 4A67A 2HVKA 1CDBA 2R2BB 32C2B 1H3PH 1MHCA 4JR9H 2B2XL 4MLSA 5E6ID 3VXSD 2R56L 1A7RH 2CBQA 3P3UA 2BFVH 2JQAA 3RDTB 1MRCL 1FZJA 4BSVB 2GBVA 4MRCA 4NZDA 3SPCA 1I8IB 2A9ML 2FWSA 2VLJB 2LABA 5C0GB 4IU2A 3SOBL 3BAJA 3CFNA 1QSEB 3GMOA 4JM2D 1XSOA 4ZNCD 3LQAC 5F9OL 4A6YH 2DQJL 2XN2A 4I88A 4F80A 2AZUA 3TF7C 3JT0A 5DJ6B 4HD5A 5GGRA 3KVQA 8CGTA 2A9AA 4Y2OB 1CFQB 4UV7L 2VR8A 3Q5TA 4TRPH 2CNYA 4L9LA 1MJUH 3UIZA 3H53A 3OJMB 4CNIA 1I8KA 1GJWA 2G2RB 5GGSY 2PTVA 3B8YA 2XN9A 5EV7A 2WQVA 3GO1L 1HHIB 1F8TL 1A4KA 1G94A 3L1EA 3SDCD 3GBNL 3EDKA 5F0LB 3QDJE 2WNGA 2ZAGA 3E8UH 5DVLA 4U0RB 2DN7A 1FIGL 4XPBH 1F42A 1JN6B 2VR4A 1SGKA 2ZXWB 4PJ9D 5KYYA 2RCSL 3SY0A 3UAAA 4QAMB 1JWUA 3LKRA 4HOXA 1MCEA 5BS0B 2LW3A 3N42F 2XCMC 3U30B 3PPEA 2Y36L 4JGUA 2XRAH 4ZUVA 5TFSL 1IC5H 1NIBA 3MV7D 5FGRA 4YXLH 3OXSB 2OYKA 1AGFB 5E03A 2IOMA 1Z3RA 4PJIF 2I07B 1UQSA 3A21A 5B3SB 1AXTL 4K2UH 3FU8A 1I9RL 4PD4J 1D6EB 3PWLB 3RPKA 2R2EB 2F1EA 3NMEA 2GIXA 4MRBA 4B53A 2HFGH 1S3KH 1BVLA 1IGTA 5ETUB 3CGTA 4F20A 1KLUB 3G6AB 4WLCA 3GMLA 3BAYA 1UA6H 2LGNA 4MZRA 4P59H 1IFHH 2X4UB 3NP4A 5KS9E 4OCLC 4DTGL 2K9UA 3O6FA 4DO5A 3EO1B 2E6PA 3U7YH 3AUVA 3CZSA 3HE7A 1IFHL 4X5RA 4G42A 5D7SL 1KBBA 3M45A 2YQ2A 3P77A 4RMRA 1KIPA 3C8HA 1NLDL 3VH8B 4NP9A 2QFPA 4P2QB 5FYKU 1D5MB 3FO0L 3O41A 4KQ3H 4XBGA 3NCCB 5IB5A 4HZ1A 3HNVH 3M1OA 4WSGA 5FDWB 5DQDH 3OLEA 5F71A 5KSBF 2EXWC 1NIDA 3Q3GA 4JFHE 2OMVA 3PNRB 4UF7C 3K80A 4V1DD 2WUCH 4GBXD 3WIFB 3NPSB 1KJMB 2FEEL 4HFWA 4MKTA 3TASA 3RGVB 2XY1A 1E40A 1WA2X 5F9JA 2CLVB 1MOEA 2Z8WC 4H0HB 3VXRD 4MS8D 2VJXA 4TNFA 1IM9D 2IPUG 5DMGC 2FB4L 2X3AA 1NBZA 3NCJL 1KXQA 4HJJH 3FYEB 3IBOA 5JZ7D 1MIML 2AFNA 2WBXA 3K6NA 2IADB 3QXUA 3QQ4A 4PJ7F 2BS71 3O6FD 2AABL 4NQQA 4MXVF 2R4SL 4JN1H 2EO1A 3FCSB 2XFGB 3DIDA 5K9JH 2YRZA 3L13A 1A2YA 2FSDA 4ATTA 1F58L 5KJRL 5BNXD 1FIGH 1S9KC 4S0SD 1FORL 2DKSA 2V3EA 3S37L 4EAEA 1HKLL 1PFCA 1EDQA 5F7KC 4U6XB 4PSPA 2YOAA 5AW0B 3BPLC 3HHSB 2DLFL 4AQOA 3EW3B 1NDGB 3GIZL 5AW7B 4IMLA 4OCWL 2F2HA 3QJTB 4IRJC 1R24B 2IAND 2X2JA 3CXDH 3BUDA 4FG4A 4G9DA 4NJ9H 3TU6A 4LCCA 4A2EA 4UQDA 1T83C 2BVTA 2PW1B 2OPCA 1AHWC 2DWYA 3QG7L 4GAAA 5HGAB 5LWYH 4HIIA 4WTXA 3RWHB 4XMXA 3FC8A 5JQIB 4XGZB 1CBVH 3QZLA 3FYIB 3FQNB 5F1OB 4AGQA 5I1HL 2BRQA 2HT3D 3BIKA 4L3EE 1XIWC 4HEPG 4Y4KB 4DVRL 3ARUA 5B1JC 5C2BL 1PQZA 2E8YA 5I24A 1G7LA 2P4AB 1MJ8H 4HJ0D 4NRXB 4JZOB 4JHVA 4BK8A 2H0JA 5AYQA 1I8LC 3MRPB 3G3LA 1X7QA 1RJLB 1X5ZA 1N6VA 3Q5OA 2CCVA 4BELD 5C71A 2K4AA 2NNAB 4JO8A 1NANH 2XXGA 3DV6A 1G9NL 2Y5TA 1FG9C 3L3HA 2WO4A 1EJOH 1Z6JT 3CC5B 4MJIA 1JPGB 3S37X 4DGVH 1IBGH 4XVJL 2WSKA 2WQ8A 3DX6A 3KYMB 3BDXA 1INQA 1TETH 3F3HA 4IRJD 4PV8A 1F5WA 3N43F 2OTWA 3C5JB 7TAAA 2V2WB 5C0CA 4HLZG 1UZ6F 2H26B 1P0SE 2MTPA 1SFDA 2FD6H 4AQZA 3CZEA 4Q74A 1OAKL 2EICA 2CKBA 5DI8B 3DBXA 3GDCA 4J3UA 5TGBB 3B2PA 4PRHA 1RK0B 5TK2A 2OL3B 3LQZB 3MV9A 3ZVVA 4H1LB 1W72B 1YZZA 4A68A 3POCA 5D93B 2ZXEB 2X1WL 2VZ1A 1BMGA 5JPMB 4GLRI 1NAMA 1QG3A 1EZLA 2JQZA 4X7TA 4BD4A 1XL4A 3B43A 1KIUB 4U6YB 1A7OH 1T1YA 3B9KC 3QJRB 1JRHI 4KY1L 4HT1L 3FQWA 4Z7WE 2XN1A 1NFKA 3HEIB 3GQFA 2COVD 1J5HA 4LSQH 3BT0A 4LVHB 4XMTA 2EIJB 3BE1L 1EX0A 1EO8H 3LS5L 1SRDA 4P06A 5I1KL 2OAAA 3PIQA 3UYRH 1RZJC 3WLBB 5KYXA 4OZIF 4BCYA 2P28B 2KUTA 1TQSA 2Q76A 3CFEB 3RWEB 3WS3B 4W9LC 2X7LB 3AWFA 5CEZH 3WD5L 4W6YB 1F41A 2DYPD 2EXTA 4U1KA 4X4XA 2H1LM 2PW2A 4EI6B 2ATPA 3ME0B 2DY2A 3W11C 3P30H 5CD3B 2MNWA 2QPSA 4UT9H 4AEIH 4WNQA 3QIUD 3D0AA 4W6WB 4U6VH 3NDZE 4PWEA 4XNYL 3F7VB 1M7DB 3P9MB 3VDCA 2XWBA 5MHSE 4X5QA 2AKRA 2VM4A 2AAVA 3MRKB 3QNXA 2DLHA 2F74A 4GW1B 5H37G 1LK3H 1RPQA 3KYNB 1UXMA 1LQBC 4BHUA 2OI9B 1WZ1L 4NPYA 3ZE1E 1O9VA 5DRZA 3S36H 4S1SH 1AE6H 3PWVA 3LXCA 4P9HH 1FO0H 4XP4L 4GQRA 1XZ0B 5DVKA 1BXUA 1OCCB 2ZWSA 4ABUA 3NSJA 5IWLA 2WXFA 2C26A 2R27A 5I1EL 1G7LB 1JYWA 5I1LA 1C8PA 3ARVA 2DLTA 1R5WB 3CU7A 4FFZA 3VFPA 3PJSA 1N67A 5HGGS 1SXCA 2O6CA 1GZPB 4I9WE 2W9LA 3HBZA 4JDTL 3MV8A 4UANA 4C8XA 5JPNA 1P7HL 3LDBC 4PGCB 3UZQA 1JGUH 2YGQA 3ME0A 3NK4A 4NO0D 1F2XK 1OIOA 4EF3A 2ITDA 3TO4D 4HKXB 3QHZH 1SMOA 5BO0D 1I7ZA 2Y06L 4N8CL 3CH1B 4M4PA 3TBTA 2BSTA 5BS0D 1DVFC 2DEYX 1VACB 2AVFA 4F58L 3ABGA 4CMMA 4AXWB 3JWDL 5E8EB 3UYRL 2X41A 5T1JA 2J12B 4FQ1H 4G1EB 1HAUA 2FJHB 2ZKHL 2XIDA 3VE0B 4BSJA 2XYBA 4E9SA 2BLFA 1RK7A 2YAPA 2C3VB 2XI9A 1TF4A 2DI7A 2YKLL 5C08B 1K8DB 2AJZA 2FX8H 5D9SA 3OAYH 3L4ZA 3KPNA 4QTHA 5J9PB 3LPWA 1YNKH 4XCCH 5C3LD 1PX4A 1T7XA 2QMKA 3HOGA 4LCWE 4JHBA 4MMXA 4CC0A 1M2VB 1ZDSA 1NAKH 2NXZD 5E6RB 1WA1X 4IU3A 4M1GL 2C9SA 4CVXB 3HVDA 1T3FA 1WT5C 3OWRA 2EDHA 5CZXD 2VDPH 4TTGA 3SGKA 5SWQB 2HH0H 2L8AA 1Z9PA 4JG1L 1R3HA 1TZGL 3JWOH 2GHZA 2ZF8A 3IAQA 3ECQA 2D03H 2OJZL 2XBZA 2GBTA 2Q6WA 2F53D 2WK2A 4WU7B 5ESAB 2DKMA 3WY3A 4XOAA 3P02A 4DK5A 5JHLH 5I0XA 4PJ5B 2IAMC 2BZ7A 4U6TA 1H15A 2NY2C 5EN3A 2R0KH 4HWBA 4P2CG 5D8JL 3KLAB 4PG9B 1L0YA 1CLYL 3HMXH 3U0TB 4XN4A 1SLWA 2H3NA 2MOQA 3T08A 4GMSL 4ZUTB 1IO4C 4TKWA 5CO1A 3M1CA 1HEHC 2B1HH 2W9DL 3ARRA 1O9WA 4W1TA 3U79A 2FBJL 2A9NL 5DLMH 1NAML 2R83A 5K39B 4FQXC 3EYOB 3N9GH 3U6XA 4ZS6D 1ETA1 2OXHB 4FQJL 4O9HH 1ETJA 4Y4HD 3AW5A 2WO3B 1IQDB 3VI3B 5SWZD 1DJHA 3ZZSA 5I1HH 1KBWA 5L2JB 4F1SA 2MPVA 3LPPA 1TU2A 1N5AB 5JUEH 4IDLA 4J3OF 1JGLL 3G6JE 4HLZH 2Z93B 5AZEH 3QNFA 4HH8A 1MCOL 4C83A 4MMYA 1ZIAA 1D7DA 4NUGH 3ZY7A 3KPQA 1AKJB 1E43A 1KLFB 5DURD 1A1NA 1VFUA 4S2SB 3VXNB 2V2XB 4NKDA 3ARED 3RY4A 1MHCB 3IRZA 3D50A 4XN1A 1G5GA 1J0KA 3WJJC 2A6JA 2ESVD 4X7FC 1LYQA 4YLCA 1OTTD 4PJCA 5C0CB 4LCYB 4O2FB 3BN9C 2C3HA 3MKKA 4RESB 3V52L 1AXIB 1VCBC 2VLJA 1I9JH 5FM5O 5HHPA 1LWRA 1X5HA 4JY4B 4JRFA 4G5AA 4BKLA 1FFOB 3VD2A 3IDGA 1LEGB 2VDLH 5EORL 1GHFH 3IWVA 4J27A 3TNNB 1K85A 1A6WL 1KDIA 3WTTA 4XN2A 5I28A 5F7EL 5E8OA 3QDGD 4XBEH 4MYPA 3QJHB 5T1MB 3RL2B 1UJ3A 3GRWA 4IOSD 5J6GB 1OP9A 2CR0A 4MD0B 2JELH 1KIQA 5D2LF 1HXYA 5HYJA 1AH1A 5D1XB 5D7IA 3KPQB 3QQ9C 5ADOH 3AGVA 3ECBA 4HHAA 3HNSH 1GR7A 3DO4A 1R9FA 2XQYK 3PS6A 5K69A 1TZHA 3LN4A 3JQOB 3Q8BA 4I7ZC 3TFBA 4MNGB 3N85L 3KWVA 3WE1A 1EDYA 1M56B 3D25B 3QIBB 4LF3B 4DP8X 3DOIA 5LVEA 5MI0C 4W70A 5DC9B 2W07B 3VG9C 3APFA 1T0NA 4M1CD 5IY5B 5DVPA 4D9QE 4LPWA 3ZHLA 5JHDD 3NQIA 2C3GA 3NCEB 1D5MA 2F8VA 2ZWYA 1F97A 1YNTB 5A6LA 3APNA 3LH9A 3F7KA 1T6WA 2C9VA 3L3GA 1BXAA 3H0TA 3IMRA 4CU6A 4Y19B 1K8IA 1VA9A 1TVBB 1U91A 3GUTB 1HZLA 4KJPD 4KK9D 2C4FU 4H13C 4WO4D 3TCLB 1CLZL 15C8H 5I1CL 3WHXB 4EUPB 1IEAB 2WNKA 3ZT7A 1QBMH 3PWPA 2BNRA 4RFNB 3B1UA 2A83A 3HI1A 3ULVC 1WPCA 4WWPA 3LVEA 5K9OA 1BVNP 3ZPDA 3RVXC 2FHCA 4KXBA 2G5BA 3QDAA 4YXLL 3WGVB 3P77B 4HPOH 4N2DA 1M57B 3LKQB 5IBUB 3ZE2E 3MO1B 2DQIL 1U3HB 2IPKB 5JOPE 4K9EL 2H26A 5C1MB 4WAFA 1JFQL 5HPOA 4GNKB 4PSRA 2XWJA 1OB0A 3MLWL 4Y4FD 5F21B 4I1NB 1R5IB 3FQWB 1MHEB 2P48B 5B7EA 1BOGB 1GGBL 4MXWH 4XN7A 5GGQL 4I3SL 5DEFB 4GXVH 2WQRA 2AK4A 1J8HE 3DYOA 4TVSa 3N2JA 1TO5A 3GBDA 4LCUA 3WEBA 5MEND 2G5UA 3UTPD 4C4KT 2NY4B 1IKNC 3EJCA 3C6EA 1RZ7L 1WAAA 5TQ2H 2C5DC 4OI9A 2VR6A 2OZ4A 5JHDA 4PJ5E 3RAJL 1UD3A 1I4FB 4KTEH 4BK4A 1CC3A 1IE5A 1FHNA 1MJUL 4O51A 4UNIA 5E4OA 3TYFB 3SYQA 5HGBA 4KQ4H 2A6DA 1B0WA 2VIRB 4G8GD 4K3DL 5D5MA 4Z7UA 4M93C 2BZDA 3RA7H 3VMOA 4N2FA 1XDTT 3AXHA 4BBWA 1J5IA 2APTA 3CLWA 3O6ML 1CICD 3HCVB 1OARL 2OSLA 2VAAA 5GRJL 1OVZA 1JIBA 3BD5A 4M9PA 4OB5L 2XTJD 4GKLA 1EHAA 1G6RL 1AKJA 1KLFA 2D7TH 4QT5B 1F4XH 4GAYA 1HDMA 3ELAT 5HHOE 5ICUA 5DQ9B 4NQVA 4Z7VA 4PCTA 1AMXA 1S9VB 3GSUB 2L3BA 6CGTA 5HYSA 1Q9LB 1HFUA 1T7YA 4WEUD 2ORBH 1UWFA 2P5WD 3AJ7A 5DZ9A 4EN2A 1XD1A 5EEVA 3FO9A 1YDPA 1ILSA 2VRQA 3HE6C 1IGIL 5FUCC 2MMXA 2BIOA 3RILA 3BGFB 3L81A 5ESQA 4B0MM 3LHAA 4LEBA 4KTDH 3Q43A 4MA3B 5IB3B 2FJUB 1A4KB 4N0FB 4DP6X 4H8WC 5D7LD 2VDRH 3L5IA 3BPOC 3JTSB 4OBRA 2YUZA 1BFVH 3M1BB 4NQSB 2WUBH 3CSTA 1IC4L 5FA4B 3LQAH 2G30A 3SDCB 1NGWB 2KHAA 5D2NC 1R5VB 1CUOA 2AANA 2BVEA 4AX3A 4EDXB 4PU2A 4DGIH 4DOHE 1LMIA 2FQGA 4APXA 5HHME 1P5UA 3DX4A 5TDNB 5LN8A 3Q05A 1WE5A 4IBZA 2EUVA 4WK4B 2CO7A 3BW9B 3MNZA 2WM0A 4GSQA 4W4OC 4ZW7A 1MI5D 1MCSA 2R0WH 3GMPA 2BC4A 5E6ZA 5FS5A 2BHUA 3SPIA 4JPIB 3WI9A 4X0KA 4DIXA 5DC2A 5DSCB 4UTCA 4JZNB 3KPSB 2N1TE 4IOFD 1DQIA 5EUOF 2NY2D 3FH7A 5TE7H 2P44B 3LYRA 2WNXA 5J12C 4UDUB 4Z7QE 1LK2A 1ND0B 1O9ZA 4LPXA 3IGFA 3ARGA 2R1YB 4NC1C 3N43B 3QH3B 5DA4A 2VL5A 4F7TB 1M2OA 3FRPB 1KOAA 3BPCB 1OWRM 1BQUA 2WMPB 3PU7A 1YY8B 4I18B 4K8RD 5CLZA 2GI7A 4D9RE 1YJDH 2AHIA 1HEJC 1F6LL 1LXMA 4OKDA 3RTQD 3M1BA 4GI9A 5L88L 1SY6H 1EXUA 4M7LL 1UXSA 4U6YA 4MNGE 4ZAKD 3SE8L 3VE0A 5D4JA 5TDPA 1TVDA 5T5FA 3RPIA 4Q89A 4QHKJ 1TIUA 1CR9L 5BUGA 2R15A 5EOQH 3UAJD 1MF2L 3U6RB 1Z5HA 1E27A 3TLRA 1X4ZA 2XZQH 4XMZA 5D7JC 4LZKA 5HYJE 1P4IL 2I9TB 4GUQA 5FYLH 3SSGA 3MNWB 1IFRA 3IT8D 3O8XB 4IDJH 2OULB 3HG0A 3P73B 4M7ZB 4XC1H 5DI8A 3GMPB 3BPLB 1RULH 2BJML 5F1KC 4HUVB 2HMID 1FH5L 4X6CE 1MCDA 3MOAL 4LP8A 3NJGA 3L4VA 4Y16C 3ISRA 4NDMA 3S88L 4TUJA 1QP1A 2YSTA 3T1FB 4FQCH 1KIQB 5CMAB 5A16A 4ZOCA 5KSAB 1WCBA 4U33A 5I1AA 1KXHA 3K46A 4HS6B 4OZIB 4L3CA 3DV6B 3L3HB 4Y8DC 1R3JA 4NWTH 5ICXA 1IKNA 1JS4A 3OTTA 2HT3C 1DP0A 2CDFA 1XB8A 1Z3GH 2W59A 4XC3L 3R8BB 5DRWA 1R47A 3EJPA 3QC6X 4PJCE 5HYSB 4U1SA 2QSCL 1N12A 4MHHG 4YE0A 1G7JB 2RFXA 1E9PA 1LMKA 3FZUC 4X6DE 3UJIL 5KBLA 1AQDA 3QPQD 4PH8A 3SN6N 1RIHH 4U1JA 2YD3A 3PABA 4HOWA 3RURA 4W9DC 4A7QA 2YQBA 1YEEL 1T5XA 3N6YA 5EA0L 3U2SA 5BRZE 3N3EA 3VFRA 3O3AA 5BO1H 2AMGA 2YHGA 1WIOA 1KTCA 2R2HB 3QORC 4U4IA 2PCXA 3QHTC 3PAVA 4FI7A 4MJJA 4UDTA 1ZHNB 3C6LA 1FNGB 2FK9A 3QIWA 3IU4L 1CYGA 1KG0B 3HS8A 2GK2A 4PY8I 4B9GA 3LRSB 1UWEH 1RSYA 3DX2A 1P6FA 3P0YL 1V3MA 2ZKWA 4KI1A 2YXVA 1QWUA 4PGDB 3U7WL 5DEGA 2IG2L 4XC1L 4FA8A 3IGLA 2HJLB 3HG1D 3DDFA 5EO0B 4GFXA 4OH2A 4JKPH 5I73C 4MA7L 1XO8A 1URIA 1YVLA 2E56A 1MCLA 1NCTA 3ARBB 4X9IA 4PJXA 4GT0A 3BP5B 4XAKE 2J21A 1T2XA 2ZCLH 2Y3AA 1NOLA 3UP1A 4KPHL 3CLFL 4G9FD 4HEMA 5KSVA 2VSKB 2Y7MA 1QBLH 4M6MH 1QSFB 3KGTA 3PUUA 4JFVA 5GPRA 4DPAX 4JCLA 4XN8A 5DYOB 4D94A 2GAZB 2OSYA 2GJ6D 2VMFA 2LV4A 1HU8A 2PP9A 4G8IA 4TVPD 3U30C 2ZIDA 5DU7A 1MFNA 5FX3A 4AK2A 3E6HA 3OF6D 4BA0A 5KSUB 1Z5YD 3GS4A 2VGLM 5EEWA 4G8FB 2VYRE 5GS1A 1XCTB 4FFYH 3DBXB 2BWDA 3QIBD 3C09B 3L1GA 4G2AA 4BFGA 4F2MA 1YPZB 4ZFZA 1L4IA 2Y72A 1W0WA 4I13B 4UIKH 1PG7H 4AY0A 2VR5A 5IVXB 1XCXA 1BZOA 5SWQA 4EN3C 1CLVA 2E75C 1DN2A 3QFDB 1Z9NA 1M71B 5DJZA 4DGIL 5I8EA 1W16A 3PWUB 5DGRA 1A8JH 2XX0A 4GIAA 4TVPH 5B39A 4N9GA 4C4KO 4G3YH 3MRLB 4NI6A 4XP1L 5HHMB 4NAMA 1IBZA 1OSPH 3PJSB 3KPLA 1T2QL 2AQNA 3G6JB 4RGNC 5F7AA 4EE2A 4YHML 2ZCKH 2WQUA 4QTFA 4JPKL 2X4QA 4LSVL 3WNOA 1MJ7L 1UXSB 1WS7A 3HHMA 4ONHA 2B4CL 1C08A 4HCIA 1TITA 1DQLH 5DK3A 3TIDB 4C54A 1L5GA 1FE8L 3PGCA 3WEMA 2BSCA 1MIEL 4LNRB 4NWTL 3X13A 4DESA 4ONGH 3SQOL 3GLDA 2ZD0A 3QEGH 4L8SC 3SDDC 2VXQA 1KGWA 1KGXA 1BD2B 3BZEA 1NC2D 5MEPB 4HIPA 2KS0A 4A7GA 3KPOB 3DETD 3MJ7A 1U8JB 3UG3A 1BEYL 4PGEB 5ADPH 3A6BL 3C5SA 4S1RH 1HQRA 4FQHA 1DZ0A 3JVGC 1QO3B 3O6LL 3QDMA 1GL4B 4HIEA 4WFGE 3LN5B 4HCRA 4OJCA 1EHLL 3ZZQA 2YD4A 2EDXA 3FOLA 4WFHE 1BEXA 4JQVC 3RWGA 43C9A 4YSCA 2WWOA 3IVKB 2XKNA 3PDOA 4C58B 1Q1JL 4FL4B 2Q87A 4EIBA 1RZKL 3WS6C 1NMCB 2YK1H 1CFQA 3ZKMC 3EFFA 5DJDA 1YEKL 4U05A 2QL1A 4G1MB 4TSCH 3W9DB 2DAVA 3VWKC 1UACH 3K2MC 2XV6B 3VGHA 1A7QL 3ECWA 3GI9L 4NQVB 5CD5C 1W15A 1AOHA 1BJ8A 3KXFA 4I5BB 1QLFB 3SYPA 5BMFH 4GRWF 3NBNA 2YAOA 2AJYL 4GG6B 4PTTB 5ICYA 4PGDA 5DK2A 4Q9QL 3RGBA 2VAAB 3Q8CA 4PB9L 3EGXA 3E6HB 2NCEA 3GSOB 1F4YL 4OD2B 4OV6F 4AV4A 1P4LA 1QD0A 4I77L 5CGTA 2PMZA 4XT1C 4ZMYA 2CPUA 5C0JB 1H8LA 4NHUA 4I1PA 1LM8V 4E36A 1S7VB 3FQXA 3RUGE 2NYYD 3QUKB 5FKAB 1UB6B 3RUGA 3VJ6A 3O3EA 4KROD 4Y5VB 1UEMA 3BHBA 1MAJA 3MROA 3WN5A 3CPLB 3MCKA 4N0RA 1TJHH 3FONA 4X99B 3WJJA 3TBSA 1O6SA 1XWVA 2EKJA 2ID5A 1FBIL 4PRPB 5IKCB 3SDDD 5CJOL 1FJ1B 2OYLA 1WAEA 4BFIB 2H2SC 4MWFA 1BVLB 1IGTB 2CM5A 3LQMA 4ALAH 3CPUA 5D7KE 5T5FL 1MCNA 2ZWLT 1MWAA 2V3DA 2VNCA 5IM7B 1EUUA 3B6SA 1TSHA 5LAXA 4TSAL 3NN8A 4IIQA 3R1GH 1OAXL 4GEIA 3V4PL 2FHBA 3BDBA 3GSNH 3N85H 4R2GD 3ZX1A 1G7PB 5GJTH 5GS3A 3JV6B 2PKDA 3PAUA 3MLSL 4HHGA 3ZE0F 2NLJB 2ZOOA 1NMAH 1SJHA 1Y0LB 2KZWA 5EMYA 2YAEA 3VQMA 2NY4C 2NY3C 3WN6A 3WFDL 3C5ZC 4AGPA 4QXWA 3N06B 4B0MB 5BXFB 2DM7A 4U3SB 1HHKA 1AZZC 1HAWA 4LK4A 2JXMA 3MGTA 3T3MF 1B2WH 2YN3A 1JWSB 3FQUA 4PJFE 1OSZA 4W9FC 3THML 5I0VA 3F5WA 3WFBL 4NNXB 4NO5B 6PCYA 1OTSD 1CVSC 4XH2A 2YOCA 2QHLA 3EYUH 5T33H 4ANKA 4M9OA 4QOKE 2KPWA 3ZL2A 4UMGA 5I6NA 3EOTL 3L7FA 5DC0A 3DUUA 1UATA 3LNGA 4ADJA 4ZMTA 2XC8A 1ZTMA 5ICZA 5EIIG 1OLZA 1SY6A 2GIYA 1NCDH 1YC8A 1AIZA 5JPNB 2BINA 5CCKH 3UO8B 2WJ7A 3MLSH 1SXZA 3KPRD 3V52H 2A9DA 2JB5H 5DFVD 1OP5K 4HIHA 4L0PB 5IVNA 5DR5H 5DJ0B 3WL9B 4GRMA 4PGEA 3TNMB 4KDVA 4UQ2A 2UVFA 1L9MA 3G9AB 4TSAH 3KH3A 3S3SA 2I24N 2AXFA 3S5LG 2OJEB 5HI4C 5DZJA 5GRVL 5I1IL 1J48A 1KEMH 3IMSA 3X1FA 1FL5B 1BGXH 2OA9A 1NUDA 3SGJC 5F88B 3CHSA 5FCSH 1YNTF 2DV6A 5F1NB 5GRUH 3KPRB 1NEUA 5BZXA 6TAAA 5IESL 3JUYA 1R5VA 3UAJC 2UVEA 1W0VA 2OCCB 1OZTG 4IK7A 2BIMA 3WIIL 4HF5L 4PP1C 1M7DA 1HH9B 4UT6L 3AU1B 4U1HB 3KR3H 1S9YA 1P5UB 5TDNA 1GY2A 4Y2LA 5I19L 4ZODA 3QUYC 4PMFA 3VWKA 3H8NA 3MX0B 2HUHA 3WFHA 3GLZA 3FT2A 1SDAB 5F0JB 3RRQA 3BAWA 4I18C 3SDAC 1I1CA 4DKFH 2EO7A 2X09A 2X4UA 1F4YH 4O00A 1P4UA 1BPLB 4O2FA 5H37A 4PRDA 5E6IA 2ENYA 2JJWA 1Q0EA 1PCSA 1RLBA 3D0LA 5H4YA 5AKRA 1A7NH 3S34L 1D7FA 2Y25A 3JTSA 4G7QB 1GGTA 2FVNA 1FC1A 4JM2A 5GRVK 3C5ZD 2V8LA 2C1OB 4DEPB 1RHFA 4HK3N 5CBEB 2IWFA 4P2OD 2ZQKA 3CFBB 5L4MA 3W1ZA 1QRND 3IJEB 5DHEA 4R4NC 1S7XA 1YC7A 3VQ1C 3PGDA 4HMDA 4BINA 1BXXA 1VGKB 3RTQB 3SPVA 4PP2A 3LKPB 5PCYA 3PG2A 4QHLA 4NN7C 2AP2A 1FFNA 1CURA 3CSFA 4FTVB 1P2CB 3CHRA 1J18A 1T89C 4RX4A 4P3CL 1MJJB 4I2XA 5I6XC 1G7QB 4FFVC 1WTGT 5D70L 4H25B 3U4EB 4Y9FA 4P04A 2MQ3A 4O58L 4ORGB 5D7IE 1NCHA 3NH7L 5EOTA 4LBEB 1OOAA 1ZRUA 4TUJB 2GJJA 2P8LA 3W37A 3ZDZF 5G4NA 2PXYB 1S9VA 2VN6A 3GSUA 3VCLA 2NY1D 3JWDH 1G7IA 3HI5L 4KNUA 2G5RA 4OZIA 3U1SL 3EXLA 5JIMA 1EMTL 1D5IH 2DIAA 2E59A 2YR3A 4WK2B 1OP3K 3W0WD 1GTFA 2HWZL 4X80H 3MV9D 1ZLEA 1OTTC 4NUGL 5LBVA 4L8CB 4X6DB 1GA2A 2EEFA 2X9YA 4PM1A 4PJ7A 4JHAH 2DDQH 4QRRA 1HL4A 4J8RA 3P73A 3FTUA 4AYSA 1IAII 2P3YA 3O4LE 4LT7A 4QXGL 4YIQA 5BRZB 2CCLA 4O2EA 3U1PA 4A7VA 5IOPA 2ZCKL 4LFHD 4D3CH 4OLYH 1N0LA 1CGSL 3GBMH 2DQUL 3UDWC 1JSYA 4G3YL 5KUMA 3WUWB 2W9EH 5B39B 4AKPA 3RWCB 5JR1L 3NFPB 1EXUB 4OUOA 2YGOA 1PLBA 2LFGA 1BYOA 1R17A 3JXAA 4WHDA 2BSRB 4HU2A 3GLAA 1SN2A 1EEYA 1PG7L 3F7LA 5CP7B 4RBPK