4G82A

Crystal structure of p73 dna-binding domain tetramer bound to a full response-element
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
201
Chain Sequence
b'HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element
rcsb
molecule keywords Tumor protein p73
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 37
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g82A00
4L18A 1HU8A 3KZ8A 2MEJB 1H9DA 4L0YA 4A63A 2XWRA 1EANA 4IBZA 1LJMA 2J1WA 1UOLA 3QYMA 2H1LM 4GUQA 3D05A 2VUKA 1E50A 2IOIA 3KMDA 1EAQA 2FEJA 4G83A 4MZIA 1GZHA 2YBGA 1IO4C 4IBTA 4MZRA 5G4NA 5A7BA 2XWCA 4AGQA 3IGKA 2J21A 4HJEA 4AGOA 5G4OA 5AOLA 2ADYA 4AGPA 2BIPA 3EXJA 4G82A 2J1YA 3WTYA 1T4WA 5KBDA 3WTXA 3TS8A 3D07A 4L0ZA 5LAPA 5AOJA 4IBYA 4QO1B 3WTUA 3QYNA 1TSRA 2J6WA 5G4MA 3D0AA 4IBSA 1CMOA 3ZMEA 5AOIA 4IBUA 2J1ZA 1EAOA 1HJBC 5AOMA 2WGXA 2GEQA 4IBVA 3VD0A 1CO1A 3WTSA 4LOFA 1YCSA 2BINA 4LOEA 5LGYA 4AGMA 4IBWA 2X0UA 5ABAA 2X0WA 3WU1A 3D08A 2P52A 2X0VA 4XR8C 3US0A 1TUPA 4KVPA 4GUOA 3Q05A 3EXLA 2AC0A 2IOOA 2J20A 2OCJA 3IGLA 3VD2A 2IOMA 3WTWA 5AB9A 2BIOA 3Q01A 2J1XA 3D06A 3WTVA 3US1A 2RMNA 2ATAA 3Q06A 4LO9A 2AHIA 5AOKA 4AGLA 4IBQA 5ECGA 4AGNA 4IJTA 5BUAA 1KZYA 2BIMA 3VD1A 3D09A 3WTTA 1HJCA 2PCXA 2BIQA 1GZHC
chains in the Genus database with same CATH superfamily
1WFJA 2YARA 4HUUB 4GG8B 3VFUB 4Y5XC 5DQ9B 2CG9X 1KELL 3L5HA 2PPDA 3THML 4IKKA 5IKCB 4MNQA 3O2WL 3RVVD 5I6OA 2C4FT 2NY4C 3FFCD 2O6DA 1BBJA 5GGRB 2PNDA 3V6OC 3F5WB 3ESOA 2FZ3A 1ZT1A 4ONFL 4RMTA 3UEQA 5C08B 4Y9EA 3WKML 4DEWA 4LPYA 5D4JA 2Q10A 2VXQA 3ERXA 3EKCA 4LXFA 4X5PA 5EA0L 1LP9A 2N59A 2D03L 4XB8A 4AIOA 4Y9CA 1A7NH 4AQAA 5IW6B 3N44B 3KNBA 4PJ7A 5DFVD 3PG2A 3RBGA 1LO2L 3D0VA 4F91B 4EIBA 2Y3NA 1I31A 4N26A 3DV6A 5E6YA 1BAFH 5KBNC 4QY8A 1RD6A 1RU9L 1P4BL 3OPZL 3GSWA 4MNQB 2JWYA 5D2NA 5FGCE 4MZ3A 5I1KH 1MXGA 4OCXH 5HHXH 1BBJB 3ZL2A 1GRWA 5DO2C 2FZ3B 1ZT1B 4AJWA 2FH8A 2IDTA 3SPIA 3UYPA 3T0VA 1OE2A 5CD5D 1YEFL 2X09A 3PDDA 2DMCA 15C8L 1LP9B 1TTFA 3APFA 3GBEA 4MMZA 2EUVA 1D9KC 4AQAB 4H2CA 3MCKA 4WV1A 1WO2A 3ABMB 3KNBB 2F19L 4PJ7B 5E4IA 4IJ3C 4W4NA 4GQPH 3D0VB 4B9KC 1EWHA 1B4JL 2JNZA 5B7MA 1SN2A 1KB5H 2CR3A 2EXSA 3CG8A 3DV6B 5KVMC 3NBNA 4N8VG 3HJEA 4MXWL 4QY8B 2K3TA 3GSWB 4JKMA 4G6MH 5D2NB 2YAQA 3L9EA 5HYSA 3FN0L 3NCBB 1GC1H 4N90D 2HA1A 1U3HC 1FDLL 2WYHA 2WXJA 5DUMH 4LCWD 4M5ZH 3UYPB 4KO6A 2VM9A 4HAKA 3K74B 5C08D 4MMZB 3QULB 1TT6A 5DT1H 3WHE0 3W39A 4WV1B 3MCKB 1LMIA 5DU7A 3IRZA 1RZFH 2G4EA 2MRYA 2ADJB 4EE2A 4UTAL 2Q6WA 2OW7A 3LIZH 3I9IA 1UUSA 4WWNA 3UYOD 4RZCA 4JG0L 3UBGA 2L7EA 4JQIA 4WHTA 1SOXA 1T0PB 4IJTA 1UFUA 1AKPA 2F5BH 5HYSB 3K71A 3QWRD 2HFFA 2VDKB 1KBKA 1R4XA 4FOMA 1MCPH 2VDRH 3MLYL 1RH8A 4XO9A 2Z31A 3ZBMA 3LZFL 1TVHA 3TPKA 1KACB 4N8CL 5FYLE 1SUJA 3RWDA 3CDZA 2Q86A 3W39B 1FLRL 5D1ZC 4EUPA 3MRDA 5C0CA 3DTUB 2VDKL 1CGXA 2X4UA 2ZOOA 4U05A 4XMZA 5AKTA 1J5IA 1F4XL 5E0QA 1IJ9A 2ZXAA 5CNHA 4RZCB 4WK0B 1L0QA 4WHTB 3LV3A 2RB8A 2AF2A 3FU7A 3LH2H 5CLWA 1ML0A 3DX7A 4GAYA 2BHUA 3MODL 1V3MA 3HFMH 4K71B 3VXNA 3K71B 3QR0A 2HFFB 5BZZA 4WZ9A 3KM2A 3S4SA 4GRLC 4KRMB 3UERA 2Z31B 2K70A 4OM1L 3R8BB 3ABGA 1TVHB 2WLNA 3M7OA 4U1JA 1TZAA 3EJZD 3ABLB 3G5YA 3GS4A 3GZPA 3L2LA 4AQOA 3LKOA 3RWDB 3CDZB 5KJRH 2CKBH 1UJ3C 3CD4A 3EXJA 1LO0L 1RZ8A 4KROB 4AV5A 4EUPB 4NAJA 5C0CB 3ELQA 4N2NA 2JI2A 5AW6B 3BUPA 4HD5A 2A0LC 5IF0A 1TTAA 3D50A 3LV3B 3QAQA 1BQ5A 4FERA 4GAYB 2HG5A 5HYIA 1MJ7H 1OAKL 3VXNB 3VH8G 4R7XA 6FABL 1RUAH 1BIHA 1X5FA 2DQTH 3EHBD 5FM5O 3S4SB 3MLRL 2PPEA 5AW2B 2X9YA 5MEND 1PPIA 2BHZA 5G55A 3S0PA 1C7TA 1JGIA 3EGDA 4U1JB 2R59A 2EE6A 3DX2A 4PJDE 3V8OA 3G5YB 3VXQA 3LKOB 4XOAA 1HXMA 3WDHA 1KF9B 2NNCA 1RZ8B 3MLSL 2X6BA 5CBEA 4N2FA 4QPEA 3SE4A 5FDYA 4KGJA 5M94B 3IS0X 4UOJA 5EU7C 1ZK9A 1A7BA 4NI6A 4ZZKA 3EFDH 3OB0H 5IF0B 4OLWH 4Z3IA 2BOCA 3LS5L 3S5ZA 4CKQA 2HG5B 1ZMYA 3FTVA 4DAGH 3K6DA 4WTQA 1UGKA 3QFDA 1TF4A 1LTXA 3MRPA 4HC1H 2DIEA 4JDTH 3K46A 2XRAL 4NWUL 4W6WB 4PJHA 1U8PA 5E23A 4YOKA 4DP9X 1EJOH 1AZZC 1DN2A 4L8SA 3A67L 5FR3A 4TNFA 3EF4A 3EOTH 3EGDB 4RBPK 3VXQB 1U8NA 5DJ8A 2D31A 3L1GA 1HXMB 3IT8D 5E4AA 1AC0A 5CBEB 3EGSB 1HIMH 3MUY1 3ENEA 3P11H 4TS6A 3MRLA 5K9JL 1ZHBA 4A04A 2YS4A 3IEAA 1NAKH 4NJAL 2DM2A 1U8OA 2XETA 4E9YA 3H3BC 3RKPA 3CFIC 4WEBL 3K2UL 3U25A 2BOCB 4YFLF 3T8XA 3QFDB 4KAQH 3MRPB 2JJWA 4PLOB 3F00A 4NN6C 1NBVL 4NCC2 4PJHB 3TIEA 4IU2A 1U8PB 3MFFA 4PMFA 4XPHH 5FV2A 4YWGL 2E7LA 2XV0A 3HIZA 4L8SB 4N9GA 1DUZA 4L4VE 2YAPA 1UM6H 4KVNL 2OJZL 2B4CH 4MAYC 4TLUA 3ZSSA 1U8NB 5DJ8B 4PCKA 1SOSA 1W8NA 2D31B 2IAMC 2QMJA 3CZEA 3TVMA 2QTVA 5J57B 4RGMB 3LZNA 2Z35A 3MOAH 4RSYA 4B60A 2BVQA 3MRLB 1ZHBB 3A6OA 1CU4H 1U8OB 1A7OH 2GC7C 4KK5D 4R4NC 4R2GD 2ZYHA 4NHUA 5FM8A 4AEIL 3FUJA 1UB5A 4LE8A 3SDCC 3TIEB 3KGTA 4IU2B 3MFFB 4HH9A 1NPUA 4N9GB 1DUZB 4UT9H 1FA4A 3N1MC 3I6LD 5I15L 3VXUD 1MF2H 4P2OD 3TVMB 2ZPKH 3BGFC 3D3VD 1FG2A 2V9RA 2DJUA 4TLSA 4XCNA 4ACTA 2D7QA 4XB7A 4DGWC 4YSTA 1HSBA 2A1WH 4LLUA 2Z35B 4LGRB 1ZT7A 4K7PL 2WPGA 1QWNA 2VDML 2QKIA 1OZTG 3QNXA 2FX7L 4L0PB 4Z7WE 4NHUB 4ZUVA 1UB5B 3EYUH 3QRGH 3BKMH 1R6VA 3S98A 4LRNL 1UA6H 4HH9B 1WZMA 2J55A 4NWTH 2P7TA 2IPUK 2XA3A 3NZHL 5TJWK 3QCVL 4LGPB 5CLXA 1SQMA 4H8PA 4L3EA 1FG2B 4XCNB 1ZS2A 1H3WM 4PVLA 4F2ME 1HSBB 4LLUB 4DN4H 2B0SL 1ZT7B 3L16A 4NZUL 3QJXA 3LN5A 1SLUA 2NZIA 2R0WH 2QKIB 3QNXB 5LKNA 1PX4A 1FYTD 4Z8FL 1ZPLA 3HZMA 2QPEB 4ZUVB 5CM1A 2R0LH 4OJFH 3IWUA 3EO1A 3JWOH 4F7TA 1N0XH 1AACA 4YHPA 3D9AH 1C12A 1CPUA 4KFMA 5DVLA 3SGDI 4YSCA 4OLXH 2P7TB 1QPKA 3GRWH 2VH5L 4L3EB 5JLZA 3TJHD 2IIJA 2X12A 4ANXA 1CFTA 1GS6X 2W81C 1E6OH 1A6UH 1DVFA 1TZ8A 4MXVF 4L05A 2H2SC 1HINH 5A7EA 5JIMA 1XSJA 2IV9A 3C5SA 5IBLD 1M3IA 3WKYA 1Q9LA 3U2SA 5DJ0A 3HZMB 3IRPX 1IM9A 2LAGB 2WXRA 2DLHA 2Y5QA 2VTFA 1UA3A 2RCSH 4OD3L 1OANA 2Q1EA 3EO1B 4F7TB 2BVPA 4Y4KD 3WJMA 3FOLA 3GK8H 4S11A 4UWQB 1VJSA 5EORL 1T04A 2FX8L 2YMXL 4YHPB 1XGTA 1C12B 3HE7A 4E9XA 5IUCA 2X89D 2NY7L 2P45B 4LSTH 5F0PB 1KBBA 4BSWA 4KV5E 4BFFA 4MJIA 2FAUA 4MLIA 2AAAA 5JLZB 1RLWA 3SB3A 1X4XA 4QRTA 2GJRA 1CFTB 4J3TA 3UP6A 5E2UL 3DX3A 1N12A 3DVFA 1DVFB 3OHXA 4BQ6A 4EOWL 4TUKH 1GW0A 2YD8A 5GHWH 1INDL 2X2YA 2DWSA 2VYRE 1EGJA 2EE2A 3C5SB 4LHJB 4ODVL 4UQ3A 2XIBA 1Q9LB 3U2SB 2JQAA 5DJ0B 1IM9B 5I6PA 3H2PA 3GSOA 1A66A 4M6OH 2BVPB 3WJMB 3FOLB 1T04B 3GT6A 3IJHA 4I88A 3MUGA 1XGTB 3ZUCA 1NCHA 2KERA 3HE7B 2P4AB 2CGZA 4BSWB 3ARGA 4MVBC 3LZRA 4MJIB 4Z0BH 3TZVA 1YO4A 3AT9A 2BINA 5KN5A 3Q1SH 1CDGA 4QRTB 3WJJC 4QIRA 2XZQL 3MREA 4L3ED 3OHXB 1JZ4A 2X4PA 3LQAL 3QRLA 3P4MA 3N42F 1F6FB 3G5XA 2VB5A 1I1YA 4UQ3B 2VXSH 3CVDA 3NH7H 1B0RA 3PL6C 4ZOBA 4TLKA 2HTKC 5F7EH 4KQ3L 5SX5H 3VXMA 4GS7C 1PAZA 2BXYA 2UWEA 3GSOB 4JCWA 4IRJA 5CLTA 3IJHB 5IR1A 5KBLA 5EULV 3MUGB 1NC4A 1T2QL 1Z3GL 3Q06A 3H8NA 5IUSA 4LPCA 3ARGB 4WI0A 4CBPA 1CXFA 1SXNA 3TZVB 4XC3L 2A99A 5KN5B 5FYJL 4OZHF 5E99H 1MHHA 3GEWB 3MREB 2QQQA 2OW6A 3RA7H 3TO4D 4TSAL 2X4PB 3P4MB 1HWWA 5DD6A 4NUGH 4BXSV 1M2OA 3G5XB 1I1YB 1NLBH 1B0RB 4N2KA 3T4YA 4JPSA 4XX1G 1J0YA 3CX5J 5C9KA 5E00A 4YVUA 2ALAA 1RQ5A 4PB0H 5C08E 3VXMB 1N67A 2UWEB 2C5DC 1BF8A 4ETYA 4IRJB 1IM9D 1UXLA 1TIUA 3S36H 1ZOXA 5IR1B 5D8JL 4ZPVA 1J1PL 2I69A 2ROYA 4G6JH 1BLNA 1NC4B 4JM0A 3ML9A 5K1JA 4EZLA 3V4UH 5T33H 4XPFL 4GYBA 4WI0B 1DQLH 1EZLA 5ITFA 4IBTA 4B9JA 1MHHB 2Y06H 2B2XL 1OAZH 4MJID 2B14A 4MZRA 2QQKL 3Q7JA 4KJQC 3T5WA 4MNQE 2WY3B 1TQUA 2APBA 2W9DH 3GI9H 5DD6B 5BV7L 2IQ9H 1OGTA 3JT2A 1GOHA 4OCRL 3O81A 3T4YB 4KK9D 1ZGLM 5E00B 4WNSA 4HMCA 4GXVH 5E9DA 2WLJA 2YGNA 1KCUH 4XWOC 4HIQA 5EFIA 1BF5A 4RMWA 3BPCA 3F7PC 1LP9E 1PFCA 3KJ4C 3LJ3A 4ZPVB 3F84A 4PJGA 4R3SA 1BLNB 1VACA 2ATPA 2EH8L 2J72A 4K3DH 4PJ7E 4PRHA 3MMEA 5ITFB 3RVWC 2PMZA 5T3XH 3SCMA 3TZVD 4V33A 5DRZA 3MJGX 3KYKL 5D2NE 1OGTB 1P1ZA 3DIFB 5HHPA 2ZXCA 5AOMA 4U0RC 3TTSA 3QQNA 3L5JA 5BJTA 4FF9A 3D25A 6TAAA 5HDRA 1MFVA 1PJ9A 5GS0D 5E9DB 2GIMA 4ABVA 5DZLA 3A6CL 5EFIB 1AMYA 2CNZA 3VXMD 4FL4B 4PJGB 4R3SB 1VACB 4IRJD 2ATPB 4HIHA 2AQ1A 4NZTH 1B2WL 1T66D 1ORQA 1F56A 1H5BA 4PRHB 4ELME 3MMEB 4R90H 3WTWA 3DYPA 3SCMB 4TNWF 5DRZB 4PS3A 5ALBH 1P1ZB 1U42A 2GYSA 1NKOA 2XG4A 3MLXH 4S1RH 5HHPB 4LLVA 3QXAA 1QYGH 1WIUA 5BJTB 3D25B 1Z66A 2EUXA 1QFWH 2I32A 1PIFA 3SSGA 5GRYA 1HT6A 2COVD 1FCCA 1XGYH 1CWVA 2R2BA 5J1TC 5EDXA 2NY0B 4JPVH 1RHHA 3LPPA 4BK5A 1ZHNA 5I73B 1SLXA 4HUVB 4HIHB 2XKNA 4HPOH 2BLFA 5T1JA 1ORQB 1CGVA 1H5BB 4OGXL 3B9KC 3DI2B 5K5YA 3IE9A 5IJDC 3QYMA 3CSYA 4H8UA 3ULUF 3SGKA 1CLYL 5F3HA 1YA5A 4OH2A 5DQJA 5HHOA 5I5JA 2XG4B 3BPOC 4DFHA 3NFPA 4FQXA 3QXAB 4LLVB 4E9QA 3FTXA 5FYKL 4XI5D 1GZHA 3GBMH 1HFUA 5ICYA 3PAYA 2R2BB 4ADIA 2OPCA 1IBFA 1RHHB 3DUUA 3K81A 4O9HL 5IHZA 1S7SA 1ZHNB 2L7QA 2XKNB 3FQYA 5C0CE 1A2YA 3LH9A 4HJUA 1UHVA 4LMQE 1QP1A 3TBSB 4CU7A 3PWLA 5LAXA 4FI7A 2HUHA 4G80A 3CSYB 1RFDL 4LLAA 4E41D 4PRHD 5DEZA 4HHAA 1ONQA 3MLUH 3UTOA 5F3HB 5DQJB 2XI9A 4PVMA 5HHOB 2R8SL 1J0JA 3P0GB 3UBXA 3SCMD 3NFPB 4FQXB 2WWKT 2KKQA 3QIWA 4RVBA 5EOCJ 2IPTH 2VNCA 4G7VH 2F8OA 5GRJH 5GGTA 3VA6A 5ICYB 4QHKJ 3GKWL 2Z8SA 3IDYC 1XGRA 3DUUB 4FN0A 3EJYC 1S7SB 1JZFA 2DQUL 4M1DL 4O58H 5C92A 3NIDF 2NY0D 1INQA 2CGRH 3G08A 1A5FL 4HA1A 5DVMA 2G0KA 4HGMA 1A2YB 1NUNB 1PQZA 3CVHA 3T0ED 5EF1A 3U1SH 5D6CB 4JRXA 3PWLB 5LAXB 2Y25A 4G80B 1JPGA 1PFOA 3TFKD 4HHAB 1ONQB 2J8OA 5EH1A 2HKFH 4UTBA 4LVNC 4FFZL 2XKSA 3UBXB 4K9EH 1SY6L 2GI7A 1DBAL 3QIWB 1P1VA 1TJXA 3D18A 1DJHA 4ENZA 1NH6A 4KDTC 3S5YA 4ZFGL 1MAML 2EUWA 1UT9A 2FHCA 4WKZA 5CN1A 3LIUA 2H26A 3UJIL 3M1BA 1LK3L 1N68A 3ARWA 4WI3A 5DD5L 3NIFF 1EHKB 4HSCX 4NHCL 3FQWA 1INQB 3G08B 3V52L 3SDYL 4B41A 3X1EA 1PQZB 3CVHB 2NDGA 2Z64C 4JRXB 1JPGB 2H6UA 4ES9A 1AR2A 1HAWA 4H1LG 4QXWA 4TQEH 1WJ3A 3S3DB 1DJYA 3TJEL 4I13B 1SDYA 1QX1A 1AXSA 4GXFA 2DEYX 4PJHE 1L3WA 3D18B 4ANVA 1QLEL 3CVHL 4P3CH 5BO0D 5F0LB 3C08H 4WKZB 3U4KA 5KVEL 1G9NC 2H26B 1KCSH 3TM6A 3M1BB 4JKNA 3GKZA 3RWCA 2ZSVA 3LYRA 3FQWB 3MZTA 4JN1L 4P9HL 1SGKA 5T1DL 1NOLA 1FYTE 5F7WC 3EDKA 3V7MA 3FO0L 1S8DA 3FN9A 4PQXA 4E5XA 1MJ8L 2LT9A 4X0KA 3NTCH 3MRHA 2EIZA 3V95A 1ICTA 5L6YH 3HB3C 2KH2B 1AXSB 5AW7B 4R6UA 5AG9A 3QNYA 3FYEB 4F1SA 1YNTA 3LZQA 3QIWD 3R4RA 3GZOA 4TUJA 2B15A 3BI9X 1ZK5A 5TTRA 3N91A 3KS0H 3RWCB 2ZSVB 2H0EA 1QW9A 4AQ1C 2EVJA 2J7LA 4WEMB 5IJVA 4HLJA 3DOHA 3ATBA 3GTTA 3APMA 3OR6A 3NEXA 4M00A 4P8QA 2XZCH 5F8QC 2ED7A 2KDYA 1QPXA 3O11A 3ARTA 3WN5A 1S8DB 3WGVB 4E5XB 1J9SA 2Z4QA 5HDQL 1TPXB 2HJKA 4X0KB 4YFEA 2EIDA 3MRHB 2EIZB 4JRXD 4BFIA 2OJ1A 1ZSHA 4JY5L 4GINA 3QUYD 3ZTCC 1KTLA 1IQDA 3MXVH 2OR9L 3SODB 3ILPA 1KCRH 2FNBA 3Q8FA 3VI4F 3QNYB 2X38A 4PJXA 4OVUA 1T80A 3RIKA 2YGVA 1YNTB 3C5ZA 2Q2EB 2AXGA 4TUJB 3FUKA 4PW3A 4U1MA 1JPFA 2ZP9A 3MN8A 4JEGB 1PCXA 2CHZA 1NCAL 4JFHD 5EZOH 1B88A 3LQMA 2ZYRA 3D08A 4TQPA 1F5WA 1CLOH 5IJVB 4X9HA 2OMUA 4OJAA 4ZUTA 5I1DA 4TSBL 3OR6B 2XOTA 3QIUA 2P8LA 3DYOA 1BFOA 1I9JH 3WN5B 2R29L 3O11B 1EO5A 5CEXA 3CXDL 4JFYA 2Z4QB 2X2JA 1ZLSH 2HJKB 2GJ6B 2J5LC 3L5IA 3QAZB 4BFIB 2FL5A 1CICD 3WFBL 4Y89A 1KTLB 1IQDB 3E3QE 4XCCL 4Y16D 2WMPA 3VFPA 1D5XA 3ILPB 3HG5A 1BMWA 5D2LF 4U4BA 4PJXB 4KZDL 5T5FH 1OD7A 3C5ZB 4CL7A 3ILEA 4XC1H 5DVKA 2Z0UA 4U1MB 4M8QA 2DJMA 4L3EE 4IMKC 1NFDA 3RVVC 4ZJ9A 4IRSC 1UYWL 1EUUA 1M56B 5F9JA 4ZUTB 5DMJB 4A66A 5I1DB 3QIUB 2P8LB 5CJXA 1G4RA 1IE5A 1BFOB 3S3BB 2Z91A 5CEXB 3S8WA 4JFYB 4HK3N 4JFFD 2IGFH 1AOHA 3JTSA 2JXMA 3HI5L 2FL5B 4YSAA 3RBSA 3V5DA 1JFQL 3IKCA 2E76C 2F8IA 5ENWA 2WMPB 4Z95L 1D5XB 5GIRA 3VFPB 4AC2A 3EJTA 2ED6A 3V9FA 3NJJA 3LNDA 1L3NA 3SHSA 3ULVD 3MNWA 5E7FA 4M8QB 2Z0BA 4MB4A 5IEHA 3K6IA 4DFIA 2XIDA 1NFDB 1KTRL 3CV5A 5SWSA 1H8LA 1P6AB 3D39A 4FG6D 5F9JB 1UD3A 2HX7A 3VGEA 1NCCH 4TVUA 3KLQA 3MLVL 3UJTH 1DANT 2Z91B 4EPSA 5BO1H 3VU1A 4H88H 5CD5C 1D2OA 3JTSB 2JXMB 4JFEA 1XB6A 3V5DB 1MVUA 2JF1A 3IKCB 1ANUA 4GUPA 4AKOA 5ENWB 4AJYV 1SQ2N 3PP4H 4XVTH 3X1BA 5I75C 4PJ6A 1EK3A 1TMCB 2ZWYA 5DJDA 1GXEA 3D34A 3NZUA 1D3CA 1FI8C 3MNWB 4OF3A 5E1GA 3CFTA 5GJTL 3IFNL 5IEHB 1ZSDA 3C5ZD 1UH4A 2ENJA 3DETD 4MJIE 5SWSB 3QC6X 3D39B 1EO8L 5D70H 4UOZA 5F1NA 1NAMH 5JDJA 2AGJL 4P46A 1OM3L 3KBPA 1BM3H 1NPJA 3QIUD 4GKNB 4NQDA 5AAMA 4PGDA 4JFEB 4PS4L 2FGWL 1MVUB 3FAXA 4GUPB 1F8TH 2FO4A 4WHYH 2F9BT 4BYHA 3LRSA 5D55A 1M7UA 3NAAH 1N4XH 3OLEA 4P0DA 3CHPA 4MSWA 2EAEA 1ZSDB 4NO3A 1NCDL 3HRPA 1I1RA 3PQYA 3OWRA 3L17A 5B3JE 3CDYA 3UJJL 5F1NB 3TEYA 4P46B 1OSPH 3K4AA 2Y2WA 3CIAA 4NQDB 5ERWA 1TOXA 3I9GH 4BFBD 2V7HB 3SO5A 5AW5B 2BNRA 3BKYL 1FH2A 3VXME 2UWEE 1NICA 2FO4B 1OTSD 2OL3H 3ARPA 4G42A 1V3KA 4GKOA 2J57A 2JMRA 3LRSB 2HMID 4KKLD 2VZOA 3SZ6A 1ZLWH 2KBGA 3ATFA 3PHOA 5AVTB 4MSWB 4C4BA 2Q3ZA 1W72A 4AUYA 2ZKMX 3RPIA 2FECL 4NO3B 2F08A 1HEJC 4PJBF 1QNZH 3ZIYA 3PQYB 1EHAA 5LNDA 5IHBA 3ZHLA 4URTB 4J1UA 5D2NC 5SWSD 1JNHA 3V4PL 4ODTL 3LQZA 2NNAA 2ICWA 4FAAB 1ACCA 2E6QA 5ERWB 2QVTA 1QSZA 2OV0A 2CUAA 3EJZC 4HOMA 2BNRB 2H3XC 2M26A 3L54A 2AABH 3WNNA 3ZKNC 4HS3A 4N5UA 4G42B 1E7VA 1A7NL 4OW6A 3MRNA 2CBMA 4MMZC 4DKFL 1TETH 2WNGA 3N41F 2HX8A 3WY2A 4WV1C 1RUMH 2XYCA 3DECA 4JDVA 1EZSA 3G6JB 3PHOB 4OT1H 1W72B 1E4HA 2YC1A 2PR4H 5GISL 3RPIB 1CS6A 1BAFL 3K6FA 1ZT4A 2J1YA 3RDTD 3OBAA 1WTLA 1JP5A 1F18A 3GIVA 1WD9A 5CHNA 4BFRA 1J5CA 1A65A 5I1KL 4OCXL 3CQFA 4J1UB 5HHXL 2PTVA 3GC3A 1JNHB 4J6RH 2C4XA 1KWGA 3LQZB 2EH7H 4WI6A 2NNAB 4ZTOH 2ICWB 5I6NA 1IBBA 1NA8A 4G3YH 1DL7H 4PCTA 3WTUA 4P46D 4ODSH 3V2AR 4WI2A 3BE1H 1H6EA 3VI3F 1BV8A 4HS3B 4NQDD 1T5KA 3DTDA 1NL0H 3H7LA 3MRNB 1CD9B 3N2JA 3D33A 2ZYSA 1LO5A 1RMFH 1I8IA 2GHZA 1AXTH 4PJGE 1L6PA 1CURA 4JDVB 3BLKA 2QMKA 3CFKA 1KB5L 1CZ8H 2YC1B 5IT2H 3JBG7 1ZT4B 5E4EB 1MFNA 4FULA 4PRHE 3VYPA 3E8VA 3TL5A 2QPSA 1QEXA 4G6ML 5JHLA 3GIVB 5CHNB 3UACA 5E5LA 1BF2A 4XCYA 4BM7A 4DP1X 3PQYD 1Z5LA 2FSEA 3WNKA 4K71C 2WJ7A 2WAQA 3M17A 1ZHKA 5DUML 2PO6A 3QDGD 2DQ6A 3SN6N 4P5SA 2DBLH 2R15A 3FU9A 4J27A 1ET7A 3QR1A 4UANA 3RL1A 1WYJA 2Z31C 4UZGA 5DT1L 4ZODA 4B3EA 5D71H 4ZOEA 4NUQA 2BNRD 4BWUA 1LO5B 1RZFL 3MGAA 1I8IB 1QMUA 4U1IA 3II1A 3T0EE 3CFKB 3LIZL 4UUJB 4J3OD 1K85A 3UCQA 2XJLA 2ZJSL 4BA0A 2F5BL 1RZQA 3SDAA 4YIQA 4XCYB 4K23H 2ZX7A 1YAZA 1Z5LB 1A8ZA 2EQDA 1L9TA 2FSEB 4YHZH 3M17B 2W59A 1MCPL 1ZHKB 2A7BA 2PO6B 4E9WA 2YAHA 3NCJH 5J56B 4ZNCD 1UUNA 1G1KA 3RL1B 1CFVH 2E27H 5MEPA 4YBLC 1FIGH 1MHCA 1U3ZA 2JKSA 1OV8A 2OZ4H 1MCKA 1NMCB 5BCAA 4U1IB 1VZIA 3EYQC 3VGGA 4KZEH 2G2RA 3FN3A 5IMOA 2CDEA 4KK5C 4XTRD 2ZCLH 1BVOA 4CDHA 1EEYA 3ARQA 4GRWF 4N2HA 3NG5A 3D12B 3SYQA 4B9CA 1MI5A 3ECVA 3HFML 3SDAB 4B9IA 3CXFA 5I76A 2AEQH 4KJWC 4AGQA 5HHOE 4HWBH 2B9AA 2FECI 4JX0A 5AOLA 4JS7A 2QFPA 2LU5A 3QJZA 2WOBA 3EO9H 1FFTB 1KTKE 1RIUH 3CIQA 2E86A 5MEPB 3FUEA 5KJRL 1MHCB 1WWAX 2CKBL 4TTGA 1WZAA 1WSST 3U0TA 4JRFA 2CUHA 2EIEA 5E6IA 5HVHC 4V1DA 2XQ0A 1YJDC 1GS8A 2G2RB 2NYKA 2Y22A 2F53D 2CDEB 4WJKB 5IMOB 3HG1A 1VCBC 1EEYB 3O3AA 1ZANH 2FBOJ 3BVVA 4DNLA 1MI5B 4YDLB 2ADFH 1XXDC 1G6RA 5I76B 2DQTL 1U91A 4M4PA 5A6IA 3U48A 5F9DC 1V7MH 3ECBA 1ASPA 1G9MH 4F7MA 2VDQB 3O2VH 2PO6D 4L8SC 4ABQA 3DIVA 3E8UH 4MHHG 3U0TB 1YQ2A 5SV3A 1T2JA 2WKLA 2FNWA 1MCDA 1KMGA 3QXUA 1BECA 5E6IB 3EFDL 4V1DB 2EDDA 3LKPA 4RGMC 4Q4EA 2BOBB 1M7DA 2V9TA 3HG1B 4F24A 4OLWL 1CYXA 2NZ1A 3QBTB 3RY6C 3O3AB 1N8OE 4DAGL 4D9LL 5IROA 2HRLA 4JRXE 2UY7A 4PBVC 4LP5A 1JCKA 1ZS8A 4HC1L 3L3DA 4UOW0 1G6RB 1QTPA 4X4ZA 1U91B 3N3EA 3S2CA 1SLWA 1VEMA 4LK4A 4P2AA 3SDAD 2CHWA 3T2QA 3NFNA 1EJOL 3ECBB 1YNKH 2NCMA 3OG6B 4OF0A 5IVNA 3SGEH 3EOTL 4X4YA 2X28A 4ALAC 4OLEA 2A9DA 1NMBH 4JFHE 3TJHC 4ZZFA 3WNLA 1UTDA 5KS9F 4PUBH 1S3KH 1JZDC 3WFEL 1KOAA 2L0DA 2N1TE 3QFJA 3P11L 1GCFA 1TNMA 5I23A 5I6KA 3LKPB 1NAKL 4PRDA 1M7DB 4Q6IA 5IBLC 3NDZE 2NUTA 1NGXA 2H1LM 2UY7B 4KKPA 4ETQA 1RSFA 3L3DB 4Y4KC 2MQCA 5BZXA 5JOPD 1MI5D 1MPAH 4XPHL 1NLDH 2QZQA 2RA1A 3NFNB 5FCSH 2YXFA 4X4YB 2B4CL 3CSPA 4TTDD 3VE0A 5ADPH 4LIQE 4ONHA 4AM0A 3TBYA 1NCOA 3S3SA 1P7QA 1JVOA 3QFJB 1PZCA 3MOAL 2MPAH 5DZNA 2PP8A 4PRDB 1CU4L 4Q6IB 4C56A 2NUTB 2JH2A 3WAKA 4C59B 1A7OL 2DQIH 5E6ID 4V1DD 4XMPH 1NGXB 2QKIC 3CHRA 4H8QA 3HG1D 4AE1A 4ETQB 1U41A 1CGYA 4JW3A 4RBPH 4F7CA 1NZRA 3GJFK 3L1FA 4O00A 4YXKH 3FFDA 3OSVA 2R0KL 4TXVB 3E3QC 2KZKA 4LL4A 1SXZA 3MV01 4FHJA 3ULVE 4CKVX 4B9YA 3VE0B 3OM3B 4AM0B 1MF2L 2E59A 3TBYB 3TCLA 1ADQH 1PX8A 3LXUX 2ZPKL 3D0AA 1NC2D 1P7QB 3SQBA 2A1WL 1AG0A 2XNAA 3T3PF 4JHWH 1BBDH 5AL0A 2B5IB 2WGXA 4EQ2A 3EAKA 2WP3O 3EUUA 4ZD3H 5I8OH 4C56B 1WWCA 1YCSA 2XSKA 1L5GA 3W0WA 2H8PA 4MS8D 2K45A 3I3EA 5BW7A 1ROWA 2KI6A 3EYUL 5IROD 3QRGL 3BKML 4K8RD 3ZTDC 3FFDB 1H15A 1SYSB 3JTBA 5EB9A 1UA6L 5D7LA 1BZQK 4NWTL 3OC8A 4PJXE 4AZUA 2FHBA 5IW3A 3TCLB 5JIIA 3OJMB 3K0YA 2L7UA 4HUKB 5CEZD 2XVKA 4FQQA 5LWYL 4R97C 4WO4D 3SQBB 3SYAA 5IJKC 2D3VA 2XNAB 4PBDA 5T5NG 2P47B 3GBNH 1SJHA 2E74C 3HC3H 3P0VH 2R0WL 3GXTA 3RTQD 4FA7B 2VLMD 2HPOA 1U3NA 1L5GB 3W0WB 2W65A 3IDXH 2H8PB 3DUHA 4YO0A 1DVZA 4Z7UF 1CBVH 4OJFL 1AHMA 3JWOL 4MFHA 1T5XA 1H15B 2D9QB 4MD4A 5D7LB 4YSQA 3KJ6H 4OLXL 1DZ0A 2V8MA 3GRWL 3WCYA 4JFOA 5HGBA 4KKCD 2EDHA 4NZ8A 1A4KA 1PSKH 4FQQB 5EIQA 1E6OL 1KFAH 3TWYA 1XV8A 4JVWA 1SJHB 4PJEF 3PWVA 1NFDE 4ZXBA 1P7QD 1JZIA 4AI7A 1HINL 3OHXC 3S7GA 4NX0A 1KLUA 2W65B 3MBXH 5AZEH 1A47A 4ODXA 4WNQA 4YO0B 3WY4A 1M2VA 3L3OA 3EUDA 4J23A 1IFRA 3K5RA 2B77A 2ZUUA 3UO8B 4CN1A 2RCSL 4HKXA 5FKPA 1FNLA 5I5RA 1ILSA 2Y7LA 1T5XB 3GK8L 4Z7VE 3MI6A 3PJSA 4MD4B 4F92B 1SDDA 1UVQA 2G5UA 3BCDA 3HVDA 4LSTL 1ED3A 4JFOB 2HRGA 2VLLA 1A4KB 1VPOH 1W0WA 1KTJA 3MBEA 4HZ1A 3E9TA 5JW4R 3TZVC 2MIZA 1F3JA 3HAEA 3PWVB 4OCYH 4TUKL 4U4IA 5SWSE 4YHKH 5GHWL 4QGYA 3D39E 1BIIA 3CLEH 1EEZA 1KLUB 2VJXA 4ODXB 3CSGA 4WNQB 1M2VB 2BCKA 3L3OB 5G4MA 5GS0C 3V0VA 4MMYA 3L3GA 5DD1L 3W0WD 3BQUA 4HKXB 4M6OL 5FKPB 2WC7A 3BEVA 4JFEE 3X13A 3PJSB 2YAFA 1SDDB 1JGVH 1I7ZB 4IRJC 1UVQB 4GSXA 1T66C 4JE0A 1ED3B 3IMUA 2PABA 2VSMB 4LLQA 2VLLB 3NP3A 4EXKA 3U7AA 4AGMA 5JXED 1CLZH 4IBWA 5JOPE 1JHLH 1W0WB 3Q1SL 3CXHJ 3MBEB 5EUKA 3RX7A 1F3JB 3FZUC 3HAEB 4Q8BA 1TEGA 1DVSA 1FF5A 3QZWG 5H37H 1KFGA 1BIIB 3GJEA 1A64A 4EZMA 2NXZB 1EEZB 3NH7L 3C9NA 5FW6A 2LLLA 1X7SA 3BZ4A 2BIHA 1J8SA 3N1GC 2AK4A 2BCKB 3VG0H 5F7EL 3V0VB 2ARJA 3L3GB 4MMYB 4NQDE 2FB4H 2DYSB 4G7YL 3BEVB 4G6KH 3X13B 2OI9B 3NDYE 2E6JA 3UAJA 5IJBC 4PJFF 4GRWH 4LVOC 1YN7A 3ZDYF 1P0SE 3GMLA 5ACZB 2VMCA 4PTTA 2BZ7A 3JWDC 3V0DA 5E99L 1Z7JA 3VX0A 4YLQT 1B4TA 5EUKB 3RA7L 2WXNA 3PQYE 4NFCA 5E6SB 3VFOA 3GJEB 4OF8A 4NUGL 2FJFA 5F8RC 3IJ8A 3CGTA 4LKCA 1MQ8A 4AIZA 1NLBL 1ZAGA 2BDNH 2HP4A 3BZ4B 4ZXBD 1IV8A 2AK4B 4XI5C 3KCWA 4I77L 2ARJB 4G1MA 4OM0H 3AS0A 4PB0L 1AQ8A 3M86A 2BNRE 2BERA 3S36L 3VNZA 3DLQR 1K8DA 1OIOA 2D4DA 3GMLB 3V4UL 2MOVA 5T33L 2JQMA 3OB8A 4FXLA 5FW8A 1DQLL 3P9WB 3FUHA 4PTTB 3CHQA 1Z0MA 3L4WA 4M8RA 4Q6KA 4M7JH 6CGTA 2WQAA 2Y06L 3M1CA 1OAZL 1T03H 4H7VA 3SZKC 4F33A 2W9DL 1QRNA 3GI9L 3VFOB 3VXTA 1Z9PA 2FJFB 2RIKA 3SCMC 4LKCB 4AIZB 1RZJC 2GSIA 4FYTA 2V33A 3ECUA 4DPAX 2OK0L 3B7SA 1VFBA 3V7AE 2NXZD 2X6AA 3JXAA 4G1MB 4PRPA 3OKYA 4GXVL 3S88H 3MNVA 3WENA 4KXAA 4YS4A 1KCUL 5GJSH 4YX2H 2NZ9C 1W15A 1K8DB 3BQUD 3IBOA 2NY0C 1TQBC 4DTGH 1C5BH 4K3DL 5I73C 3GNMH 4X9IA 3T0EC 2XU9A 3DX6A 2E9JA 2V7NA 4APQA 4ESKA 2B59A 2Z4TA 5T3XL 2DH3A 3H4HA 5I1IH 5GGVH 4F33B 3WXWH 4DZBA 1QRNB 3VXTB 2WB7A 2QADB 2GSIB 2X6VA 4CJ1A 1VFBB 1BQSA 1U36A 3PWNA 4PRPB 4TNEA 1RZIA 1U30A 5TQ0H 4YK4B 3N40P 5JIPA 4Q9RH 3MNVB 4UB0L 2Z1KA 4CILA 1PTZA 4XR8C 2H3NA 4UF7C 5DC9B 4NZTL 3S35X 3UAJD 2IOOA 1KGUA 2ATKA 5JIDA 1OP3K 3QXTA 4BZ2H 3DX6B 2V7NB 4APQB 2XN0A 4R90L 4TLTA 2B59B 5TDNA 1UM5H 2C9XA 4IDJH 1KWKA 4QXGH 3V6ZA 2MKLC 5I28A 2NQ3A 5ALBL 4DZBB 2DMBA 1MRCH 4L8CA 2ZWLT 1JNLH 1ET8A 4XN2A 3WIIH 3SGKC 3MFGB 1QYGL 2VC2H 1P7KA 4BQ8A 3PWNB 4FQXC 1RZIB 3W1ZA 3GHBH 3CU7A 2WWMD 4MJ6A 5ESAA 3KG5A 1XGYL 1GZHC 3MJ9A 4OY9A 5FLUA 5AW8B 4OV6F 1IGTA 4JPVL 2H3NB 5AKVA 4QXTA 4P59H 3N1FC 4LPTA 5EBMA 4L0YA 2ZOLA 4HPOL 4AJVA 4HEMA 2ATKB 1DJIA 3FO2B 3EJPA 5TDNB 2BSDA 3VFTA 2B20A 4BHUI 3KXFA 5GGVY 2O5XL 3V6ZB 3WG7B 5A40E 1RAMA 1EAQA 4YR6A 5F7NC 3UZQA 3F85A 4JLRA 3RY5A 4L8CB 3PABB 4N8VA 5ICUA 5GXBB 2CA3A 2QSCH 1W9XA 1P7KB 1QRND 3UXFA 2BH0A 4CJ0A 5KEZA 3GBML 3ES6A 1RERA 2QADD 2A4ZA 3QIWC 4MJ6B 5ESAB 3TT3L 1TZOA 1ZTXE 3QJSB 4K94C 4PRPD 2PXYA 3W81A 1IGTB 3AG3B 4QXTB 1PJWA 5EBMB 3SBWA 2ZOLB 3VWJA 3CN4A 3BGAA 1DJWA 4QJ4B 5DTFA 1AGEA 5LG6A 3VFTB 5ILTL 1AY1H 3KXFB 3L08A 5IVOA 3DNKA 3C6LA 1CFSA 4APQD 3MLUL 3N06B 4YR6B 3UMTA 3TS8A 4O02L 1MI5E 3P0YH 3QUYC 1KENH 1JI1A 1J1OH 3MCG1 4JLRB 3UZQB 4N8VB 3B7YA 1HKLH 2AW2A 2XIIA 4UZSA 4XO8A 3QFGA 2IPTL 1JNJA 3ES6B 4R7DA 2WCSA 4G7VL 3W2DH 5GRJL 1HL4A 2QT6A 1L6XA 1CD1A 5IFHH 2PXYB 2H45A 2PETA 3VW3H 4UTCA 4O58L 3AQXA 4YGVA 4DH2A 2CGRL 3VWJB 4ADJA 2HT3C 4A7TA 2HVKA 2X1PA 4V1DE 1AGEB 5DTFB 4OZ4A 2N7BA 1PL3A 1IGMH 2Z7ZA 3HG1E 4B7IA 4AY0A 4DGVL 3C6LB 1CFSB 3RFZC 1X6NA 1CICC 2HKFL 4M62H 4X7FC 1E4KA 4WI5A 2ERJC 4KMTH 1NGWA 3P3RA 4K9EL 1HN1A 3TA3D 5CS7A 2WNKA 1KIUB 5F1KC 4HF5H 2ITEA 1JE6A 1X7QA 5AKRA 5DF0A 2EECA 4M1GH 1DDTA 4G5AA 1J12A 3B4NA 4JJ5A 1ID2A 1DHKA 1H9VA 4YGVB 4A2DA 5DJCA 2OXGA 4DWHA 4FQ1H 2HVKB 1U3YA 2W88A 3GUFA 5ECGA 4OZ4B 1IKFH 3DTXA 4PJDF 4F8QA 5GRWA 4UOQA 4YFLI 4TQEL 1SMOA 1TPXC 1JYWA 1NGWB 1MKFA 2OAAA 4P2YA 1K6QH 1HQRA 3WD5L 2C3GA 5F70A 2K4AA 1PNDA 4P3CL 4HBQA 1X7QB 3ULVC 4M9PA 1DO5A 3C08L 1YC8A 1U8HA 4JVPA 1KCSL 3SYOA 3DJ9A 3VG9B 5JPNA 4JJ5B 3BFQG 2E8ZA 5GGSA 1E0OB 2PXYD 4PLJC 1E8YA 3CXHK 5DJCB 1HXYA 2Q2LA 2ILLA 4TUUA 1QFWI 2B1OA 2CU9A 2VLME 1BXAA 1JVLA 4HUNB 4ATWA 3DTXB 3QNZA 4BK4A 1T0OA 5LB1A 2IXQA 4NEHB 1N26A 3NACL 1LD9A 3WN5C 1BFSA 3NTCL 5I0XA 1AQMA 5EU6D 3T0WA 2R2CA 4P2QB 3IGKA 1NMAH 3EYFA 1Y0LA 4UQBA 1HQRB 1SM3H 1WBZA 2HT4D 3ARBA 2WXFA 2I25N 3BSZH 5AB2A 3GSNA 3KLSA 2NY2B 3CX2A 1U8HB 4G8AC 4HCRA 3C5ZC 3MV9D 3DETC 3WSQH 5JPNB 2YN3A 1AFVH 5FWRA 5GGSB 3WKPA 5K1VA 2G60H 3FNKA 1HXYB 3LDBB 1J5OH 2XVLA 4HWEH 1QACA 3PLYA 1BZOA 1XH2A 1BX2A 4LOVA 2XZCL 3C8HA 3U2JA 4CVUA 3HHRB 3QNZB 4ZTPH 4C56E 1JNNL 3EYVA 2IXQB 3QIUC 1E30A 2XQYG 3IPBA 2I07A 1LD9B 1RZKC 4JUSA 4JKLA 1U4FA 1JZ8A 4Y5YA 3EYFB 5DYOA 1Y0LB 3MXVL 2Z8RA 4ZFZA 1KCRL 4XBPA 1U93A 2Z7WA 3TBCA 1PU0A 1DBJH 1SJMA 4YSRA 1WBZB 3ARBB 1P84J 1F0LA 3GSNB 1UT2A 4ZMQA 2I9TA 4TVSa 4Q56A 3D52A 5EZOL 1OCZB 3LXCA 3OX8A 4MX7A 4PBWD 3KWVA 4DVRH 1CLOL 1Y1UA 1E5CA 4ADGA 1GZPA 5EHFA 1BX2B 2BVTA 1KJVA 1I9JL 1NPNA 4M6AA 4R9HA 4XPGH 3EYVB 3FCUB 2ADIA 5CJXC 2I07B 3ULAB 3W0WE 4A6YH 3EYOA 1I9EA 3A23A 4Y5YB 1GY1A 5DYOB 1OTSC 4ZFZB 2YD6A 4XBPB 1U93B 4BDVA 2HMIC 4PN6A 1MJUH 4KKLC 3ALPA 5D5ME 5T5FL 5F6IB 5D7LE 5F3BA 2GPZA 4Z7WF 4XC1L 3AREA 3ML8A 3FT0A 2I9TB 2H6PA 3BP7A 2KYIA 2CLVA 3STZA 3OX8B 1Q8MA 5DMKA 3KVDD 4MX7B 3FOMA 1PZUB 1AP2A 5ID0A 3V4VA 5HDLA 2HLEB 1GZPB 1FIEA 1KJVB 2E9WA 2M8XA 4N8UA 2PWHA 2ADIB 3CUPA 2GJPA 1IFGA 1PZBA 2IGFL 1CR9L 1ZCRA 2FQDA 5CJ5A 1C9SA 1CG9A 3EYOB 4ZBJA 3ASNB 2ITFA 4RMUA 1SF3A 4EQ3A 4WEEA 3RZCD 1E4XH 1NOAA 4WLCA 4K5LA 2W9EH 4BDVB 5FGBA 5F3BB 3DARA 5FM5M 4GSQA 1B3IA 1E27A 3UAFA 4QRRA 4PP1D 1MN4A 4DP8X 2H6PB 3BP7B 1I1AA 2CLVB 3RDTC 3STZB 2F0CA 5DMKB 2AV1A 2UVEA 3FOMB 1AP2B 5ID0B 5CU5A 3V4VB 5IHWA 4DCQA 1F4YH 1L9QA 1BG9A 3L8QA 2FYYA 3BSGA 3UJTL 2OSLA 5BO1L 2D7TL 1EZUA 4H88L 1RUKH 3CUPB 4QEGA 3NRQA 3B2UD 4P46C 1H3UA 3BX7C 3FXIC 1MWAH 4HJ1A 1CG9B 5C6WH 1YRKA 3CVIH 5FUOH 3G5VA 4LSSH 5AAMC 4NN5B 4LSQH 1JK9A 1LO4H 4H13C 1IAMA 3QCTH 3PP4L 4XVTL 3O9WD 3L13A 1A3ZA 4BJLA 1E27B 1ES0A 1DSYA 3QDJA 3GMQA 2ORBH 1UH2A 4L1TA 3UTZA 3WIFA 5DK0B 1I1AB 2AQTA 1CQKA 1YEHL 2AV1B 4B9GA 4FLSA 4DCQB 5DJXA 4CADA 4L8BA 5D70L 4AVIA 2ADGA 2FYYB 1NAML 5CZVH 2OSLB 2WYZA 4WSGA 3R7RA 1BM3L 4M6NH 3CHOA 5GZOD 3PWPA 3SYPA 4AE0A 1QUPA 3N43F 3G5VB 1JK9B 2KC0A 3FUFA 5BS0A 4J39A 4HW6A 4Y2OA 1P6WA 5F7LB 3B8SA 3FQXA 3NAAL 2PKDA 1WZLA 1ES0B 1N4XL 1TFPA 1T83A 1A7RH 2OXHA 3GMQB 3QDJB 3WIFB 3UTZB 1CUOA 3HLAA 4PRID 2LU3A 4KI5F 4JM4H 3LCYA 3ARED 2ZWZA 1EDHA 2JE8A 3AG1B 5DJXB 4CADB 3MRKA 4L8BB 1JPSH 2ADGB 2WVTA 2BFGA 1OSPL 4KK6D 1KB3A 2VCOA 3PWPB 3SD5A 3C6SA 4A68A 4CVXA 2Y72A 3PWUA 1PG7H 2DQGH 4X9BA 3ZOAA 5FYLH 4UILL 2OL3L 5BS0B 2C3HA 3B1TA 4Y2OB 3FQXB 1NBCA 4HH8A 1Q0XH 2NX5A 1PBYA 2EDYA 4XTRC 3HLAB 4ONGH 3D2TA 2VUKA 1R3KA 4MDRA 4MJ5A 2XDHA 4QRRD 1SEBA 3VGFA 4XO3A 1T6VN 5DZ9A 2BSSA 4X42A 5FYKD 1L7IH 3MRKB 4NIKB 3US9A 1WLHA 1V10A 4TVPL 4PU2A 3PRZA 1BHGA 1JS4A 1IGJA 4O5LH 5F2FA 2A77H 3MRCA 5B1CA 3V0AC 2WWOA 2V2TA 1QTSA 2AQ3A 2OKMA 2H32H 3C6SB 4GQ9H 4CVXB 1NM9A 2WUBH 2AABL 3PWUB 3E1ZA 3RGHA 2QV4A 4HETA 2A4CA 4X7SH 4AL8H 3OD3A 4LESA 2DQJH 2ICWJ 1TETL 4IOFD 3UGXA 1FL3A 4OZFG 1RUML 2NX5B 4XN8A 5C09D 2NY3B 4P07A 4OT1L 3DBXA 1A7PH 1F3RB 1GGYA 2EACA 2PR4L 4F58H 5I17A 4MJ5B 5EF0A 2F2HA 1SEBB 4QTIL 2BSSB 5EOCH 4DT2A 3N44F 4J6RL 4R4FL 4HKBA 1QRNE 3QISA 2EH7L 4XVJH 3GGWA 1IGJB 1NFAA 2K1MA 1AGBA 3MRCB 4ZTOL 4XVSH 1OWRM 1P6FA 3APDA 3BO8A 2V2TB 4G3YL 2YPLA 1DL7L 3L5XH 4WCYH 2PO6C 4ODSL 1U8LA 1A6WH 3BE1L 4PRPE 5E6UB 3PJNA 4JGMA 2GY7B 2JJTC 2APFA 4RAUA 3WI9A 2UZPA 1CO1A 1FL3B 1R5IA 2XV2A 1AXTL 2DQCH 1NMCC 3DBXB 1OXYA 1CZ8L 1NFIA 5IT2L 4BA8A 5I17B 2CZNA 5FO7A 1T7ZA 1LP9F 1J0ZA 3IDUA 3F65A 4XMXA 4WWOA 5DZPA 4RMSA 1JMXA 1H3VA 1BSIA 3EGXA 4PJ7F 3SDAC 3MOQA 3GGWB 1QASA 1AGBB 1IEHA 3BO8B 2YPLB 1KXVC 1T2XA 1E5BA 2VDOB 1JUFA 1U8LB 1YUHA 2BC4A 3NQKA 4OQ1A 1CYGA 2BWIA 2WUCL 3T08A 4RAUB 1G7PA 5D71L 2DKMA 4POYA 2ENPA 3ZZ1A 1R5IB 4TSCH 4XPTH 4ELDA 1AMXA 1FFPA 1Y6MR 3QUGA 4D0BA 1NFIB 4L1HA 1MAJA 2W0PA 4OCMC 2NX5D 3CMGA 4ZO9A 5FA3A 4PS7A 5FO7B 5JDSA 2EE0A 2NW3A 4K23L 2KMWA 3EGXB 2HJLA 2RJMA 4RMVA 4YDLC 4FTDA 3QORA 4YVNA 4TYUA 1OPOA 3NCJL 1GOFA 4G7RB 3K91A 3OKMA 1JUFB 1YUHB 4JFQA 4P23D 4TTDC 2BC4B 1UCBH 4X9GA 4CUCA 4PJ9D 1CFVL 2E27L 1P84K 1FIGL 5A1AA 1G7PB 4OFPA 3ECQA 3V8CA 5LDSA 1JWMA 3DRTA 4AT6A 2CH8A 1FFPB 1OQOA 2WSPA 4D0BB 4HEME 4YC2B 5E6IC 2ZCLL 2G9HA 2HVJA 4FTVA 1BGXH 4LLYA 4KOCA 4BINA 5JDSB 3KXFE 2NW3B 5DD3H 2AEQL 2HJLB 4GP5B 3QORB 4HWBL 3TN0A 3UIYA 4HIXL 2MCG1 2PWDA 4B5ZA 3ZY7A 4JJHA 3OKMB 1I8LA 4JFQB 2C3WA 2GIYA 1DO6A 1NCNA 1Z6JT 3EO9L 1TEFA 1RIUL 3I50H 3BZ5A 3WGUB 3UG5A 3QEUA 4OD2A 4PP2A 3MZGB 1R24A 4CAGA 1JWMB 3DRTB 3RWGA 4AT6B 4NC1E 1WBXA 2NY5L 2EVHA 1XGPA 5JXAH 2G9HB 2HVJB 2P1YA 4FTVB 4FP8L 4LLYB 1ZANL 4MS8C 5GSVA 5AOIA 3AM8A 3GZKA 1RJYA 4MQXD 2ADFL 4HT1H 5IROC 4K8RC 1BAGA 3ZE0B 1GS7A 3TN0B 1SYVA 2XWXA 2GI0A 3JVFC 3KEHA 4FJ6A 3VO0A 1V7ML 5BRZD 4AX3A 1G9ML 1IAKA 2ZG3A 1G9HA 1SJVA 1GGBH 3O2VL 4M93B 4KNTA 4Z7NB 4I7ZC 3HW7A 5EBGA 3E8UL 1I8KA 2Y1YA 3QEUB 4WO4C 4OD2B 2YJLA 3OZ9L 4PP2B 4XAWH 5DJZA 1R24B 1A7QH 3RWGB 4K3JH 3GHEH 1WBXB 3PAUA 3RTQC 3GBDA 2GTWA 1XGPB 3ZTJG 3GIZH 3OMZA 2VLRA 1DQKA 1S6NA 1FVCA 1X6LA 5GSVB 4Q6IC 1O0VA 3L81A 1UOVA 3ZZQA 3FH8A 1RJYB 1X5XA 4JFPA 4L4TA 2FO1A 1MFUA 2J12B 3ZIMA 4M56A 4F37K 3QQDA 4X6EA 4XOCA 3BAYA 4NC2B 1ILUA 1SYVB 2B1AL 2VZ1A 1AG6A 2PWFA 8CGTA 1IAKB 3ARFA 3QORD 2Q8AH 3WE1A 5L2KA 5ACLA 4N0YH 1E5AA 4KKCC 4HLZH 1NMBL 4O4YH 5D4IA 1I8KB 4YH6A 5DJZB 5FYJU 4PUBL 1S3KL 4LZKA 3RILA 4XNYH 1XR8A 5JQIB 2NTSP 2X3AA 2GTWB 4X7EC 3WELA 1JZGA 4V11A 2B5IC 1ZKAA 4Z77A 2VLRB 5ETUA 1FVCB 1Z3RA 2FQGA 2ZKYA 3GB7A 3BJLA 4L4TB 5KYWA 3QQDB 4FTVD 1A25A 4X6EB 3RIAF 1JHTA 2Z93A 2K6YA 1NLDL 2AP2A 4QAWA 3ARFB 3B6SA 3PE9A 5D7SL 2QSQA 1NEUA 5DJYA 5EC2A 5ADPL 5C97A 5L2KB 4A2LA 1PZ5A 1O6SA 2Y7QA 1I9RL 4ODBD 5C71A 1TR7A 2FYVA 2MPAL 4PJHF 1XR8B 3C75A 2W8CA 1GKOA 2MQGA 3IXTA 1HWHB 4HU8A 2PW2A 2DQIL 4Z77B 3T6ZA 4XMPL 5ETUB 1P2CA 3NIGB 3OZKA 5KVDE 3E0GA 3GB7B 3WEAA 5KYWB 2Z9TA 4LCYA 1JHTB 4YXKL 4PS8A 2Z93B 2J8HA 1JYNA 5BW7C 1MCNA 1PKQA 3N50A 3QW9A 35C8H 3FUDA 5FWQA 3B6SB 2AAVA 2OQJA 3A4FA 3GYRA 4H1LA 4JVUA 5DJYB 5EC2B 4LB8A 2YR3A 1PZ5B 1O6SB 5JXEC 1ADQL 5HXMA 2Y7QB 1ZVYA 4CGTA 2BVOA 4XE0A 2YLKA 4BFJA 2WXKA 3QDAA 3MJWA 1BBDL 4JHWL 4PY8I 4KQ4H 4X6DB 4ZD3L 5I8OL 3IXTB 1XL4A 2YA1A 2EZ0D 2PW2B 1GOGA 5C3LD 2QDWA 4HZAA 1P2CB 2LR4A 2I24N 5SX4H 3RWEA 1RL1A 2VLRD 2P44B 4LCYB 3QUMH 5TDOA 3QUHA 1OGSA 3NK3A 1KELH 2Q8BH 5J13B 3DRQA 4N2BA 3HMXA 1PKQB 4PRAA 3WMQA 2OQJB 2YPVA 4H1LB 4X5XA 4PJAA 2OZNA 1WWBX 5INCA 3WLWD 5LDUA 2MQ3A 3ARFD 3WKMH 3MCYA 3BSHA 2BVOB 5L2KD 4HOXA 4OFVA 1Q90A 3BDBA 3F05A 3GBNL 1S9YA 2AJXH 3P0VL 1DQTA 1RZGA 4M43L 2E0PA 4RWHA 4ZXBC 4D3CH 3IDXL 4UBDD 1FGNH 3RWEB 3K7UA 2TAAA 4NKMA 1CTNA 3M45A 4NKOA 5TDOB 3L3OC 3CK0H 3FQRA 3IDNA 1WBYA 3DRQB 3I9AA 4BEIA 3AB0C 3OPZH 2X4OA 3KJ6L 4PRAB 3VYNA 5GGUA 2CBQA 4X5XB 4CNIA 4PJAB 5INCB 4PI2A 3N1QC 4Z6AT 3ATDA 1PSKL 2NXYD 4NQUA 4HLEA 1YEFH 1KFAL 1JG9A 2XPZA 1M6UA 1S9YB 4OKDA 4YDIH 2YBGA 3SGEI 2RH0A 1RZGB 3DHMA 4WGWB 1JDAA 1H8SA 3MBXL 2DWTA 4Y5XB 1R1CA 2NXZC 5FYKU 4HEPG 4B5EA 3IFOA 2XVBA 4GLRH 4NKMB 4NKOB 1BYPA 1NCBH 5JNYA 2XTJD 3V0JA 3FQRB 3IDNB 1WBYB 2VXQH 1P7HL 3BQUC 5DA4A 2X4OB 2XBZA 3JTTA 2OI9C 1XO8A 1WFOA 5GGUB 4U6TA 4H44C 4YZFE 4CNIB 1U58A 3VRLE 1F90H 1S7RA 4E42A 4IM8A 2VDRB 3MROA 4QRRE 1BOGA 4QJ3B 2WTPA 1VPOL 3QE5A 4N25A 3WHXA 3OZLA 3LRGA 4AVJA 3JWNC 4OCYL 2B1HH 4DGYH 4YHKL 4OZIA 4NLHA 2P5PA 3CLEL 1OGPA 1TSRA 2LQRA 1CMOA 1I7UA 3PPSA 5DEJA 3NJKA 4ZOAA 3IFOB 5IQOA 4H4NA 4N9OB 1KCBA 2BW4A 3D69A 5JNYB 4P2CG 5CZXD 1J05A 3JZYA 2DF3A 1JGVL 3Q5TA 3JTTB 5KJ4A 3UAJC 3VVVA 3ZYOA 1JK8A 1U58B 2G2NA 3QEGL 1S7RB 3NP4A 1A6PA 4E42B 3VVWA 2ZUQB 3MROB 3IMBA 1BOGB 1JHLL 3WHXB 1T0MA 3EH4B 5MERA 5F89A 1D9KB 1FN4A 1WPCA 3QPKA 4N8CH 2EO1A 4O51A 1AIZA 1E3FA 4OZIB 1F13A 2X9XA 1HHHA 1SXCA 1OLLA 1I7UB 1NUGA 2R2HA 2VDKH 4QYOA 3VG0L 5KUMA 2WWMC 2WHVA 1F4XH 4N6QA 2FB4L 1DR9A 3PWPE 4XRCA 3D69B 2VIRA 4G6KL 3TBWA 1J05B 5DHYA 5F71A 2ZXBA 2ZUVA 3MODH 4IOIA 3TOPA 1V8HA 2DWYA 3H0TA 5BS0E 3ECWA 1HTYA 1JK8B 5DO8A 5MI0B 2IGTA 2ZP8A 1T0MB 1QSED 5MERB 3IWVA 3DJSA 1FN4B 3KDMA 1WCQA 5F89B 1VENA 4JQIH 4O51B 5D1ZA 1ACZA 3HZYA 3O6LH 1HHHB 4IHOA 3X1FA 1KYOJ 1ZEAH 2BDNL 4KX8A 2R2HB 5I66A 4QYOB 1UENA 1YYCA 2QADC 5JIQA 4OM0L 4OLVH 1A4JA 4XRCB 1WQVT 2VIRB 5B3JF 2NNXA 3K80A 4YDJA 3DIDA 3TBWB 5DHYB 1HHKA 4IOIB 3KPSA 3H0TB 3LN4A 1JXFA 4CVZA 4CVWA 3RKDD 1F97A 2Q0ZX 2VN4A 4EUPH 1HYRC 3KPMA 3NSFA 2NX5E 2VDLB 3GMMA 3Q2CA 5KVGE 2WTRA 1GYUA 3A0OA 1MCOH 2UWEF 1OT1A 3HG0A 3KDMB 3QUXA 3QNFA 4I8DA 1A6TA 4M7JL 4XN4A 1OAXH 5HJDA 3WUWA 4APQC 1T03L 4QRUA 5D1ZB 5AVYB 3HZYB 4YE4L 3FHAA 5CJ8A 4IHOB 3DA0A 1FV1B 1OTTD 1R0AH 4NAMA 1UASA 4CGUB 5I66B 2VDPB 3S88L 1F02I 3TEZA 1A4JB 2JLPA 5L0QB 3OAZH 5GJSL 4YX2L 3ZE1B 4YDJB 1LYQA 1HHKB 1OPGH 4W9CC 4ENED 3NK4A 2CPCA 1EIBA 2YAOA 3KPSB 2CKNA 3LN4B 4CVZB 2ZWKA 4N2DA 4NWUH 2EKSA 3GNML 5C0RH 3KPMB 3GMMB 5JR1H 2X41A 1N19A 2WTRB 3A67H 2AS5M 3QUXB 2HT2D 3WUWB 1A6TB 4LVHB 5I1IL 4QRUB 5GGVL 4X98A 2W80C 4M9OA 4NXSA 1P9MC 3DVGA 3KYNB 3VXPA 5F9OL 1LWHA 4DO5A 5TQ0L 5ISZA 4OTXH 3U2IA 1HDMA 1ZRUA 4Q9RL 2YPLE 4NQVB 2A74A 2ZUSA 2WB1A 4OAWA 4X80H 5JW5A 2BRQA 4ZSOA 1MW2A 3RG1C 3Q5OA 3KM1A 4XX1E 3QWNA 4HCGA 1XF2A 4I3RH 1NBVH 2EKSB 1XIWA 2XXGA 1FVDA 5DS2A 3MOBH 1S9VA 1SJEA 4BZ2L 4YWGH 4HVBA 1ID5I 1XT5A 2APWA 1UM5L 1N5YH 4IDJL 2EIMB 1S78D 4QXGL 4CC1A 3L4UA 3AQDA 4X98B 1MRCL 4PJGF 5GRXG 3DO7A 3B8YA 3DVGB 5BRZE 3QZOA 3WIIL 3VXPB 2VC2L 3VM7A 5ISZB 1IKNA 1HDMB 4QOKA 3TYFB 1XDTT 4N3UA 4FS0A 2PR9A 3OMIB 2A74B 1EA9C 5HVGB 3QHTC 4U3HA 4OAWB 4FQCL 4ZSOB 4P59L 1OP4A 4KNUA 2PXYC 1XF2B 3F04A 1XIWB 1FVDB 4NC1C 3SBWC 5AVXB 1S9VB 1SJEB 3IAQA 5EEXA 3IGAA 3IE4A 1MELA 2IAMA 5A43C 2O4EA 1TQSA 3QUXD 4LAJH 3DO7B 5I1HH 3C6LC 2QSCL 5DURD 3VD7A 2HT4C 4QOKB 4UAOB 1BVLA 2R69A 1A1MA 2NY6B 3EFFA 1WE5A 3O6FA 2FX7H 3UOAB 1KXQA 2FLRT 1OP3H 5IBTH 5BUGA 3SDCA 3MYJA 2V9QA 3IKKA 4GI8A 4MCNA 4Y9BA 2UZIL 4E9VA 1AVAA 4P04A 3ABZA 4TULH 1S46A 1KV3A 5F7FA 2EVGA 1F58H 3BISA 4A2FA 5K59E 1AY1L 3IGAB 5FA4B 2DMHA 2XJKA 5LHDA 2IAMB 1ZLVK 4M3JA 3NZHH 4L0ZA 2QKSA 4FTVE 4OGAD 4ZFOA 1KENL 5DMGD 1J1OL 1KDJA 5T1KA 2BWDA 1HKLL 2B39A 5K33A 3RHWF 4X8CA 1E4KC 1ZIAA 4NZUH 4KTDL 3HBGA 3N1PC 2GSMB 4FABH 3W2DL 1BVLB 2CALA 1A1MB 1D6VH 2JCCA 3UZVA 3EFFB 3LQAC 3O6FB 3UL4A 4DQAA 2CR6A 2W9LA 5ISZD 5EO9A 4JAMA 1J87A 3VW3L 1VF5C 3SDCB 2F7PA 3MYJB 4Z7NE 1VGEL 1CXLA 2Z8WC 3LB6D 4LOEA 1AR1D 2ROXA 4GT7A 5LO7A 3MRFA 1IGML 1SVBA 1TEYA 1XIWD 3IDGA 4R83A 2JB5H 2QGDA 5C7ZA 4M62L 2VXUH 4ZFOB 2JKLA 1OVZA 4NZFA 3FU5A 3OMAB 3N40F 4KMTL 5T1KB 1BEXA 4RH4A 1X9QA 2XN2A 1FC1A 3I02A 3R19A 4FQLH 4XMTA 5DFTA 5FS5A 2JCCB 4HF5L 3UZVB 4Z3GA 3BWZA 3LY6A 4Q7DA 2YWYA 5AWNH 4HCIA 5EO9B 5IB4A 4JAMB 4M1GL 4QOKD 1B0IA 3TV8A 1YUKB 2NY6D 2LAAA 2NY2C 4RGNB 3U30B 5DZOA 2V2WA 5JPNC 3ARDA 4WI7A 1EJ8A 2EDBA 3QZNA 2CM5A 1FO0A 3W11D 1HJCA 3MRFB 3FJTA 4Y8DC 3IDGB 1IGYA 1MW3A 2D0HA 2XWDA 2VLRE 1OTUC 2J6EA 3R18A 4UQCA 2R1WA 4L4TE 3RZCC 3VDAA 1MIEL 4PW9A 2C9QA 3I02B 1BFVH 4ZNEE 1CXHA 1HQ4A 4GNKB 3M8OH 2BHYA 3CJJA 1INDH 4PP1C 2D3NA 2VKXA 5BV7C 5IB4B 5L2KE 3OC5A 4LPXA 5KANG 3O6FD 1HZHH 1GYCA 2V2WB 3EZ8A 3ARDB 4J3OG 2ZOUA 2NT0A 4DERA 3FHQA 4K5OA 1FO0B 2CRYA 2FRGP 3LOWA 3RWFA 2Q7YA 1IGYB 2KPWA 3B2UC 4GIOA 3DX4A 3NIGE 4N0UA 3L1OH 5FIEA 4M5TA 3LRLA 3B2XA 2R1WB 4NPJA 5DMIH 1NDMA 5C6TH 4D0DA 5HHVL 3O9WC 1HQ4B 1SM3L 3GXUB 2CA4A 4JN2A 3BSZL 5F6IC 3FB6A 3D07A 4MJ2A 1BVZA 3WSQL 1GY2A 1Q9WA 4PHZA 1AFVL 3VWKD 3MV7A 5LNEA 1NTDA 5LXVA 4HWEL 4RGND 1M7IA 4JDEA 2Y6SD 3DXAD 2DW5A 3ETBJ 5LGHH 1YPZA 4JCLA 2A9CA 3OQ3B 1ZHLA 1F1DA 5AB1A 1EGJH 4N0UB 4G9DB 1G7QA 3A4DA 3SKMB 4D0DB 1CVSC 1NGQH 1NDMB 2W0FA 1QAWA 3A3YB 3W5MA 2B8OT 2QLYA 1LDPH 3SY0A 3GZQA 5KSAD 3H53A 1DBJL 3B7TA 1PKQE 1QR1A 2X10A 4JN2B 3PL6A 5GS2D 3RJDA 2VZVA 4F7PA 3FB6B 3F6IA 4HKZA 4DZ8B 2IADA 4Y1AA 1Q9WB 2NCEA 3AREC 3MV7B 4GAFB 2EILB 3FL7A 4YNYA 5J1SC 4DVRL 1OGAD 2AQQA 4U33A 3ZHKA 1M7IB 2CMRH 4JDEB 3ULVF 4HS6A 4MA3A 2WBJA 1YPZB 3ARDD 1J1PH 1YNTF 1ZHLB 1XTMA 4IU3A 4EZKA 4W4OA 5GS0H 1A0QH 1ETZA 1G7QB 2K4WA 4PGEA 2W0FB 1O6VA 2C34A 2C1PA 4ZUWA 1NUFA 5F9WB 3SY0B 5CBAB 2B2XH 5CF3A 4P5KA 1BD2A 3KPNA 3PL6B 4F7PB 5FGBC 5KZCD 1AQDA 1G7JA 4MCZA 1C16A 2W1NA 4HKZB 4GS7B 2IADB 3QQ9C 4Y1AB 2C9PA 4YNYB 3HVNA 2P5EA 1EANA 2L8AA 2VXVH 1N7ML 2YAMA 2XN9D 4IOSD 3S6CA 4PW4A 3HN5A 5DJ2B 4AMWA 1DQMH 3NCEB 4HS6B 4MA3B 2WBJB 4PJXF 4GUQA 2BOLA 2Y36H 1WTGT 5DQDH 3EZJB 2IVFC 4V2CB 4IU3B 4JO1H 1FZMA 2DD8L 5B22A 1ETZB 2UY6A 4PGEB 2YRZA 4G83A 1QZNA 1UWGH 2C1PB 4GQRA 4ZUWB 5IQMA 5I6LA 1E4XL 4J28A 1XH3A 1GYWA 4LFHG 2W9EL 2WP3T 3FO1A 1B9ZA 3H3PH 4IOFC 4P5KB 1BD2B 3KPNB 5GRVL 4D0CA 1J8RA 3SDDA 1AQDB 1G7JB 4MCZB 1C16B 1R75A 1L4IA 5JHMA 4AVKA 2E4FA 1H3PH 2NW2A 1ITCA 2BSBA 2TRYA 1QVOA 2BVUA 2P5EB 3Q8CA 2OBGA 4JO4H 5CP3A 4AUUA 2Q87A 4MCYA 4EN2A 5HJ3A 1F4YL 4MRCA 3LD8B 1YEIH 5DHXB 2K6ZA 5DHMC 3B1UA 1RUKL 2WO2B 1B2WH 2ETWA 4OR1A 1FZMB 3X14A 1HE7A 1ZE3H 2UY6B 2ZWSA 4K07A 4TMPA 1MWAL 1AC6A 2H4EA 4AV0A 4LSSL 2A4EA 1G0DA 1NFDF 3ZT7A 1LO4L 1QSFD 4F27A 3QCTL 2QSVA 4A7GA 1XH3B 1T0NA 3FO1B 4OGQC 2DQMA 4D0CB 2DEWX 3KPRA 4NYLA 2OTPA 2E56A 4HLZG 3SDDB 5C0IA 5DEGA 2EDNA 2JJSA 3H9HA 1T83C 5EEYA 2EDEA 4BE5A 2GEQA 3REVA 2NW2B 2WBWB 1QVOB 4X9YA 3GD1C 3LMJL 9CGTA 4MCYB 4UT6A 5HJ3B 3KJ4B 1IIKA 1IAIH 3MSPA 5CZVL 3CMOH 3FHEA 4OZIE 4YDVA 5BPPA 4G6AD 2NT1A 2W95A 2NLJA 5FKAA 3X14B 2WBJD 3PREA 3IU4H 1AZCA 4R5TA 5I1JH 4OGXH 3HC4H 3S97C 3VSUA 5E6ZA 2A73A 1T0NB 2XY2A 3HOGA 3WY3A 2GCYA 4MJHA 43CAA 3KPRB 3CZSA 4NYLB 5IMMA 1CLYH 1UM4L 5C0IB 2F15A 1A7RL 3OKOA 4IKIA 5DEGB 3H9HB 3MRQA 5E8EA 1BD2D 2AITA 4JM4L 3REVB 3BAJA 3B2PA 2NY3C 1NCTA 1VCAA 2KLSA 1RPQA 2GY5A 1N0LA 1RK0A 1DBKH 1JPSL 2F74A 4DP4X 4QJ5B 1BYNA 1DQQA 2P5ED 4O9HH 5AYTA 4YDVB 3C2AH 3I6KA 4PVBA 1T22A 2NLJB 4OJEH 5FKAB 1ZV9A 5EV7A 4P23C 2HG0A 5C0AA 3D30A 5KSBA 4PJ9C 1PG7L 1MVYA 2DQGL 2BS8A 5FYLL 1R5WA 5IB5A 2J1WA 5IHLB 2A73B 1JZ2A 1KEMH 2GCYB 43CAB 2QV2A 3CZUB 3V4LA 5IMMB 1Q0XL 3W9DA 2F54A 3OKOB 5CD3A 2CIIB 4PGJA 1OLZA 3MRQB 4ONGL 4LHUD 4FEIA 1ZXKA 5E8EB 3ZGIA 2XA8H 5HYJA 5DJ6B 5KYXA 1OL0A 2CQVA 4NBYB 1DEDA 1TG8A 1N0LB 2QGBA 1RK0B 1L7IL 3GKWH 2F74B 3CC5A 4L5FE 4P5RA 2YKLH 3KDPB 2DQUH 1LL1A 3QP3A 3I6KB 4O5LL 2A77L 1T22B 3WO4B 1WVZA 2CO2A 4HX1A 2BWQA 3H42L 4A39A 3SPHA 5C0AB 4GQ9L 3QZWA 5KSBB 1JWUA 1R5WB 5IB5B 3OAYK 1GSKA 3ZE1E 5DYFA 2O5YL 3EF7A 2W5PA 2YEZA 2F54B 5E2WH 3KPSE 4FFZH 3W9DB 5CD3B 3FPXA 1E7UA 3I2CH 3BD4A 2F8VA 3KPRD 3CCHA 3MGTA 5DC0A 4ATTA 4F58L 2PPCA 1U0QA 3WKNA 3A24A 1E4XI 3ZR6A 5HYJB 5KYXB 4MJ4A 4MQXC 1NDTA 3GM8A 3LXBA 1JVKA 4P5TA 1II4E 3CC5B 5EOCL 5DEFA 4NBZB 5AW0B 4WHDA 3MUHL 4XVSL 3G6JF 4HX1B 4V2BA 4AQ8A 1L0YA 4H0GA 3L5XL 4WCYL 5EC1A 3QZWB 1L9NA 1A6WL 1TTBA 3APNA 4K3EH 1JWUB 4RCAA 4IK7A 2VSKB 4K94H 1Q9OA 3BZFA 2V8LA 5GGTH 5IHUH 3U6XS 4FJYA 2YEZB 3BYYA 2DQCL 3H85A 4NQTA 2EDFA 2EXWD 3SDXA 1YECH 3CCHB 3MGTB 4N0FA 3RAJH 5IESH 4KVCH 4BFKA 5F88A 3CVHH 4JPKH 4YC2C 3N42B 3MRIA 2WQSA 5DCCA 4HSAC 4JY6A 4P5TB 3HN8A 4PGCA 3P3UA 2XVGA 5DEFB 4UTBH 3MRBA 3H9YA 3QORC 4P9HH 5EC1B 3X17A 1URIA 4HG4K 5ISZE 3HBQA 4H8WC 3IPEA 4S1DD 1Q9OB 1TMQA 3IFLH 3BZFB 4Q9QH 2ITCA 5J89A 1MJ8H 1TJMA 1COBA 2J4WH 4TSCL 2GAZA 4ZSOE 3SDXB 5CMAA 3ZLQC 1E2WA 5IIEA 2ODIA 4TKWA 3CZFA 4B9ZA 4N0FB 3PV7A 3QQ4A 3O2DA 4XNBA 2F54D 5F88B 3MRIB 2OR7A 1C8QA 4JY6B 1IGFH 3N0AA 1AAJA 4X0NA 4PGCB 5B1KA 5E1IA 3TO2A 5CCKH 2Y1ZA 2LVEA 3MNDA 3MRBB 4NOBA 5DC4B 4HXAH 2JLLA 3DGCR 3OSKA 3ZRCC 1KGCE 1UCBL 4QOKE 4XP1H 1I8LC 3T2NH 2F6AA 3FC8A 2ITCB 1IILE 1IRAY 3ZO0A 5CN3A 5FM4A 4FRWA 1DVYA 1CI5A 2GAZB 4OF7A 2R9HD 4GAGH 3HC0A 4PD4J 5CMAB 3OPUA 5IIEB 3CZFB 1UKTA 4K3HA 1CL7L 3GLAA 1CYWA 4OZGA 3QQ4B 4F93B 5EZPA 2G9KA 4M3KB 1BGXL 3PY9A 2YBRA 5EU3A 3TF7C 4DPCX 2A9MH 4WF7A 3TO2B 5DD3L 5HYSG 1KGYE 5CSGA 3S96B 1G9EA 1U95B 4JQXC 4P5TD 2GBAA 1FNEA 5AW9B 4RMRA 1UEYA 1CT8A 1P4IH 5B38A 1Z9MA 3O2DL 3I50L 5ELIA 5LAPA 3ULVH 3CXDH 3CZKA 3ROLA 1KXQE 5E03A 3RB7A 5KVFE 1QA9A 1IBYA 2IANA 3U46B 3HC2A 4FQJL 2QHRH 3OMNB 5A2FA 4XCCH 5I6MA 2EZ0C 4OZGB 5JXAL 5TGBA 3INUH 3MDJA 3DDGA 1KGXA 3Q6GH 5EIIG 3MRMA 5B39G 2YBRB 2YXWA 4LNVA 5EU3B 1QEWA 5KBPA 2ZXQA 3AADB 3S48A 1Z5HA 5I0WA 1I53A 1WFMA 1J9CT 4XNAA 5AVWB 3KPTA 4NZDA 2ZXWB 3VB9A 1FNEB 4A2HA 1QBML 1R5VB 1XAUA 3JV6A 1UYWH 2X5PA 4Z18A 5B38B 3SQRA 1GGBL 3WLWC 4GP8B 3ARFC 2JCCE 3FKUS 3B9EA 3TYGH 4XAWL 4BKTC 2OCJA 4FLQA 3ROLB 3NMEA 1IU1A 6PAZA 1QA9B 1A7QL 3HI5H 3NT0A 4L3CA 1SXBA 2IANB 3BLBA 4K3JL 4N2OA 4RGNE 3DXAE 1VADA 3GIZL 4Z95H 2CR0A 5TGBB 3ARVA 3UTPD 3MRMB 4PY7A 4LSRH 4UBDC 1AKJD 2ZCZA 3PXHA 5B1JC 1QEWB 1OK0A 1RZKH 3WBDA 5KANI 1KXHA 4IMKA 3FSVA 3X2QB 4BH7A 3WXVH 3CLFH 2A6DA 3FFCA 2FK9A 1NBQA 1S7TA 4WI9A 3JV6B 3NJGA 3LKNA 3WEOA 2XBTA 4M1CD 4N0YL 2X4SA 1ET5A 4O4YL 2NXYC 2ZCKH 4L3CB 3H2QA 5FUZH 2O6CA 2P28B 3AWEA 1VADB 2DDQH 4J8RA 2CCVA 2AI0H 3C09B 5CUSH 4PY7B 3SPJA 3SE6A 1R17A 4XP4L 2F5AH 2YEQA 4BH7B 2LU7A 4AOFA 5GJTH 5EDSA 2O26U 2CHDA 3FFCB 2A6DB 1S7TB 2V5RA 3LKNB 3X12A 1VA9A 2DOCA 3K8KA 3QHFH 2ARWA 2R39A 2X4SB 4P2RA 4CMMA 2AGJH 1OM3H 4OB5H 3P1VA 3HMWH 2BP5M 4HQQL 4D8PA 1S7QA 1NFKA 1JN6A 2J71A 1L9SA 4J8RB 2XQBH 3I6GA 4G8GA 2IAND 1E42A 2GBVA 3IAPA 4TUOA 5IVZA 3ROOA 2BPBA 4GPVA 1YSOA 3WFCH 4N0UE 5CZXC 1FHGA 1O6TA 3NGBB 4JM2A 3GJFA 3IVKA 35C8L 3X12B 2DPKA 4LCWA 3QC5X 4P2RB 4CMMB 1GC1C 4PSRA 4MWFA 4NOFA 2P24A 3DK0A 3F58H 4KXZH 5HP5A 5JPMC 4D8PB 1QFUH 1DYZA 1OSEA 4ORGA 1JN6B 3BKYH 3MV7E 4KQ4L 1BOYA 3HJ0A 4YBQD 3I6GB 4G8GB 3ZHNA 3I85A 4TUOB 5CJOH 5IVZB 3ROOB 1IBDA 1YPZE 1Q9KA 4G9FA 4GBXA 1WITA 1F00I 2N3JA 3QUML 4YDZA 3ULUD 2XY1A 3QWRA 1LEIA 2Q8BL 2W60A 2IWFA 2J1XA 4JM2B 5CZKA 3N85H 4L1SA 3GJFB 1K2DA 1XF5A 3IVKB 2V5TA 1NKRA 4YSPA 4LCWB 1FSKB 3V4PH 4ODTH 4MWFB 3ZDZB 2P24B 4YLBA 1KT2A 3DO3A 4B95C 1IUZA 4Y1AE 4F8NA 2ZX5A 4ORGB 1QHQA 4KXCA 2AJXL 4F7KA 3QH3A 3B2VL 4OJCA 5F7YC 4UM9D 3MR9A 5FDWB 4DKFH 4D3CL 1Q9KB 3L9YA 3NJMA 4G9FB 4GBXB 4PWJA 1FGNL 4GI6A 4DEPB 4EEEA 1KBWA 1WT5A 1WZ1H 5E08H 4EBQH 1BAWA 5GISH 3RVTD 1Q0YH 3J8F7 4Z9KB 3T3MB 2W60B 3CK0L 1LEIB 3UCRA 1KIPA 1N2RA 2GTZA 1K2DB 1XF5B 2XQYA 3EDJA 3LKSA 3ASWA 3RKDC 3WIAA 4LQ1A 1BCIA 1QUNA 2K8MA 4HWUA 1B0WA 4W9ZA 2BP8A 2H9GA 1BD2E 3I84A 1MHEA 2TSBA 3BFOA 2VE6A 1KT2B 1SPDA 4UV4H 3ZGHA 4P2RD 3UYRL 1W72H 2ZUQC 4WWPA 1G5AA 4YDIL 4M8UA 3QH3B 5E1HB 2P5EE 4BBWA 2DJ4A 2VO8A 5DFWH 2OZ4A 3NFSL 4KBPA 3QJVB 1OTTC 5DJAA 3GBLA 3MR9B 4JZNA 5FB8A 2UUDH 4G8GD 4ELMA 3AU1A 3M46A 4FKEA 4LBAA 5INDA 1TJGH 4DF9A 1NCBL 5J1AA 5I9QC 3P77A 4IYKA 2VXQL 4GI9A 3SQOL 1KIPB 1N2RB 2GTZB 3GI8H 3LKSB 4F7CB 2NYZA 3ZXAC 1QUNB 1UADC 1IE4A 5MENA 2BP8B 5L4FA 4JM2D 4HHGA 1V54B 1F90L 1MHEB 2VE6B 3BGMA 3TH3T 5MI0C 1H8OA 2HT2C 3KVPA 4PBXA 5AG8A 1K5NA 1UZ6F 1EAJA 4RDQG 2WLZA 1OWWA 2B1HL 2IPKA 4DGYL 4XHJD 1I8UA 1OAQH 3GO1H 3T4AA 5A2IH 4XCFH 1A22B 2J56A 2GSGA 2WLIA 4RZKA 5DJAB 5KBKA 1GL4B 4JZNB 5TPWL 3P9LA 2EADA 1E28A 4FMKA 2FUQA 4XNDA 2GBUA 4ELMB 3AU1B 3FQ2A 5INDB 5EF3A 1IC0A 4G9FD 4GBXD 5J1AB 2E5EA 3P77B 4PIRF 2ZJSH 3EHBB 5I1AA 5LVEA 4QRBA 5MENB 2E7BA 3KPRE 3LHAA 4M3HA 4NAQA 4AXWA 5HHQA 5MHSD 2ZAHA 2MNUA 4PD4K 1ZY9A 2HLFD 5TD4A 3EXLA 3P02A 3BGMB 1HK6A 1S78C 2GC4C 1K5NB 3BAKA 4QTFA 1AZBA 2OMNA 3VD3A 5A3ID 2IPKB 5LCVA 4RSVA 4LGSB 3T4AB 4JDZA 1X5AA 1I9IH 2WLIB 2GSGB 4NENA 1I75A 1LE5A 1MW1A 3P9LB 3QB7C 1E28B 4UQ9A 2AEWA 1P53A 4HZLA 5TE7H 1PEZA 1QLFA 3H6AA 1IAOA 2Q6WB 5BVPL 2E7HA 4IBLT 5E2TH 1N6VA 4BZ1A 5L0QC 3VD1A 3HBPA 3LEVH 5I1AB 5SX4I 4AXWB 3AS3A 1INEH 5HHQB 3T0XA 2BSEA 1OAYH 1D5MA 2WXHA 3GSXA 2X2HA 5CCJA 2F18A 1A4AA 1F2XK 2CRZA 1TTCA 2Z7YA 4GQZA 3T8VA 5GSRA 1UOLA 4JQIL 4EN3A 3QUXC 1P5UA 3WNMA 3O6LL 4JDZB