4G82A

Crystal structure of p73 dna-binding domain tetramer bound to a full response-element
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
201
structure length
201
Chain Sequence
HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of p73 DNA-Binding Domain Tetramer bound to a Full Response-Element
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Tumor protein p73
total genus 37
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g82A00
2H1LM 5KBDA 2RMNA 2X0WA 4L18A 4A63A 4IJTA 1CO1A 3Q01A 5LAPA 4L0ZA 1IO4C 4AGOA 4KVPA 3Q05A 4LO9A 4AGLA 3WTYA 3WTTA 3D0AA 2J1WA 3QYMA 3EXLA 2AHIA 1YCSA 3D06A 3D07A 4XR8C 4GUOA 3VD0A 3IGLA 5ABAA 4L0YA 4LOEA 1HJBC 2ADYA 3WTSA 1GZHC 3TS8A 2IOIA 3EXJA 3ZMEA 4G83A 2P52A 2XWCA 3KZ8A 2XWRA 1LJMA 4AGPA 1HJCA 2J21A 4IBZA 2OCJA 3WTUA 1TSRA 3WU1A 5A7BA 2BIPA 1T4WA 4GUQA 4AGMA 3D09A 2GEQA 4IBYA 4IBQA 5AOJA 2AC0A 4IBSA 1E50A 3D08A 2IOOA 2YBGA 2MEJB 4MZRA 4AGNA 1CMOA 4G82A 5G4MA 4AGQA 5AB9A 2WGXA 3VD2A 3D05A 2X0UA 2IOMA 5AOIA 3WTXA 3QYNA 4MZIA 1HU8A 3KMDA 2BIMA 5BUAA 2J6WA 2X0VA 3WTVA 4IBTA 1UOLA 3VD1A 3US1A 5G4OA 1GZHA 1EANA 2VUKA 2J1YA 2J1XA 5LGYA 5AOMA 2J1ZA 5AOKA 2ATAA 1KZYA 2J20A 4QO1B 2BIOA 4HJEA 2BIQA 3Q06A 2FEJA 5AOLA 4LOFA 2BINA 1TUPA 2PCXA 1H9DA 5G4NA 5ECGA 1EAOA 3WTWA 1EAQA 3IGKA 3US0A 4IBVA 4IBUA 4IBWA
chains in the Genus database with same CATH superfamily
4JFOA 1E9QA 3IJEB 3OKEA 4JANA 2AXFB 4KZCA 4NKIH 1RZIA 4B53A 4U6XA 3VXOB 5IW6B 4LNRA 5C0CD 2C3VB 3EXLA 2OMTB 4C59B 3F64A 3LN4A 1I9IL 2XWDA 5DZOA 5DRNB 3QXAA 2X7LA 4U3HA 2Q2EB 4UNUA 5KSBB 1IM9D 3EKCA 4ODVH 3DYOA 5I73C 1U8CA 4YDNA 5I16A 3LH2L 4L29B 3BRDA 1NDTA 5B3SB 2ADIA 1FCCA 2WBJB 4FZEL 3E6HB 3HC2A 3PGFL 1Z9NA 2OSLB 3GGWB 4BDVA 3MV7B 4BFKA 4HUVB 1BQLH 3EYQD 1XCTA 3VFUA 3EJUA 4F3FB 2VR9A 1DBKH 4PJCF 4YDVB 4IBZA 4O4YH 4V1DD 1QNZH 1YYMH 5HHXH 3V7AE 4DGUA 3VH8G 3STZB 2DLHA 3RTQB 3S96B 4G9FD 4AQ1C 4OUUB 1ILSA 1FP5A 5C86A 5T1KB 3FJTA 1O6SB 4U1JA 1FORH 1S7UB 4QHUA 4N28A 3GC3A 4MZRA 1G1OA 5C8JB 2VN4A 2GT9B 4NUGH 4KY1H 4F3FA 4OKVB 4OGAC 3ARTA 5K59F 1A25A 2NZ1A 4M8UA 1J1OH 1T0OA 4R0LB 4TVPD 1I8IA 3FQ4A 1WJ3A 3FL7A 4AL8H 1E4WL 2DIEA 5GS1A 3FW6A 3MRQB 5IBUG 4GY4A 2YXFA 4ILDA 4W81A 1JZHA 2MPVA 4PJ7E 3RIFF 2D9CA 1UADC 2YQGA 3X2QB 3CBRA 3L5XL 1MI5A 4P2QA 4P8QA 1QSFE 4E41B 4P3WA 1SPDA 2IGFL 3P0GB 5E7FA 1SHSA 4K71B 4XRCA 2WXOA 4LASL 3QXAB 4CC4C 4QOKD 5MEND 4DPRA 2WYZA 5I1EL 2B1AL 5FLUA 5JLZB 2WPGA 2XIBA 2P4AB 2R39A 3ALWA 1AXIB 4B50A 3TL5A 1HILA 1C08A 2Z6FA 4WNQA 1QSVA 3LPOA 1RZIB 1R33A 5DLLA 3I6GB 4IEFB 1J0KA 2WLLA 4X7FC 1MCNA 1ES0A 1MRCH 3CN2A 3FQTB 5C08B 1MCIA 3N1QC 1RFDL 2UZYB 3IN2A 3SD5A 5J8OA 3H7LA 5F8QC 4Y16D 1CURA 1CDHA 1CBVH 3FU9A 4UT7H 5EUOF 3GPEA 1DN0A 4HUWA 4LU5H 4DAGH 2IQAB 1FZMB 2I60L 5LBSH 2WP3T 2G3MA 3BP5B 5F7AA 2ED9A 2ZUTA 1E5UI 1OCCB 2IADB 4YXHH 2I69A 1UOWA 3NQKA 3IJ8A 1ID5I 1WHOA 2QKSA 3EO9H 1Q1JH 4HD9A 4NUQA 4ES8A 3UO1L 4FNLH 4HF5H 1CICD 2WQXA 4M7JH 2YPVA 2ZOKA 4ODXB 2R51A 2VDPB 1EXGA 2OCCB 2W65B 3EYVB 3I85A 1ZLWK 1ZVHA 5K9KA 2EIKB 3S36L 1GIGH 3NEEA 4KRNA 5KSUA 4AEHH 4OV5A 3GSVA 4UM9A 4ESKA 4N3UA 1IM9A 2A6JA 3RY6C 2NW2B 2JJTC 3L7EB 4JAMB 4XI5C 1Z5HA 2DN7A 4L1SA 3U0TA 3ARFA 3JTTB 3OKDA 1IBGL 4KK6C 1ORSB 5ACZA 4PB9H 3IPBA 1SBBA 2F68X 2WVVA 1HXMB 1MWAB 5LDSA 3VQ2C 3D51A 3LZPA 4ETQA 2I27N 3BD3A 3A24A 4HEME 3RUGF 4IBQA 1H3UA 1U21A 2AJUL 3ZDWA 1CFSB 2FIKB 4BZYA 4WY7L 2VDPH 4PRBA 3RGVD 2BCMA 4GG8A 5D7JC 2XTSA 3JTTA 3QIUC 4BZ2L 3V4UH 1MQKL 3F2LA 3F84A 4ZZFA 3KPRD 1CBJA 3RGBA 1NGXA 2BHFA 2BNQB 2V6HA 3ESNA 4XX1E 4XMKL 4KKCD 4EN3C 1HE7A 3WSQH 1DBAL 4F58L 3ASWA 1AG0A 4AX3A 4Q6IA 4C4UA 5TE7L 2WXJA 2ZOKB 4WJ5B 5KN5A 1SN2A 3QK0A 5AUMB 5MP6L 3WFCL 3VXNA 3KPNB 3WTVA 4P99A 3VI4B 4J1UA 3BIKB 1YPZF 1FH5L 4QTFA 1HZHL 3VD1A 3WEBA 1ZTXL 3KS0J 8FABA 3RVUC 3R06A 4H8WC 4KX9A 1YECH 2BHZA 3MRCA 1AKPA 2W94A 1C5BH 4R4ND 3O0RL 2E27H 4LLVB 2WC7A 1OARH 4QY8B 2WTOA 3LH9A 2VN6A 4NQEA 5I0DA 5GSRB 1E28A 1E6JL 3SPVB 3UDWC 4NO5B 2IVFC 3BDYH 1FYHB 2APFA 4N8CL 2OMVB 4HG4J 3KVQA 3ML8A 1WFNA 2BINA 2HRPH 4G8GE 3PQYD 3B7TA 5CCJA 5J5EA 2F19H 1A14L 3WTWA 1OQOA 5LNDA 2CH8A 2VDOL 3FU8A 1OM3L 3VWKA 1JGLH 5FKAB 3SD2A 1KV7A 5EWIH 2ESVB 3ZE1F 1GW6A 5CBAA 3NDZE 4DGIH 3GI8H 4LEXL 1A4BA 4UANA 3I6GA 4LGSB 1ZT1A 1LO2H 2IMMA 2W0FB 3N1FC 4S0TD 1J8SA 1IC5H 3CSYB 4HLZG 1CF1A 4QYAA 4WUKL 4D7BA 1OW0A 5IHZB 3LIUA 3IU3A 2VDQB 4I13B 4RZCA 5E2WH 3TZVB 1G7QA 2H9GA 3OMNB 3GD1C 1R4XA 1YEJH 3AY4C 3BZ4B 5C9JB 5IHUH 4AV0A 3ZDZE 1A0QL 2X42A 3O6FD 2NXYB 5HGBA 4KJYB 4LQ1A 1TPXC 4KRPC 3T2NH 1NGPH 2YXWA 4K0OA 1BYNA 2DQCH 5CZXC 5C6PB 4PGBA 5BXFA 1NCWL 1IFHH 3DX2A 3G08A 5HYQB 3QIBC 4R0LA 1DQML 5CEZH 1XGYH 1XSOA 1SJHB 1WLHA 2NY6C 2YUZA 3Q1SH 4PREB 1GY1A 3SGDI 5F9OH 4NQCD 2Q7NA 2ZAGA 4MJ5A 3FKUS 2GBUA 4CL7A 3NIFE 4OLUL 1SXBA 2BIPA 4GSUA 5DJ2A 1LO4H 2ZCLL 5HTSA 2R7EB 1NFDF 1XMEB 3VRIB 1CE1H 3DX8B 1JE6A 3AVEA 2A77H 5T1JA 2ZT9C 2EDFA 2OJEB 3KPLB 3VFPB 2GK2A 3S37H 2O6PA 3BUTA 4LVEA 4AVIA 4AIOA 2K9FB 3JBG7 3SJVA 1M7IB 3OAUH 4CVWA 4RIRB 3D05A 4FQXC 2VXVH 3LIZL 4S11A 5HJBA 3WIHA 4L0PB 5I75B 3AITA 3PHQA 4FQXA 3HG1E 5F7FA 2I5YH 5HDBE 2HX8A 3ZE1B 2CKBL 2OMNA 4M48L 2F54D 5DDHB 5SX4H 5HHOD 3RE0A 2X44D 3R1GH 4PJ5D 4U3SA 1A7QH 4CGTA 4H4NA 2LV4A 1CTMA 3IRCA 4MQSB 4PW9A 2VE6B 3L5WB 5FR3A 1OTTC 3G6JF 2V8MA 3LN4B 5LGYA 5CILH 3HLAA 5FA3B 5AWNL 4RLDA 4ZJ9A 2I26N 3VH8B 5F6IB 4RMWA 1ZDQA 1K9TA 3GB7B 5CEXB 5HYJE 3X14B 4WTZG 1CR9L 4IRSD 5F6HI 3H3PL 1LQSR 3QCUL 5E8PB 4L2LA 4JANB 4XMPH 4R0LC 1WRFA 4M1GL 3Q6FA 2NY0B 3CG8A 1HVXA 5DD6B 5DJXA 2VLJD 3GDCA 5F88B 2D73A 4XB3A 2XG5B 5HJGA 3VGDA 4F1SA 2ZKMX 2E9GA 4NQED 5IHWA 1T1ZB 3ULVE 5ISZE 1KLUA 2AQQA 2B0SL 1YMMA 2MOQA 4NJAL 1G84A 3CFQA 3HKFA 2VRQA 1CXLA 3LJ3A 5D2LE 2BHUA 4ZODA 3A6OA 3FAWA 1JVLA 3MDJA 2YD0A 4WENB 4XP1L 3VSQA 1AIFA 3CGTA 4QY8A 1ORQA 5D1ZB 1QX1A 3LYRA 2VQ1A 3VXME 3VXTA 3AACA 4UIKH 3WTYA 1HSBB 3R0MA 1UKTA 1SY6H 1BVKA 1DVUA 4Z7UE 4V1DB 2Y69B 2XU9A 1WBZB 2H26B 2OV0A 2ROXA 3FB8A 5GS2D 3UAAA 3V0FA 1SRDA 3ETBF 2ITDA 1EEUA 5ABAA 1OOAA 3X13B 3WDHA 2PWEA 3QS2A 2X4OB 1FFQA 5EB9A 4FNSA 4JMXA 3UGEA 4Y2OB 4PG9A 2NQCA 2HLAA 2HLFD 3N1MC 2FWSA 3WUWB 3B83A 5C0IA 4GG6F 4MHHI 3EH2A 3DIFA 3SDAA 5F89A 3TBSA 3WHXA 5FYKE 2FJFB 2FBJH 3RL1A 2WOYA 4P9HC 4JM4L 2QPUA 1E40A 1KBWA 3U9UB 1TDQA 3IAGC 4JZNB 2AJZB 4G7RB 1OLZA 4FAAB 2V33A 4WW2F 4P4KC 2YUXA 4W9IC 1F00I 3MU3A 1C7TA 3ARGC 3DVGB 5B1KA 3HZ3A 2QVKA 3TNMA 3RVXD 4WGKA 1H8OA 3NEOA 4C83B 2ZKHH 3GSNH 1IM9B 4ZYKA 1QLEL 3RDTD 1ROWA 4U6TA 2VW7A 3KL3A 5B1JC 4PJDF 3L13A 4DKTA 3B6SA 3CXDH 5I71B 4YHYC 2IAMC 2AV7B 2PETA 2ZOWA 4ODXA 1UJ3C 1U95A 3DMMC 4P2OA 4UT9H 5HHME 3W37A 4UNIA 3ERXA 2Z4QB 1QD0A 3CV5A 3WUWA 4HIPA 4RWYH 3VDBA 3KYOA 2FQFA 4JFED 3P3SA 1IEBB 2YAFA 4XBEH 4XGZA 5IW3A 4CGUB 2XY2A 3HHSB 4MWFA 4U1GB 5EF3A 1VKXA 3KE0A 4TPRL 2HJFB 1RZJC 2DQEL 2UXVA 5HI4D 2FHCA 4CSTA 4ETYA 4G6FD 4R4NC 4PU2A 4OLWH 2W9EL 5KSAA 5ADOL 3EGXA 4LVNB 3VM7A 1I3VA 1QSFA 15C8H 1YMME 3AU1A 2DD8H 3E2HB 1DR9A 2Y5QA 4JY4A 1QBAA 3ARFC 3S36X 4A2GA 1ORQB 4NBXB 2MTAA 4XMLL 4LHUB 3UH8A 3RVTD 4NOFA 2BM3A 4U1IA 5KVDH 1SYSB 4CU8A 1QATA 3CHOA 1CFNA 3WMSA 1ULVA 1V54B 2K3HA 5SV4A 4FXGA 2AITA 1IGYB 4Y2DD 3VDCA 4XI5D 4X7SH 1QRND 4E9LA 2OMWB 2ZWSA 4X50A 1SHXA 1N0LA 1T7ZA 1C08B 5CSGA 3O45B 5IIEA 1P7QA 1SMAA 3GIZL 4NUPA 1GPOH 4IOSD 3H2PA 3ATFA 5LCVA 1DVFB 1YEFL 2IAMD 2XZCL 1XIWD 3HE7D 2DWSA 3UTZB 4X4YA 2JXMA 1KPVB 2CMRH 4L1TA 1Y1UA 3I9IA 1RUPH 2D3NA 2RR3A 2ICWI 3CNKA 5K5YA 2QHLA 2PLTA 2PW1A 1DVTA 5FO7A 3NJKA 3SPCA 4TQ8A 5L2JA 1OHQA 2CCWA 3BFQG 2B15A 3H54A 3MXVL 5E9DD 1G7LB 4OIFA 4K5PA 5HD8D 4FQIL 4HEPG 4Y16B 4Z0BL 5FHAL 4J7RA 5KVEH 1P5VB 4EOWL 1P1ZA 3U82B 3KWVA 2HPOA 4NFDA 2QR0B 4NPYA 4PCSA 3JV5A 5HHMB 3MXWL 2HN7A 3OZLA 4JFHE 4DGVL 2JKJA 4X5XA 3KAAA 3KPPB 3RX5A 3T2PA 5ISZA 4MMXA 1V7MH 4OTXH 4Z7QF 3SKJL 3SKNA 2E76C 1KBKA 1MCLA 1UWEL 5AAWA 3VRIA 1O75A 2DWDA 3B9DA 3TURA 4PB0L 3S9DB 2WZPD 5EORL 4IU3B 5EV7A 1QBMH 4IBSA 1PZCA 3QDME 4P2YA 5AVSB 5JOPD 1U33A 3R8QA 3BT2H 3E9TA 1WEJL 4KJQD 4OM0L 5AAWC 1JS4A 4JN1L 3BH8A 4WFHD 1S7SA 4OT1H 4OF5A 3QDGE 3UYOD 2Y5TB 3QPXL 1O9WA 2ORBL 3FUMA 3UTPD 4UMGA 1DQLL 3LN5B 4FQ2H 3AAZA 5FKPA 2K9UA 1A21A 2Z4TA 1P7KA 3K5RA 3JWNC 2DWEA 4S10A 3EOAA 3P3YA 2IANE 3MI6A 3NN8A 3OMIB 5E23A 1F58L 2DAVA 3OF6D 1A02N 3LQMA 1UM6L 1A7OL 4IMKC 2VDLL 4IKKA 2CM5A 5F7NC 1H6FA 5IBLD 3SYQA 4KVCL 4BFFA 3GJEB 1CL7H 2VLRD 2XKSA 2Y5EA 5DGRA 1MI5B 5BQ7B 3R7RA 1H3VA 2JB6A 3O11B 4RAVA 1I82A 3HR5A 3OGOE 4HWUA 4PGCA 1DZ0A 1P1VA 2EC9T 3TYFA 1X5XA 2D7QA 4MAZA 4K07A 4PJFA 1E27B 5CU9A 3VFSA 3H4HA 4I5BB 4MTMA 1L7IH 3CFEB 1PL3A 4XZ4A 3ZKSD 3CVHH 1QFPA 1WWAX 1Y7VA 3OJ2C 2N3JA 3CC5B 1X9RA 1R24B 1O6SA 1XF3A 2I7SA 4DPCX 5I6OA 4Y4FC 4H0LC 5CNHA 2WHVA 4OUUA 5TJWK 4PWEA 3VB8A 5H37A 3RTQA 5EU4B 3S96A 1S9XB 2DMBA 4EVNB 3ESOA 4NC2B 3CIAA 5IB4A 1NLDH 1RU9H 5LCVL 3ZJAA 1P1ZB 1Q9WA 1A3LH 1L6PA 4NQCB 4PJAA 4LCYB 2WY3B 5E9AA 3C09C 4YX2L 3ULUD 2GPZA 5MENE 5E2UL 2LFEA 1F4WL 2VDRB 5FGRA 4AL8L 4QUOA 4L0YA 1MFNA 3FH7A 4DEWA 5KVGE 3WBDA 1I8LC 1KB5A 2JLPA 1MCJA 5DMIH 2F74A 3HG0A 1J7VR 1L0QA 1EAJA 1F8TH 5D7LB 5D96C 2X7LB 3ARDD 1FLTX 5IT2H 1GS6X 1U8HB 1BFVH 2C7FA 5GGQH 3T3MB 5IB3B 1MIML 4OI9A 4AMKL 1A7PL 4Y4HB 3CN0A 2D31A 4GRLA 1JP5A 1ZIBA 5B8CC 1OQXA 3Q8CA 5FC9A 5IVXE 2ICCA 3VSUA 2X53A 2EO9A 1BOGB 2QTVA 5GZOD 4JRXA 4Q74A 4H1LG 3S6CA 4Z5RA 3RUGB 5KVFL 2WSKA 1MF2H 1E3FA 1NGWA 3FUFA 3LS4L 3OB8A 1ZT7B 3MJ7B 3O4LE 4GW4A 1URLA 4ZDHB 2QSQA 3LKQB 4NO2A 4IRSB 4U3CA 2NY5C 5GPRA 4AH2A 3LKSB 5GGRA 3IDIA 2YPLB 3SIKA 3ZR5A 4FNUA 4JFUA 2GJ6D 4AXWB 5E51A 1OD7A 4JFVA 3KM2A 3G6AB 3IJSA 2D2OA 1FRGL 3II3A 1S9YB 5CCKH 4ZMQA 3NIGE 3MLXH 2XYCA 2Z7WA 3UACA 1ZGLP 1IEAB 2FO4B 1DEEA 4WUUD 4JK0D 3X1NA 2X3CA 1BVOA 1WGOA 3ZHDA 1ADQL 2GHWB 5DQJA 4G80A 4F2MA 5GS0H 1A1OA 1XF3B 4J27A 3BAJA 3SYPA 3QH3A 4LKXB 5DJ6A 5JOFA 5I1HL 5A7EA 5E24E 4AXWA 3RG1C 4JL2A 3HI6H 5AKSA 3EYUL 5AW2B 2X4UA 5IESL 1CDGA 4LVOB 2AV1A 3AW5A 1A5FH 1D2PA 1C1EH 4PJFB 5EEWA 4K3DH 2QKIA 4HKXA 3QUYC 5CD3B 3VU1A 5MEOA 3IETB 4XBGA 5BQ7A 2CO7B 5IQMA 1M1XA 1HNYA 4R97C 1MY7A 2CCVA 3GMOB 3VG0H 4YN3A 4DOHE 3DX6B 2XWJB 3I2CH 4JO2H 4X6DA 1ZA3A 4WSJA 4BH8B 2EUXA 3AWEA 1EA9C 3LXAA 5FLVA 4D9LH 2YA2A 4NGHH 4P2QE 2GC4C 4D0DB 5K9QG 2D03L 1BXVA 5E9NA 2P5EB 4E5XB 4G1EA 4PD4K 3LN5A 2O6FA 4IRJD 1C12B 2X4NA 1Q0EA 2WN2A 2HLAB 2R0LH 1WFIA 1ZTMA 1HYRC 3MCKB 5TE4L 1F3JA 2C1PB 4F58H 4YSSA 5KYYA 1N6QL 1IU1A 3KW7A 3KLLA 1JTPA 1J0HA 4QI3A 1J12A 3BFWA 4AE1A 4KTEL 2N7AA 3IFNL 2XRAL 2NYZA 5GHWL 1I8IB 4G9FA 3ZOAA 1YYLL 4LCYA 4Q97A 4PS3A 5LBSA 3O0RH 4X6BB 3FZUC 3O4OC 4UBDC 2Z1KA 3CDGB 4YSQA 5IB2A 1WO2A 2CKBA 5A16A 3DJRA 4R7DA 3Q2NA 2XG4A 4HJ0C 4NQDD 3TPUA 4XN9A 3I9PA 1Q9LA 3WNPA 1J1XL 2F8VA 4NIKB 3ZKND 4ZX5A 3WLWC 2EEBA 4TUOB 4XZUB 1E5CA 3KJ4B 1KXHA 1F02I 1PX8A 3FCTA 3Q5TA 4EO5A 1BG1A 4W9ZA 3RTLA 1OE1A 4DEPB 2VDMB 4LLYA 2P5EE 1FJ1B 5F0LB 2JVUA 5IHBA 3QUKA 2FEEI 1U2YA 1YY9C 2VDQH 1IC5L 4GKSB 1UATA 4FG6C 2AQSA 4DW2H 1XF2B 1MIEH 4UTCA 3CZJA 1OWRM 3IMUA 3K2MC 1VENA 4IBTA 5I6MA 2G9KA 4HCFA 4LP5A 1KOAA 2CGRL 4ZQKB 4JX0A 3NIGB 5BMFH 1RY7B 5IHUL 5KW9H 1IAOA 3EADA 1A4KA 3O45A 2BMKA 5DDHA 2WWMD 4RMQA 4PJXE 1DQVA 4E5XG 2YKKA 3CHPA 2WBXA 1CF8H 1KENH 2J43A 5ABDE 4M93C 3GYRA 1JCVA 4HU2A 5DD0L 1XIWB 5DK0A 4KBPA 4ZUSB 3RZCA 4DTGH 1N67A 5AB1A 4GMTL 2AGJH 5I2IB 3QFJE 1PNCA 1S7SB 5I15L 4X0NA 1CTOA 1O7DE 3MZTA 4ZTOL 4DEUA 3QORD 3S5LG 3MSPA 4XOEA 3WUZA 2GTZA 4OJDH 4AUJA 4AIEA 4UZSA 4PBVC 1R6VA 5E9DB 1Q0XH 3D5OF 4JFTA 1MFDL 2R7EA 1BVNT 5DZ9A 3S3DB 1Z3RA 3LQAC 3IBOA 3NCJH 4V33A 1G7IB 2XACC 5JNYB 1LGVA 1CYGA 3L1EA 3GMRB 4APQB 1KJVB 2GSGB 2J1WA 3MRGA 4JQIL 5F9JA 4ZUUA 2XETA 4MWFB 3RPIB 4UUJA 4NPYB 1DUYB 1ZV5A 3SE8L 1DL7H 5D93B 2FATH 4ZUWA 5F7EL 3LV3A 1N5AA 4TSCH 2GQHA 5FWQA 3V4LA 2FL5A 4HH8A 4LIQL 5L4FA 3QEQE 4PY8I 1B4JH 1JRHI 1A7QL 1U8LA 4XMVA 1WICA 1EEYA 4GSQA 1IGML 4TN9A 3QUGA 3W57A 3LAFA 4P2RA 1L9MA 5C9JA 1QSED 4C83A 4QRPE 3S48A 8CGTA 3D0LA 1DP0A 2J6EH 3NSCA 1R3IL 4S1DC 5HDBB 3ZE1E 5IV2A 4OB5L 1GGIL 4ZFOB 3MODL 4I2XB 5EEVA 2L4OA 5DFVC 4XN5A 4X7TA 2YWYA 3VXUB 2A6DB 1FVDA 3B9KD 5BUGA 4P5SA 4MNQB 1P7QB 4Z9KB 1OAUL 2ZONA 4PJEB 2MFNA 3QIUA 4J3VA 5GS0C 2F58L 1GH7A 3IFOB 4YHKH 5D4IA 4CNIA 3D52A 3DV4B 3ARRA 3KCPA 5FA4B 1D6VL 4F9LC 4U0QB 1TETH 3GSRB 1RH8A 4F15B 1WD8A 4G7QB 1HWWA 4W9CC 3MQIA 4HWBH 4WGWB 2RCSL 4YGVA 1NEZA 4TQIA 3TT3L 3BKML 4UQEA 3PWPE 4X99B 1HL8A 2PF6A 3L4UA 3FB8B 4GSDL 5ANME 2A2QT 3VFVB 2FVNA 1SY6L 4NWUL 2NY1B 2X9WA 5ENWB 4U0RB 3CD4A 2J1YA 4K7FA 1PZSA 4YR6A 3PYCA 4NCDA 2J7LA 5ACLA 5DJ8A 1F18A 3LRGA 4UTAH 3EO1B 3ISRA 1GL4B 4XN1A 5IJKA 3X1BA 1OTTD 4WKZB 1JZEA 3LRSB 2CLZB 1NBYB 3FMGH 2Z4QA 2ZCHL 4OCWL 2HG0A 3F7KA 5H8DA 2AS5M 3FBQA 5BV7C 3MRHB 1UCBL 2AJYL 1FSKB 1QO3B 1TITA 2BZCA 3ET9F 1JNNL 5JPNA 1H3PH 5DFVD 1CE6B 1JN6B 2A73A 1KB3A 3FSVA 1FHGA 5FFOA 2F7QA 4ZYKB 1GGYA 1MCQA 3C60D 4JM2C 4KNSA 1IBDA 1QVOA 5CP3H 1JPSL 2M8XA 3T0XA 2AERT 4JFEA 3ULUF 3QVAA 4I87A 2YMXL 1KCKA 1LD9B 1KDJA 5D7LD 5D5ME 3COOA 5HY9A 2OL3L 3IVKA 4M61A 3VCLB 1I4FA 5T1MA 1CFQA 4JMNA 3WJLC 3AXLA 2Y2WA 4B60A 2XUWA 4WEBL 3BSZH 5DZLA 2ENYA 4HQQH 1HKLL 1A64A 2OMYA 2YAPA 4X5WA 4XB8A 3L3KB 4XWGH 3MUJA 1MFAL 2DLIA 4ZXBA 3ZE2B 1AI1L 5JQ6L 3S5YA 3NYKA 3BPOC 3T71A 3NABH 4X4MA 4RESB 3ZZSA 1R3KA 5AW4B 4TLUA 2QZQA 5E4IA 5AVQB 1T3FB 4LLAA 4ANKA 4IIZA 4X9FA 3BP7B 4KNTA 4JRLA 1HIMH 1KTLA 3SCMC 1JG9A 3Q8FA 4RAUB 1LEKA 3ZTEA 4F7MB 2EYTB 2CIIB 3IBEA 2C9QA 4J4PA 4UIMA 2IH3B 1KTJA 3QFJA 5GS1C 1QRNE 3AWFA 4JRYB 2BFVL 2QGCA 3D09A 4HJ0D 2B2XL 3SDXA 2VKXA 5D2LA 3QA3A 4BK8A 5ES4B 3QWOB 1P84K 4MJ6A 4M43L 4GW5B 3D9AH 4DZ8A 3LOWA 5IMLB 4H5SA 4AZUA 1DHKA 2QPEB 1BAFL 3HJ0A 1QBBA 5H37G 5HYQA 2I07B 4BZ1L 3STLB 2C9AA 3VX0A 5IVXA 1CDBA 2B3IA 5I74B 4UMSA 1KLUB 2ZUUA 4I4WA 4BQ6A 1JYXA 4PGBB 4JG5A 2PYFA 1JVKA 3SDAD 4JFDE 1WG3A 1NKGA 4LESA 1B2YA 5DYOA 5L88L 3Q6GH 2CBMA 5DEJA 2XBTA 5C2BH 3KNBA 3O3DA 1NICA 2ALAA 2VSKB 4QXTA 5I0XA 3GMQA 3RWDB 3DRQA 1NCUA 5HHOA 3HUJF 4JZJA 2JF1A 5F7WC 3QUXD 1BHGA 3G04A 5FA3A 5JW3L 5MEQA 1BVZA 1F1AA 1XDTT 3U4AA 3PJSB 2WWMC 2W0FA 3WEXA 1L0YA 4Z7NB 1CDUA 2Y07H 1FJ1A 5EOTA 3AU0A 2AZUA 3VWJB 1S3RA 3VGAC 4Z7WB 1UD2A 2XWBB 4HK0B 4OZFH 5C7ZA 5AW7B 3G6JB 3NK3A 3VWKB 5JOEA 1PKQE 2GT9A 1M7IA 1BXUA 3US0A 2Q20A 1U42A 4BD4A 4ZMZA 1XD0A 3OZ9L 3WJLA 2X6CA 5DT1H 1BD2B 1UWEH 1NMCB 1N59B 4ABVA 1U3HC 1M05A 2WAHA 2XX0A 1FL5A 2DQHH 3WDIA 1BJ8A 3GXIA 2Z64C 3D0AA 3R06B 2WXNA 5AVYB 1LP9A 2D4FA 3NJGA 1PPIA 4HBCH 1A8ZA 4RGMC 3SPGA 4CU6A 3QS3A 3GSUA 3R8BB 2F53A 2H2SD 3FCGA 2GYSA 3EGDB 1U8CB 4CMMB 5JPNC 3DMMD 3T4AB 2IWFA 2NY6B 2DM4A 4XP5H 3MLVL 2FE0A 1M6OB 4LCWB 3HVNA 3M07A 1XR9A 1UEMA 2OMTA 5GISH 4E9VA 4NJ9H 5IJKC 3IRZA 3MYZA 2OR9L 5CN2A 2I9LA 5MHSD 3P4OA 1YNKL 2VABB 3WU1A 2JV6A 3FQRB 5IHZA 3V9FA 1EJ8A 3RDTB 1OAKH 2YQ3A 2K4WA 2UY6B 3VU2A 4G9FE 1E50A 2PP8A 3D08A 3O6ML 5C3IA 5I75C 4ONOA 2ZXQA 4ZTEA 1O6VA 3NP4A 4Q6IC 5C0FB 4KH2A 1GYVA 3VD7A 5ESVB 3U4BH 1D9KD 1FAKT 2D7NA 4JN2B 1CD1B 3D39A 3QH3B 4MZIA 5DJ6B 1I7UA 4PRPD 4QHKJ 4AOFA 1A65A 4XC3L 1MRFL 4G6FB 2AP2A 1X5IA 1YYCA 1XBRA 3P9LA 4NO5A 1CGYA 1ZMYA 2X0VA 3E3QC 1KN2L 2X12A 4J39A 3E6FB 2O26U 1QABA 4GYBA 4ZAKB 1X5ZA 4LHQB 2F6AA 3DOSB 3W39A 4M4PA 2WXQA 4JFFE 4GP4B 4IJ3B 1JZGA 2DQTH 3KPSA 3QW9A 1PVHA 5MERA 5ICYB 1FNEA 4OGXH 3A23A 3M17B 4NQQA 4RMTA 3GRBA 4DAGL 4HS8H 4Q14A 3CX2A 3DLQR 1J1PL 5C0EB 2EEFA 3ZSSA 2H45A 4JR9H 4KKQA 1GZQB 3K1DA 1U6AL 3K91A 1EO7A 1MRDH 5ERWA 2EO7A 5AOLA 1OSZA 2NY3D 2B14A 3E8UL 3N1PC 5EBMA 3VTTA 4R6UA 2DS4A 1KLGB 3VRJB 2X2UA 1NCIA 2FJGB 2Z31D 4PWGA 1NGWB 3PUUA 3RBSA 4Y4FA 2YEZA 1P5UC 2I9LB 2KQMA 4JB9L 4HX1B 1IQDB 5BRZD 3MJ8A 4OCNC 4GXUM 1VHPA 4EKJA 4EAEA 1DN2A 4U49A 5D7KD 3ALPA 2NY1C 4EI6A 4IGBB 3GIVB 2K6WA 2Z9TA 1KXQE 3LZFL 4LSUL 4UINH 1N0XL 1GA2A 4HC1H 1ZLVK 2VRKA 3EYOB 5ITBL 5FF6B 4Y9CA 5AZEL 1GC1L 2R1YB 3VXRA 1J05B 3T2LA 2G4GA 2XV0A 3MOQA 1JUFA 4JHWH 4B9IA 1XH0A 5LKNA 1KWKA 1N8ZA 3L1OL 3MLUH 4XT1C 2BLFA 1EUUA 2PP9A 1R5VA 1D7CA 1MFVA 3MRJB 2GC7C 4OBRA 2CBOA 5EBLA 3VO0A 4H8QA 1A3RL 4FYRA 3N0PB 3QORB 1H8NA 2VCOA 4K3EL 4WO4B 5EO1B 3ZMRA 1BWMA 3FSWA 2Q6WB 3HB3B 5KS9F 4X8JA 2FBOJ 5K9OA 3VGHA 3FB7B 3VFWB 2X1OA 5CINH 1IGTA 1AQDA 1TFPA 2KLTA 4OGYL 4G6KL 2G75B 3ARGB 2QQLL 2JK5A 5L8JB 1IB5A 2YJLA 3HZKB 3QNYA 5ALCH 4DKAA 3HMXH 4GAYB 3LS5H 3S5LA 3IXTB 3JWDC 4PFEA 5C0BB 1HINL 3M6DA 4OZ4B 1OP3K 3ZKXC 5I1HH 4FI8A 3IAPA 4ZD3H 3QNFA 3TH4T 4XNYH 2APTA 1XCWA 5BVJA 5IESH 2JIXD 3VFSB 4QIRA 3U9WA 5IR1B 3AUVA 1JXGA 4KMTH 4YL4A 4L29A 2VH5L 5KS9A 3BKCH 4HUCA 4GAAA 2IH1A 1ADQA 2ZJSL 5MENA 5K1VA 2D3JA 4MKMA 4BCXA 5IFAL 3N06B 1ASQA 1IGFL 3PWNB 3VXPA 2Y0SA 4NRYA 2VLRB 3ME0A 2Q86B 4NX0A 5F7DB 4OUOA 4AE0A 4JKNA 2R15A 3ABLB 2XPGB 3LPWA 1BBDL 2GSMB 1MLBA 4ZS7L 2D03H 1HCYA 5F0PB 4MNQD 4LMQI 3BAEH 4QHLB 5TQ2L 1FE8L 4MDRA 4FG4A 1MJJB 3CUPB 2ZYHA 2R0LL 3QEGL 5HPMA 1FYTA 2P24A 3KXFA 3ZUCA 4AC2A 3VGFA 4Z7UB 4JREB 1WAAA 3QWOA 4CN1A 4DT2A 2I9TA 1CLZL 1OP5H 1UTDA 1RUKH 1H9DA 4OF3A 2K70A 4A6YL 5J11B 4YJZL 1RURH 4IM8A 5HJ3A 1C5CH 4AQEB 1OGAD 1Y18B 1ZANH 5IQ9A 2EYTA 2ZD0A 4FFZL 4QYOA 4I0KA 4F2EA 5E2VH 3F12B 1SJMA 2A4ZA 1BQSA 2YN5A 3LKNA 2WXKA 3LXBA 4JNXA 5LAPA 4B3VA 3C5ZC 1I8KB 3REWB 3GO1L 3WFEH 1THAA 3SE3C 3D69A 1E4KA 5DF0A 3BZEA 3W5NA 1AMXA 4BRVA 2ZG1A 4WK2B 4XXDA 3SEPA 3P40A 1T7WA 2VLKB 1P5VA 4ZTPH 4V2CB 1F6FB 1PZUB 3M1OA 3ES6B 4DP8X 1WE5A 4FNPA 5DZVA 2QKIC 3HE7B 3QO1B 4DFIA 2HJLB 2OCFD 4XPTL 3AB0B 3IMTA 4N5EC 3TA3B 2VC2L 5D2NC 3TWYA 1G9NL 4FXKC 4TUUA 3QZPA 4YZWA 1ZE3C 4G83A 1N70A 5CLYA 2P52A 2CQVA 2ED6A 5CM1A 3UJTH 1YEWA 4ZW7A 3ZTNH 1PEZA 4WWPA 5BOJA 4YUEH 4HHAB 4HDIA 5IWLA 1TSRA 1QR4A 5A7BA 3O6KL 1TQVA 4YBHA 1HN1A 2VM3A 1LVEA 3PP4H 3NTCL 2YSSA 3KDMB 3NSJA 4LMQE 4RGNB 4ZS6C 3QUMB 4TL4A 1QUNA 4G8IA 2KLRA 3GI9H 2GAZA 3WLBB 4G8GA 4YDLC 4MCZB 4FXGB 2AGJL 4AYMC 4P46B 1OT1A 4J3XA 4ZUTB 3RURA 1GJUA 2X6MA 1N64L 3A4FA 5F70A 3T0AA 5CLZA 4ZG1A 3OPUA 3BRGC 3BH4A 4YE0A 1U3JA 1XEUA 1BW8A 1U8IB 1ZXKA 3DROB 3WNNA 5JHDB 3DO7A 3OKMA 3I02A 1NGZA 4PJIB 1SXZA 4AUYA 1LO3H 3B8SA 1YC8A 4O58L 1FL3A 1ZK5A 5AW3B 4PY7B 3BWUC 4S2SB 4U1HB 4X6CF 5AYQA 5T5FL 4AJWA 1F11B 4EJ1C 3U1SH 5T5NG 1QFHA 1WT5C 3ARBB 4K5OA 1KBPA 1X5KA 1YY9D 3MCLL 2QQQA 4YDJB 1ZE3H 4H26A 3PDGA 3CU7A 4N0UA 1MLCA 4ZNEE 4P2OB 4AIXA 1A66A 4HUMB 3DTXB 5E1QA 1YEEL 2H5UA 3CX5K 5GGSB 4Y4HD 3MNMA 4I9WD 2HFEA 4Z78A 1I8MA 2BERA 4Y0GA 4OZFA 3B2UC 4H2CA 1HZLA 3V9CA 4PGEA 3NJHA 1NAMH 4ZFOA 2J6EL 1SN5A 3Q5YA 5D1QB 4OFYA 3ARDA 1LQBC 1JXKA 1BQKA 3ZGIA 2C1OA 4GRMA 2BY0A 5T1LA 4M3KB 4ODSH 5E0QA 5LXVA 3MOAL 1M56B 5EO9A 5DUBB 3VFNB 3WTTA 3K46A 2FLBT 4WW1A 1ERNA 3TEUA 1EWHA 3P77B 4N8UA 1HWGB 2N59A 2ADGA 4L37A 2ALWA 4QF1A 2Q76A 2UUDH 2YK1L 4PHZA 4Y1TA 1PY4A 3QRGH 2O5XH 5FEBA 3G9VA 4LFHD 1AHWB 1A4AA 3D69B 2NTFB 2HT3C 5JA8B 4WI0A 5F93C 1KJVA 2GSGA 1VF5C 1RSFA 2J8UA 3MRKB 1T83A 1J8HA 2DM3A 3UAFA 3FSAA 1MW2A 3C9NB 3MJ9H 5E4EC 1T0PB 1T66C 3WHE0 2O5ZH 2H6UA 3JTSA 4ALAH 4U4IA 3NAAH 2OSXA 4PRPB 5IVOA 1QTPA 2DQJL 4XNMB 3SDYH 1BIIA 2VAAA 5DA4A 4L4VB 4W9HC 1CGXA 4KKBC 4M7KH 4N0CD 3G5ZB 4P5MA 1XGRA 4HU8A 5HPMB 4I1PA 1YZZA 2CGZA 3GXMA 3QIWC 1UXLA 3V5HB 1P4BH 4KDVA 5IJBC 2YPKB 2EDQA 5CKAA 1MLBB 5EC1B 4XCEA 3EZJB 5AYTA 2F8XC 2R1XB 4ZOBA 2EVFA 3FQNB 4OI8A 4MSWB 3KPOB 1XGPA 3V0IA 5CZVL 1FO0B 1HI6B 1JK9A 3GWJA 3BZFB 3BGMB 3FBKA 5EO0A 4OI7A 2EH8L 1WV7T 3JTBA 1HQ4A 2IH1B 3FFOA 3IMRA 2PNDA 1TIUA 2NZ9D 3U1PA 4KO5A 2OYPA 5TFSL 3L3DA 4JDVA 2Y25A 3SGEH 3S88H 3N91A 5E70A 4JKLA 2A7BA 4XVTH 2EP6A 1XGPB 4HGWA 4N2FA 3EJZC 5DJAB 3KGTA 3W11D 1S9VB 5KYWA 4GAJH 3FCSA 3IJYA 3WENA 1A7NH 2RALA 4WI3A 1AP2A 4OLEA 4XBMA 3TJEH 3W81A 5FUZH 1MFAH 2BSCA 4UTBL 4N2AA 2YPLE 3BAIA 4WK0B 1HH9B 3D3VD 4OAWA 4RRPA 3Q7JA 3VSTA 3EFDL 4I7ZC 4XNXH 5E6RB 2W95A 1UWGL 3GMLA 3DRTA 5DJCB 2DQGL 2ITFA 4DN3L 3SQRA 1E5ZA 1HIML 3O8XA 1KLFB 1YEGL 1S9WA 4XNBA 3U6XS 2AAVA 4M5ZH 4ZO6A 3JWDL 1CJYA 5DJ2B 3V95A 4P9ML 3B4NA 2UYLB 2A6IA 5HI5C 35C8L 4KVPA 3VQMA 5FCUH 1IC1A 2X4SB 1PKQB 1KYFA 3C60C 5JIQA 4JM2D 4ODTL 1PMYA 2IDUA 2DTML 1YNTF 2PTUA 1LDPL 1C9SA 3FTGB 4CADA 2G5BB 4HBQA 2P3YA 3BWUF 5KJ7E 1J87A 1UGKA 5TE6L 3N44F 1T21A 3AQYA 1RJCA 5D71L 3W3BA 5HYJB 2EH7H 1NDMA 1P7HL 1SJEA 1ZK9A 1U8OA 3EHBD 4XWOD 3K0WA 5KYXB 4RNRA 4WEUD 4TVSa 4DQAA 2AK4B 1RUAL 1DDTA 1R3JB 1WIPA 1INEH 3QIUD 4N8VB 5D1QA 4ELKA 4EN3A 3D2TA 3CSYA 4OF8A 1C5DA 2A1WH 2NOYA 3MFFB 4TSAL 4F8OA 2WXHA 4J23A 5CWSB 3V0DA 2FX9L 2VDNB 2VDRH 3PWLB 3BH9A 3KJ4C 5C08D 3SDCC 4POZD 3GJFA 3M8OL 4HV8B 1GTFA 4QWWC 3SDCA 4PH8A 3RKPA 1W2KT 1A6ZB 1OCWL 5EUOA 2EE3A 2MNWA 2Q3ZA 3RVUD 1T2JA 3K80A 1TEGA 1CLVA 1FBIH 1I9JH 4KUCF 2BY1A 5HDQH 1NPUA 3SPVA 4JPSA 5AVVB 3U7WL 1UZ6F 3OR7A 1P4IH 2BNRB 4EI5C 1KFAL 5I1CH 3C2AH 4U6HB 7PCYA 3F7VA 4J3TA 1Q90A 1W72L 4HLJA 2K7PA 5JYMA 2R69A 4XN4A 1XH3A 2DQHL 2ZWYA 3NFSH 1SDAB 5C0FA 1LDSA 4MA1B 2XA8H 2Y06L 3BVNA 3MNWB 1UASA 1J8HE 2XXGA 4IIQB 4JFPB 1KPUA 3L3JA 4XWOC 4UT6A 5LG6A 4JDZA 2CJUH 3S2AA 4A7UA 1OV8A 2EIZA 1F42A 3DUUA 3QAZB 4IGBA 4XP5L 3DBSA 3AREA 3FYIB 2VKWA 4WFGD 3RY4A 2FEDD 1JOIA 4NZRL 4NJ9L 3GLZA 4PJ8B 4UAHA 5I8KH 4N86A 4FE9A 5C0GA 4A63A 1S7VB 1FN4A 2D7TL 3S8GB 3GRWL 1BZ7B 3ECQA 3VI4E 2R4RL 3I6LD 4JRYE 5CBEB 4WNSA 1UB6B 3X3FL 5B7MA 4U2ZA 1NUNB 1MSPA 1BVNP 5F1IA 4S1SL 5J9PB 4Q9BA 3VXQA 1F5WA 3F85A 4GKZB 3QFGA 4PW3A 4QRSB 4DP5X 2V17L 3ZN6A 3HRZA 4RFNB 5ICYA 5TF1L 5GGVH 4PV9A 4ANUA 2YPVH 5JIMA 4HZAA 4ENEC 1ZSDA 1SLWA 5E1HB 2RH0A 3QQDA 1CN4A 3QI9C 4U6HA 2HVJA 2TAAA 4MHHG 4G8EA 2H4EA 1QTYT 3M7OA 1Y1DA 3ULSA 3IS1X 3A6BH 4JQIA 1DSYA 2DEYX 2PUQT 3HC4H 4P3DB 5IVZA 1RK1B 4BA0A 4U1KA 3IAQA 4U05A 1LJMA 4ES9A 5I1KL 1HZKA 1OP3H 3TFKC 3MBXL 5ESVA 3NJMA 4X5PA 2FUQA 2FWUA 1L0XA 2IQAA 1J9QA 4ATWA 4C56E 3LKRB 5CEZE 3VAEA 2BWDA 5T33H 2JB6B 3C5XA 3O11A 3O3AB 3FQUB 4IS6A 1D5MA 2JELL 1I75A 4PRAA 4L8DA 3HNVH 3WIFA 4L48A 5I1IH 4FCAA 1PS3A 4MA7L 1FWXA 3MA7B 1KULA 1IFRA 2E75C 3DHJA 3DTUB 4AUUA 4QO1A 1AY1H 1AGEA 2WUCL 3SQOH 2ZP9A 4ZX4A 2J5WA 2HKFH 4DUWA 1U2CA 4KTYA 3U36A 5JW5A 4TXVB 5DYOB 2LFGA 3EOAB 4PR5B 1NCAL 4X5QA 3QQNA 3QR1A 1H8SA 4J3OF 4PBDA 3OXSB 5FYJU 5JPMC 2X4RB 1JZJA 3TN0B 3AXHA 3QZOA 4UINL 5DFTA 3TPKA 2GBAA 4OLVL 5E5MB 4NO0A 2J1XA 2DKMA 4PLNC 1AJ7H 2QSCL 3N85H 3NPSB 4ANVA 3HBGA 3N1GC 2VM4A 4DK6A 1H5BC 5HGAA 2PMZA 3A67L 4WWOA 5MI0B 4KTDH 3SDXB 4XAWH 1JZ7A 2PR4H 5AVWB 1T1XA 2O4EA 2ICEC 3ZLQC 5FB8A 2X6AA 1KJ2A 2NYYD 3M86A 1XF1A 3O3UN 3T09A 3VD5A 1X5HA 3DRTB 1JGEA 2EDJA 4P3DA 1DJWA 1FAIL 5DJCA 4HLEA 5D2NA 3QG7H 3ELQA 3ZDZF 1CK0L 5DSCA 3S3PA 5CLXA 4L0ZA 4DN4H 4LSPH 1PEWA 3FT1A 3GQFA 4GMSL 2DWYA 4HPOL 3M1BA 4NHUA 2P44B 5LBVA 5C09D 3E9UA 2VN5A 2VXSH 2BY3A 1EHLL 2VQ4A 3L54A 5DJAA 5GJTL 4HGWB 3A4AA 2NX5D 1S8DB 3FOLB 3OJDA 1J5HA 4QRUA 5TGBA 1MHCA 5I1EH 5CJ5A 5HHOB 5IM7B 5K93A 5EU3B 2JKWA 1MWAL 1YEHH 2EADA 5BO0D 3IJHA 1NCCH 3CN4A 1IM3A 2AKRA 2UWEE 1KCUL 1PG7X 5KYUA 2W38A 4BA8A 1UYWL 5I30H 2CAKA 2YEQA 4V1DE 5C1MB 2VN7A 2J4WL 2A73B 1YVLA 2E9WA 3KR3L 1RFDH 4YZFE 3AT0A 2B5IC 1IGYA 2XC8A 4YGAB 3LDBB 2H1PH 1DDHA 1Q72H 1PKOA 2XN9E 1XGRB 1XHHA 4LU5L 3WAKA 3WOVA 2MCMA 1JAEA 1E7VA 2HKHL 4W4OC 2WGNB 3BVTA 3SY0A 1X5AA 5HGGS 1EZVX 4NENB 5C0BE 5LDUA 3GBMH 3SDDA 2JJSA 2MPAL 3MBEA 4A6YH 2BP3A 3IDJB 3EO9L 4P2QD 4PJCA 2WWKO 1ZA6B 1ZANL 1TJGL 1Z3GH 4JPQA 1IQWH 2GHZA 1KTCA 3SQBB 2QQNL 4MXVF 4WW2A 2B1OA 1D5ZB 4KX7A 3LEVL 4LP8A 3ROLA 2JH2A 1M57B 1HU8A 2WK2A 1JPST 3MLYH 1IZKA 1NCGA 2W9DH 3F65A 4MA8H 5I18L 1X44A 3DGGA 3P9LB 4PCKA 3NOIA 5E6ZA 4QHMA 1NMBH 5FFGA 4QOKE 4FD0A 4FP8H 4FABL 5GZOC 4J6RL 3KLDA 4TYUA 5TH2A 5FIEA 1IGIL 4AEIL 1DVXA 4PMFA 4UQ3B 4DERA 1JYVA 5C0CB 1F1GA 1G7PA 3P9MA 1M9WA 2AJ3B 2Z31A 4W9KC 4L23A 1FVDB 2XVKA 4A6YB 4EUPB 1DQDL 3RDTA 5LN8A 3GBNH 3L1FA 4WY7H 1GCFA 1D5RA 4XTRC 1PD6A 1WZKA 4N87A 4ATTA 2FRGP 2XJKA 3UJTL 3FO2B 4M6NL 3K8LA 1FHNA 2NY2B 4WI6A 5LUMA 2V7NB 1DEDA 4P0DA 3P0VL 4M1DH 4YUEL 3ATBA 1RXLA 5D70H 4W9DC 2G3ZA 2PN5A 1FG2A 4BGLA 4ICXA 5TE7H 3DIFB 5DS8B 3HJEA 1DYZA 5D5MF 5LNEA 2AHIA 3QSKB 4NUJA 2BRRL 1OHZA 4FJ6A 3U2SA 4F33A 1J0YA 3L3JB 4YXKL 3GEFA 5I0VA 1KNOB 3UAEA 2Z92A 1BEYH 4W6XB 4RBPH 3MV9D 2NUPB 3IMBA 2BC4B 2A83B 5LGJA 1OPGH 1UENA 4NNPL 1ZLVH 3QO0B 3T8MA 1MJ8H 5DJDB 3UP1A 1HSBA 1E6JH 4MXWL 1ECZA 1FNLA 3E8VA 4Q9CA 2IFGA 4XPGH 3GKWH 3EG9B 3ROOB 2Z91A 3MV8A 4J8RA 4XP4H 5FDWB 3RWGA 1KLFA 1O7VA 2DBLL 4H8UA 5DVLA 1YNTB 5T5FH 2C34A 1UG9A 3HS9A 3DV6B 3UEZA 4O2CA 1XB3A 3BQUB 5F7LB 4QGYA 3RU8L 4ELMB 3RI5F 1I1YB 3RAJH 2R2EA 2WXPA 1EZVY 2XG5A 2VXQH 3WFDH 4DESA 4F8TA 3QC5X 2W9LA 3GJFB 3Q6FB 3PAVA 4FQLH 4PJEA 4A55A 1NUGA 1ONQA 4ONGL 1KTBA 4PJGB 1DCEA 4MA3A 3DX4A 5AD0A 4AY0A 1XXFC 4PJBB 3Q3GB 2VXTL 4PHXA 4XVOA 1I1AC 2CLRA 1P4UA 2HWZL 2C9UA 5MEQB 4GOSA 1JWUA 2JI2A 4NS0A 5KJ4A 4JZJB 3WXWH 5IV2B 4BQ8A 2WJ7A 4AK2A 2F5BH 3HFML 4GSXA 4PV8A 4FXTA 2H0PA 5BRZA 1KELH 5J89A 3KMDA 1FPTL 5KYXA 4NKIL 2AK4D 3EOBB 3L5WA 3HI5H 3OLEA 4LNVA 5DC4B 1AO7D 1KN4H 5AQ0A 5TPWH 1DQQB 2HLEB 1XQ4A 4TLKA 4XCEB 3TLRA 4A67A 2BVOB 1EXHA 3UZEA 4NO3B 1KTRL 4FHKA 3C5JB 2L7QA 2V2TB 2DQFB 1S7RB 3QRGL 1Y0LA 5I6XC 2ZE0A 3KPLA 4X9BA 1AFVL 3QCVL 5CCHE 3WJMB 4ZFGH 3QA3B 2Y7LA 4FFTA 3QR0A 3BLPX 4LPWA 2QADD 2F18A 4QRPA 3S34H 2IWKA 3NSXA 5F72S 5ETUA 1G5AA 3NAAL 4N2MA 4Y7OC 3VI3A 1GGBL 4CRPA 2DZEA 5IJVB 4ZOEA 1NGYB 3GT6A 5HHVL 3VB9A 4GB9A 5DI8A 4WI0B 3DURB 4S1QH 1TTBA 4M48H 4DZBB 3BD4A 3H7BB 4H0HB 4OSUL 1RVFL 1WIOA 4TULL 2VQUA 1YCSA 3EOTL 3WNLA 4AYDC 3C6LB 1M7XA 3PGCA 3MX0A 2WIMA 4EIUA 2ENQA 5DUML 5IEKB 2A9MH 4UCFA 1CVSC 1JYNA 2AEWA 2Q8BL 4FHJA 4L4TA 1BREA 5HI3D 4PJXF 3EOBA 4N0RA 1OP9A 4A2LA 1AZBA 4CC0A 3H3PH 2XTLA 3QCUH 1JGUL 1RCYA 5SWSD 3MGOB 1SM3L 1QMUA 3DX7A 1HQ4B 3T0EB 2XIIA 1HNFA 1C16B 1HAUA 3O8XD 1LE5B 1X4XA 5ID1A 4NQCE 2CLRB 4KQ3H 3MYJB 3WFBH 4AL8C 5KVGH 2XWXA 3I3DA 1ZJBA 2IPKB 4ODWB 3TEXA 2YXVA 5GIRB 3HB3D 4P59L 4LL4A 5LGKA 3DUSA 2OZNA 3RGHA 1Q8MA 3MUGA 1ZD6A 4OZ4A 3BEWB 3CFKB 5HBBA 1NM9A 4M3HA 4YDIH 3RWHB 2CLZA 3MCG1 4WI7A 3MOBL 3LRLA 2BVEA 1G9MC 4O2CB 4AGQA 4IRZL 5HHPA 1YNTA 3LQZB 2KERA 4OCSH 4X9IA 4UB0L 2GUOA 4HIJA 5L4JA 2RB8A 1IAMA 3KLHC 1NGZB 4LDEB 2I60H 5LBSL 3DO7B 2R59A 4TUKH 1NBZA 1QW8A 4HIEA 4HWEL 3O4LD 2A0LC 3MJ9A 4H8VA 5D5MA 2R9HC 3APMA 1UD4A 3F7YA 4OIIL 1MCCA 2WVTA 1TVHA 1TXKA 4Z7OB 1UACH 3RX8A 2XZAH 4U1NB 4E5XA 1NGXB 2BNQA 4N2NA 5LN4A 2ZG3A 1JWMB 4QF1B 4KRLB 4E41E 1Z9PA 4K5NA 5EEUA 2JFCA 5J12C 3IFOA 4EI6B 4ZSOE 3MZGB 1M9SA 3TJPA 4J4PC 3ULVD 5EOCH 1GIGL 4AEHL 2XYBA 2UXGA 2A74C 3WKQA 1H6UA 1KEMH 3RWCB 3T6ZA 5D7LA 5KJRL 5F9DC 4GG6A 3TEYA 3OKDB 1I31A 3DVNB 2X0WA 3BUYB 1PZ5B 1E7UA 5CMAB 4R84A 2LQRA 3STBA 2VLMD 4Q0XH 4BWTA 2BSSA 4ORGA 2AJUH 2B3RA 3B9KA 2CO4A 4PRHA 4XBEL 3TVMA 1TT6A 1KIRA 4WWKA 2YGPA 5DUJA 4XPAH 5DZPA 1QPXA 2EDDA 1EZUA 3AB0C 2ZUSA 1TZGH 3APCA 3CZKA 3L3OB 4PUBH 4OD1L 4JCWA 4AEEA 4NRZB 2ZICA 3WIIL 2JQMA 1QSEA 2QGBA 2AJSH 4HZLA 5EDXA 2VGLM 2ZUYA 2K7QA 5ECJE 5LJYH 1I8KA 1TLKA 3REWA 4LSVH 5C0DA 1G7IA 1I7UB 2QMKA 2UUDK 5MP6H 4TOYH 5I1CL 3BSHA 2YZ1A 3BLKA 3UPRB 1NIEA 4U4BA 1A6AB 5KVDL 4AG4L 1KJ3H 5KTEL 3IE9A 1FH5H 5IQ9B 4G5ZL 2OTPA 4GQ9L 1JDDA 1KGIA 2BPBA 2YMOA 3V4VB 4MDJA 4NWTL 5F7KC 3QFDB 1DE4A 4JFZH 5D7SH 4YZFF 4K9EC 2NSMA 5L2KE 5IK3B 3VI3E 2DYSB 4G8IB 3U7YH 4IEFA 3RWIB 1J9CT 1CU4L 1E42A 2G5UA 3T0BA 3GS4A 5T8IA 2F7RA 2OZ4L 4LLDA 2C4XA 3H9SA 5EWIL 3D18B 5DYFA 2EYSB 2M83A 1WFOA 3W38A 1RIUH 4KJWD 1EHNA 2XPZA 1TTAA 1ND0B 1XEDA 4FEIA 5FKPB 1PAZA 3IJHB 4A1RA 2NLJB 3EJQA 1G6RL 2YARA 4L4TE 2VMEA 5JHDD 4NZ8A 4M6OL 1QBLL 4KKCC 2YLHA 4EN3D 3ZT5A 3FOLA 5IR1A 4EOWH 3CE1A 3FNKA 2YFOA 4Z7OF 1ZJAA 1NCDH 1NANH 1EQWA 1R46A 4DGVH 3LB6C 3ZRFC 3LEXA 3DYPA 1CGSL 2J20A 3BSZA 1NGPL 2D4DA 5AZUA 5DHXB 2WVUA 1S7UA 2Y3AA 4M4RB 4GAYA 2ZNWA 2W91A 1F4AA 4XPBH 4P06A 2FAUA 2XG4B 5EOQL 1QKZL 5DZJA 2VNCA 3DTDA 3CXFA 3GMMA 3DVFA 4HEMA 2HTKD 4GS7B 1Q94B 3NQIA 3BT2L 3CDCA 3OM3B 1QWUA 5DD3L 1WA0X 2R29L 3Q1SL 4YDVA 3IGFA 3MPCA 4XVSH 5IMMA 4JM2A 2WINB 5AW8B 4Z7VB 4EQ2A 4PJ9A 1N6QH 2WYHA 4DGYL 1ZSHA 4XBPA 3C08H 4MJJA 4F37F 5EC2B 3L4TA 1OTUC 4QLWA 1WPCA 3Q2LA 5IFJB 1NFDE 2X4QA 1FCGA 3BQUD 3RVWC 4FQQA 5F9AC 2L7JA 4JGUA 4JE0A 1GHFH 2VDMH 4Y1AD 5TQ0L 4YL9A 1UM6H 2JB5H 4N2DA 1YY8B 2IBGA 4Y8AA 4FG2A 2V8LA 3D25A 2R0ZL 3H9SB 3OXSA 2HKFL 3GFUA 3GIVA 4PR5A 1TQCC 2YSTA 3P4NB 2WQVA 3G3LA 1F90H 3CLFL 2ISDA 1J9RA 3RWIA 3PIQB 1UXWA 5CXPA 2ADJB 5DRWA 2BVPA 5GRXG 5IKCB 3KZ8A 1YJDH 2IAAC 3ZO0A 4Y4FB 5GJSL 2WW8A 2J72A 5BO1L 3MLSH 4F57H 2PO6C 5SWSA 1R5IA 4GKNA 3N43B 4AKQA 3DETC 3N85L 1TTUA 4B3EA 5DXWA 3ZL4L 1JHTA 3NRQA 4AQAB 1WZMA 4UQDA 5C0RH 2EJ1A 4WFFD 4E42B 3A6CH 4WU5A 5EDSA 1E5BA 1K5NA 3VFMA 3IFPA 1BLNA 4K2UL 3QBTB 4MMYA 5ANMB 1FUNA 3S97C 1FAIH 3FB7A 3MV01 3AM8C 3VFWA 2EIDA 4QXUL 1CDIA 2YOCA 3TCTA 1IBYA 4P57B 2NY3C 5TTRA 1CK0H 4DN4L 4WU7B 5EBLB 2GJ6E 4ONFL 1DJSA 3QZLA 3WN5C 3KLAA 4PEEA 2KLSA 2OR7A 2BSSB 5AW0B 4GIAA 4NI6A 3B34A 3J07A 2B1HH 2Q5BA 3FN9A 2QBWA 5EU6D 5FW7A 3BP4B 4KKZA 4AMKH 2CR3A 5FM4A 4MNQE 3F7PC 1HEZB 1WWBX 1G5GA 3IDYB 3U46A 1PYWB 4R4FH 3TWCH 3N55A 4UV7H 2Y7QB 1OWWA 4HIIA 3KWUA 3ZTJG 4KV5E 1EAPB 1AC0A 3N9GH 4C56A 4CC1A 1E67A 2FQDA 2WB7A 1B4LA 3J7HA 2BO0A 4WV1C 3NIGF 4R96B 5C7XL 4JM4H 4HS3A 3ZPDA 1NWPA 5F1KC 3NK4A 3VW3H 2LU4A 1WS7A 4X0KA 3GZKA 1R5WA 2BOCB 4FMVA 4M7LT 12E8H 3T0ED 5I23A 1NBYA 4RCAA 3TIEB 3EGDA 4BSVB 4O51B 4U1IB 5E6IC 2DQ6A 2OQJB 3RZCC 1S7XA 1EZLA 4KVNL 3WKML 1NBZB 2B4CL 4P3CH 5JXED 3G9AB 5J12B 2AEQL 3SN6N 4U2YA 4P2RE 3M17A 5ESAB 4YSAA 2WBWB 3SY6A 1JZ6A 3V0GA 2J12B 2QFPA 1NBVH 3VD9A 4QNPF 4YHIB 3BRFA 3VI3F 1GXEA 4PLOB 3ZKMC 4DP1X 1BD2A 1NCJA 2FQGA 4YDKH 1DFBH 1NJ9B 1TYJA 3ZDXB 3FTZA 1VSCA 2E6PA 4OCRH 4ISVA 5I1AB 2P46B 3L3IB 5JXAH 3QZNA 4OD2A 3FUHA 1NMBL 1YLBB 2X6UA 4L3EA 2OXHB 5I1JL 4BFOA 3GSRA 1EJOH 3FONA 2D7MA 3QEHB 5GZOA 2WKGA 3SGDH 1IRAY 2FO1A 1OGAE 3GUFA 1FFPA 1X6LA 2BP8A 2FT6A 3CFEA 4YQXL 4F7EA 4MYPA 1AD9B 4Y5YB 3O4LB 4U1MB 2ZX6A 4Z7WA 2H2PC 1CFVH 4XMLH 3SKOA 3ZSTA 5KSVA 3T4YB 3PV6A 4UQIM 4OFKA 1FFRA 2OTUB 1AKJB 3RUGE 3DX7B 3BEVB 1JHLH 2PPEA 4JS7A 1JZ5A 4RRPM 4MNGE 1VIWA 1L9OA 1YN6B 4FJZA 4XCCH 4ALAC 3UZVA 4JFXB 2LE9A 1ED3A 3H8NA 1PZ2A 2VDPL 3MV9E 4PGDB 4E36A 2NNCA 5FV2A 4Z0XB 1RJZA 2WTRB 5DK2A 4G9DB 4BZ2H 1NINA 4TRPH 2BIMA 5D70L 1M6OA 4TSBH 3VFTA 2PYEA 4FQPA 1CC3A 3BESR 5DJYA 4URTB 1NDMB 3B2PA 3O0LA 1CG9A 1IL1A 2YAMA 4OM1H 4L8SA 4XMKH 4HKJB 3V0EA 4BFIA 4L9LA 4LHUD 2Y72A 3BIAX 4NXKA 3BH8B 4ZUUB 3MLWH 3UGXA 3IXAA 1OGTB 3B7UX 2ETWA 5SWZB 3VI3B 2P80D 2WXRA 4Y2DB 4XE5B 1OPGL 4DVBB 4Z3JA 4Y5VB 5F9WC 2R0KL 3DX1A 2A6KA 2FJSA 2UZPA 2CXKA 2P8PA 1FL5B 3WO4C 1MJUL 1HYSC 2H8PA 4LOFA 2P1YA 5C07A 3CVIH 1A6TB 4FKKA 4XPGL 4G6MH 1ITBB 5C70A 1QQDB 1KDIA 1JGIA 1LEKB 4MMXB 4RAUA 4F7MA 1VCAA 2MHAA 3QJSB 2EO1A 4X5XB 4LRIA 5DQDL 2YD2A 4GW1A 4Q4IA 1RI8A 2DQFA 5A43C 4JO3H 3K5SA 2XKNA 3LHAA 5CS7A 3T8XB 4A68A 2IXQB 4GSRA 3U6RA 5JORA 3SKJH 4M7LH 5FS5A 1IO4C 1M4KA 4HIHA 2XZQH 4B97A 2XWBA 2PYEB 5DJYB 2J73A 4C54A 4R8WL 4NZUH 3GI8L 1RZGA 4LEXH 1THCA 3OL2A 1UM5H 1MFMA 3QUHA 3OWEA 3VE0A 1LO2L 1RMFH 1I4FB 1ZLWH 2ATKA 1ED3B 2NY4C 4PV8B 3VH8A 2GJZA 2ZF8A 3UTZA 1JDAA 1BBJB 3RTQC 4MXVE 4MD0A 4ABWA 3QEQB 1HX0A 1U8PA 4HIQA 5HYSB 2QHRL 2DIAA 5I9QB 2RQEA 3DSFL 1MCKA 4RGMB 3PV6B 3MLZH 5JHDA 4I9XA 1A0QH 2YRLA 4PBXA 5BNXD 4LLQA 5JW4M 2EE9A 4FFYH 4V11A 2AW2A 3FCTB 3PQYB 1KN4L 2VL4A 4I8DA 4L9LC 5I24A 4I1RA 3OTTA 4I2XE 2J88H 3PF2A 4H25A 4KVCH 3I6KB 2H3XC 2XT1B 3SDDD 4N2EA 1UA3A 4ISVB 1NCBL 1RHFA 2UV3A 1JPTL 3NCJL 3WL9A 2AANA 4UYPA 3JWOH 4LHJB 1FZKB 4XMXA 1NAMB 3BN3B 4LCCB 1B0RB 1EFXB 4JFYB 3EGXB 2IH3A 3CN3A 5GRZA 2V9QA 1KJ2H 1AGCA 2F1EA 1MAMH 2X9ZA 3QDJE 1DL7L 3DNKA 3SYOA 4H1LA 2W81C 1M53A 1S7XB 1BJ1H 3CH1B 3G08B 3TJHD 2BDNH 3ZIYA 5JHLH 2DKSA 4G8FA 1JFQL 2CDGA 4KZDH 2ARJA 4P05A 1I1AA 3B2VH 1OTUD 1I85A 3E3QE 4TULH 2RACA 2P5EA 5I8EA 4BWUA 5IQ7L 4PQXA 2VDNL 1ZXQA 2A99A 2GBTA 1RLWA 3BN9C 5EEZA 1LMIA 1FZJB 1X9UA 1CD0A 2RTTA 3AXLB 3BGAA 2J8HA 5C3LD 5L8KB 3FOMA 4TQEL 1KG0A 4OU3A 2IQ9H 3IU3B 4RZCB 3BO8A 2Y7QA 1JGUH 3CFCL 4K7PY 2ATPA 2YPLD 2FWOA 1QAWA 2NCMA 2C7UA 3PWPA 3FT3B 4IRJB 5AKVA 3QXTA 4YHKL 2BSDA 5DWUL 4JL1A 3H2WA 1BZ9A 3U9UA 1S78C 1FIGH 3KYKH 5E6IA 3MUZ1 3VYOA 1FZJA 3IWVA 2AXHA 2JQZA 1JF1B 3FN0L 5DEFA 3EO0B 4J2QA 4QRBA 2CXGA 4W9JC 1TJHL 3L17A 3V5DA 4Q4EA 5A3ID 5H35A 2JNZA 5KVFH 1RJLB 1CZ8H 2V7HB 4G8FB 3IFLH 5BJTB 4GSDH 4U7MA 4XP1H 3RPIA 2IFFL 1IAII 4I1NB 4N5UA 2CR6A 4KK8D 4MMYB 5EBGA 4J5VA 4U1HA 3MGAA 2R8SH 2F5AH 4Y4KC 5A2LH 3QNZB 3K81A 2F54E 3O2DL 1GYWA 1GOFA 1HE8A 3LNGA 4HUUB 1D5XB 1YEKH 2ZPKL 5E00B 3I02B 3QYCA 1FZMA 1S7TB 2DJ4A 5CP3A 5D7JB 2VQ1B 3VXTB 1OAXL 2WKOA 1LEGA 4OCWH 4PJAF 4XCNB 5CCKL 3T8VA 1TCRB 3WO3B 3PABA 5GS0D 1JK8B 1AD0B 3PCYA 2R27A 4OQ1A 1AGBA 4A38A 5JR1L 5BZWA 1XFPA 5IGXH 5IBLC 2BZ7A 5FM5M 4EI5A 1IC4H 4O9HL 2Z31C 3KDMA 4F37K 4M62H 1WZ1H 3QR2A 4YHZL 2EYRA 3QDJA 1ZHKB 4YVUA 4PJHF 1DLFH 3BYYA 5D9SB 1D3CA 5H94B 3AS2A 5EULV 2EXYD 3EJZD 4AITA 4G6JH 3HCVB 2KBGA 2FR4A 3L3GB 2NXZC 4PJ6A 1YY8A 1SYVA 1KYUA 2BOBA 2F8OA 2IDSA 3Q9QA 5KJRH 1N9PA 3N0AA 4QCIA 3BE1L 3BSZL 3PXLA 1H19A 4U1LB 1HOEA 4UT6L 4ZSOB 5JIIA 4FI7A 1KWGA 4XVJL 4GO8A 1QRNA 1GJIA 4FOMA 3ZYIA 4WW2C 2ICWJ 3MV9B 2FNWA 1ZVYA 1GRWA 3PFUA 3ZZ1A 3G6DL 3G5YA 4NN6C 3US1A 1NDGB 1MUJA 4WTWA 3TBYA 3VNYA 3MNVA 3OPZH 5BV7L 1TZGL 1DQJB 1E5AA 3UTTD 5D1ZI 2XQBL 3MA9L 3MN8A 1NZRA 1Q1PA 3EZ8A 3MRDB 5IW1A 3JSSA 4XNAA 4Q9QH 1WUZA 5AAPA 3A21A 4R97B 4KI5F 4FERA 2EEXA 3BZEB 5A16B 4W9LC 2X1WL 3STZA 3VFMB 1M7UA 4TOYL 3TF7C 1KPRB 4J6IA 3INUL 5ADOH 1NL0L 4AG4H 1XCQA 3RWJB 5DMJB 2A5UA 2Z7YA 4FQHA 1MAKA 2XN9D 4RX4A 1M2VB 3PHOA 5T3ZL 2NUTA 1ZLUK 2HKAA 4JPIA 3SDAC 2HMIC 4BELD 2JLLA 5DMKA 4DHLA 1F1DA 2IBZY 3FT4A 4GI6A 4A7QA 1QP1A 2I9TB 4FKHA 1KIQB 2YGNA 3TIDB 4PJ9C 1BQHB 5AALA 3TC9A 4AC4A 2LR4A 1B0GA 1ZHLB 1KGWA 5GQBA 4LZKA 3QEUA 3OX8B 5E08H 1IL1B 1UXWB 1K8IA 1S5HA 4A7VA 4IU2A 3RHWK 2TSAA 1T5WB 1J8KA 3OGCA 2CUAA 4KX8A 4K3GA 3D18A 1MPAH 1VACA 4O2FA 3RVVD 1OK0A 1U3HA 3DJTA 3DX6A 4RFEA 2DW5A 1IBFA 1OF2B 5FGBA 1WBYB 1UKSA 5EF2A 2YA0A 3GK8L 4R9HA 1KTKE 4E41A 1RULH 2CMRL 2X4QB 2HG5B 1T7VA 4LRIC 5I6LA 2IJ0C 5BRPA 2GTWB 1HDMA 2V0AA 2AI0H 4EXKA 1X4ZA 3SBWA 1UJ3A 3DMMA 3H0TB 4FC3E 4YMPA 2HLFC 4F7EB 2NUTB 1KYAA 1UUSA 2V4LA 2YIHA 4KJPC 1RKRA 4FQIH 1ETB1 4QAMB 4BKLA 5MHSE 4X4ME 1T4WA 5E1IA 3OZ9H 4O4YL 5JOFB 4GG6E 3UX9B 3S5LB 4L3EE 2OMVA 1Q9OA 2AABH 1ZIAA 4F7TA 3L3IA 5IREA 4P5KB 3VVWA 1K3IA 4G8EB 4DTGL 2EDWA 2NY5H 3WMQA 4M5TA 5INCB 1IGTB 2NRDA 1DVFD 3BC9A 5AB9A 4KKPA 2IBZX 4L8SC 3AQZA 4LLVA 1SN0A 5DHVA 3Q5OA 2H0JA 4X7CC 5EORH 3T77B 1VPOL 1TJIH 4IMLB 5HGDA 1DVSA 3ZYOA 5ADPL 1J1OL 3MMEB 4N2KA 1CT8A 2NSQA 2WWNA 2IWGA 3WLWD 2BJMH 4AJVA 3VI4A 4ADGA 2GK0B 3ECVA 5AUMA 4XE0A 3VXUD 1J05A 2DIJA 3K8KA 5DFAA 2E7MA 2X4NB 4X4YB 2IGFH 3AT8A 5I26A 5CF3A 5DD1H 1N6VA 1P69B 1GMIA 5J13B 1HHIB 4NQDA 2I7OA 2ZYSA 3BYTA 3NCWA 1MDAA 5GRVK 1BG9A 3BHBA 4HKBA 4N2CA 1TKWA 1ZHKA 3AT9A 5H94A 4PVBA 1BJMA 1KIPB 2DB8A 1F90L 3CLFH 2A9NH 3D1MC 3IGUA 3V4VL 5D93C 5E4AA 1JNHA 1EAOA 3VFRB 3QQ9C 4AZ8A 2OL3A 1UOKA 2WYIA 1U8HA 3I50L 4EBQH 5DLML 5GJSH 4PJGE 4X6FB 4OF0A 3MLTA 3QI9A 5E8OA 4RGND 1DBBH 1NFIA 2YC1B 4A2FA 1IUZA 1D7DA 3EGSA 2XY1A 3HN8A 4C4BA 2XN0A 4GRWE 4MMZB 5KWYC 4R7VA 3NA9H 6PCYA 5DMYA 1W0YT 3NP3A 3EFOA 2H3KA 3AY4A 3BPNB 3F58H 3GJFH 5C09E 1I9EA 3GS0A 1IJNA 1KCVL 1V5JA 2XKUA 4K8RD 1F3DH 1OZTG 2DQTL 4P4KB 1QSEB 3KPRA 3S4SG 1YNLL 4PP1C 3ZK0A 4DVRH 4EQ3A 4Y19B 4Z7AA 2YFNA 4G70B 4QTIL 3DA0A 1J1PH 4Q2ZB 5AZ2L 1V7NH 2DM7A 4GKLA 4L4JA 3O9WC 4U3XA 4Y1SA 1U6AH 4WU5B 4PJXA 2WLYA 1MRDL 4XPFL 4OZGB 2XVLA 4D8PB 3B9KB 2VR6A 4QRRE 1YAZA 4DQOL 1QFWI 4PWIA 2VSMB 4I5BA 1ZEAH 5CHNB 5GGRB 4IKLA 1B3IA 1UJ3B 3DMMB 2YRBA 5KAQF 2UZYA 3KJ6H 1TQUA 3ATEA 3ZY7A 3QPQD 5E4EB 2BSRA 4H40A 5IT2L 4R4FL 2X1XR 5D1ZC 2JTYA 4OGQC 5DRWB 5IKCA 5LGHL 1O6TA 2CO6A 1FIEA 2OSYA 1WA2X 3OR6A 1TMCB 1U8NA 4RA3A 4Y1AA 5GZND 3N9GL 5D7HA 5F44A 4N6RA 1H3PL 2EZ0D 2N0MA 1IAKA 1IC0A 4P5TC 2VR3A 3U48A 1T2XA 3HEIB 3PGCB 2CDEB 3VD3A 1N19A 1JNLH 4LOUD 4YPJA 2G5BA 5BV7B 3C8KA 4X6DF 3B2MA 4Z7QE 5I19H 1K8IB 4PM1A 4EMZA 3V0WH 5CCGE 4XN8A 2CDGB 2XFGB 1B0GB 3OSVA 4C4KO 3VXMA 4U6VL 3VGEA 4Q9RH 3ZL2A 4NCC1 2ITDB 1XB6A 4XNQB 4JFFB 1EVTC 1SEBA 2NCEA 4HOZA 3MMEA 3EUUA 4Q8BA 1L6ZA 3T77A 1NBVL 3QJHB 1QEXA 1UXSA 3K4DA 2VERN 1N59A 1KYOJ 4GP5B 3LS5L 4WQOA 1NC2D 1ZDSA 2G30A 1NPNA 3GMMB 5HDRA 2Q10A 1ADQH 3LMJL 4LCUA 1UT2A 1VFAA 1G0XA 3K71B 4ECNA 4MD4B 1V55B 1YMMB 5I1JH 2ZG2A 4DK3A 3FO9A 5CN1A 5C09A 3NZ8A 4S1DD 3S3SA 3SE3A 4PTUA 3V6FA 4YHYB 4F91B 4F93B 3C5ZA 3D0VA 2J25A 4RAHA 5IB5A 2XN9A 4RX4D 2G9HA 1QI3A 2WWKT 3HPJB 4OD3L 5L7XH 4KNQA 5DO8A 4BCYA 5IB1A 1UVQB 3MGOA 2NLJA 3HC0B 1QYGH 4FQJL 3RGVA 1H3TA 3VWJD 1UWXH 4OW6A 5B39G 3BZFA 1GGCH 4MCMA 3CN1A 3E80A 4PLKD 4YSCA 3CFMA 1KXQA 1L7TH 3D33A 3D3VA 2NT1A 4Z8FH 4TNFA 5IB1B 1EO5A 4CSZA 4DO4A 3AAZB 2H32H 3UZEC 1NCWH 3QEUB 4YPGB 5C2BL 1E4HA 3EYFA 2BFGA 3QJFA 1N3NA 4RIRA 3CDZB 2C9RA 2AMUA 2X5PA 3W82A 5IVXB 4U6YB 1OCZB 4RZKA 4GLRH 4TLTA 4D7PA 1OB0A 3U6XA 1Z9LA 2H6OA 3HC3L 5EU5B 5EF1A 4JRFA 4PV1C 4PJHE 4LBEA 5GGUA 1EO8L 1HTYA 1MCRA 2R0KH 1YYLH 5D7JA 1A1MB 3ZTJH 1AXSA 1U8JB 3UPRA 2ZCLH 1KPRA 3V55A 3CVIL 4NT6A 3LD8B 3UBXB 3FTXA 5E1GA 2A77L 2EXSA 4X5RA 1TO5A 5DQDH 1PLGH 2HN7B 5H4YA 3V6OE 3O2VL 3VFGH 2XICA 3NVQA 1CGTA 2YAEA 3GNML 5BXFB 3DXAE 3VWJC 3RY6A 4QXWA 4PJ9D 1R0AL 5EU6B 1VESA 4MCNA 5DUBA 3VXMB 5CFHA 5H4ZA 1HNGA 4LAJH 4KHXH 1BD2E 1GTNA 1YPZE 2EXWC 1ACYL 1HOCA 3FSZA 2P5WD 4GUPB 4G7VH 4I3SH 4IYKA 4PW4A 5GSVA 2VDQL 4O2EA 2W1NA 1QFWH 4FFVD 4DW2L 1EV2E 1JBJA 3UZVB 4YSEA 3DPDA 4L1BA 4ZMAT 2WBJD 4GG6B 1KCBA 1BDYA 1EGJH 3CBJB 3IU4L 1UM4H 5BS0B 3ZE0E 1L9QA 3BW9A 2A9DA 2OPCA 4HKZB 4PJFF 1HH6B 2CJSA 3KPMA 5B1CA 2AFNA 4XMPL 4M1GH 1WH0A 4AYBA 1IGCL 1F2QA 2VZOA 4X6CE 4DPAX 1SOQA 5GISL 4NZJA 3LX9A 3KDPB 5T3XE 5HI4C 4KO9A 3QEHA 1LNUB 2Q7AA 3V10A 5IFHL 3EIFA 4GMTH 1G7HB 4HUKB 4N0UE 4JPKH 4Y2OA 3PRZA 3DGGB 3B3BA 3FU6A 4LEBA 3WY3A 1O5DT 4LHUA 4XCNA 1W0VB 1P5UA 3HE6C 1EVUA 3RA7H 4O58H 3V6BR 4CILA 1M2OA 5F7MC 2PYEE 1RZFL 4HOWA 3HAEH 4Y89A 5B4MD 1CD9B 2HTKC 2OJ1A 2FTAA 5KSAB 4PJCB 3FS9A 4HFWA 1NLBL 1VA9A 4LCWD 3RDTC 1AACA 1AR1D 1VGEH 1WC7B 1G1YA 4P4RA 3ARYA 3LQZA 4XP9L 1FZOB 4YAQA 1AAJA 2JIXB 4MVBC 3SOTA 1MCFA 1Z32X 4HHGA 1JGVH 4G3YH 4YGVB 5FYKL 2OKMA 4P23D 1TMQA 2DTSA 2IOIA 3D12B 1K5WA 1HHKA 3EDFA 2NR6D 2XWRA 5IY5B 2LT9A 4WDIA 4A7GF 2WQAA 2MTPA 3QI9B 5E8OB 4NFBA 4RMSA 2EDLA 2FBJL 2ZZUT 1MCWW 2IPKA 4ODWA 2WXMA 1GVIA 1F13A 1M7DB 3LPGA 3RB7A 1B2WL 2EDEA 4ZAKC 2NDGA 1XH2A 3JUYA 4LLQB 5BVPH 3ZE0F 2MNUA 1EXUB 4JR9L 2JMRA 5AVTB 2NY7H 1L3WA 1ZY9A 3P3RA 3FT3A 3QFJD 1INDL 2WCSA 4CVZB 5A2FA 5EA0H 2EZ0C 3L9EA 3IDNA 4M6AA 2B59A 5FO8B 3K6SB 2V9TA 3SDDC 4BFEA 1I9IH 5SV3A 2HJLA 2F0CA 3ZUNC 5AW6B 3P9MB 4UU9A 1I9RH 4ZRGA 4ZUVA 3VG9C 3ZDZB 4HXAH 1KGYE 3K72A 2DYPB 4O5LL 4XXCA 5GZNA 2G3NA 2O5XL 3B2XA 1WAEA 1RZGB 1R17A 3BMWA 4U0RC 4BWWA 1KCWA 3UYPA 1A47A 3SODB 3L95B 2LLNA 1A1NA 4HIHB 2CZNA 2Y22A 1WP6A 1L0PA 3L2NA 4NM8H 1XGZA 5C0AA 4PRNB 2X70A 1JF5A 4UDUA 1BQLL 2VWEC 2I85A 2VMDA 4LPXA 4WSKA 5LXGL 1RZKC 3BWZA 3DXAD 3DDGA 1VGKA 3QJXA 5JPMB 2N01B 4JKKA 3BCDA 3V5KA 3TT1H 5AOZA 3FF7A 4DKFL 1P0SE 2CNZA 4NWUH 4APXB 4B0MB 3IGAA 5CR8A 1YEIL 2O61B 2ZUQC 1JGDB 1OEZW 3I9GL 4IHOA 4L1LA 5FDYA 4N8VG 4EIZC 1RK0B 2DD8L 4L3FA 1UQSA 1VRSA 4KAQL 4KXCA 1WHPA 3MJWA 4PTTA 4WLCA 2RJMA 3U0WL 5MEPA 1ECYA 2YHGA 3B8YA 1T89C 1CXFA 1R5IB 2ZCHH 5FK9A 4L2YA 4UNVA 5B38G 3FUEA 4HJSA 3U30B 2NY0C 4FXKA 4QHLA 4QJ4B 4PJEE 2BNUB 5EHFA 3S35H 1UCBH 5HI5D 4JPWH 1CG9B 3NACH 5DTFA 1FFNB 1U9KA 2P48B 1QR1A 3KGRA 2O6CA 3QORC 4NRYB 3GIZH 2BXZA 4ABUA 3FTUA 1SJVA 1W0WB 5CEYA 2BSTB 2WCGA 3DXAA 1OVZA 2VO5A 3PDOA 1RP9A 3BZ4A 1RZ7L 2OR8A 2YMXH 4JFXA 1EPFA 4XVTL 4W6YB 4XRCB 3VXSE 3WY4A 3V4PL 1T66D 2Y7MA 3HRPA 1ACCA 1SVBA 4WI9A 3L45A 4DOHB 1Z66A 2CUMA 4XOBA 3TBWB 3BKCL 5J57B 3KPSE 1SXCA 2OTUA 4MDIB 1WBXA 3FYEB 3OHXB 3SCMB 3ILPB 5EC2A 1JZDC 3OX8A 4UZUA 3FK3A 4NP4H 2C3XA 2VDKB 5E6ID 4XWGL 2HRLA 1AZNA 4OJFH 3NZ8B 3DUHA 2VITB 4JVUA 1K6QL 3ML9A 3U6RB 5BV7H 4HCIA 1GKOA 3AG4B 5SWQA 4ZOAA 3T8XA 4JPIB 1NFAA 1U93B 3FHQA 3VACA 2E86A 5ALBL 1FNGB 1NAKH 4GW1B 1EFXD 2CO2A 1K8DA 1T04A 2IPTL 4AKOA 4XXCC 1XCQB 3RWJA 1E28B 2ZF9A 2R56L 5T3ZE 1NJ9A 3UC2A 3ZKMD 2HVJB 1U8KB 3L9RA 3K6IA 3QHZL 4YHPB 4Z7WF 3WEOA 1S7WA 3DHMA 2L7EA 3IF1B 5AL0A 3W9EA 5B39B 1NL0H 3MRCB 4JFWA 5DHEA 5IHHA 5TD4A 4M00A 1MVYA 3A4DA 3ILEA 4RMUA 3EYQC 4PJ5B 4Y2DA 3F04A 3I74A 2NUPA 4M43H 1K4CA 1O0VA 4L3CA 1OGTA 3JYBA 4M93B 1KNOA 1WVZA 4DCQB 2ADIB 4Z7IA 2DH3A 1DLHA 1SBSH 2BNQD 3J8F7 1QEWB 4X6DE 1P2CB 1F4XL 2H6PA 4FTDA 4FTVD 2FT8A 1WFJA 2WUBL 2RAMA 5KBKA 3OD3A 1TU2B 2ZKYA 3FUKA 4U1LA 3ULUC 1IFGA 1T1YB 5I6NA 1INEL 1Q4NX 1NWOA 3DSNA 4PVLA 5ANHA 1HCZA 2ERJB 5C0AD 1NUDA 4QO1B 4Z95L 4ZXBC 1QNIA 1TF4A 5FYLH 4U6XB 1OB1A 3VXOA 3GSNB 3OLDA 2XLLA 3K2UL 4LGRB 4JY5L 4DP7X 1E2WA 3HRZC 1BECA 2Z34A 1OSZB 2IDTA 3BI9X 3QWQB 3M8OH 1RD6A 1CIUA 2MQ3A 2FEDC 5LWYL 2QKIB 4UQCA 1RQ5A 3ARFB 3BUPA 3MJ6A 2X41A 5IBTL 2YKLH 4FXLA 5JUEL 4MDJB 3T65A 4LCIL 3T6WA 3QRFM 5K9KB 1COBA 3EJYD 1N5YH 3OJVC 2UY7B 2B39A 3U7WH 1A3QA 1CICC 3DX0A