4G8AA

Crystal structure of human tlr4 polymorphic variant d299g and t399i in complex with md-2 and lps
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
601
structure length
601
Chain Sequence
EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDGIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTISLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 4
publication title Structural analyses of human Toll-like receptor 4 polymorphisms D299G and T399I
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 211
structure length 601
sequence length 601
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4g8aA00
2OMYA 4BSUA 5HZLB 3RGZA 4FMZA 2A0ZA 2O6QA 4V2EA 4ARRA 1OZNA 5GS2B 3W3NA 2ID5A 3O6NA 1SQ0B 1DFJI 1K5DC 4RWTC 4R08A 2OMWA 4CILA 4FDWA 3WPCA 4Z79A 2R9UA 1OGQA 4LXRA 4R6GA 1KOHA 4KNGA 4PKIG 5CMPA 3WPHA 4TZHA 4G8AA 3RFSA 5B4PA 1Z7XW 1O6TA 4LI1A 3JB9j 3DZEA 3CVRA 1A4YA 4CP6A 4R6JA 4P8SA 4Z61C 3REZA 3C6NB 2P1MB 4QXEA 3WPDA 2WQWA 4PSJA 3VQ2A 3W3MA 3RGXA 4YEBB 3WPBA 1P8TA 3PMHG 1XECA 3W3KA 4ARNA 3E4GA 4FD0A 2Z66A 3O53A 2O6SA 2Z64A 3RW6A 4Q62A 3OJAB 3CIYA 3KJ4A 3M19A 3G04C 1H6TA 4PQ8A 1OTMA 4LSXC 2P1NB 4K17A 1FT8A 5GQRK 5IJCA 4Y61B 4J0MA 5LFNA 4AY9X 3WPIA 1A9NA 4PEQB 2P1OB 4XGOA 1FO1A 3G3AA 1XKUA 1YRGA 2Y5QA 5FTTB 1XCDA 4KT1A 2O6RA 5CMNA 4LXSA 4C2BB 1XWDC 4M7EA 1OOKG 2WQVA 1H6UA 1KOOA 4WP6A 2V70A 2JE0A 2Q4GW 4MQWX 4V2CA 2BEXA 4Z64C 4R5CA 4OQTA 1FQVA 5IJBA 1P9AG 2WQUA 3OGKB 4J4LA 4PERA 4BV4R 3ZYOA 4Z8GA 2OMUA 1XEUA 4CC4A 1QYYA 3RFEA 2Z81A 1U0ND 1PGVA 1M9LA 3E2JA 4IM6A 2V9SA 3VQ1A 3UL7A 3ULVA 1K5GC 1WWLA 4CNMA 2ASTB 2OMTA 4QBZA 2WQXA 3G06A 4XOSA 1M9SA 4HQ1A 3TSRE 1W8AA 1O6SA 5IYXC 4RCAB 1FS2A 2P1PB 1DCEA 4EZGA 3SB4A 3W3GA 4XSQA 4LSAA 2JQDA 3W3JA 4AW4A 2UZYA 2Z82A 3OGMB 5GS0A 2Z7XA 4B8CD 2IFGA 2WFHA 5GMHA 5AWBA 1ZIWA 3WPEA 1OTNA 3UL9A 3G39A 5B0TA 2RA8A 3ULUA 3ZYNA 5GMGA 4RCWA 2Z62A 1M0ZA 4R0AA 4U06A 4CNCA 4LSCA 4Q3IA 4MN8B 3CIGA 4BSSA 4L3FA 2OMZA 3WPFA 5IJDA 2Z65A 3OJAA 4H09A 1IO0A 3WN4A 4BSRA 4FHOA 5AZ5A 2FT3A 2V9TB 2RR6A 4U7LA 4R6AA 2OMXA 2P1QB 3RJ0A 5HDHA 1GWBA 4LI2A 5AWAA 4FS7A 5GMFA 2UZXA 5AWDA 2CA6A 4M7EC 4R6FA 5D3IA 3ULAA 4GLPA 3E3ZA 1OTOA 4Z94G 1P8VA 4L3AA 3WPGA 3RFJA 2XWTC 4Q3GA 3UN9A 5B0NA 3C6OB 4R09A 4P91A 3ZYIA 4CC4C 3G3BA 1JL5A 3BZ5A 4ECOA 4NKHA 3OGLB 3C6PB 4R07A 4I6JB 4U08A 4U09A 2ASSB 1O6VA 2JE1A 4ECNA 1DS9A 3UL8A 2Z7XB 1LTXA 4UFRA 4WYKA 4V2DA 3RIZA 3FXIA 3W3LA 3A79B 5AWCA 4C2AB 3M18A 4R58A 3RW7A 4FCGA 2ELLA 3ZYJA 2Z63A 2BNHA 5A5CA 1G9UA 4LSXA 1D0BA 2OMVA 4R5DA 4NKGA 4GT6A 3GOZA 4QC0A 4KXFB 3P72A 2XOTA 3E6JA 1M10B
chains in the Genus database with same CATH superfamily
2OMYA 4BSUA 5HZLB 3RGZA 4FMZA 2A0ZA 2O6QA 4V2EA 4ARRA 1OZNA 5GS2B 3W3NA 2ID5A 3O6NA 1SQ0B 1DFJI 1K5DC 4RWTC 4R08A 2OMWA 4CILA 4FDWA 3WPCA 4Z79A 2R9UA 1OGQA 4LXRA 4R6GA 1KOHA 4KNGA 4PKIG 5CMPA 3WPHA 4TZHA 4G8AA 3RFSA 5B4PA 1Z7XW 1O6TA 4LI1A 3JB9j 3DZEA 3CVRA 1A4YA 4CP6A 4R6JA 4P8SA 4Z61C 3REZA 3C6NB 2P1MB 4QXEA 3WPDA 2WQWA 4PSJA 3VQ2A 3W3MA 3RGXA 4YEBB 3WPBA 1P8TA 3PMHG 1XECA 3W3KA 4ARNA 3E4GA 4FD0A 2Z66A 3O53A 2O6SA 2Z64A 3RW6A 4Q62A 3OJAB 3CIYA 3KJ4A 3M19A 3G04C 1H6TA 4PQ8A 1OTMA 4LSXC 2P1NB 4K17A 1FT8A 5GQRK 5IJCA 4Y61B 4J0MA 5LFNA 4AY9X 3WPIA 1A9NA 4PEQB 2P1OB 4XGOA 1FO1A 3G3AA 1XKUA 1YRGA 2Y5QA 5FTTB 1XCDA 4KT1A 2O6RA 5CMNA 4LXSA 4C2BB 1XWDC 4M7EA 1OOKG 2WQVA 1H6UA 1KOOA 4WP6A 2V70A 2JE0A 2Q4GW 4MQWX 4V2CA 2BEXA 4Z64C 4R5CA 4OQTA 1FQVA 5IJBA 1P9AG 2WQUA 3OGKB 4J4LA 4PERA 4BV4R 3ZYOA 4Z8GA 2OMUA 1XEUA 4CC4A 1QYYA 3RFEA 2Z81A 1U0ND 1PGVA 1M9LA 3E2JA 4IM6A 2V9SA 3VQ1A 4NZTM 3UL7A 3ULVA 1K5GC 1WWLA 4CNMA 2ASTB 2OMTA 4QBZA 2WQXA 3G06A 4XOSA 1M9SA 4HQ1A 3TSRE 1W8AA 1O6SA 5IYXC 4RCAB 1FS2A 2P1PB 1DCEA 4EZGA 3SB4A 3W3GA 4XSQA 4LSAA 2JQDA 3W3JA 4AW4A 2UZYA 2Z82A 3OGMB 5GS0A 2Z7XA 4B8CD 2IFGA 2WFHA 5GMHA 5AWBA 4NZRM 1ZIWA 3WPEA 1OTNA 3UL9A 3G39A 5B0TA 2RA8A 3ULUA 3ZYNA 5GMGA 4RCWA 2Z62A 1M0ZA 4R0AA 4U06A 4CNCA 4LSCA 4Q3IA 4MN8B 3CIGA 4BSSA 4L3FA 2OMZA 3WPFA 5IJDA 2Z65A 3OJAA 4H09A 1IO0A 3WN4A 4BSRA 4FHOA 5AZ5A 2FT3A 2V9TB 2RR6A 4U7LA 4R6AA 2OMXA 2P1QB 3RJ0A 5HDHA 1GWBA 4LI2A 5AWAA 4FS7A 5GMFA 2UZXA 5AWDA 2CA6A 4M7EC 4R6FA 5D3IA 3ULAA 4GLPA 3E3ZA 1OTOA 4Z94G 1P8VA 4L3AA 3WPGA 3RFJA 2XWTC 4Q3GA 3UN9A 5B0NA 3C6OB 4R09A 4P91A 3ZYIA 4CC4C 3G3BA 1JL5A 3BZ5A 4ECOA 4NKHA 3OGLB 3C6PB 4R07A 4I6JB 4U08A 4U09A 2ASSB 1O6VA 2JE1A 4ECNA 1DS9A 3UL8A 2Z7XB 1LTXA 4UFRA 4WYKA 4V2DA 3RIZA 3FXIA 3W3LA 3A79B 5AWCA 4C2AB 3M18A 4R58A 3RW7A 4FCGA 2ELLA 3ZYJA 2Z63A 2BNHA 5A5CA 1G9UA 4LSXA 1D0BA 2OMVA 4R5DA 4NKGA 4GT6A 3GOZA 4QC0A 4KXFB 3P72A 2XOTA 3E6JA 1M10B
chains in the Genus database with same CATH topology
2OMYA 4BSUA 5HZLB 3RGZA 4FMZA 2A0ZA 2O6QA 4V2EA 4ARRA 1OZNA 5GS2B 3W3NA 2ID5A 3O6NA 1SQ0B 1DFJI 1K5DC 4RWTC 4R08A 2OMWA 4CILA 4FDWA 3WPCA 4Z79A 2R9UA 1OGQA 4LXRA 4R6GA 1KOHA 4KNGA 4PKIG 5CMPA 3WPHA 4TZHA 4G8AA 3RFSA 5B4PA 1Z7XW 1O6TA 4LI1A 3JB9j 3DZEA 3CVRA 1A4YA 4CP6A 4R6JA 4P8SA 4Z61C 3REZA 3C6NB 2P1MB 4QXEA 3WPDA 2WQWA 4PSJA 3VQ2A 3W3MA 3RGXA 4YEBB 3WPBA 1P8TA 3PMHG 1XECA 3W3KA 4ARNA 3E4GA 4FD0A 2Z66A 3O53A 2O6SA 2Z64A 3RW6A 4Q62A 3OJAB 3CIYA 3KJ4A 3M19A 3G04C 1H6TA 4PQ8A 1OTMA 4LSXC 2P1NB 4K17A 1FT8A 5GQRK 5IJCA 4Y61B 4J0MA 5LFNA 4AY9X 3WPIA 1A9NA 4PEQB 2P1OB 4XGOA 1FO1A 3G3AA 1XKUA 1YRGA 2Y5QA 5FTTB 1XCDA 4KT1A 2O6RA 5CMNA 4LXSA 4C2BB 1XWDC 4M7EA 1OOKG 2WQVA 1H6UA 1KOOA 4WP6A 2V70A 2JE0A 2Q4GW 4MQWX 4V2CA 2BEXA 4Z64C 4R5CA 4OQTA 1FQVA 5IJBA 1P9AG 2WQUA 3OGKB 4J4LA 4PERA 4BV4R 3ZYOA 4Z8GA 2OMUA 1XEUA 4CC4A 1QYYA 3RFEA 2Z81A 1U0ND 1PGVA 1M9LA 3E2JA 4IM6A 2V9SA 3VQ1A 3UL7A 3ULVA 1K5GC 1WWLA 4CNMA 2ASTB 2OMTA 4QBZA 2WQXA 3G06A 4XOSA 1M9SA 4HQ1A 3TSRE 1W8AA 1O6SA 5IYXC 4RCAB 1FS2A 2P1PB 1DCEA 4EZGA 3SB4A 3W3GA 4XSQA 4LSAA 2JQDA 3W3JA 4AW4A 2UZYA 2Z82A 3OGMB 5GS0A 2Z7XA 4B8CD 2IFGA 2WFHA 5GMHA 5AWBA 1ZIWA 3WPEA 1OTNA 3UL9A 3G39A 5B0TA 2RA8A 3ULUA 3ZYNA 5GMGA 4RCWA 2Z62A 1M0ZA 4R0AA 4U06A 4CNCA 4LSCA 4Q3IA 4MN8B 3CIGA 4BSSA 4L3FA 2OMZA 3WPFA 5IJDA 2Z65A 3OJAA 4H09A 1IO0A 3WN4A 4BSRA 4FHOA 5AZ5A 2FT3A 2V9TB 2RR6A 4U7LA 4R6AA 2OMXA 2P1QB 3RJ0A 5HDHA 1GWBA 4LI2A 5AWAA 4FS7A 5GMFA 2UZXA 5AWDA 2CA6A 4M7EC 4R6FA 5D3IA 3ULAA 4GLPA 3E3ZA 1OTOA 4Z94G 1P8VA 4L3AA 3WPGA 3RFJA 2XWTC 4Q3GA 3UN9A 5B0NA 3C6OB 4R09A 4P91A 3ZYIA 4CC4C 3G3BA 1JL5A 3BZ5A 4ECOA 4NKHA 3OGLB 3C6PB 4R07A 4I6JB 4U08A 4U09A 2ASSB 1O6VA 2JE1A 4ECNA 1DS9A 3UL8A 2Z7XB 1LTXA 4UFRA 4WYKA 4V2DA 3RIZA 3FXIA 3W3LA 3A79B 5AWCA 4C2AB 3M18A 4R58A 3RW7A 4FCGA 2ELLA 3ZYJA 2Z63A 2BNHA 5A5CA 1G9UA 4LSXA 1D0BA 2OMVA 4R5DA 4NKGA 4GT6A 3GOZA 4QC0A 4KXFB 3P72A 2XOTA 3E6JA 1M10B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMY A;  4BSU A;  5HZL B;  3RGZ A;  4FMZ A;  2A0Z A;  2O6Q A;  4V2E A;  4ARR A;  1OZN A;  5GS2 B;  3W3N A;  2ID5 A;  3O6N A;  1SQ0 B;  1DFJ I;  1K5D C;  4RWT C;  4R08 A;  2OMW A;  4CIL A;  4FDW A;  3WPC A;  4Z79 A;  2R9U A;  1OGQ A;  4LXR A;  4R6G A;  1KOH A;  4KNG A;  4PKI G;  5CMP A;  3WPH A;  4TZH A;  4G8A A;  3RFS A;  5B4P A;  1Z7X W;  1O6T A;  4LI1 A;  3JB9 j;  3DZE A;  3CVR A;  1A4Y A;  4CP6 A;  4R6J A;  4P8S A;  4Z61 C;  3REZ A;  3C6N B;  2P1M B;  4QXE A;  3WPD A;  2WQW A;  4PSJ A;  3VQ2 A;  3W3M A;  3RGX A;  4YEB B;  3WPB A;  1P8T A;  3PMH G;  1XEC A;  3W3K A;  4ARN A;  3E4G A;  4FD0 A;  2Z66 A;  3O53 A;  2O6S A;  2Z64 A;  3RW6 A;  4Q62 A;  3OJA B;  3CIY A;  3KJ4 A;  3M19 A;  3G04 C;  1H6T A;  4PQ8 A;  1OTM A;  4LSX C;  2P1N B;  4K17 A;  1FT8 A;  5GQR K;  5IJC A;  4Y61 B;  4J0M A;  5LFN A;  4AY9 X;  3WPI A;  1A9N A;  4PEQ B;  2P1O B;  4XGO A;  1FO1 A;  3G3A A;  1XKU A;  1YRG A;  2Y5Q A;  5FTT B;  1XCD A;  4KT1 A;  2O6R A;  5CMN A;  4LXS A;  4C2B B;  1XWD C;  4M7E A;  1OOK G;  2WQV A;  1H6U A;  1KOO A;  4WP6 A;  2V70 A;  2JE0 A;  2Q4G W;  4MQW X;  4V2C A;  2BEX A;  4Z64 C;  4R5C A;  4OQT A;  1FQV A;  5IJB A;  1P9A G;  2WQU A;  3OGK B;  4J4L A;  4PER A;  4BV4 R;  3ZYO A;  4Z8G A;  2OMU A;  1XEU A;  4CC4 A;  1QYY A;  3RFE A;  2Z81 A;  1U0N D;  1PGV A;  1M9L A;  3E2J A;  4IM6 A;  2V9S A;  3VQ1 A;  3UL7 A;  3ULV A;  1K5G C;  1WWL A;  4CNM A;  2AST B;  2OMT A;  4QBZ A;  2WQX A;  3G06 A;  4XOS A;  1M9S A;  4HQ1 A;  3TSR E;  1W8A A;  1O6S A;  5IYX C;  4RCA B;  1FS2 A;  2P1P B;  1DCE A;  4EZG A;  3SB4 A;  3W3G A;  4XSQ A;  4LSA A;  2JQD A;  3W3J A;  4AW4 A;  2UZY A;  2Z82 A;  3OGM B;  5GS0 A;  2Z7X A;  4B8C D;  2IFG A;  2WFH A;  5GMH A;  5AWB A;  1ZIW A;  3WPE A;  1OTN A;  3UL9 A;  3G39 A;  5B0T A;  2RA8 A;  3ULU A;  3ZYN A;  5GMG A;  4RCW A;  2Z62 A;  1M0Z A;  4R0A A;  4U06 A;  4CNC A;  4LSC A;  4Q3I A;  4MN8 B;  3CIG A;  4BSS A;  4L3F A;  2OMZ A;  3WPF A;  5IJD A;  2Z65 A;  3OJA A;  4H09 A;  1IO0 A;  3WN4 A;  4BSR A;  4FHO A;  5AZ5 A;  2FT3 A;  2V9T B;  2RR6 A;  4U7L A;  4R6A A;  2OMX A;  2P1Q B;  3RJ0 A;  5HDH A;  1GWB A;  4LI2 A;  5AWA A;  4FS7 A;  5GMF A;  2UZX A;  5AWD A;  2CA6 A;  4M7E C;  4R6F A;  5D3I A;  3ULA A;  4GLP A;  3E3Z A;  1OTO A;  4Z94 G;  1P8V A;  4L3A A;  3WPG A;  3RFJ A;  2XWT C;  4Q3G A;  3UN9 A;  5B0N A;  3C6O B;  4R09 A;  4P91 A;  3ZYI A;  4CC4 C;  3G3B A;  1JL5 A;  3BZ5 A;  4ECO A;  4NKH A;  3OGL B;  3C6P B;  4R07 A;  4I6J B;  4U08 A;  4U09 A;  2ASS B;  1O6V A;  2JE1 A;  4ECN A;  1DS9 A;  3UL8 A;  2Z7X B;  1LTX A;  4UFR A;  4WYK A;  4V2D A;  3RIZ A;  3FXI A;  3W3L A;  3A79 B;  5AWC A;  4C2A B;  3M18 A;  4R58 A;  3RW7 A;  4FCG A;  2ELL A;  3ZYJ A;  2Z63 A;  2BNH A;  5A5C A;  1G9U A;  4LSX A;  1D0B A;  2OMV A;  4R5D A;  4NKG A;  4GT6 A;  3GOZ A;  4QC0 A;  4KXF B;  3P72 A;  2XOT A;  3E6J A;  1M10 B; 
#chains in the Genus database with same CATH topology
 2OMY A;  4BSU A;  5HZL B;  3RGZ A;  4FMZ A;  2A0Z A;  2O6Q A;  4V2E A;  4ARR A;  1OZN A;  5GS2 B;  3W3N A;  2ID5 A;  3O6N A;  1SQ0 B;  1DFJ I;  1K5D C;  4RWT C;  4R08 A;  2OMW A;  4CIL A;  4FDW A;  3WPC A;  4Z79 A;  2R9U A;  1OGQ A;  4LXR A;  4R6G A;  1KOH A;  4KNG A;  4PKI G;  5CMP A;  3WPH A;  4TZH A;  4G8A A;  3RFS A;  5B4P A;  1Z7X W;  1O6T A;  4LI1 A;  3JB9 j;  3DZE A;  3CVR A;  1A4Y A;  4CP6 A;  4R6J A;  4P8S A;  4Z61 C;  3REZ A;  3C6N B;  2P1M B;  4QXE A;  3WPD A;  2WQW A;  4PSJ A;  3VQ2 A;  3W3M A;  3RGX A;  4YEB B;  3WPB A;  1P8T A;  3PMH G;  1XEC A;  3W3K A;  4ARN A;  3E4G A;  4FD0 A;  2Z66 A;  3O53 A;  2O6S A;  2Z64 A;  3RW6 A;  4Q62 A;  3OJA B;  3CIY A;  3KJ4 A;  3M19 A;  3G04 C;  1H6T A;  4PQ8 A;  1OTM A;  4LSX C;  2P1N B;  4K17 A;  1FT8 A;  5GQR K;  5IJC A;  4Y61 B;  4J0M A;  5LFN A;  4AY9 X;  3WPI A;  1A9N A;  4PEQ B;  2P1O B;  4XGO A;  1FO1 A;  3G3A A;  1XKU A;  1YRG A;  2Y5Q A;  5FTT B;  1XCD A;  4KT1 A;  2O6R A;  5CMN A;  4LXS A;  4C2B B;  1XWD C;  4M7E A;  1OOK G;  2WQV A;  1H6U A;  1KOO A;  4WP6 A;  2V70 A;  2JE0 A;  2Q4G W;  4MQW X;  4V2C A;  2BEX A;  4Z64 C;  4R5C A;  4OQT A;  1FQV A;  5IJB A;  1P9A G;  2WQU A;  3OGK B;  4J4L A;  4PER A;  4BV4 R;  3ZYO A;  4Z8G A;  2OMU A;  1XEU A;  4CC4 A;  1QYY A;  3RFE A;  2Z81 A;  1U0N D;  1PGV A;  1M9L A;  3E2J A;  4IM6 A;  2V9S A;  3VQ1 A;  4NZT M;  3UL7 A;  3ULV A;  1K5G C;  1WWL A;  4CNM A;  2AST B;  2OMT A;  4QBZ A;  2WQX A;  3G06 A;  4XOS A;  1M9S A;  4HQ1 A;  3TSR E;  1W8A A;  1O6S A;  5IYX C;  4RCA B;  1FS2 A;  2P1P B;  1DCE A;  4EZG A;  3SB4 A;  3W3G A;  4XSQ A;  4LSA A;  2JQD A;  3W3J A;  4AW4 A;  2UZY A;  2Z82 A;  3OGM B;  5GS0 A;  2Z7X A;  4B8C D;  2IFG A;  2WFH A;  5GMH A;  5AWB A;  4NZR M;  1ZIW A;  3WPE A;  1OTN A;  3UL9 A;  3G39 A;  5B0T A;  2RA8 A;  3ULU A;  3ZYN A;  5GMG A;  4RCW A;  2Z62 A;  1M0Z A;  4R0A A;  4U06 A;  4CNC A;  4LSC A;  4Q3I A;  4MN8 B;  3CIG A;  4BSS A;  4L3F A;  2OMZ A;  3WPF A;  5IJD A;  2Z65 A;  3OJA A;  4H09 A;  1IO0 A;  3WN4 A;  4BSR A;  4FHO A;  5AZ5 A;  2FT3 A;  2V9T B;  2RR6 A;  4U7L A;  4R6A A;  2OMX A;  2P1Q B;  3RJ0 A;  5HDH A;  1GWB A;  4LI2 A;  5AWA A;  4FS7 A;  5GMF A;  2UZX A;  5AWD A;  2CA6 A;  4M7E C;  4R6F A;  5D3I A;  3ULA A;  4GLP A;  3E3Z A;  1OTO A;  4Z94 G;  1P8V A;  4L3A A;  3WPG A;  3RFJ A;  2XWT C;  4Q3G A;  3UN9 A;  5B0N A;  3C6O B;  4R09 A;  4P91 A;  3ZYI A;  4CC4 C;  3G3B A;  1JL5 A;  3BZ5 A;  4ECO A;  4NKH A;  3OGL B;  3C6P B;  4R07 A;  4I6J B;  4U08 A;  4U09 A;  2ASS B;  1O6V A;  2JE1 A;  4ECN A;  1DS9 A;  3UL8 A;  2Z7X B;  1LTX A;  4UFR A;  4WYK A;  4V2D A;  3RIZ A;  3FXI A;  3W3L A;  3A79 B;  5AWC A;  4C2A B;  3M18 A;  4R58 A;  3RW7 A;  4FCG A;  2ELL A;  3ZYJ A;  2Z63 A;  2BNH A;  5A5C A;  1G9U A;  4LSX A;  1D0B A;  2OMV A;  4R5D A;  4NKG A;  4GT6 A;  3GOZ A;  4QC0 A;  4KXF B;  3P72 A;  2XOT A;  3E6J A;  1M10 B; 
#chains in the Genus database with same CATH homology
 2OMY A;  4BSU A;  5HZL B;  3RGZ A;  4FMZ A;  2A0Z A;  2O6Q A;  4V2E A;  4ARR A;  1OZN A;  5GS2 B;  3W3N A;  2ID5 A;  3O6N A;  1SQ0 B;  1DFJ I;  1K5D C;  4RWT C;  4R08 A;  2OMW A;  4CIL A;  4FDW A;  3WPC A;  4Z79 A;  2R9U A;  1OGQ A;  4LXR A;  4R6G A;  1KOH A;  4KNG A;  4PKI G;  5CMP A;  3WPH A;  4TZH A;  4G8A A;  3RFS A;  5B4P A;  1Z7X W;  1O6T A;  4LI1 A;  3JB9 j;  3DZE A;  3CVR A;  1A4Y A;  4CP6 A;  4R6J A;  4P8S A;  4Z61 C;  3REZ A;  3C6N B;  2P1M B;  4QXE A;  3WPD A;  2WQW A;  4PSJ A;  3VQ2 A;  3W3M A;  3RGX A;  4YEB B;  3WPB A;  1P8T A;  3PMH G;  1XEC A;  3W3K A;  4ARN A;  3E4G A;  4FD0 A;  2Z66 A;  3O53 A;  2O6S A;  2Z64 A;  3RW6 A;  4Q62 A;  3OJA B;  3CIY A;  3KJ4 A;  3M19 A;  3G04 C;  1H6T A;  4PQ8 A;  1OTM A;  4LSX C;  2P1N B;  4K17 A;  1FT8 A;  5GQR K;  5IJC A;  4Y61 B;  4J0M A;  5LFN A;  4AY9 X;  3WPI A;  1A9N A;  4PEQ B;  2P1O B;  4XGO A;  1FO1 A;  3G3A A;  1XKU A;  1YRG A;  2Y5Q A;  5FTT B;  1XCD A;  4KT1 A;  2O6R A;  5CMN A;  4LXS A;  4C2B B;  1XWD C;  4M7E A;  1OOK G;  2WQV A;  1H6U A;  1KOO A;  4WP6 A;  2V70 A;  2JE0 A;  2Q4G W;  4MQW X;  4V2C A;  2BEX A;  4Z64 C;  4R5C A;  4OQT A;  1FQV A;  5IJB A;  1P9A G;  2WQU A;  3OGK B;  4J4L A;  4PER A;  4BV4 R;  3ZYO A;  4Z8G A;  2OMU A;  1XEU A;  4CC4 A;  1QYY A;  3RFE A;  2Z81 A;  1U0N D;  1PGV A;  1M9L A;  3E2J A;  4IM6 A;  2V9S A;  3VQ1 A;  3UL7 A;  3ULV A;  1K5G C;  1WWL A;  4CNM A;  2AST B;  2OMT A;  4QBZ A;  2WQX A;  3G06 A;  4XOS A;  1M9S A;  4HQ1 A;  3TSR E;  1W8A A;  1O6S A;  5IYX C;  4RCA B;  1FS2 A;  2P1P B;  1DCE A;  4EZG A;  3SB4 A;  3W3G A;  4XSQ A;  4LSA A;  2JQD A;  3W3J A;  4AW4 A;  2UZY A;  2Z82 A;  3OGM B;  5GS0 A;  2Z7X A;  4B8C D;  2IFG A;  2WFH A;  5GMH A;  5AWB A;  1ZIW A;  3WPE A;  1OTN A;  3UL9 A;  3G39 A;  5B0T A;  2RA8 A;  3ULU A;  3ZYN A;  5GMG A;  4RCW A;  2Z62 A;  1M0Z A;  4R0A A;  4U06 A;  4CNC A;  4LSC A;  4Q3I A;  4MN8 B;  3CIG A;  4BSS A;  4L3F A;  2OMZ A;  3WPF A;  5IJD A;  2Z65 A;  3OJA A;  4H09 A;  1IO0 A;  3WN4 A;  4BSR A;  4FHO A;  5AZ5 A;  2FT3 A;  2V9T B;  2RR6 A;  4U7L A;  4R6A A;  2OMX A;  2P1Q B;  3RJ0 A;  5HDH A;  1GWB A;  4LI2 A;  5AWA A;  4FS7 A;  5GMF A;  2UZX A;  5AWD A;  2CA6 A;  4M7E C;  4R6F A;  5D3I A;  3ULA A;  4GLP A;  3E3Z A;  1OTO A;  4Z94 G;  1P8V A;  4L3A A;  3WPG A;  3RFJ A;  2XWT C;  4Q3G A;  3UN9 A;  5B0N A;  3C6O B;  4R09 A;  4P91 A;  3ZYI A;  4CC4 C;  3G3B A;  1JL5 A;  3BZ5 A;  4ECO A;  4NKH A;  3OGL B;  3C6P B;  4R07 A;  4I6J B;  4U08 A;  4U09 A;  2ASS B;  1O6V A;  2JE1 A;  4ECN A;  1DS9 A;  3UL8 A;  2Z7X B;  1LTX A;  4UFR A;  4WYK A;  4V2D A;  3RIZ A;  3FXI A;  3W3L A;  3A79 B;  5AWC A;  4C2A B;  3M18 A;  4R58 A;  3RW7 A;  4FCG A;  2ELL A;  3ZYJ A;  2Z63 A;  2BNH A;  5A5C A;  1G9U A;  4LSX A;  1D0B A;  2OMV A;  4R5D A;  4NKG A;  4GT6 A;  3GOZ A;  4QC0 A;  4KXF B;  3P72 A;  2XOT A;  3E6J A;  1M10 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...