4G8AA

Crystal structure of human tlr4 polymorphic variant d299g and t399i in complex with md-2 and lps
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
601
structure length
601
Chain Sequence
b'EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDGIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTISLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 4
publication title Structural analyses of human Toll-like receptor 4 polymorphisms D299G and T399I
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 211
structure length 601
sequence length 601
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4g8aA00
4PQ8A 4PEQB 4BSUA 2JE1A 4BSSA 3O6NA 2OMYA 2Y5QA 3ZYOA 2ELLA 3W3KA 4RCWA 2Z82A 3BZ5A 4LXSA 3G3AA 3WPGA 4QXEA 2V70A 3CIYA 3P72A 4R6FA 4WP6A 3W3MA 3WPHA 1GWBA 2P1MB 3GOZA 4P91A 1M9SA 4R6GA 5GMFA 4C2BB 2P1NB 1XECA 1P8TA 1FS2A 4R0AA 3OJAA 4HQ1A 4C2AB 2UZYA 5GQRK 3SB4A 3RW6A 3CIGA 2WQVA 1FQVA 4XSQA 1QYYA 5B4PA 2BNHA 4TZHA 1H6UA 4R09A 4ARRA 4FS7A 1Z7XW 4P8SA 4LSCA 3RJ0A 3REZA 1OZNA 1PGVA 4AW4A 4FDWA 3WPCA 3G39A 1M9LA 3OJAB 4CC4A 1FT8A 2OMZA 1FO1A 2O6RA 4FD0A 1A4YA 2IFGA 5FTTB 4R08A 3ZYJA 3C6NB 3UL7A 4J0MA 3W3JA 4I6JB 1M10B 2P1PB 1D0BA 3ULVA 3FXIA 1JL5A 5IJBA 4EZGA 1U0ND 3KJ4A 3E2JA 5HZLB 1OGQA 2A0ZA 4NKHA 4U06A 2JQDA 5B0TA 1DFJI 4XGOA 4LI1A 4Z61C 4U09A 3JB9j 4UFRA 1W8AA 4GLPA 4Z8GA 1K5GC 2WFHA 2Q4GW 3WN4A 1KOHA 4KT1A 2O6SA 4V2EA 2V9SA 3WPBA 3RGXA 3WPDA 2OMXA 3VQ1A 1XWDC 1XCDA 5IJDA 4CP6A 5AWCA 4R6AA 1OOKG 3UN9A 2R9UA 4MQWX 1H6TA 1WWLA 3CVRA 3M19A 2CA6A 2JE0A 4Z94G 5LFNA 4PKIG 3RFSA 3G04C 4CILA 4J4LA 4WYKA 4FMZA 4R6JA 3RFEA 2P1QB 3E4GA 5D3IA 2WQWA 2WQUA 2RR6A 2UZXA 2ASTB 2V9TB 4R5CA 4V2CA 1SQ0B 5IYXC 2OMUA 5A5CA 4YEBB 3WPEA 2Z64A 1XKUA 5GS2B 4OQTA 2Z65A 3OGMB 2ID5A 1OTNA 4Y61B 4B8CD 3E6JA 1XEUA 4IM6A 2Z66A 2ASSB 4CNCA 3RGZA 4GT6A 1O6TA 3TSRE 4BV4R 4LSXC 3O53A 4M7EC 2OMVA 5AWDA 4XOSA 3A79B 4R58A 4LI2A 4LXRA 5AWAA 3WPIA 3ULUA 1YRGA 5GMHA 3OGKB 3W3LA 4ARNA 4K17A 4Q3IA 1A9NA 4FHOA 3OGLB 3E3ZA 4ECOA 3RIZA 4L3FA 4NKGA 3VQ2A 4LSAA 1O6VA 5B0NA 4Z79A 3UL8A 3W3NA 2BEXA 1LTXA 4MN8B 1IO0A 2XWTC 2RA8A 4R07A 4KXFB 3PMHG 1P9AG 1OTMA 5CMNA 2XOTA 4RWTC 4KNGA 3M18A 1K5DC 4U08A 4FCGA 4QBZA 5CMPA 4Z64C 4BSRA 2FT3A 1O6SA 1P8VA 5AZ5A 1ZIWA 2Z81A 5GMGA 4ECNA 2WQXA 2O6QA 4LSXA 3W3GA 4M7EA 4CNMA 1G9UA 5IJCA 3G3BA 4H09A 4L3AA 3DZEA 4V2DA 3G06A 2Z7XA 1DS9A 2OMTA 1M0ZA 4PERA 4G8AA 5AWBA 4R5DA 3WPFA 4AY9X 3UL9A 3RFJA 4RCAB 3ZYIA 4U7LA 1KOOA 3RW7A 2OMWA 3ZYNA 4QC0A 5GS0A 3C6PB 4Q62A 2Z62A 3C6OB 2Z7XB 2Z63A 4PSJA 4Q3GA 4CC4C 1OTOA 1DCEA 5HDHA 2P1OB 3ULAA
chains in the Genus database with same CATH superfamily
4PQ8A 4PEQB 4BSUA 2JE1A 4BSSA 3O6NA 2OMYA 2Y5QA 3ZYOA 2ELLA 3W3KA 4RCWA 2Z82A 3BZ5A 4LXSA 3G3AA 3WPGA 4QXEA 2V70A 3CIYA 3P72A 4R6FA 4WP6A 3W3MA 3WPHA 1GWBA 2P1MB 3GOZA 4P91A 1M9SA 4R6GA 5GMFA 4C2BB 2P1NB 1XECA 1P8TA 1FS2A 4R0AA 3OJAA 4HQ1A 4C2AB 2UZYA 5GQRK 3SB4A 3RW6A 3CIGA 2WQVA 1FQVA 4XSQA 1QYYA 5B4PA 2BNHA 4TZHA 1H6UA 4R09A 4ARRA 4FS7A 1Z7XW 4P8SA 4LSCA 3RJ0A 3REZA 1OZNA 1PGVA 4AW4A 4FDWA 3WPCA 3G39A 1M9LA 3OJAB 4CC4A 1FT8A 2OMZA 1FO1A 2O6RA 4FD0A 1A4YA 2IFGA 5FTTB 4R08A 3ZYJA 3C6NB 3UL7A 4J0MA 3W3JA 4I6JB 1M10B 2P1PB 1D0BA 3ULVA 3FXIA 1JL5A 5IJBA 4EZGA 1U0ND 3KJ4A 3E2JA 5HZLB 1OGQA 2A0ZA 4NKHA 4U06A 2JQDA 5B0TA 1DFJI 4XGOA 4LI1A 4Z61C 4U09A 3JB9j 4UFRA 1W8AA 4GLPA 4Z8GA 1K5GC 2WFHA 2Q4GW 3WN4A 1KOHA 4KT1A 2O6SA 4V2EA 2V9SA 3WPBA 3RGXA 3WPDA 2OMXA 3VQ1A 1XWDC 1XCDA 5IJDA 4CP6A 5AWCA 4R6AA 1OOKG 3UN9A 2R9UA 4MQWX 1H6TA 1WWLA 3CVRA 3M19A 2CA6A 2JE0A 4Z94G 5LFNA 4PKIG 3RFSA 3G04C 4CILA 4J4LA 4WYKA 4FMZA 4R6JA 3RFEA 2P1QB 3E4GA 5D3IA 2WQWA 2WQUA 2RR6A 2UZXA 2ASTB 2V9TB 4R5CA 4V2CA 1SQ0B 5IYXC 2OMUA 5A5CA 4YEBB 3WPEA 2Z64A 1XKUA 5GS2B 4OQTA 2Z65A 3OGMB 2ID5A 1OTNA 4Y61B 4B8CD 3E6JA 1XEUA 4IM6A 2Z66A 2ASSB 4CNCA 3RGZA 4GT6A 1O6TA 3TSRE 4NZRM 4BV4R 4LSXC 3O53A 4M7EC 2OMVA 5AWDA 4XOSA 3A79B 4R58A 4LI2A 4LXRA 5AWAA 3WPIA 3ULUA 1YRGA 5GMHA 3OGKB 3W3LA 4ARNA 4K17A 4Q3IA 1A9NA 4FHOA 3OGLB 3E3ZA 4ECOA 3RIZA 4L3FA 4NKGA 3VQ2A 4LSAA 1O6VA 5B0NA 4Z79A 3UL8A 3W3NA 2BEXA 1LTXA 4MN8B 1IO0A 2XWTC 2RA8A 4R07A 4KXFB 3PMHG 1P9AG 1OTMA 5CMNA 2XOTA 4RWTC 4KNGA 3M18A 1K5DC 4U08A 4FCGA 4QBZA 5CMPA 4Z64C 4BSRA 2FT3A 1O6SA 1P8VA 5AZ5A 1ZIWA 2Z81A 5GMGA 4ECNA 2WQXA 2O6QA 4LSXA 3W3GA 4M7EA 4CNMA 1G9UA 5IJCA 3G3BA 4H09A 4L3AA 3DZEA 4V2DA 3G06A 2Z7XA 1DS9A 2OMTA 1M0ZA 4PERA 4G8AA 5AWBA 4R5DA 3WPFA 4AY9X 3UL9A 3RFJA 4RCAB 3ZYIA 4NZTM 4U7LA 1KOOA 3RW7A 2OMWA 3ZYNA 4QC0A 5GS0A 3C6PB 4Q62A 2Z62A 3C6OB 2Z7XB 2Z63A 4PSJA 4Q3GA 4CC4C 1OTOA 1DCEA 5HDHA 2P1OB 3ULAA
chains in the Genus database with same CATH topology
4PQ8A 4PEQB 4BSUA 2JE1A 4BSSA 3O6NA 2OMYA 2Y5QA 3ZYOA 2ELLA 3W3KA 4RCWA 2Z82A 3BZ5A 4LXSA 3G3AA 3WPGA 4QXEA 2V70A 3CIYA 3P72A 4R6FA 4WP6A 3W3MA 3WPHA 1GWBA 2P1MB 3GOZA 4P91A 1M9SA 4R6GA 5GMFA 4C2BB 2P1NB 1XECA 1P8TA 1FS2A 4R0AA 3OJAA 4HQ1A 4C2AB 2UZYA 5GQRK 3SB4A 3RW6A 3CIGA 2WQVA 1FQVA 4XSQA 1QYYA 5B4PA 2BNHA 4TZHA 1H6UA 4R09A 4ARRA 4FS7A 1Z7XW 4P8SA 4LSCA 3RJ0A 3REZA 1OZNA 1PGVA 4AW4A 4FDWA 3WPCA 3G39A 1M9LA 3OJAB 4CC4A 1FT8A 2OMZA 1FO1A 2O6RA 4FD0A 1A4YA 2IFGA 5FTTB 4R08A 3ZYJA 3C6NB 3UL7A 4J0MA 3W3JA 4I6JB 1M10B 2P1PB 1D0BA 3ULVA 3FXIA 1JL5A 5IJBA 4EZGA 1U0ND 3KJ4A 3E2JA 5HZLB 1OGQA 2A0ZA 4NKHA 4U06A 2JQDA 5B0TA 1DFJI 4XGOA 4LI1A 4Z61C 4U09A 3JB9j 4UFRA 1W8AA 4GLPA 4Z8GA 1K5GC 2WFHA 2Q4GW 3WN4A 1KOHA 4KT1A 2O6SA 4V2EA 2V9SA 3WPBA 3RGXA 3WPDA 2OMXA 3VQ1A 1XWDC 1XCDA 5IJDA 4CP6A 5AWCA 4R6AA 1OOKG 3UN9A 2R9UA 4MQWX 1H6TA 1WWLA 3CVRA 3M19A 2CA6A 2JE0A 4Z94G 5LFNA 4PKIG 3RFSA 3G04C 4CILA 4J4LA 4WYKA 4FMZA 4R6JA 3RFEA 2P1QB 3E4GA 5D3IA 2WQWA 2WQUA 2RR6A 2UZXA 2ASTB 2V9TB 4R5CA 4V2CA 1SQ0B 5IYXC 2OMUA 5A5CA 4YEBB 3WPEA 2Z64A 1XKUA 5GS2B 4OQTA 2Z65A 3OGMB 2ID5A 1OTNA 4Y61B 4B8CD 3E6JA 1XEUA 4IM6A 2Z66A 2ASSB 4CNCA 3RGZA 4GT6A 1O6TA 3TSRE 4BV4R 4LSXC 3O53A 4M7EC 2OMVA 5AWDA 4XOSA 3A79B 4R58A 4LI2A 4LXRA 5AWAA 3WPIA 3ULUA 1YRGA 5GMHA 3OGKB 3W3LA 4ARNA 4K17A 4Q3IA 1A9NA 4FHOA 3OGLB 3E3ZA 4ECOA 3RIZA 4L3FA 4NKGA 3VQ2A 4LSAA 1O6VA 5B0NA 4Z79A 3UL8A 3W3NA 2BEXA 1LTXA 4MN8B 1IO0A 2XWTC 2RA8A 4R07A 4KXFB 3PMHG 1P9AG 1OTMA 5CMNA 2XOTA 4RWTC 4KNGA 3M18A 1K5DC 4U08A 4FCGA 4QBZA 5CMPA 4Z64C 4BSRA 2FT3A 1O6SA 1P8VA 5AZ5A 1ZIWA 2Z81A 5GMGA 4ECNA 2WQXA 2O6QA 4LSXA 3W3GA 4M7EA 4CNMA 1G9UA 5IJCA 3G3BA 4H09A 4L3AA 3DZEA 4V2DA 3G06A 2Z7XA 1DS9A 2OMTA 1M0ZA 4PERA 4G8AA 5AWBA 4R5DA 3WPFA 4AY9X 3UL9A 3RFJA 4RCAB 3ZYIA 4U7LA 1KOOA 3RW7A 2OMWA 3ZYNA 4QC0A 5GS0A 3C6PB 4Q62A 2Z62A 3C6OB 2Z7XB 2Z63A 4PSJA 4Q3GA 4CC4C 1OTOA 1DCEA 5HDHA 2P1OB 3ULAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQ8 A;  4PEQ B;  4BSU A;  2JE1 A;  4BSS A;  3O6N A;  2OMY A;  2Y5Q A;  3ZYO A;  2ELL A;  3W3K A;  4RCW A;  2Z82 A;  3BZ5 A;  4LXS A;  3G3A A;  3WPG A;  4QXE A;  2V70 A;  3CIY A;  3P72 A;  4R6F A;  4WP6 A;  3W3M A;  3WPH A;  1GWB A;  2P1M B;  3GOZ A;  4P91 A;  1M9S A;  4R6G A;  5GMF A;  4C2B B;  2P1N B;  1XEC A;  1P8T A;  1FS2 A;  4R0A A;  3OJA A;  4HQ1 A;  4C2A B;  2UZY A;  5GQR K;  3SB4 A;  3RW6 A;  3CIG A;  2WQV A;  1FQV A;  4XSQ A;  1QYY A;  5B4P A;  2BNH A;  4TZH A;  1H6U A;  4R09 A;  4ARR A;  4FS7 A;  1Z7X W;  4P8S A;  4LSC A;  3RJ0 A;  3REZ A;  1OZN A;  1PGV A;  4AW4 A;  4FDW A;  3WPC A;  3G39 A;  1M9L A;  3OJA B;  4CC4 A;  1FT8 A;  2OMZ A;  1FO1 A;  2O6R A;  4FD0 A;  1A4Y A;  2IFG A;  5FTT B;  4R08 A;  3ZYJ A;  3C6N B;  3UL7 A;  4J0M A;  3W3J A;  4I6J B;  1M10 B;  2P1P B;  1D0B A;  3ULV A;  3FXI A;  1JL5 A;  5IJB A;  4EZG A;  1U0N D;  3KJ4 A;  3E2J A;  5HZL B;  1OGQ A;  2A0Z A;  4NKH A;  4U06 A;  2JQD A;  5B0T A;  1DFJ I;  4XGO A;  4LI1 A;  4Z61 C;  4U09 A;  3JB9 j;  4UFR A;  1W8A A;  4GLP A;  4Z8G A;  1K5G C;  2WFH A;  2Q4G W;  3WN4 A;  1KOH A;  4KT1 A;  2O6S A;  4V2E A;  2V9S A;  3WPB A;  3RGX A;  3WPD A;  2OMX A;  3VQ1 A;  1XWD C;  1XCD A;  5IJD A;  4CP6 A;  5AWC A;  4R6A A;  1OOK G;  3UN9 A;  2R9U A;  4MQW X;  1H6T A;  1WWL A;  3CVR A;  3M19 A;  2CA6 A;  2JE0 A;  4Z94 G;  5LFN A;  4PKI G;  3RFS A;  3G04 C;  4CIL A;  4J4L A;  4WYK A;  4FMZ A;  4R6J A;  3RFE A;  2P1Q B;  3E4G A;  5D3I A;  2WQW A;  2WQU A;  2RR6 A;  2UZX A;  2AST B;  2V9T B;  4R5C A;  4V2C A;  1SQ0 B;  5IYX C;  2OMU A;  5A5C A;  4YEB B;  3WPE A;  2Z64 A;  1XKU A;  5GS2 B;  4OQT A;  2Z65 A;  3OGM B;  2ID5 A;  1OTN A;  4Y61 B;  4B8C D;  3E6J A;  1XEU A;  4IM6 A;  2Z66 A;  2ASS B;  4CNC A;  3RGZ A;  4GT6 A;  1O6T A;  3TSR E;  4BV4 R;  4LSX C;  3O53 A;  4M7E C;  2OMV A;  5AWD A;  4XOS A;  3A79 B;  4R58 A;  4LI2 A;  4LXR A;  5AWA A;  3WPI A;  3ULU A;  1YRG A;  5GMH A;  3OGK B;  3W3L A;  4ARN A;  4K17 A;  4Q3I A;  1A9N A;  4FHO A;  3OGL B;  3E3Z A;  4ECO A;  3RIZ A;  4L3F A;  4NKG A;  3VQ2 A;  4LSA A;  1O6V A;  5B0N A;  4Z79 A;  3UL8 A;  3W3N A;  2BEX A;  1LTX A;  4MN8 B;  1IO0 A;  2XWT C;  2RA8 A;  4R07 A;  4KXF B;  3PMH G;  1P9A G;  1OTM A;  5CMN A;  2XOT A;  4RWT C;  4KNG A;  3M18 A;  1K5D C;  4U08 A;  4FCG A;  4QBZ A;  5CMP A;  4Z64 C;  4BSR A;  2FT3 A;  1O6S A;  1P8V A;  5AZ5 A;  1ZIW A;  2Z81 A;  5GMG A;  4ECN A;  2WQX A;  2O6Q A;  4LSX A;  3W3G A;  4M7E A;  4CNM A;  1G9U A;  5IJC A;  3G3B A;  4H09 A;  4L3A A;  3DZE A;  4V2D A;  3G06 A;  2Z7X A;  1DS9 A;  2OMT A;  1M0Z A;  4PER A;  4G8A A;  5AWB A;  4R5D A;  3WPF A;  4AY9 X;  3UL9 A;  3RFJ A;  4RCA B;  3ZYI A;  4U7L A;  1KOO A;  3RW7 A;  2OMW A;  3ZYN A;  4QC0 A;  5GS0 A;  3C6P B;  4Q62 A;  2Z62 A;  3C6O B;  2Z7X B;  2Z63 A;  4PSJ A;  4Q3G A;  4CC4 C;  1OTO A;  1DCE A;  5HDH A;  2P1O B;  3ULA A; 
#chains in the Genus database with same CATH topology
 4PQ8 A;  4PEQ B;  4BSU A;  2JE1 A;  4BSS A;  3O6N A;  2OMY A;  2Y5Q A;  3ZYO A;  2ELL A;  3W3K A;  4RCW A;  2Z82 A;  3BZ5 A;  4LXS A;  3G3A A;  3WPG A;  4QXE A;  2V70 A;  3CIY A;  3P72 A;  4R6F A;  4WP6 A;  3W3M A;  3WPH A;  1GWB A;  2P1M B;  3GOZ A;  4P91 A;  1M9S A;  4R6G A;  5GMF A;  4C2B B;  2P1N B;  1XEC A;  1P8T A;  1FS2 A;  4R0A A;  3OJA A;  4HQ1 A;  4C2A B;  2UZY A;  5GQR K;  3SB4 A;  3RW6 A;  3CIG A;  2WQV A;  1FQV A;  4XSQ A;  1QYY A;  5B4P A;  2BNH A;  4TZH A;  1H6U A;  4R09 A;  4ARR A;  4FS7 A;  1Z7X W;  4P8S A;  4LSC A;  3RJ0 A;  3REZ A;  1OZN A;  1PGV A;  4AW4 A;  4FDW A;  3WPC A;  3G39 A;  1M9L A;  3OJA B;  4CC4 A;  1FT8 A;  2OMZ A;  1FO1 A;  2O6R A;  4FD0 A;  1A4Y A;  2IFG A;  5FTT B;  4R08 A;  3ZYJ A;  3C6N B;  3UL7 A;  4J0M A;  3W3J A;  4I6J B;  1M10 B;  2P1P B;  1D0B A;  3ULV A;  3FXI A;  1JL5 A;  5IJB A;  4EZG A;  1U0N D;  3KJ4 A;  3E2J A;  5HZL B;  1OGQ A;  2A0Z A;  4NKH A;  4U06 A;  2JQD A;  5B0T A;  1DFJ I;  4XGO A;  4LI1 A;  4Z61 C;  4U09 A;  3JB9 j;  4UFR A;  1W8A A;  4GLP A;  4Z8G A;  1K5G C;  2WFH A;  2Q4G W;  3WN4 A;  1KOH A;  4KT1 A;  2O6S A;  4V2E A;  2V9S A;  3WPB A;  3RGX A;  3WPD A;  2OMX A;  3VQ1 A;  1XWD C;  1XCD A;  5IJD A;  4CP6 A;  5AWC A;  4R6A A;  1OOK G;  3UN9 A;  2R9U A;  4MQW X;  1H6T A;  1WWL A;  3CVR A;  3M19 A;  2CA6 A;  2JE0 A;  4Z94 G;  5LFN A;  4PKI G;  3RFS A;  3G04 C;  4CIL A;  4J4L A;  4WYK A;  4FMZ A;  4R6J A;  3RFE A;  2P1Q B;  3E4G A;  5D3I A;  2WQW A;  2WQU A;  2RR6 A;  2UZX A;  2AST B;  2V9T B;  4R5C A;  4V2C A;  1SQ0 B;  5IYX C;  2OMU A;  5A5C A;  4YEB B;  3WPE A;  2Z64 A;  1XKU A;  5GS2 B;  4OQT A;  2Z65 A;  3OGM B;  2ID5 A;  1OTN A;  4Y61 B;  4B8C D;  3E6J A;  1XEU A;  4IM6 A;  2Z66 A;  2ASS B;  4CNC A;  3RGZ A;  4GT6 A;  1O6T A;  3TSR E;  4NZR M;  4BV4 R;  4LSX C;  3O53 A;  4M7E C;  2OMV A;  5AWD A;  4XOS A;  3A79 B;  4R58 A;  4LI2 A;  4LXR A;  5AWA A;  3WPI A;  3ULU A;  1YRG A;  5GMH A;  3OGK B;  3W3L A;  4ARN A;  4K17 A;  4Q3I A;  1A9N A;  4FHO A;  3OGL B;  3E3Z A;  4ECO A;  3RIZ A;  4L3F A;  4NKG A;  3VQ2 A;  4LSA A;  1O6V A;  5B0N A;  4Z79 A;  3UL8 A;  3W3N A;  2BEX A;  1LTX A;  4MN8 B;  1IO0 A;  2XWT C;  2RA8 A;  4R07 A;  4KXF B;  3PMH G;  1P9A G;  1OTM A;  5CMN A;  2XOT A;  4RWT C;  4KNG A;  3M18 A;  1K5D C;  4U08 A;  4FCG A;  4QBZ A;  5CMP A;  4Z64 C;  4BSR A;  2FT3 A;  1O6S A;  1P8V A;  5AZ5 A;  1ZIW A;  2Z81 A;  5GMG A;  4ECN A;  2WQX A;  2O6Q A;  4LSX A;  3W3G A;  4M7E A;  4CNM A;  1G9U A;  5IJC A;  3G3B A;  4H09 A;  4L3A A;  3DZE A;  4V2D A;  3G06 A;  2Z7X A;  1DS9 A;  2OMT A;  1M0Z A;  4PER A;  4G8A A;  5AWB A;  4R5D A;  3WPF A;  4AY9 X;  3UL9 A;  3RFJ A;  4RCA B;  3ZYI A;  4NZT M;  4U7L A;  1KOO A;  3RW7 A;  2OMW A;  3ZYN A;  4QC0 A;  5GS0 A;  3C6P B;  4Q62 A;  2Z62 A;  3C6O B;  2Z7X B;  2Z63 A;  4PSJ A;  4Q3G A;  4CC4 C;  1OTO A;  1DCE A;  5HDH A;  2P1O B;  3ULA A; 
#chains in the Genus database with same CATH homology
 4PQ8 A;  4PEQ B;  4BSU A;  2JE1 A;  4BSS A;  3O6N A;  2OMY A;  2Y5Q A;  3ZYO A;  2ELL A;  3W3K A;  4RCW A;  2Z82 A;  3BZ5 A;  4LXS A;  3G3A A;  3WPG A;  4QXE A;  2V70 A;  3CIY A;  3P72 A;  4R6F A;  4WP6 A;  3W3M A;  3WPH A;  1GWB A;  2P1M B;  3GOZ A;  4P91 A;  1M9S A;  4R6G A;  5GMF A;  4C2B B;  2P1N B;  1XEC A;  1P8T A;  1FS2 A;  4R0A A;  3OJA A;  4HQ1 A;  4C2A B;  2UZY A;  5GQR K;  3SB4 A;  3RW6 A;  3CIG A;  2WQV A;  1FQV A;  4XSQ A;  1QYY A;  5B4P A;  2BNH A;  4TZH A;  1H6U A;  4R09 A;  4ARR A;  4FS7 A;  1Z7X W;  4P8S A;  4LSC A;  3RJ0 A;  3REZ A;  1OZN A;  1PGV A;  4AW4 A;  4FDW A;  3WPC A;  3G39 A;  1M9L A;  3OJA B;  4CC4 A;  1FT8 A;  2OMZ A;  1FO1 A;  2O6R A;  4FD0 A;  1A4Y A;  2IFG A;  5FTT B;  4R08 A;  3ZYJ A;  3C6N B;  3UL7 A;  4J0M A;  3W3J A;  4I6J B;  1M10 B;  2P1P B;  1D0B A;  3ULV A;  3FXI A;  1JL5 A;  5IJB A;  4EZG A;  1U0N D;  3KJ4 A;  3E2J A;  5HZL B;  1OGQ A;  2A0Z A;  4NKH A;  4U06 A;  2JQD A;  5B0T A;  1DFJ I;  4XGO A;  4LI1 A;  4Z61 C;  4U09 A;  3JB9 j;  4UFR A;  1W8A A;  4GLP A;  4Z8G A;  1K5G C;  2WFH A;  2Q4G W;  3WN4 A;  1KOH A;  4KT1 A;  2O6S A;  4V2E A;  2V9S A;  3WPB A;  3RGX A;  3WPD A;  2OMX A;  3VQ1 A;  1XWD C;  1XCD A;  5IJD A;  4CP6 A;  5AWC A;  4R6A A;  1OOK G;  3UN9 A;  2R9U A;  4MQW X;  1H6T A;  1WWL A;  3CVR A;  3M19 A;  2CA6 A;  2JE0 A;  4Z94 G;  5LFN A;  4PKI G;  3RFS A;  3G04 C;  4CIL A;  4J4L A;  4WYK A;  4FMZ A;  4R6J A;  3RFE A;  2P1Q B;  3E4G A;  5D3I A;  2WQW A;  2WQU A;  2RR6 A;  2UZX A;  2AST B;  2V9T B;  4R5C A;  4V2C A;  1SQ0 B;  5IYX C;  2OMU A;  5A5C A;  4YEB B;  3WPE A;  2Z64 A;  1XKU A;  5GS2 B;  4OQT A;  2Z65 A;  3OGM B;  2ID5 A;  1OTN A;  4Y61 B;  4B8C D;  3E6J A;  1XEU A;  4IM6 A;  2Z66 A;  2ASS B;  4CNC A;  3RGZ A;  4GT6 A;  1O6T A;  3TSR E;  4BV4 R;  4LSX C;  3O53 A;  4M7E C;  2OMV A;  5AWD A;  4XOS A;  3A79 B;  4R58 A;  4LI2 A;  4LXR A;  5AWA A;  3WPI A;  3ULU A;  1YRG A;  5GMH A;  3OGK B;  3W3L A;  4ARN A;  4K17 A;  4Q3I A;  1A9N A;  4FHO A;  3OGL B;  3E3Z A;  4ECO A;  3RIZ A;  4L3F A;  4NKG A;  3VQ2 A;  4LSA A;  1O6V A;  5B0N A;  4Z79 A;  3UL8 A;  3W3N A;  2BEX A;  1LTX A;  4MN8 B;  1IO0 A;  2XWT C;  2RA8 A;  4R07 A;  4KXF B;  3PMH G;  1P9A G;  1OTM A;  5CMN A;  2XOT A;  4RWT C;  4KNG A;  3M18 A;  1K5D C;  4U08 A;  4FCG A;  4QBZ A;  5CMP A;  4Z64 C;  4BSR A;  2FT3 A;  1O6S A;  1P8V A;  5AZ5 A;  1ZIW A;  2Z81 A;  5GMG A;  4ECN A;  2WQX A;  2O6Q A;  4LSX A;  3W3G A;  4M7E A;  4CNM A;  1G9U A;  5IJC A;  3G3B A;  4H09 A;  4L3A A;  3DZE A;  4V2D A;  3G06 A;  2Z7X A;  1DS9 A;  2OMT A;  1M0Z A;  4PER A;  4G8A A;  5AWB A;  4R5D A;  3WPF A;  4AY9 X;  3UL9 A;  3RFJ A;  4RCA B;  3ZYI A;  4U7L A;  1KOO A;  3RW7 A;  2OMW A;  3ZYN A;  4QC0 A;  5GS0 A;  3C6P B;  4Q62 A;  2Z62 A;  3C6O B;  2Z7X B;  2Z63 A;  4PSJ A;  4Q3G A;  4CC4 C;  1OTO A;  1DCE A;  5HDH A;  2P1O B;  3ULA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...