4G8EA

Crystal structure of clone18 tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
201
structure length
201
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVLNTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha chain clone 18 TCR
publication title A conserved human T cell population targets mycobacterial antigens presented by CD1b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2012-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eA02
2GEEA 4DW2L 1JI2A 2LU3A 4I13B 5J4MA 4PJCF 4PRPB 1UB5B 5DQJB 4EIGB 4RGNC 1G1YA 1CDHA 5BV7H 1L0YA 5E9DE 1ES0A 4UB0L 5J3HD 5FKPA 1GHFH 1GC1L 2EXWD 1MEXL 3DX9A 1I8IB 2BCKB 1YNKL 5F6HJ 4K7PX 2Q1EA 5J0BA 1R24B 1MFCH 3TBSB 3TZVC 1DUZA 2ESVB 4F9LA 1JK8A 2F54E 3AS3A 1I9RH 4HKBA 5FA3B 3DX8A 1J1PH 1UYWL 3CSPA 4XPTL 4C83A 4LVNB 1WICA 2R0WH 3GIZL 4LQ1A 4MAYC 4PJHE 3V6BR 4DGIL 4OD3H 1VFMA 2JF1A 1FFPB 1CFSB 4GKSB 1P4LA 2DQDH 5EDXA 4S1RL 1KIRB 3MLZH 1N8ZA 1MCEA 4XMPL 4JVWA 3F7QA 4OD1L 2C1PA 4ERSL 4WI7A 5EZOL 1YC7A 1DBKH 5SWSA 4TNWF 3PWJA 1QSZA 5CBAA 3KJ6H 5GRWA 4LPWA 4LP4A 4KVCH 2Y5TB 2DWDA 5ANMB 5EULV 1GOFA 3I75A 2X1OA 5IB1A 2HN7B 1BF2A 3IKCA 3MRDA 1RUPL 1OGTA 2ZKHL 4DQOL 2AV7B 4F7TA 2PETA 1TQBC 4YHZH 4NO3A 2Y6SD 1U8KB 4EOWL 1JGVH 5F70A 1CDGA 1HYSC 2Z4QB 1S7WA 2OJZH 4NZUL 3UTTB 1HILA 3IS1X 3QP3A 1A6PA 3WEXB 4UAOB 4GKNA 5E56A 1J0YA 4HZLB 3IU4L 1V5JA 4HUUB 2NY1D 5HHPA 3OKKB 4UI2A 3MNZA 2NW2B 1UT9A 4WFHE 15C8L 4PLJD 4OLXL 5I75B 4PV9B 4BKLB 4HKZB 3C08L 2IMMA 1SJVA 3T08A 4JFFE 4Z8FL 4QRRA 4HJGB 4KK6D 5HY9B 5B8CB 5DJYB 1RUKL 5ALCL 1RUQL 4FA8A 3WS6C 1OLLA 4F8QA 1JRHH 4X99B 3HFMH 5DJXA 1W0VA 5HDBF 5IQ9B 1SEBA 4Z7QE 1KF9B 4K9EL 2XG4A 2NXZD 3QPXH 3CFKB 4MGXA 2BVQA 3WLWD 4P4RA 4OGXL 2PXYB 3V6FA 1EAPB 3KPNA 4KDTC 3QIWA 5D2NC 3KPPA 3CFDA 4EI6A 2FGWL 4CDGC 4GW4B 3QEQD 3DVGA 3KG5A 3N85L 2M26A 1FZMA 4PJ7E 4DN4L 4HH9A 3O2WH 2HMID 2CRZA 3BPOB 3NPSC 1IGIH 1IC4L 1J8KA 3RTQC 3Q5TA 4DKAA 2E7HA 2FX9H 3EYFB 3I3BA 2OMNA 1A6TB 3CPLA 2NMSA 3CJJA 3BPCA 1JZ8A 1Q94A 4ZOCA 1TVBA 4DWHA 3QYCA 4QO1A 1MJUL 4APQC 4KTDH 2MCPH 1KTKE 3WNMA 5H94B 1YMME 3S35X 1TJIL 4FTVD 2P1YA 3BW9B 5ETUA 3ISWA 2HJKA 4XVTH 5BS0D 2H2SD 4P2RD 3BD5A 4Y5XB 2QQNH 5F9AC 1JWSA 3UYOD 5JR1H 1NGPL 4GOSA 4WU7A 3TN0B 1CK0L 4G9FB 2Q8AH 4XAKE 5DHYB 2P43B 1T6VN 4J6RH 3WYRA 4UU9B 5F9OH 4JRYA 2DQCH 1TMCB 2NR6D 2D03L 2VIRB 5EWIH 3GRWA 4J1UA 4EUPB 4U7SA 3CK0L 1FYTB 4P3DB 2AJUH 4ENEC 2C5DC 3AY4C 1VEMA 3FQRA 3WLBA 4K3HA 2H8PB 2A9NH 4FQLH 3QJHB 3UMTA 1KNOB 4I48A 1A14L 1I85A 1RFDH 3P0GB 2ICWI 2V17H 4LNRB 4LCUB 2WUCH 4LHQB 4QGTA 3SO3B 4YHML 1KLGA 4RMRA 1QO3B 5JPNA 5FYKD 3ALPA 3GJFA 3NTCL 4OJFL 4X7TA 5F7EH 3WO4C 4U6HA 2NPLX 4Y16B 2NXYC 2ZSVA 1CGUA 1MHPH 1V7NH 3ARFC 1A3QA 2QHRH 1K2DA 4YFDB 1S7TB 1FVDB 1YQVL 5HDOA 3V2AR 1NCDH 3I50H 2F53D 1UKTA 4CADA 5D93B 4JB9L 4AEIL 1LK3H 3ARZA 3JWNC 3EO0A 4CN4A 2VABA 1T0MB 5D4QA 2VDKL 4A6YL 1V3KA 3C6LA 4XH2A 5JW4N 1RUML 4S0TD 5E00B 3HPJB 2QQKL 4N9GA 1CGVA 3EO9H 2B7DT 3NIFE 3ULVF 3AFLA 1TVHB 4JM2A 3CCHB 1HHKB 1DFBH 1UC6A 1UJ3A 4P57B 1UB6A 5C0CA 4Y1AD 4GLRH 4UNVA 3MCG1 2DJ4A 4KRPC 1P84K 4RISH 4J12A 3OPZH 3QAZB 2BNQE 4OUUB 3RX5A 1YEEH 4Z78B 4I1NB 4PJXE 3EKCA 5HGDA 5BV7L 3S5LB 1HHJA 1OGAA 4Z7UE 1DQQB 4WUUA 1A2YB 4HIIA 5FKAB 4Z7VA 1MFCL 2FDBP 4B50A 3PWNB 1P7QD 3BI9X 3GSRB 3QXTA 4JZOB 2ITCA 3WFBH 3ARYA 1N2RA 3S96B 1L9NA 1BQSA 1D6VH 4P9HC 3V6ZB 5JHLH 1I9RL 5D72H 3O41B 4NUJB 1ETZA 2BXZA 2R0WL 4U0RC 5B39A 5KVFH 2AXFA 1MI5E 4OD3L 3H6JA 4HIJB 4URTB 4MZ3A 4P23C 4N8PA 2DQDL 4PJBB 4OF3A 1YNTB 3BGMA 3RGHA 3MLZL 1XT5A 3QUZD 4NQEB 5BW7A 2NQCA 5C0IA 1J86A 1K6QH 2HP4A 2GAZA 2Y36H 3WDJA 2AJYH 5F3HA 4JDZA 2H26A 1DBKL 1U3HA 4HAGA 4P5KA 4H5SA 2LV4A 4IDLA 4BQ8A 1RZKH 3KJ6L 2DQFB 4KVCL 2QR0A 2DI7A 5MERA 3PWPD 4IHOA 2D7PA 3VFSB 4IOFD 3FONB 3U7YH 3GSOA 4WUKH 3E0GA 4GRWB 5CGYD 3EW3B 4F9LC 2V7NB 3RPIB 3MUGB 2K7PA 1I7ZB 2XXMB 4YHZL 3X3GH 4F7PB 1BVKB 1NCUA 3FFDB 1RK0A 3QG6B 5ITBH 1JGVL 5J12B 1PYWA 4LSVH 3OF6D 1IGCH 4HV8B 3B9EA 1LE5B 4G9DA 1HWGB 3PWUA 5D6CB 5I71C 1VEPA 2OJZL 2Y72A 5E8NB 2UY7A 4RIRB 2GJ6E 3P4NA 3Q48A 1N0LA 3PDOB 1WZ1L 1QBMH 4YHYC 3KPQB 4G43A 4P3WA 1QSVA 3RDTD 1JNNH 4N5EC 5D1XD 5DJ2A 4E0RB 1G7JB 4K8RH 2DF3A 2XACC 3LKRB 4IRSA 2P7TB 1FO0A 5L2KA 4IRJD 1ZLUH 4NDMB 5J11B 3GGWA 1CFTA 1NAKH 1A4KA 3FFCB 5I1IH 1HQ4A 3FB7B 2CQVA 4QGYA 3I6KA 3VXOB 1JRHL 5ESVA 1R3JB 3HFML 3VU2A 5E5UB 3LKNB 1YEDA 3KJ4B 3MFGB 1HEZA 3QPXL 4WWID 4MD0B 1CQKA 1DBBH 3MBED 3H3BC 3B9KD 4LCWA 2R8SH 2KL6A 5FGRA 2VAAA 5JIKA 2R0ZH 2JB6A 2CLRB 2EKSB 3RY6A 5GXBB 1YPZE 2Y25A 4IMLA 4OLUH 1YEJH 3GI8H 3O2WL 2RIKA 4QXTB 1GGTA 2X4NB 1VCAA 1IGIL 3I6LE 3D18B 5J1AA 3QNZB 3MV9E 4ZUSB 5DEGA 2FX9L 4X4ZA 2OXGA 5DRXB 5C6WH 5CEXB 4YO0A 3JTTA 4CW1B 3TYFB 3UTSE 1GPOH 1CD9B 2EDRA 2R56H 5L2JB 4S1DD 4Z7OE 3VW3H 2WP3T 2XN9D 4H1LB 4ISVA 4KTDL 1U58B 2MCPL 4KK9D 5IHZA 5JZ7D 3BJLA 3DURB 3SGDI 1BIIA 2D3VA 3TEUA 4XVTL 3VH8A 3ROOB 5JPMA 4X83A 2QQNL 2XKUA 5JR1L 3LN4B 4V1DA 4F3FA 5CBEB 3TF7C 1OT2A 3DX7A 3QO0A 2Q8AL 5FO7B 4PJFB 3DSNA 3QIWC 2UZYB 4J6RL 2Z0BA 1IILE 4GAFB 4KFZC 1R3HB 5F9OL 3WIHH 1JP5A 2DQCL 2W59A 4XCFH 1EFXB 3MCKB 3X11A 2PO6A 3QQ3A 5EWIL 2W91A 4ZOEA 5IOPB 1JYWA 4QKXB 2EYSA 1WAAF 5I8CB 5JA8B 3GI9L 1U8PA 1MIEH 2AJUL 2FRGP 2B20A 2HVKA 2DL9A 3IT8D 3ZMRA 5CJXA 1K4DB 4LRNH 2A9NL 3MNWB 4FQLL 3BVNB 3BQUD 3Q6GH 5D96B 3IF1B 1RFDL 2CR3A 3X12B 4KI5C 4NOBA 2V17L 4NQXB 1KXQE 1FFQA 2OI9C 2OL3A 3T2OA 1BOGA 4JO1H 4LAQH 4O2FA 4PUBH 3LEVH 1YZZA 3RGVD 2C1OB 5F7EL 3MA7A 3VWJC 1I7RA 5GSRB 4GRLA 1G7LB 4WV1B 5EU6D 4IBLT 4R7DB 5MEPB 3SKNA 1MHPL 1V7NL 5MEQB 1ZV5A 3RWFA 2QHRL 3GIVB 3RHWF 1LE9A 3BIBX 1PQZA 1NCAH 4OCNC 3ARPA 1BQHB 5E9DB 1BPVA 1NCDL 2AQ2A 4PRAB 3I50L 4MJIA 5IESH 1KJ2B 1DN0B 3HI5H 1D6EB 1LK3L 4GAJH 4KKAC 2YMXH 2YHGA 4RFEA 5HYQA 5LWYH 2VISB 4MCYB 3DPBA 4NNYA 1HSAB 2F54B 4M6AA 2DM2A 3EO9L 4MNQD 3BRGC 2Z8RA 2AJZB 3BDXA 1DFBL 1A7OH 3WNKA 1I85C 2V2XA 4PJHB 4LGSB 1KOAA 4RISL 1MLBB 2BVOA 3OPZL 1IC7H 5DHVB 3MGOB 3T4AA 2VZUA 1YEEL 4AG4H 1NBVH 3QHZH 5KSUB 4PREA 4JN2A 3NAAH 5IK3B 2ARJA 2VLJD 4XX1G 4YDLC 4M02A 3VCLA 1A1NB 3WFBL 2QL1A 3U4EB 1UH4A 1AD9A 1D6VL 1DVFB 1MHEA 5JHLL 2V2TB 2QKIB 4FOMA 5D72L 1XF4B 4JRXE 2AV1B 4JE4B 2A2QT 5KVFL 4FMFA 4RQQA 3WV0A 1QSEE 4H26A 5H37G 4JM2C 2NY0D 4QRSB 2V9TA 1H5BC 1LNUB 4HPOH 5F7UA 1UJ3C 5C0BE 1OY3B 3WHXA 3MV8A 5HHOA 4E5XB 2V5YA 4Y7MA 2UYLB 4V2BA 1IZKA 1K6QL 1A8JH 4YH6A 1QEWA 2Y36L 2AJYL 3C5JA 4MQXC 2AXGA 2P4AB 2WWKO 5HHVH 1FN4B 1RZKL 4G6JH 3VJ6B 5FO9A 4YIQB 3KPRA 1QZ1A 3BP4B 5F1NA 2QLVB 4DZBB 4NQSB 2G5BA 3U7YL 3UBXA 4WUKL 1UKQA 4GAYB 1BMGA 1ZWIB 5HI4C 4XTRD 1WITA 2GJZA 3W9EA 3T65A 5KS9B 1AGBB 1KPUA 5I17B 3X3GL 5FYKH 5ITBL 2A6KB 2A6DA 5J6HB 1DE4B 4LSVL 1IGCL 2Y1VA 1AHWC 4ZXBB 5HJ3A 2BSSA 4ODXB 3O45B 5CD3A 4QHKJ 5AYUH 1QBML 4HXAH 4XNQA 4BSWB 4MMXC 1VFBA 3BH8B 1JNNL 3C2AH 4N0YH 2XQYK 1IL1A 5GS1A 4TPRH 4Q9RH 4K8RL 3GMOB 2YK1H 3ZKMD 5C2UB 4JRYD 1EDQA 3ARGD 1IQWH 4G7YH 4Z7WE 5J9PA 4YXKH 2P42B 1Y6KR 3EOBA 1KN2H 1NAKL 4RBPH 1W72B 1KFAH 1OQXA 1CLZH 2H9GB 3MUZ1 3PDGA 4UILH 1IAIM 3G6JB 1FFOB 4XCNA 5I1IL 3VXPB 3OX8B 4AM0A 4JHBA 1FPTH 4PJBF 4F7CA 1TXKA 2QADD 4DVBB 2OJEA 3IJHB 2HFFB 3LSOB 2ZSWA 5CJ5A 2VXSH 1DBBL 5ID1A 3IFOA 3C8KB 1BJ1J 1T4KA 5D7SH 3CSGA 3REWB 2R8SL 3RWDB 2GSIA 1D5ZA 1XCQB 5IV2B 1YY9C 5F97E 5C08A 3SY0B 1WEJH 4X4XA 3ULUE 2R0ZL 2A9ML 1WZLA 4GKZA 5JXEA 4MHHI 2JCCE 2EC9T 5DVKA 1YEJL 3FJTA 5B21A 4PRPA 4XGZA 1Q9LB 1UB5A 3GI8L 5DQJA 1H3GA 4F9PC 2PUQT 1U3JA 3B5GA 3QG7H 4GRWF 1KEGH 1D5XB 4IRSC 2NY4D 4P2CG 3WE6B 1VFUA 2BCKA 3C6LD 5KSAD 4ZDHB 3FZUD 1R24A 3O3EB 1GPOL 4M43H 1ADQA 1RUAH 2R56L 3RAJL 1PLGH 1J05A 2ESVA 2PTVA 2UWEE 3KPSB 4J4PA 3VW3L 3MA9H 3RVTC 4IJ3C 5EO1A 4R4BB 4J3OC 3I6GB 5FA3A 4XPFH 5AG8A 3UZEA 2J8UE 1SY6A 3QRFM 3CC5B 3BE1H 5BMFH 1ZOXA 2BOCB 1FFPA 1CFSA 4GKSA 4NKDB 3WIHL 4XCFL 3F8UB 1KIRA 4J23A 1G6RH 2UUDH 2WZPD 1NLDH 5DVNA 2IH1B 1MIEL 1AJ7H 43CAB 3W82A 2NW3B 4LRNL 5BZWB 2QHLA 3H42H 4WI6A 5ACLA 3Q6GL 2Y5TA 2EE3A 2XTJD 5ANMA 4M6MH 3C09C 3AXLB 2IALB 5D7IB 4PJEE 3EYOA 2ADJB 4QRPB 3SDYL 2HN7A 4JO1L 4LAQL 4PUBL 1CICD 4EJ1C 4JVPA 4AL8H 3LEVL 2IBGA 2YS4A 2NX5D 2XWTA 2AV7A 4O00A 1ERNA 3FO1B 2P5WE 1T20B 2BNQB 4FQXD 3F62A 5EUOE 1U8KA 4PJXB 3QEHB 1NCAL 2WM0A 3SCMD 2Z4QA 1G9EA 2FIKB 4Z7UB 5IESL 5JA9A 1U3HD 4NCC1 3C60A 2EEBA 3OV6A 3HI5L 2CRMA 5EU4B 3BP6A 1FL5A 4GAJL 4X4YB 2YMXL 3WEXA 5FDWB 5LWYL 3QEGH 2AABH 4HZLA 4HUUA 4ODWB 1RZKC 4KZEH 1FZKB 4PLKC 3OKKA 2PO6C 2NW2A 5DUBB 5I1CH 3W9DB 4LVEA 1TJGH 3FOMA 4PV9A 4BKLA 5CJXC 4DGVH 4PP1C 5MEND 1KCUH 3FT3B 1JZ5A 4PJDE 1FE8H 1A7OL 1KEMH 3NA4A 2FWOB 1MI5B 4Z77B 2XNAB 4HJGA 5FHBH 5HY9A 5B8CA 5DJYA 5F9DC 4HKJB 1IC7L 1WAAA 4M7LH 1AO7E 4AG4L 5ADPH 3ARWA 1NBVL 5HHNB 1K3ZA 3ARDD 3QHZL 3RZWA 1UQSB 1NCTA 2MSPA 3KVQA 5C0AE 4RX4D 1RHHB 2AK4D 4GRLC 4HLJA 2BY1A 1LO0H 3NAAL 5CP3H 1G0YR 3QDME 5GGSB 2PXYA 3OTTA 1SBSH 1EAPA 2IBBA 3GMQB 3ARQA 1MQKH 3QISA 4PR5B 4WTZA 3LQZB 4N90D 1B0WA 5IBUG 4GW4A 2YA2A 1XMWA 4IM8A 3VG9C 4OM1H 5DC4B 3BD3A 4KKBD 5F21B 3TBYB 4L3AA 2VLRE 2X4UA 1GOHA 4NO0D 4IS6B 1WJ3A 3EYFA 1A6TA 2FJFB 3U2SB 4HPOL 4FQIH 3VXRD 3HAEH 4KROD 2GJ6B 1T5XA 1NL0H 5F93C 4WW1B 1CF8H 5HHVL 5H94A 4G6JL 5HYSB 3BW9A 2A38A 1QR4A 2AJ3B 2DJUA 5DVMA 4ZS6D 3TN0A 1TETH 4G9FA 5DK3A 1Z9MA 5DEZA 3NIGE 4JO2H 2ICWB 4I2XE 4UU9A 2Z8SA 2Z31D 1IGYA 2LTQB 4MDIB 3ETBF 4JFHE 4FABH 5K9QG 5FYKL 3QWOA 2PR4H 2VIRA 1FIGH 1NBQA 3INUH 3LCYA 1FYTA 4P3DA 4H0GA 2HG5B 1I1YB 2H8PA 4LHUB 3QI9C 3QJHA 1KNOA 5AYUL 4HXAL 3S97C 4XT1C 1ZVHA 3S7GA 4LNRA 3K80A 4LCUA 3TFKD 2AP2A 2RFXB 4X6CF 4N0YL 1BD2E 4V1DD 3ZTNL 4FS0A 5C9KA 3VI3F 4TPRL 1QO3A 1T5WB 4X6FB 4Q9RL 1F11B 1YPZB 3MJ7A 2YK1L 3ULVC 1UA6H 4H0IA 1AE6H 1C5DB 1IQWL 4G7YL 3DV6B 1KB5B 5D8JH 4ZAKD 3AAZB 4YXKL 4RMVA 2EE6A 1KN2L 1S7TA 1FVDA 4UILL 1CLZL 3MV9B 4N0UB 3IDNB 4I4WB 1FVCB 5FGSA 1IRAY 3RP1A 4K71C 5HGBB 2BNRE 3O8XD 1FPTL 1RZFH 3P9MB 3T77B 3F7PC 1GYAA 1T0MA 3LB6C 4TRPH 4M9OA 5F72S 2VXSL 3EYSH 4R6UA 5E00A 3HPJA 3ECBB 5D7SL 5C71A 4EN3B 3FRPA 5DJAB 1TJHH 3ARED 12E8H 1TVHA 1WEJL 3CCHA 4X6DB 5T1MB 3NCYP 3O3DB 3MRPA 1Z9LA 2XFXB 3G9AB 1RQ5A 4G3YH 1KYOK 5DO2D 3VXQA 4E41E 4OUUA 4HUKB 5GS1C 4BH8B 1A3LH 3QG7L 1ZS8B 3S5LA 1KEGL 5EBWB 4HKXB 1DLFH 1F3RB 4J2XA 3ILQD 4YWGH 5KS9F 1OCWH 4ZUUB 7CGTA 3VH8G 1A2YA 5FKAA 3NZ8B 5D9SB 4HUNB 4M43L 1RUAL 3PWNA 1CD0A 1PLGL 4Z7QF 4JZOA 3CD4A 1F5WA 3S96A 4R2GC 3HE7D 5DZNA 3V6ZA 1OP5K 3O4LE 4ZMAT 4XPFL 3O41A 4Y4HB 2DWEB 4OQTH 5D7JB 2FGZA 4NUJA 3JSSA 1YEKH 3QIBB 3SGJA 4XPHH 3BE1L 4HIJA 5BMFL 2X5PA 1WSST 4CVZB 3OQ3B 2WANA 4PJBA 1YNTA 5JXEC 4NQEA 3U30C 1IM3A 1G6RL 4RGNE 4NQDE 2D4DA 1YC8A 1NLDL 3G6JF 5GGUB 3NFPB 1AJ7L 4P5MB 3S88L 3QWRD 3T1FB 5IEHA 3H42L 2BVYA 3EAKA 4NN6C 3QNXA 2DQFA 3W0WA 4NGHH 2AEPH 3ZKXB 1CD1B 2BP3A 4M6ML 2C7UA 3VFSA 1RZIB 3FONA 4Z9KB 5C70A 3V6OC 1XGYH 2PYEE 4YC2B 1FNFA 4AL8L 4J4PC 2XA8H 2V7NA 3RPIA 2KBGA 1I7ZA 3F7RA 5IB3B 2DIAA 3FFDA 3QG6A 5HHOD 4HV8A 1LE5A 5E5MB 5D6CA 4DK6A 1B6UA 5E8NA 4RIRA 1LO2H 3PDOA 1EVUA 1IM9D 3QEGL 1JV5B 2AABL 4L8SA 4JFEE 3KPQA 4PG9B 4Y4FA 5TH2B 4KZEL 5I1CL 2OX5A 1IE5A 4OZGF 3WIFB 1TJGL 4TVPD 3O9WD 1UXSB 5J89A 5FK9A 2P7TA 3HC0A 4ZFFA 4DGVL 3K1KC 4PJGF 4J3VA 1KCUL 2RJMA 1FE8L 1KEML 1E0OB 2J2ZA 1IAKB 3KHQA 5JLZB 5FHBL 1CCZA 4L3CB 4N68A 1QSEB 3FFCA 2CGRH 5HPOA 4EBQH 4M7LL 5ADPL 3ZDYF 1WFOA 1R3JA 1ZHLB 3P40A 4FG6C 1S9WB 3U0PB 5C0BB 3NCEB 4UT6L 3LKNA 4KRNA 1LO0L 5I18H 1LWRA 4MD0A 4TTGA 5B4MD 1SBSL 1E4WH 3O6FB 3L9RB 4JN1H 3QQ9C 1M4KA 3E2HB 1MQKL 3C60C 3HC4H 3QCUH 5A3ID 3VXMD 2EKSA 2F8OA 4KQ4H 4UAOC 4OM1L 5KSBE 5D7IF 1Q38A 5EA0H 4QXTA 1MVUA 35C8H 3SGEH 5I75C 3VXNB 2DD8H 3CU1A 2YN5A 3QNZA 4ZUSA 3CZFB 2B8OT 2Q76B 1HCVA 1U92A 1JWMB 2X70B 4KUCD 4U6VH 1NAMB 2YRPA 1WTGT 2I60H 1S3KH 1OTSC 4FQIL 1N64H 3QUYB 5B8CC 4CW1A 4G8GD 3TYFA 4LCYB 1M1SA 3RWJB 2RGSA 2MFNA 1NL0L 3VMOA 4JFQA 1R3LB 4H1LA 1U58A 1CF8L 1O7SA 3VXUE 1Q72H 4MYWB 3ROOA 1ACZA 4R4FH 5KVDH 2X4RB 3DARA 4PRPD 5CGTA 3OKMA 3T09A 5D2NE 4HQQH 3O3BB 2PXYC 5CBEA 1TETL 3RZCD 5FO7A 2D7MA 2ZNWA 4RZCB 4JO2L 5DFWH 1R3HA 1NFIB 1LGVA 3V5KB 4FABL 3MCKA 3FO0H 3MTRA 5SX5K 8CGTA 4G8FA 2PR4L 1FIGL 5IOPA 3INUL 3TESA 5I8CA 3BEWB 3QZWB 2ESVD 4AIXA 3VFUA 5KBNC 1QRNB 3MNWA 4F2MB 1MOEA 3IF1A 4OZFB 3X12A 1N3NB 4NQXA 4FQHB 5L9DH 2C1OA 1EXUB 1G7IB 1HH6B 4BFGA 5GSRA 1AE6L 4XC1H 5MEPA 1G7LA 4R7DA 4CU6A 4W68A 4JFXA 3FCTB 5MEQA 1ZT1B 5D8JL 1EGJA 3GIVA 4PGDA 5ICYB 4MS8C 3LEXB 1BQHA 5E9DA 1F02I 3G5ZA 4PRAA 5K93A 4LF3B 1KJ2A 4HGKC 4U6YB 1DN0A 3GSUB 3JV6B 4N0FB 1RZFL 4POUB 2VISA 4MCYA 1I8MA 4TRPL 5DWUL 1QA9B 2X6MA 1HSAA 3ES6B 3EYSL 5EO0B 2F54A 5GGTL 3MYJA 4HJ0C 4WHYG 1TJHL 5DJ8A 12E8L 3GMNB 1T83A 2AJZA 3DBXB 3V95A 2XZZA 2J8UB 3TC9A 1IT9H 2W0PA 4G3YL 3RDTC 2GYSA 1C08B 4RRPA 1MLBA 2IADA 1AR1C 5DHVA 5KAQG 2E7MA 3CX5J 3MGOA 2YRLA 3SO3C 1A3LL 3GB7B 3VGBA 3UTTD 3UJTH 1DLFL 5IMKB 5KSUA 4YWGL 1PDKA 4X98B 1OCWL 3AU1B 4DZ8A 4MVBD 2EIBA 5EB9A 5IK3A 4X6CA 4R3SB 4YQXH 4WIQA 3EYUH 5GRJH 3QDGE 2E6PA 1A1NA 4UV4H 3L95A 1NH6A 3LPFA 4U1IB 1XGTB 1DVFA 2BVPA 2V2TA 4NC2B 4LIQH 5L8KB 4Q6IC 1XF4A 4MAUH 4OQTL 2AV1A 1Q0XH 1P7KB 2FZ3B 1YEKL 2JJTC 1QFUH 2QQQA 4MNGB 4XPHL 4HCRA 4NO5B 4MDJB 3H9HB 4DEPB 4QRSA 2OLDA 1LNUA 5INDB 1IAII 3BGFC 5MEOB 1BQLH 1MCJA 2GFBB 4E5XA 2UYLA 3WN5C 3QAZC 4WJ5B 4AEFA 4L8BB 3ZE2F 3SE4A 3WMSA 4L3EE 2D0FA 1FN4A 2L0DA 3TLRA 4HF5H 4NGHL 2AEPL 3BP4A 1U3ZA 3OXSB 3VFWB 5LCVH 4DZBA 4NQSA 5DC0A 1J8HD 2NY2B 4GAYA 1ZWIA 1J1OH 4JY6B 1XGYL 4PJDB 4A2LA 1EERB 4XNYH 3QFJA 2XA8L 3DXAE 3O3AB 4X6DF 4K94H 5KS9A 1AGBA 3DHMA 5F9JB 5I17A 4U1NB 4HFWB 4OZ4A 1J18A 2A6KA 4Y19E 5J6HA 1DE4A 2A6IB 3AS1A 5C0AB 1EO8H 3SGJC 4D8PB 4IRZH 2MOVA 4Z5RB 4X9IA 1LO2L 4ELMB 4ZXBA 4ODXA 3O45A 1NLBH 4U7MA 1DCLA 4BSWA 3QQ4A 3VG0H 2FEDD 4NKIH 3OJ2C 3BH8A 1MJ8H 4XXDB 4M8VA 1S5HB 1N5AB 3TN0D 4XVUD 3GFUA 3GMOA 4NWUH 4R97C 3CUPB 2OL3H 2R1YB 3U36B 4MCZB 4FFYH 3DRQA 5J13B 2ZZUT 3G6AA 1RZ8B 5FA4B 1W72A 3O81A 2H9GA 2CGRL 3G6JA 3OAUH 1FYTD 1FFOA 1CT8B 3STLA 4EBQL 3VXPA 3OX8A 5F7HA 4ZD3L 5JOPD 1VA9A 3OL2A 5D70H 2D31B 5DK2B 4DVBA 3IJHA 1BX2B 2HFFA 3LSOA 5I18L 5E24E 3IDUA 5I1AB 5J12C 5IUSA 2A77H 1E4WL 1FQ9C 4JN1L 3RWDA 1FNHA 1XCQA 5IV2A 3SY0A 3HC4L 3QCUL 4FNLH 4I0PD 1UWXK 4Y16D 1D9KA 4KQ4L 2FL5A 4L8SC 4Y4FC 1CZ8H 3MXWH 3HE6B 2X44D 4HIEB 1Q9LA 5EA0L 3LN9A 4I2XB 35C8L 5SWSE 4M93B 1XGQB 1D5XA 5EC2B 3CGTA 4ORGB 1CFQB 4U6VL 3WE6A 3C5SB 4GT7A 1FNLA 2I60L 1S3KL 1I3UA 1N64L 2P5EE 4ZDHA 5J11C 5HI5C 3O3EA 5LGHH 5CCKH 4RDQF 3KPSA 3BZFB 3AM8A 3OKDA 3K8LA 5TDPA 4PJGA 1Q72L 2OQJA 1Q9WB 5FO8B 5BRZE 3I6GA 4R4FL 5KVDL 3R06B 1VKXB 4HQQL 5BO1H 5DURB 4HMCA 3CC5A 2PTTB 3KLSA 3VRIB 1JRHI 4NKDA 1KJ3H 1ACYH 3FO0L 5CJOH 3PL6D 3T04D 2IH1A 2X2YA 43CAA 4B7IA 5E95B 2NW3A 2Z92B 4OZIE 3CFCH 4QRRE 1MCSA 2VAJA 3MV11 4OLWH 1MRCH 3P77B 2IALA 5D7IA 1ZT4A 4XNZC 2ADJA 4QRPA 4PJ5A 2QJDA 5ICZA 5AEAA 4OFDA 5C6TH 5A1AA 2KQMA 2OZ4H 4KTYA 2F74B 3EYQD 2ZUQB 4LGRB 4XC1L 3FO1A 1T20A 2OTWA 4I3SH 4NQED 5LGJB 4TVPH 4NBXB 4XHJC 4PJXA 5CD5C 3KAAA 2FIKA 4Z7UA 5HHMD 5FYJD 4XTRC 1EEZB 5EU4A 1PX3A 4X4YA 1IKNC 5J1SC 2YD2A 4HHAB 5T33H 1FFRA 2EDBA 4W6WB 4ODWA 3D39D 5C0EB 5DUBA 4MX7B 3VD5A 5FEBA 3W9DA 1C8PA 1G6VK 4KJQD 5EORH 4YDVA 1EHXA 1MCLA 3S5LG 1KTLB 4KI5E 5M95B 2R39A 5TQ0H 2O26U 4HFUH 1IT9L 1EBAA 2FWOA 3MO1B 3PGFH 4Z77A 2XNAA 5JHDB 1W8OA 4HKJA 1I4FA 3TP4A 3GJEB 3MRMB 1K5NB 3EDKA 5C07D 3MCLH 3KS0J 1HI6B 5HHNA 3KNBB 2J1KA 2DMCA 3UJTL 1RHHA 5H2BB 2H32H 1U8MB 1A9EB 5GGSA 4ZFOL 4R4ND 2CIKB 1QVOB 1FHGA 2IQAB 4YQXL 1EO5A 1DBAH 5DJ0B 3KXFE 4C54A 5GZOD 3GMQA 3EYUL 5GRJL 4PR5A 4UV4L 2QSCH 3LQZA 3V0VB 4DCQA 1FC2D 3P73B 5K9QI 1A9BB 3ZKQD 3BAEH 1CDUA 4LIQL 4MAUL 2PYEB 4WEMB 3FFCD 4BFIB 3TBYA 1HQRB 2A83B 2AXHA 4XPGH 1QFUL 3VRLF 3WL9B 4U3CA 1T83C 5EO9A 4ODVH 5INCB 1KCSH 2V9RA 5BXFA 4FQ1L 2FJFA 1AGFB 2FCBA 4CN1A 3U2SA 3PWVB 1E4KA 2CKBB 5EN2B 1BQLL 4HX1A 1WBXA 3NIDE 1RIUH 3A67H 5C9JB 3BFOA 4L4TA 4WW1A 3MV7D 1NMBH 3MLSH 5HYSA 2X4PB 4HF5L 1QFWH 3L5WB 3OXRB 5KSAC 4E42A 5LCVL 3QULA 2W9LA 3QA3B 4GLRI 4M7LT 3X3FH 2LU4A 3SDXF 4F7MA 2LVCA 1B4RA 1J1OL 4NM4H 4QHNB 5J57B 1PGRB 1V3JA 4XNYL 5ITFA 2ICWA 4BSVB 2OTPA 4LPUA 4K94L 5ISZE 4MDIA 1DVFC 1GL4B 3QIUB 4NM8H 1AIFB 4JPIA 1TQBB 4FQJH 1H8OA 1IC5H 5DT1H 5E4EB 1EO8L 4JY5H 4X8JB 2HG5A 2C26A 4HS3A 1XEDA 3RKPA 5HVWA 2JELH 2BHZA 4IRZL 1I1YA 4LHUA 5EFIB 4DAGH 1F3JB 5C0CE 4PPTA 1NLBL 5DJZB 3VG0L 4DKFH 5DJCB 4NKIL 1OF2B 1MJ8L 2RFXA 2F8XC 3VFRB 4MMZC 4G6KH 1SJHB 1T5WA 1HE7A 1OGAE 1Y6MR 1F11A 1YPZA 3SE4C 4PGBB 2OL3L 2VRAA 5E8PB 1RV6X 2FR4B 5IROA 4WUUE 3CDGB 5HXMA 4Z7VE 1EFXD 3GSWB 3H8NA 3OAZH 4UT7L 3DV6A 1KB5A 4FFYL 1A6AB 1CG9A 2IAMB 5KW9H 4NFDA 3MV9A 4PB0H 3OAUL 1S7UB 1CDCA 2FJGB 2G75B 4N0UA 3ZHDA 4O2EB 3IDNA 4I4WA 1FVCA 4JKWA 3KHOA 1KJVB 3TA3D 4U1MB 5D70L 4NQCE 4HGWB 3P9MA 3T77A 3LQAC 3TJEH 4LOUC 1T66C 4KRLB 3G5YB 4NHUB 4XRCB 5DD6B 1EAJA 1YN6B 3EUUA 4KK8D 2A77L 3VXUB 2HJFB 4EN3A 4W6XB 5DJAA 3BUYA 4TUOA 2KDGA 4FNLL 1MUJB 3BO8B 3BYTA 3NVQA 4OQ1A 2CO7B 4X6DA 5IMMB 3O3DA 4N0CD 5E08H 5D2NB 3F58H 5F6IC 2XFXA 3PV6A 5DUPH 1CZ8L 2BY0A 3MX0A 2J8HA 3MXWL 4KU1A 3NA9H 4FFVC 5B3NA 5CILH 1E6JH 5E9DD 4QRTA 2ADGB 4BH8A 1FV1B 3CLFH 4H1LG 1ZS8A 1M71B 4HKXA 5EBWA 3IDYC 4FP8L 5C3LD 4OZHB 3D0VB 1T0NA 4ZUUA 3RTQB 4PJCE 4KMQA 4CMHB 2OMBA 2YD9A 4HC1H 2EDKA 3NZ8A 5T1DH 5LGHL 5CCKL 2F54D 4JO4H 5IT2H 2Q8BH 3ZL4H 4FXKB 4ELMF 4WO4D 4FRWA 1CXKA 4JZNB 2R9HD 3U0TB 4APQB 1UADC 4M48H 1OQOA 3NACH 4Y4HA 5IVOA 2DWEA 5D7JA 5DGRA 1JWUB 5C09E 4BFBD 4CVXB 5LGKA 5L0QC 4WTXA 4JKPH 5BO1L 2COQA 2R15A 1HXMA 3ESUF 3IFPB 5HYJB 5GGRY 4CVZA 4X0KA 2HTLC 3OKYA 1YMHB 1KJ3L 1ACYL 1D9KC 1MFBH 5CJOL 2XKNB 5DFTA 3V79C 1TIUA 5GGUA 4L8CA 3TIEB 2J8OA 3NFPA 4P5MA 2FEEL 5L2KE 4J3TA 3T1FA 4OCRH 1QFHA 3CFCL 4RWYH 1CD1A 5EU7C 4OLWL 3H9SA 1MRCL 3QWQB 5HHQB 2BVTA 3BUTA 1OAQH 1RZIA 4NJ9H 1CXFA 1FL3B 5C6TL 2RB8A 2OZ4L 1INEH 4QHUB 5KVMC 2KPNA 5DDHB 3G5VA 1WWCA 3NGBC 1MSPA 5IB3A 3HG1A 4I3SL 5IFJA 3WO4B 4LCWE 4TVPL 4D0CA 2GKIA 3HZKA 3NIGF 3SDAA 4U33A 3ARFB 4JJ5B 4WHCA 5E5MA 4YBLC 3BKYH 4XWOC 4EIZC 4EUPH 4WFHD 5IW1B 5T33L 4PG9A 5TH2A 3KYMB 1BFTA 2VZSA 4K3DH 3WIFA 1MCPH 4DTGH 1CFBA 1UXSA 5EORL 1CVRA 4JFFD 5GHWH 3WJJA 4LARH 4H8WH 1CR9H 1F58H 4HFUL 1IAKA 1E4XH 3PGFL 5JLZA 5ELIA 5I9QB 3ZT7A 1EJ6A 3QUKB 3CFEB 1TDQA 4KRPB 3MCLL 3EBAA 1ZHLA 3U0PA 1S9WA 4OGAD 5F71A 4ZXBD 3D2UD 4ZPTB 4YHLH 4DGYH 2P8MB 4QOKB 5DMKA 3VXSB 1IEBB 4G42A 4L3EB 1REIA 2F15A 1DBAL 3O6FA 5HDBE 3L9RA 2VR9A 4Y4KD 3VFMA 4W4OC 2QSCL 3O8XC 4QHLB 1G1CA 3EYVB 5FF6A 3GSQB 2BY3A 4NFBA 2XV6B 1J9CT 4K2UH 5T3XE 3BDBA 3O11B 3I84A 4HS8H 4CDHA 3AREC 3VXNA 4XPGL 3F12B 2EDYA 4U0RB 3CZFA 4C56B 4ODVL 1GRWA 4Y19B 1MRDH 2J7LA 4UDTB 1YECH 3IU3A 2X70A 4MNHB 1NAMA 1X5IA 1MWAL 4PTTB 4P23B 3LDBB 3QUYA 2BHYA 4LCYA 1SYVB 3SJVB 3RWJA 1RIUL 1YMMD 4ZUVB 3A67L 3CLEH 4KJPD 1R3LA 3PNWB 3ZT6A 1EHLH 4QRUB 1NMBL 4NZTH 3MLSL 4W6YB 3L1OH 4MXQD 1QFWL 2FATH 5C2BH 1ZGLM 4XAKD 2X4RA 4MJIE 1YA5A 1WF5A 3DX9B 3O3BA 4Q6YA 5HI3C 5IB4A 3X3FL 4NM4L 1EZVY 3VGHA 5IBLC 1NFIA 4KJWC 4P4KD 2YC1B 1ORQB 2FLRT 3IDJB 4NM8L 5H8DA 1NC4A 1WV7T 1YQ2A 2Q3ZA 4FQJL 1IC5L 5DT1L 3HMXL 4JY5L 1IAMA 3BEWA 3QZWA 4GRMB 3PF2A 5E2TH 2JELL 1QRNA 3VFOA 4DAGL 4F2MA 3T0XA 1U8JB 5HGAB 5I71B 4OCWH 2APFA 5E6IB 4DKFL 4OZFA 5FYJH 1I3RB 1VB9A 2VZOA 3HI6H 4YHYB 4G6KL 3SO5A 4MA8H 4FQHA 3QUXC 5HTSA 1G7IA 1HH6A 1A7NH 3IJSA 3FCTA 1ZT1A 3KDMB 5CBAB 5ICYA 3LEXA 2HKFH 3OKNB 4B41A 5KW9L 1SEQH 1T21B 4PB0L 2N4IA 1S9KC 2VUOA 1MQ8A 4U6YA 5IB1B 3GSUA 4R7NA 1RZGB 2FX7H 1FL6B 1FVEB 3GMMB 3JV6A 5GGVY 2P5EB 4MD4B 4JFPB 4N0FA 2APTA 1OGTB 3TJEL 1BREA 3CH1B 3DV4A 3HC3H 1QA9A 4LRIA 3BZEA 1H15B 3SDXA 5EO0A 4QTHB 1ZVSB 3CDYA 3PIQB 1DEDA 3PJSB 4XP4H 4OLVH 3MZTA 5BRZB 2ZUXA 2EIDA 3DBXA 5E1HB 5FYLL 2YN3A 1ZLWH 5E08L 3MV8E 2J8UA 2BNQD 3F58L 3PABB 4CUCA 2EDLA 5DUPL 4PJ9C 4UT9L 1C08A 4PD4J 3NA9L 5CILL 1E6JL 3DRTB 3OZ9H 5GZND 3ULVE 5HHPB 1B2WH 5EZLB 3CLFL 1ROWA 3RL1A 3U0WH 2EZ0D 2XOTA 3IRPX 3KPRE 1CTOA 5IMKA 3LN5A 4X98A 5IROC 3AU1A 2GIYA 3ZLQC 5LQBH 2ADFH 3WFHB 2ATKA 4HC1L 5T1DL 1UWGH 4JO4L 5IT2L 4OZIB 2NY6D 2CSPA 2Q8BL 3ZL4L 4S2SB 4U1IA 4A6YB 4UNUA 1TNMA 4M48L 1MI5D 3NACL 3IDGA 2J4WH 5TFSH 2FZ3A 1P7KA 4ETYA 2WBWB 4JKPL 1P1ZB 1R0AH 4EN3C 3DMMD 1I1CA 4MNGA 4EI5A 1NEZB 4G6FB 4OV5B 4NO5A 5ESQB 4MDJA 3H9HA 3KPNB 25C8L 2WLYA 5INDA 1MFBL 4P46C 2GFBA 4ONHB 5TDOB 3DVGB 4NRYA 4WJ5A 1A47A 1G9NC 1FZMB 2C4FT 2DM7A 1ZKAA 2EH8H 3QPQD 4L8BA 1NKOA 3L5HA 3QH3B 1S7QA 4IMKC 1RZJC 4OCRL 5ID0B 4YPGA 3GBLA 3VFWA 1UZ8B 1ZLUK 2MWCA 1OAQL 4NJ9L 5IFAH 3A6BH 1B0GB 1BBDH 3LS5H 4NJAH 4UBDD 4JY6A 4LFHG 2OI9B 1Q94B 2D7TH 3D85D 1TVBB 1INEL 3MYZA 3O3AA 2YUWA 2JE8A 4U1NA 4HFWA 3KYAA 3VWJB 3GBMH 2ZG1A 3OSKA 4Y4HC 1Z5LB 1QLFA 2EXYC 4X7FC 3NFNB 3DECA 4PIRF 2GJ6D 3W81A 1S7XB 2YRZA 5C08E 4D8PA 3BKYL 4WEBH 1E27B 4Z5RA 1JWSB 3PP3H 4ELMA 2LU7A 4OZHF 2BMKA 3BEVB 5A40E 1A7RH 1NGQH 1CDYA 3KXFB 5B3JF 2NY7H 1FBIH 4LASL 1QYGL 4XXDA 1TTUA 4LCCA 1S5HA 1N5AA 1MCPL 4DTGL 1J7VR 3MODH 5L88H 2WQRA 5GHWL 2EEDA 3CUPA 4LARL 4WHDA 4H8WL 5CHNB 3CSYA 4MCZA 3GBNH 1CR9L 1F58L 3SKUD 3ZKXC 2CIIB 3BP5B 1RZ8A 3DYOA 5FA4A 2I9TB 3P4MA 1CT8A 4PJAE 4YC2C 4LHUD 3CDCA 4GS7B 1CXIA 1KLGB 4YHLL 4DGYL 3GJFB 3PE9A 1BX2A 1QP1A 1KJ2H 5DD1H 5HSFA 5I1AA 2ZSVB 3SDAC 4OI7A 4OFYA 3B9AA 1DUYA 3I2CH 1MCKA 4B53A 1SVZA 1K2DB 1Z3GH 2QTEA 2VZ3A 1WZKA 3FQNB 1AD0B 4YDLB 1VDGA 3DGCR 2HWZH 5EIQA 3RFZC 4K2UL 1L7TH 2WWMD 3LVEA 5SX5H 3RWCA 3I6LD 3HE6A 4HIEA 4HS8L 4UV7H 4DKEH 5C0GB 3B4NA 3MV9D 1YEFH 5ISZB 5DQDH 5I16A 1XGQA 5EC2A 5ANME 5F89B 3WJJC 4ORGA 5DHVH 1CFQA 1YECL 4Q2ZB 4WW2B 3C5SA 3UTSD 2N56A 3FHAA 5I8EA 1H5BB 1ORSB 4PRIE 1A4JB 3CLEL 5D1QB 3BZFA 4RWHA 1UM6H 3S8WA 1EHLL 1VHPA 2R2BB 3R4DA 4NZTL 1Q9WA 5FO8A 5HGDB 2FATL 3TV3H 1WIOA 5GRXG 1HHJB 5TPWH 1OGAB 3EFFB 1J10A 3R06A 1VKXA 1GXEA 5SX4H 4UTAH 4HIIB 3MRGB 1LD9B 2PTTA 5IB5B 3S37X 2C3HA 2DLEA 2MKLC 4ZODA 3BYYA 4LEOB 4HCRH 2KH2B 2LE9A 2VWEC 4NQCB 3SKJH 5MP6H 2AK1H 3EDEA 5E2TL 2Z92A 1AHWB 2E5EA 2FYYB 4NNXB 4OCWL 2YA1A 4XP5H 5TE7H 2ZG2A 4XNUH 3DIFB 5IB2B 5FYJL 1WAAE 3O2VL 3P77A 4OB5L 5IBUB 3SQBA 3HI6L 3ROLB 1G0XA 3QIBD 1RAMA 3IYLW 1U8OB 1XF2B 4MA8L 3N0PB 3RVVD 1PVHA 1IEAB 1A7NL 2F74A 2XPGB 5I1EH 3C5ZA 3TO2B 2MNUA 1SMAA 5LGJA 2MHAB 1C5CH 2BRQA 4XBGB 2HKFL 3E6HB 1S8DB 1SEQL 3V0WH 1XFPA 3GEWB 2QR0B 4KK5C 3HZMB 4PJCB 3BRDA 1UEYA 1EEZA 2FX7L 5DUMH 3FQXB 4MB5A 4HHAA 2XZCH 2IG2H 3HC3L 2FJHB 1IC1A 5C0EA 3SN6N 4MX7A 4BZ1H 4XCCH 4DUVA 1RK0B 2X1XR 4NQUA 4XP4L 4D0BB 4OLVL 3P9LB 5I1HH 3R8QA 1KTLA 3TVMA 1T3FB 3PWUB 5C09B 5HHXH 1BWMA 4EZMA 3MO1A 1TZGH 2EDOA 3P4NB 1KXVC 5JHDA 1EA9C 3OZ9L 3GJEA 1MLCB 4P2OD 4XVUC 1B2WL 2NCMA 3U0WL 4P3CH 1HI6A 4Y2DC 3KNBA 5EPMA 3TO4D 1HN1A 2BERA 5LQBL 2ADFL 4IRSB 3R8BB 1U8MA 1L0XA 4TYUA 4G9FE 2DMBA 4PLOB 5L2KB 4OCSH 3QUML 4MXVF 1UWGL 2CIKA 1QVOA 2IQAA 1S7RB 1P6AB 4WWKD 4Y8DC 4MB3A 3VGAC 1Q8MA 1CFTB 1PKOA 2VSCA 2P24A 4JRXD 2XQYG 3P73A 4LVHB 5ESVB 4M03A 1H3UA 4OD2B 4IJ3B 2PYEA 2J4WL 4LRIC 1QSED 4HMEA 5TFSL 4BFIA 1HQRA 2A83A 3H7LA 1R0AL 2DYPD 4ZFZB 2QSQA 3D9AH 5C0BD 3WL9A 2R2EB 5INCA 4F7EB 1HIMH 4MLSA 1AGFA 4G7VH 3E1F1 3PWVA 2ZCKH 2CKBA 2I07A 1RU9H 3EJYD 4GXUM 5KN5B 1IGFH 3O6FD 5C9JA 4HG4J 2EH8L 1WWBX 1OAXH 1TTGA 2X4PA 4EVNA 5F1SA 1NDGB 5IFAL 3A6BL 1FRGH 4LSSH 3C09B 4XNXH 2NYYD 3LS5L 4NJAL 4YK4B 4QHNA 4RBPK 4RDQG 3JTTB 2D7TL 4OLEA 2E9BA 3DO7A 4BSVA 3L5JA 1X5HA 3I85A 3QIUA 3EDDA 5DLMH 5BQ7B 3B2VH 3GBML 1AIFA 3WBDA 3QUYD 4RFOH 2WBJB 2WLZA 1JUFB 2W38A 4XPAH 3VH8B 5DA0B 4XHQA 4X8JA 5CJBA 4WEBL 4EI5C 5EFIA 2IGFH 1F3JA 1OTTD 3DX7B 3QO0B 4DEPC 3R0NA 4U1SB 1IARB 4QRQB 3STBA 5DJZA 5DJCA 1A7RL 4M62H 1NGQL 5F3BB 2EDFA 1HZHH 2NY7L 1FBIL 5I74C 3FQTB 3HRPA 1F2QA 2R4SH 3DHJA 1SJHA 4U1LB 5JORA 3QQ3B 3MODL 2ORBL 5L88L 1UG9A 4X80H 3RUGB 4LLVB 2FR4A 2D7QA 2DKSA 3U4BH 3GBNL 3GSWA 1QLEH 3EJZD 1CGWA 4ODUA 3D3VB 2EDJA 2IAMA 4J3WA 5IR1B 1ZT7B 4M3KB 4OKVB 1IVLA 2NY2C 1S7UA 2G75A 4O2EA 4DN3H 2CO6B 5HPMB 1BOGB 1KJVA 4U1MA 4O2FB 4HGWA 3HR5B 2RQ8A 2DMKA 1S78C 1WWWX 4X6EB 1CYGA 2JTDA 1KJ2L 3BP7A 4NHUA 4XRCA 5CSZA 5DD1L 1ZA3B 4GRLB 4KAQH 2Y9RT 3ULUD 1JZ4A 3SOBH 3VXUA 2HJFA 3UYPA 3I2CL 1Z3GL 4PJBE 5BJTB 3NFSH 5IMMA 1MUJA 3BO8A 1A0QH 3DYPA 3ZE1F 2O5YH 2HWZL 1EX0A 3THMH 2GTZB 1L7TL 2DL2A 1MFDH 5AWNH 4CJ0A 3DVFA 4RFEB 4DKEL 4UV7L 4LDEB 4YX2H 3ZTJG 3BT2H 4LCCC 3VG9B 5C8JA 1YEFL 2KKQA 2ADGA 2UUDK 2E7BA 5DQDL 2CUMA 4QWWD 4NKOA 5FB8B 2Z9TA 3W0WE 2G9HB 3KYNA 5HD8C 1M71A 5FM5M 1F45A 2CRIA 4RMQA 3LKSB 1G0DA 4OZHA 2A6JA 3MMEB 1CE1H 3QBTB 3RNQB 1WBZB 4OF5A 4B5EA 1F90H 3CX5K 3HZYB 2VL4A 4GRWE 3AMLA 2V2XB 3B5TA 4YHIB 3RVUD 4CN6A 2J5LC 5D1ZC 1D7FA 2W07A 3DUUB 1GJIA 1UM6L 4JLRB 4FXKA 4CKVX 4JZNA 3U0TA 2I5YH 4APQA 2GY7B 3TV3L 3KPMB 4JN2B 1JWUA 2O5ZH 2PKDA 4ODTH 4O2CB 4CVXA 3WKNA 4XMLH 4UTAL 4U31A 2ARJB 4Y0GA 3IFPA 5HYJA 1C1EH 3SDCD 2HLFC 2I26N 1YMHA 1RK1B 2GK2A 1R3IH 5GSVB 3ZT5A 2RHEA 2XKNA 4RGMC 4HCRL 2KZ1B 3HE6C 2HT4C 3TIEA 5MP6L 2AK1L 4HWBL 4DK3A 4M93C 5EU3B 3MACH 5D7LA 2B0SH 4XP5L 5TE7L 4RQQB 4XNUL 2E7LC 3MRKB 3QI9B 4JPVH 1SYSB 3SE3C 1FL3A 2R23A 4AQ1B 2YR3A 2ED7A 2P5WD 3MV8B 4PJ8D 4LLAA 3PHQB 4M9PA 3FN0H 4QHUA 5DDHA 2YUVA 1YNLH 3NCJL 3P0YH 1GGIL 3MV01 2AXGB 4JGUA 1C5CL 4XP1H 2EDDA 3QDHA 4NCDA 3V0WL 3ARFA 4JJ5A 5F1NB 1P5UA 4GBXC 1Y6NR 4U1HB 2Y06H 4NHCH 5DUML 4A2MA 1OW0A 4KDVA 5IW1A 4WW2F 1VADB 2XZCL 4K71B 2IG2L 5F7KC 1UFUA 5SV4A 3KYMA 3RVXC 3T65B 3LS4H 4BZ1L 3TBWB 1INDH 4XCCL 5CMAB 1D3CA 4GG6B 2DAVA 4HPYH 3S36H 3KYKH 3QHFH 2LABA 5I1HL 1G7QA 5HHXL 1FCCA 3VE0A 2VOTA 3JV4B 1OL0A 4Z76B 3PV7A 1AO7D 1TZGL 1Q9OA 3QUKA 3VA6A 5EUKB 2NY1B 3CFEA 3HLAA 2J6EH 5C0AD 5DJ6B 4KC3B 3JWOH 1UJTA 4P3CL 4QXGH 5I1KH 4WGWB 3T1WA 3QDMD 4JCMA 1CN4A 5T5FH 2ZUQC 1XF3B 3C5ZC 4L29A 4ZPTA 1X3DA 1V8HA 3EFDH 2P8MA 4FQCH 4OGYH 3MOBH 4QOKA 1XF1A 3VXSA 1IEBA 4OCSL 5DEFA 3KLHD 5J9PB 5KOVC 3N1PC 2ZCLH 2A73A 3EYVA 4XCNB 2VUYA 3GSQA 4W81A 2OXHA 2YPLE 3K3QA 4R2GB 3JZ7A 2XTLA 3UDWC 2NZ9D 4F7CB 4KPHH 2X9YA 2WK2A 2VLRD 4UIMB 2AKRB 2OJEB 4KMLB 5ENWB 4WCYH 3DNKA 3F12A 2VH5H 5HDQH 5ID1B 2DS4A 3D9AL 3HUJF 1T4KB 4ZNEA 1U8QB 4C56A 3TVMC 4Y19A 1HIML 4UDTA 1RJCA 1BFVH 4G7VL 4LLMA 4MNHA 4BYHA 4EDWH 4PTTA 4P23A 2ZCKL 1HYRC 1Z9OA 5H35A 1RU9L 2H2PD 3BH9B 1SYVA 4GKZB 3SJVA 3U30B 4ZUVA 1IGFL 5HVFB 2ZG3A 4BUHA 3PNWA 4HK3J 2V2WB 2GQHA 4S0SD 4XGZB 1OAXL 4XI5D 4QRUA 2AVGA 1MFNA 1C16B 5EOTA 3BX7C 1U95A 3IAQA 5D2LF 4TTDC 3NCMA 4M6OH 4NN6B 3TJHC 1FRGL 4LSSL 2YKLH 4XNXL 4JFHD 4M1GH 3JTSB 4G6AC 5AD0A 3WSQH 1J05B 2YC1A 4PRHA 1ORQA 1UM5H 3IDJA 3SE8H 4U7KA 4PJAB 3B2VL 4RFOL 5EO1B 3W11D 4XPAL 2HT3C 4OF8A 4GRMA 1XZ0B 2IGFL 4MQ7B 1JZ2A 1U8JA 3L3HB 5HGAA 3ARTA 1BD2D 5E6IA 2VLLB 4M62L 5ALBH 3WXVH 1HZHL 1I3RA 5C6PB 2EDWA 1FGVH 1PX4A 2R4SL 4CRPA 4MHHG 5J1TC 5DZOA 1I8LC 5C0NC 3VWKC 4X80L 5GS0C 2R2HB 5TGBB 3U4BL 1WFNA 4X6CE 3KDMA 1QLEL 1VENA 3VI3E 3OKNA 1T21A 4NBZB 2BNRD 3UYRH 1D5IH 4DN3L 1DQJB 1B0RB 3EYOB 3ABZA 1RZGA 1FL6A 1FVEA 1M05B 3GMMA 4HUXB 3X14A 2P5EA 4MD4A 2G5RA 4JFPA 3CH1A 4M1CC 1R6VA 4PRIB 2XWTB 3QIUC 1KUMA 5FFLA 4KAQL 1H15A 4QTHA 1ZVSA 3SOBL 3PIQA 4ORZC 5E4EC 3PJSA 3UAJD 3NFSL 2EO1A 4LSUH 5BRZA 2D0HA 1GSMA 3DUHA 1A0QL 2VXTH 2JLLA 4GQPH 2O5YL 2VLME 3H0TA 4E41D 3C60B 3PABA 3THML 4WI4A 3BP6B 1FL5B 1MFDL 5AWNL 4YX2L 3DRTA 3BT2L 5EZLA 1AKJD 1DJSA 3UTPE 1K3IA 1KT2B 3FOMB 1CE1L 1F90L 2DTMH 1F6FB 1WISA 3WFHA 4M5YH 3C2SA 1NUFA 2IAMC 3QFJE 4OZIA 1DQTA 5KS9E 3O4LD 4S2SA 4A6YA 1KTDB 2DQUH 5DMGD 4WY7H 5E2VH 1JHKH 2I5YL 2X4QB 4DOHE 1F4YH 4CNIB 2EH7H 1VFOA 3DROB 2VZVA 2O5ZL 4ODTL 4C4KT 1HHIB 1P1ZA 4XMLL 3FQWB 1U91B 1C1EL 1NEZA 2K1MA 4OV5A 1P7QB 4O9HH 1T89A 5ESQA 3RUGF 1FH5H 4RGND 1Q9KB 2VNCA 1T7XA 4NQDD 4Q0XH 1R3IL 1FZOB 4YEFA 4ONHA 1T22B 3UXFA 1FZJB 5TDOA 2B39A 2VZ1A 2YPVH 1Y0LA 2W60A 3MLPA 3QH3A 3TZVD 5ID0A 1EHNA 3JWDH 3MACL 2B0SL 2DQEH 5IJKA 2YXMA 1FG9C 2X4UB 1UZ8A 3G6JE 4CMHC 2PYED 3I9GH 3QUZB 4JPVL 1MCOH 4D9QE 1B0GA 2Q86A 3H7BB 3KWWB 3QEUB 3KYOB 5DZLA 3FN0L 3ESVF 4LEXH 4MAYD 1T5XB 3TNNB 1YNLL 5ACZB 3P0YL 5CZXC 3VWJA 4XP1L 2ZUWA 2VLKA 1TCRA 1Z5LA 5I66A 3NFNA 1S7XA 3PXJA 4N1EA 1ND0B 3T3PF 1E27A 3D0LB 4JFED 2Y06L 3P0VH 4NHCL 4GMSH 3PG2A 4P2QE 3BEVA 5J7CC 2XIDA 3KXFA 1IGYB 2B4CH 4LSDA 3BPNC 1YJDH 4XBPB 1BJ1H 2OP4H 3CAFA 3F65A 2UV3A 3LS4L 1INDL 2EDXA 4B7LA 1J0ZA 3QWOB 4HPYL 3KYKL 3S36L 1GC1C 3QHFL 4NC0B 5EU7E 1S5IH 4BM7A 5CHNA 4Z7NF 1OOAA 4FQ2H 3ULUH 2DM4A 1FLTX 2OS7A 5ERWB 2DBLH 2CIIA 3NZHH 3BP5A 4OZGE 3WD5H 4MA3A 2I9TA 3KPSE 2J6EL 1RZ7H 2BC4B 3RDTB 5JOEA 2XKSA 5D1XB 3JWOL 4PJGE 4QXGL 1HYSD 5I1KL 2B2XH 4YHNB 1SJXA 1L6XA 2IBZX 2ZPKH 5T5FL 1Y18B 2FX8H 3MJ7B 3EFDL 4FQCL 4OGYL 3MOBL 5AZEH 1K8IB 3ZDYE 2CH8A 5IHBA 1FDLH 2AJSH 1EEYB 4ODHH 3OKOB 2ZCLL 4LL9A 5CS7A 3FQNA 4ODBD 1AD0A 2OSLA 4PP2A 1OW0C 1HKFA 4N8VG 5EIIB 1QSFE 4KPHL 5C0GA 1WT5C 4Q6IB 5ISZA 2DLTA 3FTGB 3B9KB 4WCYL 2VH5L 2PW1B 2HJLB 3IXTB 5F89A 4O02H 5D7IE 1BFVL 2BJMH 4Q2ZA 5FXCH 4WW2A 4EDWL 4QRPE 4PJ5E 1KLUB 3D1MC 3RNKB 1H5BA 2XQBH 1ORSA 4I0CC 5I9QC 2R0KH 3MRPB 2VXQH 2F5AH 3VXUD 3BGFB 5F9WC 1A4JA 3VXQB 1I8KB 4Y5YC 5D1QA 1KLFA 4UQ3B 4OFPA 3WN5B 3MJ6A 3ZE0F 2R2BA 5A2JH 1MCFA 4LNVA 3VXTB 1HXYB 2HAZA 1CGYA 1RULH 3WXWH 3BKJH 4M6OL 5IW6B 3EFFA 5DF0A 1GHFL 2YKLL 1U36A 4GG6F 4L4VE 1MFAH 3L3KB 3MRGA 4M1GL 1LD9A 5IB5A 3RQ3A 2XN9B 1MH5B 3WSQL 2VN4A 4ZTPH 3VGGA 3RTQD 5J8OA 4XP6H 1UM5L 3TM6A 3QNYB 4LEOA 1I1AC 2DQTH 1C12B 3F6IA 1NCBH 3BDYH 3G5XB 4NQCA 1RJYB 1ITCA 4O4YH 1AI1H 1J1PL 1XR9B 1SQ2N 2PW2B 1AHWA 2FSEB 3O6KH 2FYYA 1DQMH 4NNXA 4APQD 2DLGA 5DVOA 3HAEB 3DIFA 3OGCB 4OIBA 5IB2A 5ALBL 3WXVL 3LDBC 1RHFA 2R4RH 5DRNA 3ROLA 1KPVB 1FGVL 1IM3B 1U42A 1U8OA 1XF2A 3QSKB 3VFNB 4L9DA 1PKQB 1CL7I 4K9EC 1QQDB 1J0JA 1IEAA 3RWGB 2XPGA 3TO2A 5GGQH 2HFGH 4R97B 3BQUB 2MHAA 5IEHB 3CSBA 5F44A 4XBGA 3MFFA 5J06A 3QNXB 3E6HA 1S8DA 3W0WB 4PY7B 2SEBB 1AY1H 3T0AA 4JGMA 3UYRL 1NFKA 1WFTA 2IBZY 2C7UB 1D5IL 3HZMA 4PJCA 2E6QA 4OBSA 2M2DA 3WFZA 4ENED 1X5YA 3MRLB 3FQXA 3RGVB 4D9RE 1KIQA 3DVIA 3BMVA 3GNMH 5EU6B 1QFWI 3VI4F 3U6RB 2FJHA 4BFEA 8FABB 2X9WA 4EXKA 1P2CB 1I3GH 4D0BA 5I1JH 1GOGA 3P9LA 4LSUL 4JZJB 1FNSH 1T3FA 2C3VB 5EZJB 1PBYA 2VXTL 4POYA 3CFJB 5C09A 1JMXA 3LQMA 1F4XH 3FAXA 5E6IC 1KPRA 2NXYD 3BKMH 1FAIH 3ARFD 4L4TE 4L8SB 4Y4FB 1MLCA 3Q2CA 1F97A 2JIXD 3IAGC 4BQ6A 4F15C 4J3XA 4F9PA 5KAQF 3MROA 2NY5H 4JQXA 1N4XH 5CZVH 5FK9B 3HC0B 4PJAF 4ZFFB 2NY3C 3QDGD 4M5YL 1NUNB 2VJXA 1Q1JH 4X7CC 2Z35A 1S7RA 4R0LB 3UP1A 1N59B 2H45A 2ICWJ 3WNPA 1CWVA 1MPAH 2DQUL 4WY7L 5E2VL 1JHKL 2ITDB 4JG1H 4OD2A 1F4YL 3AMKA 2EH7L 3PWLB 2X89D 5JO5B 4Y88A 3WUWA 2VLJB 5DHXB 4ZFZA 4O9HL 2R2EA 3HCVB 1FH5L 1TPXC 4F7EA 2QSVA 3RKDC 1G7MB 4HEME 43C9B 4Q0XL 2WWMC 3I02A 1BF8A 1RD6A 1X5AA 3T4YB 1NC2D 3MJ9A 4D9LH 4L3ED 4IEFB 3MRHB 1SMOA 2ZCHH 5KN5A 2YPVL 4XPBH 1ZMYA 2IPTH 1X6NA 2UZIH 1MVUB 2VN7A 3PQYA 1KELH 3F7YB 3JWDL 2DQEL 1XIWC 2X4TB 3NOIA 4PY8I 2FIRT 1NDGA 2C3XA 4PGCB 3I9GL 2V5SA 4N0UE 4OGZA 1U92B 4I5BB 3ZE2E 1MCOL 3DXAD 4XNZB 2DIJA 2L4OA 1GZPB 3MUHL 4TUJB 4LEXL 3BIAX 3SGKA 5FUZH 2NLJB 4Y19D 1T2XA 4JFQB 2VB5A 3M1BB 1WWAX 3QO1B 3ET9F 4P23D 5BQ7A 3KPOB 5C0JB 2WBJA 1GH7A 1DDHB 1JUFA 1A1MA 2I9LB 1SJEB 4X6DE 5M94B 3FT4B 3OKMB 2H6PA 3WJLA 3P0VL 1FFNA 4GMSL 3SDDA 3CVHB 4Q9QH 2CDGB 1ZTXH 1JGLH 1T89C 4U1SA 4QRQA 1IBGH 1I9EA 5F3BA 1W0WA 2CDFB 2B4CL 3ARBA 1YJDL 3FQTA 2OP4L 5BV7C 2XZQH 3CXDH 4U1LA 1BJMA 4OKDA 4G8FB 2MQ3A 5GRYA 1F6AB 3RWEB 2YPLB 1S5IL 3RUGA 4LLVA 3D25B 3L7EB 4FQ2L 3ULUL 1OP3H 5IJKC 3VFUB 2DBLL 3NZHL 3D3VA 3WD5L 3ULSB 5IR1A 1ZT7A 4OKVA 5IP4A 1HK6A 3AS2A 1RZ7L 4LLUB 5T1KA 4Q9CA 2WUCL 5HPMA 4X9BA 2B2XL 3G08A 1MCHA 4P5TA 2ZPKL 4BZYA 1WUNT 2L7UA 1QPPA 2B5IC 3HR5A 4X6EA 2FX8L 1CGXA 1G9MH 5AZEL 3GO1H 1ZA3A 2AERT 4RSVA 1JMZA 4JFXB 4GUPB 4JEGB 1FDLL 2AJSL 4PGDB 5TDNB 4N5ED 1P53A 4ODHL 2HRPH 5BJTA 5L6YH 1MY7A 3G5ZB 1QACA 3RIFK 2ED9A 5SWSD 5CJQH 2GTZA 1AXIB 1QBLH 2Q7NA 1ZEAH 1I8MB 4X5XB 5FB8A 2G9HA 4D2NA 2A1WH 2P5ED 3LKSA 3H9SE 3MYJB 4O02L 4GG8B 3MMEA 3RNQA 1WBZA 5DJ8B 3PHSA 1HH9B 4S11A 3UJIH 4PJIB 4XVSH 2XQBL 3HZYA 5CEZE 2R0KL 2VXQL 2F5AL 1FNAA 4YHIA 1W0YT 3S3JA 5E0QA 3DUUA 2IADB 5BRZD 4CGTA 4JLRA 3HG1E 4GS7C 2W0KA 2FLBT 3BRFA 1A6WH 5DJDB 2XY2A 1RULL 3WXWL 5JXAH 2NY4B 2LQRA 2D4FA 3KPMA 4NWTH 4O2CA 5KSAB 4DZ8B 1UKSA 1R5IA 1MFAL 4X6CB 2RCSH 1YUHB 1MNUH 1BVZA 3R1GH 3AROA 2V6HA 4ZTPL 1RK1A 5GSVA 2HTKC 2GI7A 3L95B 4PRDB 1KSRA 2BVPB 2DQTL 1NCBL 3BDYL 4QRRD 4O4YL 1AI1L 3EDFA 5EU3A 3MQIA 3O6KL 1DQML 3V7MA 2YOCA 3MRKA 1TQCB 4WW2C 3QI9A 5BVPH 5IF0B 2R4RL 4JO3H 1SYSA 1T1ZB 4NO2B 5D1QC 3PHQA 5D71H 3WDIA 1U8IB 3C9NA 3H3KA 5FYLE 5GGQL 3QIWD 2HFGL 1CLOH 1AGCB 5HVHC 2XTJB 1ZGLB 1IAOB 5B22A 1AY1L 2P8LB 3WIHA 3A0OA 4K3GA 1MCDA 4U1HA 2V9QA 1CICB 2N1KA 2NX5B 3QFJB 1VADA 3GNML 4FQXB 1J11A 3TBWA 4KI5D 1JBJA 1LP9B 4OZ4B 5CMAA 3RVWC 3SCMB 4GG6A 1I3GL 4YDIH 2DQJH 4ALAH 5I1JL 2IFGA 4DOHB 1OTUC 3BZDA 1TFHA 3GMPB 1F4XL 3JV4A 3VWJD 5EOCH 4Z76A 1BECA 3BKML 5DFVC 4NKMA 2A0LC 5EUKA 3T0BA 5F6IB 4KKCC 3QQ4B 5DJ6A 3Q0HA 5IEKB 3VFPB 2AW2A 4JHZA 1T1WA 3RBGA 3LEYH 2NY5L 3BWAB 1N4XL 4FFWC 4GAGH 1XF3A 1KACB 5CZVL 5MENB 1QFPA 3IDYB 3KXFD 4KKAD 1A21A 4RAHA 1Q1JL 3DRQB 5KJRH 3G6AB 3HB3C 4U05A 2CK2A 1NEZG 1MPAL 3STLB 3ARDB 4JG1L 1JFQH 3K0WA 3NPZB 1FP5A 5B38G 4K55A 4UIMA 2AKRA 1QRNE 3IRZA 5ENWA 2AJVH 1I3VA 5A2KH 5L0QB 3OAYH 5DVLA 1U8QA 3HNSH 5JW4R 3OHXB 4D9LL 3VRLE 1D9KB 3BH9A 3IVKB 2HT2C 4X7EC 2ZCHL 2FL5B 4P2QB 4X9GA 1TZHB 4OLUL 4XPBL 5DRZB 2ENSA 2V2WA 2IPTL 2UZIL 2GSGB 4MD5A 3NCFB 1KELL 4RMTA 4JQXC 1C16A 4OTXH 4ZS7H 2HVJB 1CXEA 3OAZK 3HMWH 3VXRB 5ISZD 4O51A 3FN3A 5TE6H 3JTSA 3OBAA 3V6OA 3U7WH 1GGUA 4OZGB 2ZJSH 4XXCA 5FUZL 4LVHC 1BLNB 1INQB 4KHTH 4FTVA 4JM2D 3K4DA 4PJAA 3OKDB 3SDXE 5TDPB 3BGAA 3NGBB 4PJGB 5F7WC 5BS0A 4P2RA 2OQJB 5C0CD 3U82B 4LKXB 5I15H 4JQIH 1XZ0A 3P4OA 3QHTC 4MQ7A 1GZQB 3UTZB 4Q9QL 4YBLB 1ZTXL 1JGLL 2BXYA 3L3HA 4MQXD 2X7LB 4U3HA 4YBQC 5E94B 4UB0H 1IBGL 2Z31B 2VLLA 1WK0A 1AC6A 1OGAD 1NMCC 4WI5A 4MJ4A 4PRNB 2XZQL 2WUBH 3CXDL 4WUUD 4OFVA 2C4XA 5HI4D 2R2HA 2CMRH 5TGBA 1QSFB 2DJSA 1LEGB 2CK0H 3P30H 2MPAH 4NQCD 4OV6F 5GGRA 4PJ8C 1ZT4B 2O5XH 1DQJA 1B0RA 4YK4C 3VD7A 4WHTB 4PJ5B 1M05A 4HUXA 2IWGA 1A02N 3SGKC 1L0QA 5ICZB 3REVB 1IGMH 3EHBC 2AJXH 4PRIA 1G9ML 3BPLC 1WCBA 4HK0B 3GO1L 2WBJC 4ZAKB 4MNGE 3G6DH 4LMQI 1NCNA 2OTWB 1UWEH 3RI5K 4LLYA 3T0DA 2HRPL 5L6YL 2F53A 4ESKA 3WJLC 3SDDC 5IVNA 3Q1SH 2J88H 5CJQL 3O8XB 3Q6FB 1QBLL 2FO1A 4I0KA 4L4VB 1ZEAL 3WFCH 4N0RA 3HPLB 3ARBC 4Z0BH 3KR3H 1JTTA 3AREB 1CGSH 2A1WL 1KT2A 3S4SG 1LHZA 4YDVB 3UJIL 5KZCB 5T3ZE 1LEIA 2UVEA 4XVSL 4HDIB 1KGCD 4UTBH 1I4FB 3A6CH 4F8TA 4NZUH 1KTDA 2EIZB 3T0EC 1A6WL 5C09D 4P5TC 1T7ZA 2X4QA 5JXAL 1UZ6F 4CNIA 3DROA 4NWTL 5GGVH 1X4ZA 4KGJA 1HHIA 3UCRA 1KYOJ 1ULVA 4ELME 1WIUA 3FQWA 5HGHB 1U91A 4QXWA 2RCSL 4AT6A 4O58H 1P7QA 1GGYA 1MNUL 4P9HH 3R1GL 1Q9KA 3HE7B 4IRSD 1DLHB 1I1FB 2NZ9C 4FXLA 1FZOA 4DCQB 2X4SB 5F6HI 5L2KD 4K8RC 1T22A 1FZJA 5DSCB 3V8OA 1A6UH 4MWFB 3B2UC 4NUGH 3N1MC 1U8HB 3CFBB 2VL5B 3T2QA 5DD3H 1Z2KA 2YD5A 3RVTD 1EHAA 5BVPL 4RMWA 5EO9B 5BXFB 3QUZA 4JO3L 5FECB 1ZHNA 3H7BA 3KWWA 3QEUA 3KYOA 4F58H 1QHOA 1HHHB 3W39B 5HYIA 4HX1B 5D71L 1WBXB 5ABDE 4LCWD 3TNNA 5ACZA 3QUXB 1UACH 5E8OA 4L4TB 3LY6A 5EOQH 5KVGH 1FSKB 5J3HC 1CLOL 4HMDA 1N6VA 2EXWC 3PWPA 4E42B 2VZTA 3QULB 1ND0A 3D0LA 4KXZH 2GTWB 4F7MB 1G6RA 2AEIT 5ITFB 1ZXQA 4PJIF 1JCKA 2GUOB 2X41A 4MA7H 4XBPA 1KIPB 2OYPA 4JPIB 4YDIL 2DQJL 3S36X 4ALAL 5JOFB 1HOCA 1ZHBB 1VGEH 4HS3B 4PYGA 5ERWA 1TJIH 2WIIA 4M7KH 2BC4A 3RDTA 4PJ9B 5D1XA 4LPXA 3DTXB 4QNPE 3C2AL 5AUMB 3HA0A 4YHNA 5IMLA 3O9WB 3LEYL 4GAGL 32C2B 1Y18A 3B9DA 4XNMA 5DR5H 1PFCA 3FMGH 1JHTB 2F19H 2YD8A 1K8IA 4LCIH 1QNZH 4OCMC 2Z8WC 3MRNB 4JJHA 5T5NF 1EEYA 4PLKD 5KJRL 2PO6D 5GGSY 1CG9B 3WUWG 3OKOA 3FQUB 1KFAL 4LLQA 5T3XD 2EICA 4JKLA 1RIHH 1F00I 1QTYT 1X5JA 1FORH 1JFQL 1YN7B 4LMQE 4MQTB 3V4UH 5EIIA 2Y6SC 4Q6IA 1FC1A 3FTGA 3B9KA 2AJVL 2PW1A 3FRUB 2HJLA 3IXTA 2JJTA 3U7AA 1L9MA 3HNSL 4YBHA 1X44A 3BUYB 5D7KE 3VXMB 4TUOB 1KLUA 3RNKA 3TH4T 4GRLD 2NY1C 4KKLD 3PV6B 1JNLH 4P46B 1I8KA 2DN7A 4UQ3A 2H32B 4PLJC 3WN5A 5CP3A 3MRBB 4QRTB 1UH3A 3VXTA 2IJ0C 4MJID 1HXYA 1HSBB 4OTXL 1T6WA 1DP0A 4ZS7L 1IAIH 1MFEH 5IW6A 5EZIH 2VKWA 3QXDA 3NN8B 1T0NB 1GCFA 4KK6C 3HMWL 4YFLI 4G8GB 1LP9F 4HUWA 2AQ3A 2CJUH 3K81A 3L3KA 2IF7A 5TE6L 5I2IB 4L8DB 4LPCA 4OM0H 3RX8A 2XN9A 1MH5A 2ZJSL 3U7WL 2ERJC 5KSVB 2YD4A 3H3PH 3CNKA 3QNYA 3MA9L 1B90A 4KHTL 4L5FH 3WCYA 4YHOH 3X13B 1C12A 2NXZC 4JCLA 2EDEA 3G5XA 1RJYA 3W2DH 5JIHA 3WLWC 5I15L 1XR9A 4HJJH 4JQIL 1FNEB 2PW2A 5I8KH 1TLKA 1MWAB 3RZCB 3MUJA 3U4AA 2FSEA 5EG6C 1HXMB 5JHDE 3HAEA 4YR6B 3OGCA 5JTWA 3HRZB 4X0KB 2PF6A 1ZLWK 4OI9A 4WFGE 4LDOB 4S1SH 1KPVA 2WUBL 4BZ2H 3VFNA 3DLQR 2E8YA 2HMIC 1PKQA 4QLRA 4P48A 1QQDA 3GSXB 3RWGA 4L8CB 2CMRL 3OR6B 3LKPB 3BQUA 3CZJA 1NSNH 3IDIA 2D7OA 3SE9H 2CK0L 4PY7A 4U6XB 2SEBA 3P30L 4I9WE 2MMXA 2MPAL 1L7IH 1UXWA 2X4OB 3H9SB 3KS0H 2O5XL 5I1DB 5CEYB 3MRLA 3RGVA 4XXCC 5JUEH 1LDSA 1IGML 3QI9D 2AJXL 5EU6A 3U6RA 2W1NA 3B8SA 3WNOA 3G5VB 8FABA 3BXNB 1N0XH 2H2SC 4TN9A 3G6DL 5I1LB 3HG1B 1UWEL 5IFJB 1P2CA 1BIHA 3MV8D 4D0CB 3HZKB 5DMIH 4PYHA 3SDAB 4UUJB 2IMNA 4JZJA 2C3VA 5EZJA 3CFJA 3Q1SL 4YGVB 3TNMB 2OR7A 2J88L 4X7SH 3ULVD 4X5LA 1NBYB 4WEUD 3GRWH 3WFCL 3WDHA 1UEMA 3KPRD 2NR6C 5FUCC 4Z0BL 3KR3L 4EXPX 4K7FA 4XVJH 3UZQA 3GUTB 5FV1L 1XAUA 2NTSP 1CGSL 4MNQA 3N1FC 3STZB 4YNYB 2YBRB 3M17B 1D5MB 4TULH 4HS6B 3LB6D 4R0LA 4UTBL 1AQKH 3GJFH 1N59A 1U41A 2YEZB 3A6CL 1NGWB 1LO4H 2ITDA 1WZ1H 1V05A 4UOJA 5GGTA 3LRHA 3PWLA 4FQPA 5GGVL 5JO5A 3MJGX 5I73C 5CGMA 3JUZA 4HBQA 2VLJA 5AYQA 5DMKB 4G42B 4O58L 4P9HL 3HCVA 5C3TA 3O2DA 3RPKA 3PP3K 1G7MA 43C9A 3VFMB 1YYMH 3T4YA 3HNTH 5FF6B 4O5LH 1CS6A 3MRHA 5EOCJ 1A6UL 5A16B 1MHCA 1T80A 4NUGL 2ZOKB 3F7YA 2X4TA 5DD3L 1QRKA 4R2GD 3K4AA 4PGCA 4M4RA 4K7PY 4Z6AT 3FO9B 4I5BA 3IU3B 5CWSB 3M07A 4F58L 1GZPA 4H0HB 4TUJA 4IOSD 4OQTA 2NLJA 5M7QA 1K8DB 4HIXH 1UACL 4LPTA 3M1BA 5EOQL 3QO1A 4JAMB 5C08D 5KVGL 3KPOA 5C0JA 2Y07H 3GSNB 1DDHA 4XBEH 2VITB 5JXED 2I9LA 1SJEA 2GCYA 1CFVH 1J8HB 3MPCA 3FT4A 3T2NH 4D0DA 5IB4B 3CVHA 2CDGA 5A2FA 4MB4A 1XR8B 3S37H 4NYLB 2CDFA 1IKNA 4QEGA 1KG0B 4MA7L 3B6SB 1EBPA 5FOBA 1NC4B 3VD4A 3V4PH 2PYFB 2WW8A 4OZHE 1F6AA 1Z0NA 5IVXF 3RWEA 2YPLA 1CGTA 1T03H 1AXSB 3D25A 1SVCP 1VGEL 1S9XB 3L7EA 5B3JE 4MQSB 4J4PD 1DANT 1JPSH 3FB5B 3VFOB 4QT5B 4LKCB 4CVUA 3ULSA 3T8XA 3QUZC 2GJJA 4M7KL 4LLUA 3HI1B 1A7BA 1MCQA 5JW5B 5IKCB 2R69H 1QR1B 4Y2DB 3CVIH 5DR5L 5JDSB 5CFHA 3FMGL 2F19L 3ARGA 1UA6L 5LAXA 3LOWA 1OAZH 4LCIL 3IJSB 5HYJE 1QNZL 4GUPA 1DL7H 3FT2B 2O93L 5E2WH 4IOFC 5TDNA 3GI9H 1WZMA 3DUSB 3VGAB 1RIHL 5CGYC 1FORL 4R7NB 6FABH 3V4UL 2VDRH 3LV3A 3BZ4A 3VGFA 3DV4B 4X5XA 4NCC2 2IANE 1AR2A 2ICCA 5D7LE 3BZEB 3KLDA 3SDXB 5K9OA 2VERN 4GG8A 4FG6D 4I0PB 1HH9A 1MVFA 1UM4H 4PJIA 4PRID 2GHWB 3MRIB 3RIFF 1EEUA 4TQEH 2X09A 1P9MA 2BSTB 5JDJA 1JNLL 4N9OB 5FDYA 1NMAH 5D1XC 3OR7B 2OR9H 1FO0H 1DN2A 3UO1H 3MLUH 5DJDA 3QQ9D 3RL1B 1TENA 2Q87A 3C60D 5TF0A 1K9TA 4AY0A 1IAIL 2CPCA 2J3SA 1MFEL 3LN5B 3MOQA 4IRJC 5EZIL 5GISH 5KSAA 3BN9D 2CJUL 3OB8A 2ATKB 1JPTH 1YUHA 1NANH 1PG7X 4OM0L 1GGCH 3EDJA 3H3PL 2VE6B 1RIVH 1RVFH 4PRDA 4L5FL 3WIIH 3ELAT 1HDMB 4YHOL 2QQLH 3UPAA 1KJMB 1ZAGA 5K59F 1OTSD 2F9BT 5I6XC 3IDGB 3W2DL 3MBEC 4HJJL 3B9KC 5EBLB 5I8KL 3MJ9H 2Z91B 1NGYB 4MZ2A 3L3IB 4EI5B 4JKKA 1MY5A 2X42A 1ONQB 5IF0A 1LK2A 4NC1C 7FABH 4S1SL 1T1ZA 3PL6B 4BZ2L 4NO2A 1H0DB 2BOBB 5I74B 3MLRH 2PXYD 3CXHJ 1I9JH 1U8IA 4NRYB 1NFDF 3IXAB 1PJ9A 4QOKE 3B3IB 1L4IA 3VXSE 3GMLA 4H88H 4YJZL 1NSNL 1S7QB 1AGCA 5CLTA 1G7PB 4YPGB 1ZGLA 1IAOA 2L7JA 1EVTC 3SE9L 3LD8B 3EJJX 2OTUB 3KPTA 2P8LA 3PGCB 1L7IL 1JF5A 3CDFA 2B1AH 4S1DC 1CICA 2K9UA 3SEPA 2NX5A 5JUEL 1BZ7B 4KK9C 5JZ7C 2HLAA 1X4XA 4FQXA 1N0XL 4JY4B 3IDMB 4PBVC 1LP9A 3SCMA 1ZA6B 2AI0H 4C56E 4ZNEE 5DMIL 4YAQB 1QLFB 4OCYH 1N26A 3ILPA 4XC3H 5HHMB 3UTOA 2E27H 3GMPA 1E6OH 2P8PB 4X7SL 3S9DB 3SJVE 5AZ2H 4I3GA 1TITA 3GRWL 4KUCF 5T3XH 3U48A 2BMKB 4M61B 2BVEA 3D39B 5J56B 4MS8D 5JW4M 4CJ1A 5IEKA 3VFPA 4XVJL 4LCCB 3LIZH 4G9FD 3BWAA 1OAUH 2IPUG 5MENA 3OWEA 3BQUC 4TULL 5J6GB 3CSYB 4TNVK 1M7IB 1WLHA 2BX5A 2FO4B 3OG6B 1AQKL 2AS5M 1UCBH 4ZO7A 2MKWA 4PRHE 1J5OH 5C07B 3P4MB 4HJ0D 4RGOH 1CU4H 4ZTOH 2WSKA 3ARDA 2J5LB 1LO4L 5D1ZB 3RGVC 1TZIA 4AEEA 4U2YA 2ZUUA 5E7FA 2E7CA 4MXVE 4RX4A 2AK4A 2E3VA 4OF0A 5GIRB 4XX1E 3VGEA 3ZKSD 1AR1D 1DUYB 4JZJC 2C4FU 1F2XK 2W92A 4JPKH 4PGEB 1YYML 1WC7B 3HNTL 3OHXA 2DICA 4O5LL 3IVKA 4J3UA 4P2QA 5DRZA 1TZHA 5KG9B 4RGMB 3RWCB 1H9VA 4JG0H 2GSGA 4ZFOA 4M5ZH 5EC1B 4NO0A 2DD8L 3QUMB 5I16B 2JB5H 4LSPH 4F33A 3UEZA 1V7MH 3VA2C 5DQ9B 2HVJA 4HT1H 2XICA 3VXRA 1T2QH 5I8EB 4R0LC 5SWQA 4OZGA 2ATPB 3MV7B 2EE9A 2R2CA 4HIXL 1BLNA 2A9MH 1INQA 2Y07L 2NZIA 4XBEL 3SPVB 3NCYS 3UTQB 3HZVA 4B0MM 1CFVL 4LKXA 4AENA 3ZDXF 3RJDA 4RMUA 3T2NL 3E6FB 1VESA 1GZQA 3GMRB 3UTZA 1XGPA 1IQDB 4GBXB 2X7LA 5E94A 2Z31A 3S37L 5IM7A 4Q9BA 3V5HA 3JVGA 3QB7C 4OLZH 4N1CA 3HNVH 4PRNA 1ODAA 2EKJA 1ZGLP 3V4PL 5MI0C 3RAJH 4KKNA 1HNGA 1T03L 5FHAH 4EDXB 1QSFA 3WFEH 1JPSL 3L5IA 5LVEA 2NY0C 1EUTA 1LEGA 2ZOLA 4ZSOB 5DRWB 4K3JH 3BHBB 4RCAA 4WHTA 3ULVH 1X7QB 3VFVB 2R69L 1MJ7H 1X5GA