4G8EA

Crystal structure of clone18 tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
201
structure length
201
Chain Sequence
b'GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVLNTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha chain clone 18 TCR
molecule tags Immune system
source organism Homo sapiens
publication title A conserved human T cell population targets mycobacterial antigens presented by CD1b.
pubmed doi rcsb
total genus 36
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2012-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eA02
4POZC 3FONA 1U91B 3SN6N 4XWOC 1U8MB 1CFSA 4K8RL 4RGMC 5DJ0B 3KPNB 4QRTA 5B3JE 3T1WA 2IBBA 2OTUB 4LP4A 1CZ8L 4MJ6B 2Q87A 1TETL 2ZOLA 1K8IA 4NDMB 1W2KT 1F58H 4HUXB 4U1MB 3TNNA 4XNXH 3VXMA 3Q6FA 4F58L 5IMKA 2ORBL 4OZGA 3W5MA 1KB9J 3MRQB 1NC4A 2Y1VA 4LLDB 2ORBH 1NGQH 1CLZL 1XGYH 3RZCC 1MI5B 5DJ8A 3SE8H 3LD8C 4L3ED 4X6CB 3QDGE 5I1HL 1SY6L 4Q9QH 4OGAC 4WFFD 4CNIB 1DFBH 1JWMB 3ZYIA 3NFSL 5C0EA 4L8DB 3WD5H 1O5DT 2IPTH 4WHYH 3EGSA 3VWJA 1YUHB 2Q1EA 3KPRB 3FT4A 4OZ4A 2YBRB 5CMAB 5GJTH 3AS0A 4PGDB 3E1F1 3ZHLA 1PLGH 4WUUA 5DO2D 3Q5YA 3HZVB 1DSFH 2V2WB 1AXTH 1J1PH 2RJMA 1V3JA 4CBPA 2A2QT 5HYJE 4RMUA 2J4WL 2LTQC 3X3FL 3RWJA 2W1NA 3MRNA 3FN0L 1HSBB 2EC9U 1CDYA 5C3LD 4G6FD 4MAYB 1UB5A 1WBZB 1CG9A 3VGDA 3VXUA 2R23B 1WF5A 2FL5B 4ELME 5T33L 5E1AA 1NBYB 5DJ8B 2EDYA 1MCPH 5ECJE 5ERWA 4MZ3A 4W4OC 1PEWA 1N64L 3D69A 3AU1B 5IF0B 3RA7L 3GMMA 1C16A 2RIKA 1MRFL 3FO2A 3WHXA 3VD4A 3BFOA 3GSOA 3OAUL 4JG0L 1MCWM 4J3UA 1IGIH 4OI9A 1QLRA 1UKQA 5ALCH 4X4MA 1MAKA 1AE6L 4F37K 3BP6A 2VLKB 4Y19E 4PRHD 2HP4A 2FJGB 3O45A 4JQIL 4WUUB 5L2JB 1X7QB 3BUTA 2YD9A 1QHOA 1KCSH 3RZWA 3GKZA 4JHWH 2VL4A 5DLMH 3DMMC 3NZHH 2VXVL 3RTQB 2FJGA 5D1XB 2HFFB 5A2JH 3LN9A 4K8RH 5EUOF 3V6FA 4QOKB 3L5XL 3D0LB 4EVNB 5D5MA 3MJGX 4OLEA 4W6WB 1H3GA 4XPTH 3HI5L 3DYMA 4FQHB 3RWHB 4RFOH 1S7TA 3K7UA 4YHNB 4K7FA 4LU5L 1WVZA 2E27L 3JV4A 1LK2B 3INUL 3C5ZC 3S35L 5GRZA 2DYPB 4HWBL 4ALAL 3SGKA 4JB9H 5EUKB 5ALCL 5H37H 2PYED 1R3LA 4LGRB 3RUGB 1QQDB 1BREA 4HEME 3Q6FB 2DLFH 2PETA 5TH2A 2QLVB 3RI5K 3SDDC 2DF3A 3R1GH 2QSCL 1XAUA 3L3KA 3U46B 2I9TB 4CW1B 2A83A 4Y5XA 5DJ0A 3PL6B 3RHWK 5DFVC 2EC8A 3HE6A 5IW1A 2AJZA 3KLAA 3T2QA 3IXTB 4P46C 1NMCB 4HK0B 5JO5A 4AQOA 2OK0L 4HJ0D 1ZLSH 5J8OA 4QXTA 1F6AB 5IB3B 1CFTA 2O5XH 4KJPD 3MLWH 3KJ6H 2A38A 4UU9B 5DUBB 1FZMA 4U31A 2EXWD 2HMIC 4KDWA 2FH8A 2HTLC 3KDMA 4YWGH 4PJCB 4U1JB 5E8OA 5A43C 4S11A 4OZFA 3TLRA 3L7FB 5MHSD 3OKYA 4XBPA 1HQRA 1IC5H 5EZIL 1R6VA 3TV3L 4JO1L 2VR9A 5I17B 1U3HC 1AXSB 1SYSB 1VGKB 3MACL 4GRLD 4NJAH 3MJ7B 2H6PB 3UCRA 3LIZL 1BVLB 2BNUA 3NIDE 5JDSA 3RL2A 3GI9H 1XR9B 1YEHL 4JKWA 2BHZA 4LPCA 1TETH 3QIUB 4KI5C 3N0PB 1LMKA 1WJ3A 3UC0L 1BQSA 3SDXF 2WQRA 4CVXB 4JGUA 1FRGL 1YN7A 2D7OA 4R90H 4EN3B 43C9A 1NCDH 1MWAB 2YRZA 1ZHNA 3CFKB 3GMRB 1WTLA 4MS8D 1J8HD 4MQXD 4OBSA 1I8KA 3BZ4B 2P8MA 1YDPB 4ODUB 3ROOA 5AYQA 3ZTNL 3NACH 1NCWL 4R96A 5CWSA 1BJ1H 3DSFL 2F5BL 1RZ7H 2DQIL 4PV8A 3BP5B 4XCCL 2HJLA 1NGZB 2I9LA 4Y4KA 3TO4B 4F7CB 2RFXA 4MDJA 2FHBA 3REVA 1K6QL 2C5DC 1FFPA 2X89D 2EKJA 3DX7B 3TZVB 4S10A 1G9EA 4NPYB 1AR1D 4I2XA 4G8GB 2A6KA 4QWWD 1S7VA 3FQNA 1HHJB 3HC4H 3WNPA 1ZEAH 2GT9B 4EOWL 4YFLF 3SE4A 3IDYB 4DKEL 5GPRA 2UV3A 2BCKB 4JAMB 4OKVB 4OCSL 1BF2A 1UQSA 2YA2A 5ESAB 5FO8A 35C8L 5D4QA 2EYRB 2VAJA 5DDHA 4U05A 5ACMA 1MCQA 1VGEL 3FQXA 1FNLA 5FXCH 5HBBA 1U8QB 4Z7WF 4UINH 4EXKA 5BV7H 4ONHB 3H42L 1CD0A 2VXQH 4PG2C 2AKRB 3GBNL 5FGCE 4P57B 3QIUC 1G7LB 2DD8L 3IFLL 3ZHKA 3ILQC 3G5VA 2WWKT 2C3VA 1QPPA 3QUYD 5EOTA 2X4SB 5EC2A 1ITCA 5DD1L 5F6HI 2C7UB 2IQAA 1C7TA 2ERJC 3OKKB 1IILE 5HHVH 3CX5K 3KR3H 4HT1L 1TZIA 4JM4H 4UBDD 1FNGA 1U8LA 1KXTB 4DGIL 1RIVL 2JCCE 1KELL 5FO9B 3BGFC 2RGSA 3EYQC 2VISA 3MGTB 4U4BA 2AXGA 1UADC 1J8HA 4C83B 3T04D 4Q2ZA 4U2ZA 2VDRH 3X13B 4G6FB 1AY1L 4LCIL 2DTSA 1MWAL 1PYWB 1UACL 2J4WH 1SJHA 5EC1A 1UYWH 5D7IF 5DS8B 5IJKC 1MFNA 2R0LL 1FG9C 4NO5A 3QDMD 1U3YA 5HI3C 4P46D 1X4ZA 4PJ7F 5JHLL 5KJRH 4W4OA 2Q8AL 1FL5A 1UWGH 4UIMB 3TC9A 4EQ2A 4TNWF 5H35A 1LVEA 3MOAL 1KOAA 3WFCL 3TZVD 3M1BB 2Q8AH 1KENH 2DIBA 2XWBB 3M8OH 4IDLA 3ARBC 5CEXA 3PWPE 3JTTB 5F3HA 5C0JA 3BO8A 4NKDB 1JYVA 3H9HA 4PJGA 5M7QA 4TPRL 4L8DA 5IHZB 1K4CB 1IAKA 2E7BA 4FG6D 5CEXB 1CBVH 2D7TH 3D2UA 3QEGH 1PZ5A 5T1MB 4U1GC 2P49B 4KV5E 4PJEE 3QO1A 2Y7QB 1AKJD 1HI6B 1XF4A 3MR9A 5GS2H 3QPQC 2ZJSL 3FTGA 1A6UH 3QIBD 4X7TA 4PRAB 5IJKA 1VEOA 5JIIA 5LQBH 2V2TA 1XCQA 4BH7B 1G9MH 2AW2A 3FMGH 1BEYH 5CGTA 1D5BB 3U2SB 4ZMAT 3FTGB 3OJDA 1P1ZA 2P5ED 1BZQK 4LVNB 4XCFL 1BD2B 4IRSB 4JR9H 4R4BA 2MWCA 4LMQI 2XI9A 2BNRD 2GW5A 1WLHA 5GJSH 4Z95H 1GGIH 1X6NA 3RWEA 1G7PB 3ZTNH 3KXFB 1YDPA 4ODUA 1OTUD 2C3HA 1AR1C 4YDIH 1A2YB 3SO5A 1ED3A 1RZIA 4JFPB 4JB9L 1REIA 2W07A 1T1WA 1ONQB 1BD2E 1IEHA 4BFEA 4YZFF 3TVMC 3Q6GL 3PWLB 3CDGB 3EYOA 4X6CF 2QKIA 2W0PA 1KB5L 5ICYB 5HHME 1MEXL 1ZTXL 4KTDL 1UJ3B 2EDDA 4L4JA 4ELMF 3F7VA 4M6OH 1BJ1J 3QNZB 5GS1A 1A7PL 4X0KB 1QYGH 1N5YH 1ITBB 3ZDZE 4RAVB 1A1NA 4U1NA 5FUZH 1KIQA 4Z7QE 3O4OB 4N90D 4AM0A 2ICWA 4LLUB 4OZFB 4RGOH 3K0WA 2A9NL 2E7HA 1YNLH 1FYTA 3PGFH 2ICWI 1PKQB 2MNUA 2ITDB 5F93C 1BLNB 3OKEB 1R3IL 2ZUTA 3ULVH 1YQ2A 3VA6A 1S7SB 1T80A 4JO1H 3V6OA 2APFA 4HEPG 1JPTL 5J1AB 5F44A 2NY2D 3QRGL 3BN3B 1UJ3C 5CS7A 5I2IA 4NZUL 3UTTD 3OJVC 5F9AC 1VADB 2YD6A 3DYOA 1ADQL 2VQ1A 4DZ8A 1RQ5A 3WO3B 3RGHA 2VLJB 2CO7B 5I76B 1YQVL 3RBSA 1QOKA 1IGCH 1NL0L 4LLYB 1DP0A 3OJDB 3RGVD 5EOQH 5T1KD 5C0GB 3TVMB 3MRRB 4IOIA 1CE1H 3TBYB 4YHOH 1MNUL 5JQ6L 4BQCA 3SGJA 4Y0GA 5E6ID 4WU5B 1VFAB 4K07A 3HPLA 1MNUH 4MLSA 4X8JB 1DUYB 1R3HB 4RIRB 5TDOA 5B39G 1K2DA 4YJZL 2X6MA 4QO1A 3UPCA 2LAAA 4HQQL 1CL7L 3LV3B 2JCCB 2DM2A 3GSWB 4DVRH 1HHJA 2VC2H 3LN5B 4NPYA 4JJHA 1IZKA 2DQDL 4JRWA 3VGAC 3ULVE 3BE1H 4XXDB 1NBQA 2YSSB 4YHIA 3HR5A 5IESH 1BFSA 4KROD 1AR2A 3OF6D 1D5ZB 5F8RC 1LD9A 1GAFH 2OSLA 1UJTA 2X4NA 5BQ7A 3IDMB 2SEBA 4NNPH 1T2QH 2FYYA 4NKDA 3B8SA 1UM6L 3CFDB 5HYJD 3V0WL 1V05A 3B9KC 3WUWA 1BAFL 5GS0L 3LS5H 4HCRA 4YBHA 1YN7B 4LLQA 4XNZB 1MQ8A 4Z7VA 5ITFA 4OFYA 1PKQA 2BY3A 1P7HL 4BFIB 3BUYA 4OCNC 1AGCB 3QJHB 2Z4QB 1YJDC 4PJFE 3BE1L 4G6AC 1KIRB 4I0PA 5B39A 4WHDA 3GIZL 4RBPH 4F7TA 4U7KA 4JRYD 3C5JB 4JKPL 4K7FB 3WLBA 2FHCA 3HKFA 1YEIL 1HH9B 5EZOL 5KVEH 3UTSE 1VEPA 1WIUA 1MJUH 3GMMB 1T0NB 3PHOA 5CKGA 1A9BB 1F42A 2X7LA 1YMHA 1YEDA 3MXVL 2HT4D 3TGXA 4KMLB 3DBXB 2IBZY 5HGDB 4WI2A 2DQTL 2OZ4A 4KUCD 3EOTL 4AEIH 1QP1A 4P9HH 1IKNA 2AK4B 1MFCH 1WZKA 2Z93A 1U8HB 1HDMB 4JKLA 4Z7WE 4ZNEA 1HYRC 1MHHB 5HHOD 4LSQL 1B6UA 1H3PH 3SBWA 1N6VA 1JPFA 5HHNB 3V6ZB 4PJGB 3FN9A 1F6LL 5D93B 2WP3O 3OMZA 5ICZB 2Z31B 3OB0H 2ZSWA 4NQCD 3VWKD 2GTZB 3D85A 1NC2A 1NGXB 5BS0A 5HDBE 3V7AG 3S34H 1U8PA 1D5BA 1IL1B 1CLOH 3MYJB 4GW1B 4L4TA 5E08H 5HGAB 2J7LA 4ZFGL 1DBBL 3CSGA 5MENB 4R0LC 3I6GA 2JB5H 4KHXL 3VFMB 4GQPH 2R0KH 4KY1L 4JN2B 1JGUL 1HHKA 4I4WB 5SX4H 4I18A 3HCVB 5I9QC 1EV2E 2I5YH 5D7JB 1KN2H 3TJEL 4JO4H 1UT9A 2YC1B 2CLVA 1RJCA 4X5XA 3MNZB 4Q58C 1EH9A 3VI3F 4K3JH 3MV8B 3UZEA 2XWTA 3MRNB 1TJIL 2QV2A 1S9XB 3KPMA 1CFVL 1MI5E 1ADQH 3A6BL 4XNXL 3D3VB 2IADA 4LIQE 3G6AB 5K9OB 5EN2A 5IK3B 3CFJB 3L95B 1G6RH 1YMME 1B4JH 3L9RA 2DQEH 1AGDA 3QEQA 4QHMB 4DVBA 3O0RL 5GZOD 4XBGA 2Z31A 5DRZA 5GSVA 5IROA 2LU7A 3F6IA 2FB4L 1IQWL 2PO6B 4GKSA 3DMMD 1TCMA 4D3CL 1NCBH 5C0IA 1X7QA 1DQQB 2KL6A 1R0AL 1ZWIA 2H41A 1JZ5A 4GRMB 3ZKSD 3X17A 4FQ2L 1J86A 3FQTB 1T0MA 4AENB 4HX1B 4KROC 2KDGA 4PY7B 4F57L 3C60C 4NKIL 4MCZB 4WI3A 4E41E 2CJUH 3SO3B 5J13C 3IRZA 3GO1L 4OCMC 2NXYD 4PLOB 1BGXH 5SWZE 3OXRB 4GKZB 3SDDA 3QDAA 5EZOH 5KVEL 4PJBE 2E9IA 4UDTA 2R0WL 4J12A 2X4UB 4NRYB 5DJ6A 3GSNB 2OJZH 4MAUH 4RMVA 1G9NC 3GMQA 1IKFL 1KB5B 5GHWH 1F4WL 1KBGL 1CD1A 4N0FA 4N8CH 5GISH 4TSCH 5FCSH 2QHLA 3Q48A 5JW5A 3U9PH 2IANA 1J5OH 4OD1L 3U0TB 3L7EB 5GGVH 3GNML 3FONB 2AXFB 3KPQA 5FKPA 2CDFA 5T5NG 3SDXE 3TA3A 2DB8A 5JOFB 3CFKA 4JZOB 4NQDD 4JJ5B 1FAIH 4LF3A 3KPQB 3TA3B 5JA9A 2FECL 4ENED 4NRXB 1Q72L 4YGVB 5JLZB 4Y5YA 4Q74A 4GMSH 4GRLB 4OI8A 2XZZA 3VE0B 1FORH 3C08H 5IGXL 4FQ2H 4LASH 1A3RH 1II4E 1FC1A 5GGTH 1U8HA 3TYFB 4ZUTB 4OI7A 3JWDH 1SJXA 5FV2A 4M6MH 4OFVA 3PXJA 5CBAB 4HWNA 5JXEC 3TA3C 1WBYB 1KCUL 4I48B 5HGBA 4KVNH 1FFPB 1OAYL 4NNPL 4TUOB 4PJXE 4HH9B 5E8OB 3PDOA 4NQDB 1ZVHA 2B1AL 2B8OT 3T0WA 15C8H 3HPLB 5TFSH 1CFQA 4PRPD 4CADB 4FP8H 4NZJA 4QTIH 5EO0A 1A6WL 5D1XA 3VRLE 2L0DA 3CSPA 4OTXH 4WNQA 3LRSB 4JHZA 5DR5H 1AO7A 1FG2B 4KI5D 1KT2B 2FR4B 5CJOL 4P2RA 3BGMA 3HNVH 3F5WA 2H2SC 3HC3H 4L1DA 5FUCE 1JVKA 4AJ0A 5C0AA 5L0QB 5FF6A 4NC1E 3PV6A 1QBLH 2VXSH 3WIHL 4TNWK 2VDQH 4DGYL 2Q8BL 4Z7WB 4CUCA 1JTOA 2H6PA 1NUDA 3TV3H 5KVMC 2FX9H 3HE7D 4PGBA 2EDXA 1Q9OB 2X1OA 3B9KA 4CVWA 1H5BB 2NY6C 5HYSA 4IRSD 4XB7A 3VXOA 1KPUB 1RMFL 3VXNB 4R4FH 4IDJL 3FT3A 4F58H 2MPAL 3L3OB 1CR9H 2AQ1A 4BELD 5SV3A 5EU6B 4I18B 4N5ED 3RQ3A 3TH4T 1L7TH 3ALWA 3D1MC 4PRHE 5DD5H 1H3XA 4U1HA 4ZS7H 1DUZB 4YBLC 4X9BA 4NT6A 5ESQA 2G60L 2X09A 3QA3B 4EVNA 1DBKH 4X9GA 5IQ9B 3IU3B 3V4PH 3MLYL 4XNUL 5EZJA 3V2AR 1FV1B 4XPAH 5F9OL 4QXTB 5DJXA 2FGWH 2G5BA 4M43H 3C09C 4M03A 3CFBB 3QDMA 4ZUUB 3OHXB 1OCWH 3SDAC 5HPMB 4HIEA 4QHMA 4FQXD 4TNVK 1WWCA 4QF1A 1SMAA 2R1WB 3T0BA 3LB6C 4E42A 1S8DA 3P2TA 4X5LA 2P48B 3QUKA 3P30H 5J12B 5FECA 3QIWC 4LGSB 3GI9L 4JFOB 4DKAA 4NRYA 2EYSB 4NJ9L 4PJHE 3GUTA 1A1MA 3NH7H 4G6JL 3VWJC 1T0PB 4NN7C 2NQCA 4M7LL 5SWQA 1IC1A 4HBCL 2IGFL 4N0UA 1IGYA 5CILH 1NAKH 3LKOA 3WS6A 4I4WA 2XZCL 4P0DA 5FGSA 2ZUVA 3AS3A 3ARGB 5E5MB 3QI9C 4L1HA 4GG6E 2F58H 4UV7L 5T3ZH 3V6FB 4KK5D 3SKNA 3FOMA 2FO1A 4Y1AB 3QSKB 1OM3L 4ETYA 2ILLA 1HHHB 3KPNA 4QRTB 4ZD3L 3T0XA 3CCHB 4U6XA 2O26U 2PXYC 1QLEL 3QO1B 4XGZB 2A6IB 5HYSG 1FGNL 5F88A 5GS1C 2VDPL 3OAYK 3MLVL 4LAQH 3WO4C 4XPFL 3P0VH 3GSXA 1CBVL 1Z9MA 4ONFL 2VZUA 1R5WB 5H94B 4MWFB 2DQFA 4I0PC 1DEEA 4O5LH 3E2HC 1ONQA 2IG2H 5C2BH 4LNVA 4O5LL 1VDGA 2PNDA 5E7FA 5ESVA 1BD2D 2NW3B 2BNQB 2XRAL 5C2UB 5SWZB 4R8WL 1OARH 5ISZB 1I1AA 1EZVY 2GJZB 2DQGL 3UPAA 4EJ1C 1T5WA 4GAYA 4P3DB 1JF5A 1N4XL 2OP4L 3QCTL 1YNTB 4XAKE 2VLRB 2YD8A 5F9WB 1UWGL 3UJIL 2BJMH 4HJGB 4MA8H 1OTTC 2EDBA 3FQUA 3EHBD 3VCLB 3O2VL 2UY7A 2JF1A 3QCVH 2BX5A 3ZE0E 1YMMB 4L9LA 3UYRL 1MCRA 3O2VH 3PQYB 4EDXA 3BQUC 2F58L 1HKLL 3LMJL 1TQCC 2NXZD 2YD7A 3L3DB 2R4RL 5IM7B 4BA8A 1J0KA 1RUML 1A5FH 2EYTA 3L1OH 4NC1C 5CIPA 1UXSA 3GRWA 1TDQA 3HMWH 5A16B 4F7EB 2N7AA 2PXYA 5FDWA 5B39B 1EGJA 5C08D 4F7MA 3PJSB 3DROA 2UZIH 5F3BA 2NR6D 3ALXA 3GRWH 2CRIA 2IPTL 1UGNA 2UYLA 3BMVA 3K80A 3GSUA 1UKSA 1TCRA 3GZKA 5DJYA 4DJMA 5D2NA 3WXWL 2OMNA 4N5EC 2MQCA 1MIMH 3TF7C 3LEYH 3TBTA 3BKCL 5KSBA 1SEQL 2OXHA 1C7SA 1KGCE 4HUNB 3P77A 1I9JL 3DURB 1T21A 3SCMD 5GS0C 4PJ9D 2BSTB 5IQ7L 1U8NA 3LEVH 4LBEA 3QWRA 1TZHA 1QR1B 4Y4HD 5DQJA 5TGBB 3RVUD 5KVDH 1DVFB 1JF1B 3VWKA 4GH7B 3ARFD 3W2DL 3QDMB 3LN4A 3O2DH 4HPYH 4RFOL 4Y16B 3CVHH 2R2EA 5C07B 4NYLA 5DJXB 1R3HA 1Q72H 3BD4A 2R1YB 3Q0HA 4XBEL 5F72S 4KDTA 4OKVA 3CUPA 4UQ2B 1CXHA 3QNZA 3QEGL 5DZLA 2QQNH 2ARJQ 3N9GL 3VXMB 1A3RL 5ISZD 4ZFZB 1Q38A 3I84A 3SDAA 2OBGA 2WV3A 1U93A 2X89A 1CFNA 2V7HB 3GB7A 4GLRH 4HS3B 4PJFB 3X3GL 3T3PE 3SE9H 1DQLL 3WIIH 1PYWA 4RNRA 1C5BH 3MLSH 3AS2A 5M95B 2B1HL 3IYLW 2AI0H 3QUZB 3BIKB 2R8SL 1BFOB 3KVQA 4ZPTB 2DDQL 3I3DA 4GBXA 4KMTL 2X4OB 1H15B 4Y16D 1QUNA 3WFDH 1NCAL 2UWEA 5E00B 3N85H 2RCSH 4OCXH 1L7TL 3IJHB 1GC1C 4O51B 3VXUE 1JCKA 1FIGL 3STBA 3T2NL 2IJ0C 3LEVL 5DFWH 2ZCKH 4ELKB 3HNVL 1RVFH 3ZT7A 1U36A 4LSSH 3HFML 3SDDB 1RU9H 1C5DB 4U0RB 5E6IC 3VH8G 2E7MA 3FO9A 2EDKA 2F53B 2DIAA 3VFSA 3G5XB 1FAKT 1CVRA 1W0WB 3D85D 4JZNA 3MJ9A 1OAUH 5TE6L 4R7NB 1GL4B 1EUUA 4PJ9B 1XR8B 4YPGB 5AYUH 1QHPA 3QXUA 4YDVB 4Q6IA 1NFIB 5D1XD 5HHQB 4MMZC 4XCYB 1DDHB 4NZRL 4R4FL 4M48L 1SY6H 5T3ZE 4LSRH 3FO1B 1Q9KB 2DM7A 3TFKC 1ZGLA 4MA7L 4NQVA 4P3DA 5KSVA 2LAGB 4GKSB 1NCTA 3IDJA 1QLFB 5FOBA 5TFSL 4CU6A 3RWDA 4EBQL 3TBVB 5CP3A 2FX8H 1N0XH 3LPFA 4WTZA 1OARL 3BD3A 5ID1A 3DUUA 3P40A 4D0CB 4MWFA 4ZAKD 3B9KD 1N4XH 2OP4H 5ANMB 3DWTA 1NFDA 3PL6A 3BESR 2HKHL 2QHRL 4N9GB 3WFZA 4WW1A 4GBXB 4GMTH 5B8CC 4M3KB 4JRXD 3PP4H 5D6CB 5FO7A 3KLSA 1RVFL 2X4TA 1RIVH 3DOSA 4DQOL 5GGSB 2JELH 1MOEA 5GZNC 4MCYA 3CZFB 4BZ2L 1XR9A 1B6DA 3CXDH 2BXZA 5DQDH 3D2UD 1I8LC 1SJHB 2DI9A 2AV7A 4HXBL 2Y25A 3PWJB 1OAKH 1U42A 2DRUA 3JVGC 5F89B 3ZYJA 4PRDA 4X7TB 2UY6A 4U0RC 5I74B 2M8XA 5EB9A 4IM8A 3AY4A 4HG4K 2IGFH 1AHWA 4BSWB 2Q7YA 3B2VH 2VAAB 4X7SL 3RVUC 5HHXH 2WINB 4PRPA 4RFNB 4LBEB 1LEKA 4L3EA 5HDLA 2PW1B 2ICEB 5IFAH 1JL8A 3KJ4C 3NN8A 1KTLB 2CRYA 5GRJH 1CT8A 1CFTB 2LTQB 2GUOB 3ZKXC 5IMOA 5DLML 2B7DT 2P24A 5MI0C 2V9TA 4V1DA 3QUZC 5FEBA 2GAZA 3E3QC 3GJFK 3MACH 3RWEB 4NCC1 4PRPB 3UMTA 2F54E 1JFQH 1KLUB 2E7CA 5HGDA 4X6EA 2AJYH 5J4MA 3FZUD 1CGUA 5D1ZB 2JB6B 4O4YH 4KTYA 5E8EA 5TDNA 3H7BB 2D03H 4E41D 5IESL 3T3MF 1KG0B 2ADFH 2RB8A 3DMMA 4ISVB 4YNYA 1YNKL 4PV9B 2NYYD 4UAOC 1S7RA 3RPIB 1EEZB 3B9DA 2DLHA 4D94A 3DXAD 4PTUA 1IC7H 5IIEA 2VO5A 3DVGA 3QH3B 2WBJD 1UM6H 1LO0L 1N3NA 4XP1L 1EJOH 1ES0B 3CZFA 1YA5A 2AV1A 2GCYA 2OL3B 4KKAC 4M1DL 5KN5B 2EDNA 5T33H 2HJKB 3O6MH 1NAML 1LEGB 1GJIA 4O51A 5HYJB 2V5SA 4XPBH 1UH4A 2PCPA 4S0SD 4CVZA 3D2UB 4WV1A 2X9YA 3W0WE 2DOCA 2D4DA 1FVDB 4M4PA 5T1LB 5A2KH 3QWQB 2Y72A 3WHE0 1HKLH 3LMJH 3RTQC 4NM4L 4M8QA 1XF2A 3S34L 3IDXH 3HG1A 2NXYB 1FZOA 3UBXI 3G5ZA 2BK8A 3QUMA 5EC2B 2VAAA 3BN9C 1WCBB 5FK9A 4ODHL 4QT5B 4QOKD 2MHAA 5GJTL 4KGJA 1U58B 1CXIA 2VDMH 3MLRL 5IJVB 4K94H 3CC5A 4YE4H 3U4EA 2WW8A 1UZ8A 2E27H 4U0QB 1TTUA 2VDOH 1OAXH 1OW0A 5F88B 4KAQL 4YDLB 2D0GA 3CSYB 4KK8C 4LHUB 4LIQL 4NM8H 5DHVB 2O5YL 1A1OB 1BQHB 4QEGA 1MFCL 3OB0K 4V1DD 3T77B 5B4MD 1JV5A 1AY1H 1BFVL 2JELL 3C60D 3FOMB 4XMLL 2CGRL 2J3SA 1UWEH 4RMQA 1QBBA 1RZGB 3A6BH 2V7NA 2N4IA 1L0YA 4LNRA 3RWCB 1P53A 5D1ZD 3TO4A 1N59A 5GGRB 5FYKD 1WBYA 3WFDL 1ZVSA 2DIJA 5CWSB 3HC0B 1CGYA 1H0DB 4ZFGH 1PX3A 2MTPA 3BMWA 3O6ML 4PP1D 3S7GA 3H8NA 4KI5F 3OSKA 2BMKA 1PEZA 2XNAB 1FNSH 4NO0D 3GM0A 5D2LB 3KPSE 1A9EB 3DUUB 2CUMA 4OUUB 2CMRL 1Z9LA 3L5WB 4KJWD 3PV6B 5EA0L 3RJDA 3ULSA 5CZVL 4GQ9H 3O6FC 3ARGD 1HXMA 1CQKA 2HJFB 2YN3A 4EI5C 1G0DA 4BZ1H 4D0BA 3DO7A 2YEZA 3BIKA 3RL2B 1KN2L 2HJFA 3HZVA 2I60H 3AREB 4KQ3H 4KTDH 3NCYP 3G6DL 4ZUSB 4MJ2A 2ZP0T 3RWIB 1T22A 1OB1B 4MB5A 3VI4F 4KTEH 5KSAC 4NUGL 4PGEB 2EIDA 1CI5A 3S5LG 4JZNB 4OZIF 1FIEA 3NABH 3F6LA 3BAEH 2HAZA 1H0DA 1MJJA 4GG8A 1TNNA 5HHOE 3DPBA 5I71B 4X7SH 4P23C 3GSWA 4UNVA 3Q3GA 4ZUTA 3CK0L 2BOBA 1AD0B 3NPSC 4OSUL 3HE7B 5T1DH 4ZODA 4MA1C 1KJ3H 5AUMA 3MA9L 1MCPL 1IAOB 4Y8DC 4P5KA 3IDYC 4K7PH 3VXOB 2BOCA 3O4OC 2WUBH 1ACZA 3KYMA 1ZWIB 2GSGB 3DX8A 4QCIA 5C70A 5CCKL 1T7YA 5KS9A 4GW4B 3WKMH 2NYYC 3DO7B 2DL2A 1LWRA 2CR3A 3STZB 3IDNB 2HA1A 4IMLB 1YQVH 3KLAB 4KI1A 4HUKB 2ATKA 4KJYA 5I1JL 4MYWB 4M1CD 1HINL 2CO6B 1CLYL 4J4PA 4UDUB 5LXGL 4ZG1A 5JDSB 5IEHB 2ID5A 4WI8A 3WIFA 3V5DA 4BH7A 3MBEC 2DI8A 2D0HA 3LKOB 2BVPB 4WFGD 1WEJL 1QKZH 3PQYA 3OXRA 4FQHA 3RWHA 3ZDZF 5LGKA 3MV7A 3L7FA 1A1MB 1V7NH 4MD4B 4FQ1H 2Y7QA 4KK9C 4RGOL 3QDGD 2VTFA 5I8EA 4MA3A 1AJ7H 4IEFB 1EHAA 3OG4B 4NFDA 4WHTA 3MMEA 2XACC 5L2KB 5GGUA 5I6XB 2CIKB 2VLRE 3RTQA 2HLAA 2K9UA 5T5FH 4HD9A 3S35X 1BZ9A 1PG7H 5C86A 1W72L 3MLRH 4C58B 1HQ4A 1PY9A 1WT5C 5JLZA 3OHXA 2F54D 4GSDL 1DBAL 1QA9B 1SJEA 2NX5A 2G5BB 4ODSL 3OR7A 3GI8L 3W0WB 1ZLUH 3WSQL 3P4MB 4RAUB 4YAQB 1CCZA 5I1DB 5IT2L 2AK1L 1IGML 5IMOB 1I7RB 2APTA 4N0YH 3MBXL 1BFTA 3NN8B 3WFBH 3LS4H 1QVOA 3T09A 2VZ3A 2W91A 4QRRB 3MLXH 3G6JB 1DE4B 2G2RB 2J88H 5E8PB 1K3IA 2XY2A 4FOMA 4OZFH 4TRPL 5D1QD 5EC1B 5I1LA 4I1NB 2BMKB 1KCVL 3CNKA 4K2UL 1ZT7A 3C9NA 1DLHA 1P6FA 3QWRD 1N3NB 4NRZA 1S78C 4FXGB 1DLHB 3RDTD 1N59B 3MV9A 1A0QH 3GUTB 4KK5C 2Q20A 4MCZA 4LLAA 5I1LB 3ZE2F 2X70B 3U0PA 1ORSB 1YEGH 4XHQA 1WZ1H 1I75A 4XWGL 2BVQB 1IEBA 5I18H 3P30L 4YFEA 1DLFH 1JNNH 2WUCL 2XYCA 1S9WB 4U1SA 1LO0H 3LD8B 3VXSA 3WE6A 1MCHA 3LQZB 4ZDHB 4YC2B 2YD5A 2PF6A 3UROR 3WEXB 4NKOB 3S5LB 3S6CA 2DQHH 2V9RA 4HDIB 1UEYA 1IC4L 3KS0H 4P23D 2VB5A 4LSDA 3T4YB 1BIIA 4P5TA 4YDKL 3TNMA 1T4KA 5D9SA 4NHUA 4ORZC 3K8LA 1HOCA 4WWKD 3P4NB 2Y36H 3F7YB 3AXLA 1TPXB 3HC4L 3HPJA 5SX5K 4NRZB 2GSIA 3ARQA 4G8GA 1BECA 4I2XB 4XVSH 2VZSA 3OAZK 5ALBL 2XPGA 3ZTJH 3UDWC 3QUXC 1TZGL 3SOBH 2EDJA 3VFUB 3HAEG 1YNKH 2BNRB 3NFNA 4KKCD 4FFVD 4Y4KB 5EA0H 3ULVD 4B7IA 3JWNC 4YX2H 1QSFB 4ORGB 3SQOH 4QGYA 3S96A 4WTWA 1AI1H 4ZPVB 3STLB 4MJ6A 2K1MA 2P8MB 1AD9B 2EECA 5IFHH 1CE6B 2NY4C 5CAYB 5C07D 3D9AL 3LRGA 5TE4L 3O9WC 2DBLH 4W68A 4PJAB 4RQQB 4JPVL 4XPAL 5F9OH 3L5HA 1UCBL 3O8XD 3T4AA 5ETUA 2FYYB 2DQCH 5DJAB 3IJHA 4PRHB 1P7QD 2IPUG 1NGYB 1I1RA 5DMIL 1BVLA 2BNUB 3KHQA 5IFJB 4QWWC 2QSVA 4NO2A 3LZFH 3IJYA 2W60A 3P0VL 3VXTA 4WFEE 5TJWK 2IFGA 3O41B 3QNYB 1GIGL 4XXCA 5HI5D 4P5TC 3QNYA 4KGLA 5JW3L 4I48A 5HGBB 2R0WH 3CVIL 1PY4A 1D6VH 1CDIA 1G7IB 4HCRL 1I7ZA 2OI9C 5AEAA 5CILL 1N5YL 1MRCH 5C0GA 2F53D 2NCMA 5E56A 4JHBA 4OLVL 4KHTL 4P2YA 1ZA6B 5BVJB 5FK9B 5BRZD 4F7CA 4P4KB 4WJ5B 2P46B 4L4VE 5D1QC 1WZMA 1CQYA 1XH3A 1FZJB 4WW1B 2X4QA 4G6MH 2UUDK 1ED3B 3O2WH 2PYEB 4XPTL 3RWGA 3VFPA 1R3LB 5HHOB 4ZO8A 4WUKH 4HZAA 4EI6A 1NMCC 3C5SB 2PCPB 4JFFB 5J6HA 2CK0L 1D9KD 2A6JA 3KG5A 3BYYA 3JZ7A 4ODWB 3QNXA 4OJFH 3H0TA 2OJZL 4MAUL 1G1YA 5A3ID 1F3DJ 4YHIB 3OJ2C 1QSEA 1KIQB 5DYOB 3NZHL 4M7KL 2XXCB 1P5UA 1FFQA 1GGCH 4ODTH 2YPLB 4ZTOL 4X4ZA 4XAWL 2WIIA 2CRZA 4GW5A 4JLRB 4M00A 2VN7A 3RX7A 4PJHF 4U1LB 1I1CA 5LGHH 1OP3K 4P2QD 3RWIA 4JFDB 2HFFA 5F6IC 1LDSA 5EU4B 1MJ7H 1W0WA 5LGJA 1FYHB 3PIQB 5CBEA 2HT3C 3W9DA 4Q0XH 3S5LA 1MAMH 1A6VH 2YEZB 1CFBA 3OAUH 3ZSSA 5IJVA 5F96L 2CDFB 5JOFA 4Z8FH 3MUHL 3O45B 4M9PA 3MRLB 2ZCLH 2M26A 4YFDB 1RI8A 1KLGA 4YUEL 3VXRD 3G6AA 4B50A 4LCCB 4PJDA 1S5HB 3D18B 2YPVH 3U30C 1P2CB 2H32A 3UX9B 3TP4A 3QXDA 4PJIE 3ZLQC 3IFPB 4HLZH 9CGTA 1I4FA 2EEDA 1JZ3A 4WIQA 1HH9A 4I0CC 4JZJC 2FWOB 5DR5L 5JOPE 2Z91B 3DV6B 4N1EA 1J1PL 1KXVC 5CSZB 1HHIA 5IWLA 1FO0L 1X5XA 3E2HB 5IUSA 1L0XA 4ZPVA 5SWSA 1UM5L 1OP5H 5I66B 4DOHE 1D9KB 5IMMB 3FQTA 2H3NB 4H8WC 1ZHBB 4PTUB 3V7MA 1BQHG 2FX8L 1ZANH 4OFIA 4LVHB 1A6ZA 2NY5H 4LHJB 4NOFA 1OLLA 2WWKO 4X6DB 2Q8BH 3QFJE 3D39A 2IMNA 1KGCD 3KPLA 5GZOC 5IVZA 1RIUH 2F74B 5BZWA 1R3KA 4B41A 5DMIH 4Z7NE 4NCC2 4GRWF 3BW9A 4ZS6D 4YDLC 3MFFB 2VLLA 1I1YB 5E99L 2EDRA 5I1CH 4LARH 4UT9L 3V52L 1T04B 1TVBA 4G6KL 2IH1A 1T21B 1PG7L 1J0IA 4WW2C 5LAXA 2DQFB 2X4SA 4LPTA 3QI9A 5GXBB 3O3EA 2F53E 2NTSP 5IHUL 5FYLD 1G1CA 3TH3T 4L3EB 2XZAL 2NMSA 4NNXB 1VEMA 4WY7H 5ID0A 3SQBA 2R15A 1G0YR 1CICB 5I1EL 3CMOL 1RZFH 5EIIA 1KJ2H 1T66C 3MLUH 3V79C 3V0AC 5DF0A 4X8JA 5IBUB 1TFHA 1SBSL 3GSOB 5E2JA 3SJVE 1HNGA 4QHNB 4HGWA 3FQNB 4P2RD 1YEEH 1HHIB 4KXZI 4L3AA 4FHBD 2JB6A 5FHBH 5JIKA 4NKMA 5F70A 3SDYH 1YN6B 3C5ZA 4JFEB 1SVZA 1KLUA 4OD1H 1A7RH 3DVNA 5F1IA 1OF2A 4OB5L 2ZSVA 4XTRD 3FRUA 4TSAL 4X7EC 5F97E 5D8JL 5B3JF 4P23A 1NFDB 2AJUH 3O3DA 1DQJB 5CUSL 4EUPB 1JP5A 4C56B 2YOCA 43C9B 4P2OC 1Z9SA 4J8RB 1VCAA 3MRHA 1SM3L 1NKOA 5M94B 4NO0B 3PGDB 3KYKH 3J7HA 3RIAF 5JXED 1EXUB 1FGVL 5C08B 4G8GD 1B9ZA 1MCBA 4NHCH 2DS4A 3BSZH 4XC3L 3VFGL 4MVBC 3PIQA 3L3GB 3IDUA 5L2KA 4Q9QL 1ZHLA 1EO7A 1MVFA 4OLWL 3UTZB 4YXLL 3VFRB 1HHGA 4WU5A 4MCYB 2ITCB 3DRTA 3VRJB 4R3SB 2O61A 1LP9E 3GRWL 1H3UA 5TQ2H 1O7SA 5F9WC 3E3QE 4R96B 5I8KH 3O9WB 5C0BA 4LLYA 4JFFA 3B6SB 5CJXA 2DMBA 2X4RB 1IC7L 5EBWB 1EAJA 4QRPA 3VGBA 1DN0B 4DZ8B 2BC4A 3CH1B 4J7RA 5IB3A 3FB5B 1A3LL 2ZOKB 5EIQA 3RVXC 1MCEA 3HE7C 4OUUA 1HH6B 4J3OC 1F11B 2UWEB 5E00A 2VDNH 1GGYA 4GAGH 1UWEL 2F8XC 4R7DB 3O3AA 4XMLH 5EBWA 1NUNB 2AJSL 1MRFH 4ZYKA 3O6LL 1XH3B 4K8RD 4GOSA 4QNPF 3VW3L 1FHGA 1JUFB 5FYLL 1J1OH 1DFBL 4TVSa 5FM8A 2DQGH 1I3UA 4WUUD 1F4AA 2EIBA 5DJZA 4P99A 4LSSL 3KYMB 5EU4A 3GGWA 1AXSA 1WWWX 4RWYH 3V8OA 1OGAA 1QO3A 4AL8H 2WM0A 3GMOA 1A4KA 5DSCA 2XTJB 5T1DL 5B21A 1W72B 5GRYA 3ZHDA 5EUOA 1KULA 4HWBH 3TN0A 4X6BB 1EMTL 2I07B 5AD0A 2YHGA 1QSVA 4YDIL 4H0IA 4XC1L 1MJJB 2ATPB 4QRRE 3ARDB 1M1SA 4K94L 3CH8A 4WGWB 3P4NA 3WLWD 3EOBA 4X83A 1AIFA 3BJLA 3EDEA 2XN9D 3Q6GH 1R24B 5F7EL 1IARB 4EIZC 1XZ0B 3RL1B 1NCAH 1TZHB 1QR1A 1B88A 4NP4H 1JGLL 3CLFH 5GRVL 3IXTA 3MFFA 4JDTH 3ZKNC 3KHOA 4FNLL 4HFWB 4WU7B 5CKAA 5LBSL 5LVEA 3S9DB 1BQLL 4LF3B 3ARYA 1EFXD 2FHFA 3LQMA 1LO2H 5DJYB 4KQ4H 2XG5A 4Q7DA 3HRPA 5IOPA 3C60B 1CICD 4GUPB 4H1LG 5FUZL 1T1YA 2DTMH 3QZWB 4OZHA 3QEUB 3RNKB 4NKMB 3PABA 3FRPA 2F8OA 2F5BH 2W0FB 1CFNB 1SYVA 3O2DL 4HV8B 4YHPB 1YPZE 2NX5D 2IF7A 4DGVH 4P4KC 1QSFA 4ORGA 4NUJB 3DVGB 2E9WA 2J6EA 4Z7QF 2ZPKL 2R9HD 4FZ8H 5TQ0H 1WBXB 4ZQKA 3MV9B 3W0WD 3CUPB 3OKMB 5I1AA 2W0LA 1EVTC 4PJAF 5E03A 1L9MA 1QRNE 3HC0A 5IF0A 4YBLB 4PLKC 4MAYC 5CP3H 1BQLH 2Z8WC 2QSQA 3G6JF 3R4DA 4FQQB 2R29H 1MCDA 1I9RL 3QUYA 1WAAE 3O41A 4ZTOH 2AS5M 3WDIA 3U4BH 5DUBA 2OR8A 4D9QE 2DTML 3AC0A 2AJVH 1PSKH 4UT7H 3RY6A 2ICEA 3FB8A 4D8PA 3IFOB 1L6ZA 1TVBB 1NC2B 1ZANL 4X7FC 4Y4KC 5KJRL 2H1PH 4GRWH 5SX4I 3VI4E 3MUY1 3WE6B 4H1LA 1U3HA 2OX5A 4JM2A 1R3KB 3NVQA 1DANT 1T5XA 4PGDA 4HQQH 1C5CL 3X3FH 1P1ZB 5KG9B 2XQBL 3Q5OA 4ERSH 1Q0YL 4DQOH 4D8PB 2IAMD 4CJ1A 5IKCB 1MQKH 4O2EB 3LAFA 1BZ7A 4U6XB 1G9NL 2AK4E 2ESVE 3WS3B 2XWTB 4DCQA 5JW4Q 4WHTB 4POZD 4OF6A 4KMTH 1ULVA 3FFCB 4H26B 2HFGH 2HTKC 3GJEB 1MFDL 2CLVB 5D2LE 3X11B 2YUXA 3S4SG 3QAZB 1WWBX 3ARFB 4NO3A 1ES0A 4HXAL 1A9BA 2A77L 4WENB 2R29L 1WAAF 2B4CH 3FFCA 4HXAH 1J0HA 4U2YA 1B0RA 5IHBA 1QVOB 1S9YA 5F9DC 2HRPH 1WC7B 2BNQA 4Y7MA 2VXQL 4LDLB 3HR6A 1TJGL 2QJDA 1S7RB 3T65B 1RZ8B 1WEJH 4RGMB 5C0BE 4F7TB 2AEPH 1A7NH 5DUPL 4RA0C 4ETQB 4Z77A 3DX6B 3IGAB 3K4ZA 4LRIC 3OKOB 4QHKI 4YHZL 4NQTA 3D85B 3WN5B 1N0XL 4JFED 4URTB 4OKDA 4G9FE 4JM2B 1P9MA 4U1IA 3JTTA 4P49A 1QLFA 5I74C 5FOBB 4S1SL 5C0DB 1JTPA 3KPRA 1F13A 4L8SA 5IEKA 4KVCH 5DA0B 3R8BB 3WUWB 4JFDD 4G42A 1C5CH 1L7IH 2CXKA 3BPCA 2ADFL 4MNGA 5D8JH 2JIXA 3B5GA 4OD2B 5FA3A 3AM8C 3EDDA 3FQRB 3SCMA 1NAMB 1D5ZA 4UZGA 3BDXA 4O2CA 5JR1H 2YPLA 4OCWH 3QPXL 3KDMB 4PUBH 3W5NA 1FCCA 2YK1L 4X80H 5I8OL 4WFHD 4MA3B 3MBXH 4L8SC 1MCOH 2NNAB 2IPKA 3G6JE 1OPGH 4IBLT 3S36H 3T0EB 4UOW1 1BEYL 4FABL 4XPGL 3VGHA 4Q9RH 1JRHI 2R0ZH 25C8L 5IFJA 1V5JA 4A2LA 4ODVL 2ENSA 1IAIH 3QJHA 2HN7B 1WQVT 4DUVA 1TITA 1JHKH 5C08E 4Y5YB 3KYOA 4ZSOE 5FHBL 1T03H 3OQ3B 3O9WD 4IMLA 4CW1A 4YQXH 3FO0H 3I6KB 3DV4B 3NCCB 2DJUA 3SY0A 5HVGB 4OFKA 2NY0C 1S7WA 4NQDE 4LRNL 4R7DA 3SPVA 4IHOB 1A14H 1BBJB 3JWOH 3HNTH 4KY1H 4O2FA 1FPTH 3BPNB 4HFUH 4Z0XB 4D9LL 2X44D 5BRZA 3OKLB 1CIUA 3STLA 4P5KB 4FFZL 1MCWW 3E6FB 4KRLB 1FG2A 4XXCC 4X6DF 2EH8L 2BCKA 4JAMA 5H2BB 5DVKA 2H8PB 4RAHA 3IU3A 2OJEB 5LQBL 3OKDA 1EX0A 2J8HA 1Y18B 4X6CA 1E4XL 1C08B 2BFVH 3LN5A 4TUKL 1FL3B 5F7EH 5FGBC 5L6YH 1JHLH 4I3RL 1OAQL 1MFDH 5BZDB 3QO0B 4DAGL 3HI6L 2Z8VC 2VLKD 1OSZB 5D7KD 3NGBC 1B4JL 3EOYG 4I77L 2VABB 3NFSH 5IB1B 1XFPA 2GJ6E 5EU5A 3VFSB 4WI7A 4XPFH 3MUZ1 3QFJA 4GFTB 4CMMB 1S7UA 3WEXA 4KRPC 3LKPA 2DN7A 4BFGA 2ADJB 2IC2A 3C5ZD 4UT6L 3ZSTA 3T0ED 3BZDA 3PGDA 1QSZA 5D72L 5BOPA 5DRZB 4NQCB 3QIWD 2UVFA 5GSVB 5C07E 3SQOL 3ECBB 3RKDD 2ZG1A 1IBGH 1IM9A 1KV3A 3QFJB 3N50A 1FBIH 4WI9A 5FUOH 4LCYB 2B0SH 3DXAA 5GQBA 3ZL4L 5IFHL 3GIVB 4LCWB 4HLZG 2BDNL 2FZ3B 5IBTH 2JJVA 1T2JA 3FRUB 1Q1JH 1KC5L 5C3TA 1RJLB 3QI9D 5AUMB 1KELH 5GGRA 3GKWL 1L9NA 4E5XA 5IVNA 5D71H 3OF6A 4YHKL 5DD3H 5KTEH 4JDZB 1T5WB 1URLA 4GAYB 5F7YC 3WMSA 1OOAA 2PR4L 4UQ3B 3MRJA 4HUMB 3LV3A 5I0ZA 4OGAD 4IRZH 1R5IB 1SHMA 4PY7A 2YKLH 3E6FA 1QNZH 1X5GA 4KH2A 4OF8A 3ZDXF 1P4IL 2FBJH 2IFFH 5C8JB 1T7ZA 5BV7L 3D25A 3QXTA 1GOGA 1PD6A 3ILPA 3MRBB 3P4OA 4LAJH 1IAIL 1SBBA 4OT1H 4JPIB 4AT6A 4PJ5E 3K2MC 4JRXB 2VDKL 5DRXB 1Y0LB 2JK5B 4JZOA 1J8KA 2B5IB 4GRLC 2VJXA 4M62H 3O3EB 1IKFH 5GHWL 3TIDA 3V4VH 4F3FA 4JHAH 5DI8A 2QQLH 2IH1B 4I5BA 5DA4A 2BVQA 1NSNH 3CK0H 4O58H 2A9NH 1LO2L 4WFGE 2XA8L 1AQDA 4P4RA 4XPGH 4MS8C 2XV6B 1S7TB 1MH5B 3PJSA 2O5YH 1H8OA 4KKLC 1MY5A 4PJ7E 4QHNA 3C9NB 1BBDL 2L7UA 3HA0A 4OCLC 4JVPA 5DD3L 2VLJD 5K9QI 2R1XB 1NBYA 3GSNH 4LCUB 3RKPA 2VLJE 4E0RA 1KIRA 4I0PB 1GZQB 1HNFA 4S1QL 1RFDL 1ZLWH 1GAFL 4LKCB 4JHAL 4H20H 2BHYA 5C09B 2G9HB 1U8MA 4JHWL 1L7IL 1U8IA 2R2BB 2GIYA 4HPOH 2HT4C 5D7SH 4XX1G 5D93C 4FQIL 4GSDH 2GTZA 1G6RB 3MRGA 3BIBX 5IVXB 2CMRH 1EHNA 1P84K 4YDJA 4ONGH 2AEWA 3C6LD 4D0CA 1YUHA 1Z0NA 2EDHA 2A9MH 1Y6NR 3KLHC 2H9GA 2ZKHH 3ARDD 1TJIH 4AMKH 4DZBB 4YH6A 4ZFFA 5AWNL 3O3DB 2WBWB 32C2A 5MP6L 3BW9B 3S88L 1EJOL 3HR5B 1ZLWK 3G5VB 1RUPH 1FVDA 3MCLL 4YK4C 3RUGE 2WBJB 3ILQD 4JVWA 4F9PC 3A67H 4OM1L 3T0EE 4G5ZL 3QUYC 4RSVA 5F1IB 3N06B 4JN1H 1S7QA 2DKSA 5D1ZC 4KU1A 3RX5A 1QBLL 1FN4A 3WIHH 5MEQB 5C0CE 1KSRA 5I71C 1VFMA 5BRZE 4TUJB 2MOVA 3LHPH 1KEGH 1CGXA 4NZRH 3IDXL 3ZE0F 5EU3B 3C8HA 3H9ZA 4YXHL 1U6AH 1H5BA 3QEQD 4OZGB 3FOLB 4NN5B 4FZEL 3GIVA 4LCWA 5JUEL 1JNJA 3JWOC 1I3RB 4RFNC 5DRWB 4ODHH 2AXGB 1GGCL 4ODTL 3S35H 3H7BA 1RJYA 3ARWA 1AP2B 5ID0B 4F8QA 1WICA 4YZFE 3VXMD 3D0VB 4ODVH 1MIEH 3WKML 1RZKH 3LKQA 2ZUSA 3QDGB 1UVQA 3IS0X 4OAWB 4P2OD 1G7MA 1XF5A 2YMXL 3NZ8B 1NJ9A 1JHKL 1QSFE 3X12B 2I26N 4ONHA 1QRKA 1MEXH 2YXMA 3W11C 3EO1A 4HIEB 1CTNA 1CDHA 3D3VE 2FEDC 4HUUB 4RNRB 2UWEF 1RK1B 1DLFL 7FABH 2HTLD 2NY6B 3OPZH 5A40E 4ZOEA 2QADB 3RU8H 1Z9OA 1JPST 5FYLE 3VH8A 1DQDL 4KKBC 4MB3A 3BVNB 5EUOB 4HWBA 2Z92B 1R5VA 4ZXBC 3HI1A 1P7QB 5IGXH 3GSRA 2DQUH 3I3EA 1CD9B 1AGEA 3CC5B 5TE7H 3VXSE 2L7JA 1ADQA 5B38A 2HH0L 2DWDB 4NQEB 2YUZA 4HC1A 2I60L 3HUJE 1TMCB 3MRHB 1JNNL 2WUCH 2DQEL 3THML 3JSSA 4UU9A 5D6CA 3PF2A 3G5ZB 4X5WB 5FO7B 3SGDI 5GRJL 3TO4D 4EI5A 3BPNC 3DGCR 1I9IH 3BEVA 4X4XB 1RZKL 3WJJA 4PJDB 2X4QB 3SDCD 4DKFL 5JW5B 3TBSA 4XRCB 2AJYL 5EG6C 1S3KL 3P73B 2X42A 3ECBA 4K8RC 3TEUA 5AG8A 1LO3H 1U8JB 5FGBA 4L9DA 5I1KL 1GYAA 4ZXBB 3DUSB 3MJ9L 2A83B 4Y5XB 5E8NA 4QRUB 2KZWA 4XP6L 1BGXL 5FGCB 2EE6A 1DDHA 1EEZA 1A4JA 2AERT 1NMBH 4X7DC 4CADA 4Q9BA 4DN4H 1FSKB 4I0KA 4J2XA 3K4DA 1FFRA 1MSPA 1AXTL 3PHQA 4FQLH 3BKYH 2E8YA 3BDYL 1AI1L 2AXHA 2CR6A 1RSFA 2GT9A 4OM0L 4N90E 1OW0C 1NCBL 1UEMA 1PG7W 2Q3ZA 5DHYB 5CLTA 4FZEH 4RZCB 4D9RD 5JXAL 1B4RA 4LCWE 4PJ5D 5EBLB 1D5XA 4XP4L 2AJSH 3UEZA 4K71B 3QCTH 5F21B 4MHHI 1RURL 3B9EA 5JHLH 3DTXA 3AS1A 3LQAC 1JGUH 5FYJH 4EUPA 3K81A 3G04A 1RUAH 5E6ZA 3EDJA 4M8QB 1XF2B 2Q7YB 4DK3A 1KEML 3FAWA 4U6VH 1BBDH 5E9DE 3DROB 2AK4D 4R0LA 4P46B 3BDYH 5HYQB 4J3VA 4ZDHA 5FYKE 5F89A 1JHTA 4QHUB 4XX1E 4M5YH 3EYQD 4F8TA 4R4BB 4H20L 3QULA 3KR3L 1Q0XH 5J89A 2QSTA 5DURB 1NC2D 2QQLL 2JB5L 4ZUWA 4KHXH 4IRJC 1LK2A 2XN9A 2FEEL 3VGGA 3BH8A 2BVYA 5I75C 2R1YA 4B7LA 4PJBF 1MH5A 2C3GA 3U4AA 5D2NC 4XH2B 4YX2L 5TDNB 4MD0A 5ERWB 3TZVC 3E8UH 1OTSC 1TZIB 4LSTL 2CK0H 2ZUQB 1ZLSL 4ALAH 5ACZB 4GXVL 32C2B 3QWOB 5I0DA 4AIZA 3UTTA 4WI4A 4JFHE 4PRIA 3I3BA 1HN1A 1ZE3C 3QDJD 1KYOK 2DM4A 1RU9L 2J88L 4M93C 1IAKB 4NGHL 1OT2A 4KWUA 3TPUB 2FX7H 3VXSD 4C4KO 1CVSC 3QQ3B 7FABL 1WFTA 4JFEA 4JFDE 1NEUA 1KBGH 5GISL 5IVXA 1IGFH 4JREC 1JZ4A 3CZJA 1MCNA 3EGSB 4O9HL 4JM2F 4JZJB 2DLEA 2HFEB 4JPKH 1Q0XL 4PR5A 4JO2H 1OSPL 2V17H 4CNIA 4G7VL 3O3BA 1OLZA 1DBMH 1X5JA 4NT6B 5EOCL 4GLRI 1FJ1A 3DRQA 3MCLH 4TUJA 2CJUL 3IETA 5DGRA 4Z7OE 2I5YL 3TJEH 1H3VA 1CDGA 4YEFA 1EO8L 2OQJA 3MJ8A 5EU6A 4AL8L 2CKBB 2XTLA 2JE8A 4BZYA 1M7IA 4XHJC 1FJ1B 2X10A 2Q86B 2B5IC 4DCQB 1P2CA 4WDIB 4XVTH 1HILB 1U8KB 2X9WA 5J6GB 4LCCA 4KUCF 4XVJL 3ELAT 1QBAA 1EEYA 1VERA 3EFDL 3FB7A 3OZ9L 4YIQB 3CIQA 3IDGB 4WJ5A 4K55A 1F58L 5BO1H 2IALA 4L8BA 1JGEA 1UA6L 4ZUUA 1TZGH 4PREB 1G6RA 5KOMC 1OT1A 2V7HA 3GB7B 2R69H 4HS3A 4JFQB 3WNKA 1MPAL 3U7AA 1DBAH 4LSRL 1P7QA 3V7AE 3FO1A 5E4IA 2EZ0C 5I16A 4JPIA 4AT6B 4RISH 1CK0H 4HBCH 3IDIB 5IBLC 3BP6B 3P0GB 2EDQA 1K2DB 3OAZH 1N8ZB 1ZTXH 4LLWB 3VWKC 4EEEA 3UZVB 1VFUA 2CKBL 4YR6B 2QQQA 2XXMB 3QO0A 1AH1A 5EU7C 4YUEH 1Z3GH 5I1GH 3HRZB 4YHOL 1MAJA 2VOTA 5F7NC 1FL3A 3ZE1E 1A7PH 3QHZH 3P11L 2B2XH 3MRCA 4ZOAA 3EHBC 2R4RH 2PW2A 3BH9B 4Z7VF 4LLVB 3BIAX 1FGNH 4HS6A 2A73A 2GJ6A 5JORB 4CU7A 1AQDB 4CN1A 4ELKA 2EYSA 3AREC 4K3DH 3DVFA 2XKNA 1JRHL 3ARTA 2GJ6D 3IKCA 4U33A 3VE0A 5DJDB 5I2IB 2EIZB 2W9LA 2GY5A 4FXKA 5EIVA 4HMCA 4N8VG 3HNTL 1FO0H 1M71A 4O4YL 4NN6C 1TVDA 4NQCA 2KQMA 3QG7L 2F9BT 1CLZH 4PYGA 1GGBL 4JQXC 2FSEA 4LCYA 4OGXH 3VJ6A 1AGFB 2ERJB 2AEQH 5HYQA 2XRAH 4GJTB 3TT1L 3TN0C 2YPKB 4QTHB 3VFOA 3DV4A 5A1AA 1CWVA 1I7UA 2VZTA 3LKNA 3MC0A 1SJVA 5TH2B 5BMFL 4KDTC 2V5TA 1FLRH 5T3ZL 2OM5A 5J13B 3RIAK 5INCB 5IB1A 2YZ8A 3PWPB 3IAQA 4JFEE 4ZFOB 1A6AA 3MUJA 1OTSD 4DEPB 1H5BC 2OZ4H 4M1DH 4OGYH 5F8QC 3SDAB 3V6BR 3U30B 1K9TA 3TCLA 1TQCB 2HLAB 2F54A 2VDPH 1AD0A 6CGTA 4UQ2A 1NCWH 5IT2H 5JHDA 2XPGB 1RUMH 4JFYA 4WW2A 1C08A 4BQBA 4TVPL 1BF8A 4I3SH 1A3QA 2FLRT 4JCLA 4PJAE 4X6BA 4C56E 4WFHE 3PWLA 4AENA 4RRPA 1T1WB 4B5EA 2BY2A 4L5FH 2OJEA 2NXYC 4PGBB 3MRFB 4LSUH 4M7LH 4AH2B 4HS8L 3U0WH 4M6AA 3M8OL 1CXFA 4HCRH 3LRHA 4JFZH 3ZDYE 5FF6B 3LQZA 3BQUA 4PRNA 4G6KH 3UYRH 1WGOA 5L8JB 3MCKA 5KANG 1PX4A 5IV2A 3VG9C 1VESA 4YHZH 1YEJH 4KZDH 3N1FC 4ODXA 1EDQA 2CLRB 1LO4L 5AZEH 2PXYB 2FGZA 2YPLD 2VNCA 1MPAH 4PRBB 4X9HA 4XHJD 3LH2L 4KVCL 4WO4A 3RDTC 2VABA 1LE5B 2N7BA 4F2MA 2FJHB 1M7IB 3OB8A 2HVKB 4P9MH 2V2XB 2DYPA 5SWQB 1E28A 1FNSL 5DJ6B 3P3YA 5EIIB 3HCVA 4P4RB 3W81A 4NSKB 2VZ1A 3R06A 2E8ZA 1TNMA 1KACB 3VFRA 4UT6H 1FO0A 5DUMH 1AFVL 1CL7I 4K71C 3WNLA 1A14L 2H45A 2A6DB 3GJEA 4WCYL 3V0VB 4PJ8A 3AXLB 2ZWLT 5DD1H 1BQHA 3EBAA 5ISZA 2D31A 1DQQA 3TA3D 2Z8SA 1I7RA 5LKNA 2EH7H 1D5IH 2EZ0D 4YNYB 4Z9KB 4NC0B 5B3NA 5E24E 3TYGH 2J2ZA 3BZFB 4MNQA 3BXNB 4GRLA 4MD5A 1XF1A 1NEZB 1JGEB 2DJ4A 4YDJB 2X1XR 2AGJH 3SPVB 4FXLA 3EO1B 3CFBA 3ZMRA 5L6YL 4YIQA 2X05A 5HVHB 1JNLL 4AIXA 4LCIH 4F33A 4JREB 2NY1C 3DX6A 3IGAA 4LU5H 3CXHK 3EDFA 1FZKA 4G8GE 5H35B 5KAQG 2FIKA 2EE3A 1IJ9A 1F4YL 3LZFL 5L2JA 3H42H 3ZYZA 2V5MA 1IQDA 3L5WA 3U9UA 5IVXF 3EOAB 3VMOA 5DZOA 1J05B 4NKIH 4APQB 1LE9A 4LPWA 1FVCA 4NKQB 3AFLA 1HHKB 5AYUL 1K5NA 1NAKL 4MJIA 1RZ7L 2DQIH 3BH9A 5GGTL 2VQTA 3C6LB 5HHPA 2CD0A 4AYFA 2APWA 2VXVH 2OTPA 3LIZH 2XY1A 1Q9OA 3B9KB 4TVPH 4XI5C 2AJXH 4FTVE 1KCKA 4PRIE 5E1AB 5LG1A 3TO2A 3WNOA 4OZIE 4ZUWB 5I8CA 4FTVD 1KB5H 2BRQA 1OAQH 4I3RH 1ZLVK 4Y4FD 3TT3L 4LPXA 1A1OA 3V5HB 3SKJH 2P43B 2B20A 2PKDA 4FTVA 5I1DA 1C12B 5I6XC 4OZGF 3MRPA 4U6HA 5BXFA 5T3XH 1YEFL 3O2WL 4V1DB 4YO0B 2CQVA 2ADGB 5KS9B 3QUXB 3OKNA 4RWHA 2VE6A 2GUOA 3PP4L 5CLWA 5EO0B 2OR7A 2BVEA 4JY5L 5IWLC 1Z3GL 3MLSL 3UJTL 3UTTB 4PJXB 5I15L 4IMKC 2YA0A 3BO8B 2VXTL 3RWDB 1JWMA 1DQMH 3MGOA 2ESVA 2AK4A 1D3CA 3HTLX 1DANU 2BVTA 3FZUC 4N9OB 1IVLA 5DYOA 4FNLH 1M4KA 3SGEH 2ESVD 4RA3A 5MEOB 4QRRD 2QBWA 1VSCA 2AV1B 1N5AB 1G9MC 3NIFF 1XEDA 2XWJA 1D9KA 2DAVA 1CK0L 2KQNA 3IB4A 4KUZH 1UCTA 1I1FA 1ROWA 2AEPL 2KKQA 2P7TB 1I7TA 3RWGB 4MX7B 5HGAA 4LLQB 4FQPA 4UT7L 2VXTH 1NGXA 5MP6H 2Y5TA 4Y88A 5C0BD 4OQTL 1XGTA 1H3TA 4Q6IC 1MCLA 2AP2A 4ENEC 1G7HA 1V7NL 1YC7A 4XRCA 3BI9X 3MV7E 2PXYD 3IKCB 1QZ1A 1MVUA 12E8H 1HZHL 3RL1A 1KIUA 4P9ML 5FCUH 1AIFB 3EFDH 5E6IA 2KPNA 1VB9A 1OP3H 1KTLA 1GVIA 4IIQC 3T0EA 2ARWA 5EDXA 4LQ1A 2Y5EA 4KPHL 3RU8L 4NQVB 5KSVB 2O5XL 2FNBA 3HB3D 1S9VA 5CJQL 4L8CB 4PJDF 3C6SB 3ORJA 3WCYA 3BZEB 4FQQA 4TUOA 2CRMA 2NLJA 3BRFA 1QACA 1YYML 5JXEA 5TDOB 1T6VN 3REWB 2D9CA 1RV6X 4Y5YC 5BVPL 4M9OA 4ZXBD 4GBXC 3SKMA 3IT8D 1M7DB 3GMLB 2XIDA 2A1WL 2H8PA 4JFFE 5DJZB 3VFGH 2IAMB 2LABA 3TBYA 1MCSA 2DQHL 4XMKH 3F7VB 5HSFA 4LHQB 4KZDL 3VXRA 4CRPA 1MF2L 2OTUA 5C0CD 3VGAB 4OLWH 1JGLH 3K2UH 3EYOB 5FUCC 2ATKB 3EW3B 4JDVA 1H9VA 3WFHA 1F11A 3AY4C 1DBBH 3KYAA 1KJMA 3HS0B 4PGCA 1VACB 3ESUF 1ZT1B 4R9HA 3SEPA 1OL0A 3O6FA 4PJHB 3CFDA 1YEFH 5ANMA 5T1LA 5D7SL 1Q9WB 4FXKB 1K8DB 4FABH 1MLCA 4J3SA 1NDGA 1OY3B 3MX0A 5DK2A 2FEEI 25C8H 3DUHA 1RZFL 4NNYA 4R26L 4UIKH 4WRLA 2X4UA 3MRKB 1WK0A 3BWUC 2O5ZH 3FRPG 3I75A 5D7IE 3IAPA 4JFZL 1BIHA 1RIHL 4IS6B 2GSIB 2XZCH 3EFFA 2DLTA 1UXSB 5FDWB 3OL2A 4QYOA 5T1KA 1J1OL 4NQSB 4ZUVA 2O61B 1U92A 3NIGF 4L3CA 1NFIA 4P3CL 3UTZA 3TWCL 5D7LB 3LDBC 4QRSB 2NY0B 5KZCB 1JV5B 4U7SA 3GK8H 4OLXL 4HKBA 1WZLA 1JYWA 1BAFH 5L8LB 1YEHH 4MNQE 1YEKH 2VZVA 3QDJE 3MOBL 3PL6C 3MZTA 5DJ2B 3EZJB 2P44B 1EK3A 4HAGA 1S7XA 4FFWD 3RRQA 5IB2A 1V3KA 4MXVE 4XVUD 1GC1L 5ISZE 1Y6MR 5E2UL 3LPWA 3UXFA 3FQWA 4PJBB 4P23B 3CDGA 4KMQA 2IAMC 3LB6D 5D7LE 3OX8B 43CAB 4ZTPH 3WN5A 5I18L 5K9KB 5TF1H 4PRHA 1KIPA 3H9HB 1A9EA 2QQKH 4O00A 5BRZB 1B3JA 1RZ8A 3UDWA 2D7PA 4GT7A 3MROA 4PJIF 3RDTB 5BZWB 1VACA 3Q1SL 4ONFH 3DXAE 4F7MB 2V5RA 4YLQT 2GK2A 5DD6A 4TSBH 3RVTC 3VW3H 3DVIA 2HJKA 5K59E 3OKMA 2HWZH 1RK0B 4AEIL 5KTEL 2F8VA 5JXAH 3C5JA 5DQ9B 4LLMA 2C9AA 3U83A 3QQ4B 1NPUA 5I1IL 5DFVD 4Q97A 1YY9C 3GSRB 1YY8B 3EOAA 3MA9H 4LLMB 3GSNL 2GEEA 3GBML 5MENA 4S1RL 3BUYB 5F7FA 3UTQA 2R0LH 4S2SA 3VFUA 1RK0A 1ORQA 2MMXA 3IF1A 3VD7A 4U6YA 4M1GH 5CZXC 2R2EB 3MOBH 4OIBA 1DSFL 3LDBB 5D1ZA 1HK6A 5JMRA 1BHGA 3GMPB 4Z7UA 1S5HA 3D18A 3HZKB 4XNQA 1EEYB 3A0OA 2C7UA 3RY4A 1DR9A 4X6CE 3RP1A 5DHXB 1OVZA 5J6GA 5I8KL 5DMGD 5JHDE 4YXKH 5TDPA 4P59H 3CX5J 5DJCB 1NGWB 3B83A 3ISWA 2F19H 4X98B 2A0LD 4JO2L 4HWEH 1NC4D 3BAEL 1PQZA 1SY6A 1XGPB 1JYXA 2UVEA 1AQKL 3R06B 2ZUQC 2EDFA 2XWBA 2DICA 3MV7B 4A6YL 1AQKH 1OTTD 1NFDF 3GMOB 3LKRB 4RMTA 4X6DA 5IIEB 5CSZA 4DN3H 4LEOB 5CEYA 3ZKMD 2Q7NA 3V5DB 1IGYB 2P5EE 5MEPB 4NGHH 4PJ5A 2YRPA 5MERA 3QDJA 2P1YA 3IFNH 3U6RA 3QXDB 1T20A 1N5AA 1X5FA 3O3AB 4P5MA 5MEOA 4OJFL 2FL5A 2V6HA 4I13B 3VRIA 5DD6B 1SEQH 1XGUA 2CLZA 1WIOA 5HYSB 2WBJA 3EO9L 5DI8B 1FNGB 3MA7A 2VRAA 4HFWA 4WU7A 1NMAH 4RAUA 4YAQA 1KCRL 4XP4H 1A6PA 1T3FA 1CL7H 4X5WA 2JK5A 2B39A 4MQSB 4UV4L 1CD8A 3IVKA 5F6IB 1QTYT 5A2FA 2LE9A 1UM4L 2ITCA 3GSXB 4OF3A 3EJZC 2DQDH 2Y06H 2R0ZL 2ATPA 3TBWB 3O11B 4AQ1B 5DJ2A 2E5EA 4UI2A 4BM7A 1EPFA 1ZLUK 4M7JH 1CXLA 2VITB 4L3CB 3QUZD 4KDVA 3RI5F 4H88L 4LDOB 2B2XL 3QIUD 1MUJB 3PHQB 3PXHA 4LKCA 12E8L 4WO4C 1NFDE 1DCLA 4Q6IB 5AZ2L 3REWA 2YPVL 5DS8A 5C07A 4IOFC 1ND0B 3LVEA 5HGGS 3BISA 4KKNA 2NLJB 4TQEH 3QULB 2C1PB 4MJID 1SEBA 5HGHA 4FQXA 3DECA 3ROLA 1I4FB 1HCFX 3S88H 1OQXA 4KKCC 4FFVC 1JPGA 3RKDC 3I85A 4BK4A 1DQJA 5ITBH 1J0YA 3BPOC 4OM1H 1A02N 1WIPA 2EH8H 4NNYB 3RVTD 4PV8B 1I9IL 1KXQE 1X6LA 3QAZC 4HZLA 3H3BC 4JY4B 5DJAA 4M6NL 3QRGH 5D2LA 1UCBH 2JJSC 3GSUB 4AMKL 1H15A 2B0SL 3SE4C 2CKNA 4WEBL 1XGQA 5F96H 4WWKA 4HS6B 1UWXH 4NQED 2R56L 5FOJA 1QSEE 3JV5A 5E2VL 3JUZA 3WL9B 4UT9H 4HIHB 5F7HA 4M7JL 2IANB 4W6YB 1VPOL 5K9JH 1VFBA 1Q9LA 4PJ9A 3VA2C 2WIMA 1IGJA 1OSZA 4HW6A 3O6KH 3VXPB 1NGQL 1XGYL 4LHUA 3QHFH 3RVWC 3C6SA 4LVOB 4N1HB 4OV5A 3UTOA 4ZSOA 4HJJH 1KJ3L 2MCPL 5CUSH 3PP3H 4M02A 3TYFA 4S1QH 5DMYA 3TFKD 2QKIB 3THMH 5IR1A 1T4KB 3N1GC 4B0MM 1T7VA 1J12A 4K7PX 4PRPE 3X12A 4OT1L 1U8NB 5JO5B 4MNHB 4HSQA 1GZPA 1U95A 1G7MB 3T4AB 4JANA 4XAWH 5H94A 1BBJA 3QP3A 3MRGB 4OGYL 4G6ML 5FYJE 1LGVA 2Q3AA 2Q86A 1UC6A 4PBXA 5C0DA 1K6QH 4TNVF 5E1HB 4O02L 3EOTH 1JF6A 5CD3B 1FAIL 2GI7A 3D6GA 1AGEB 5C6PB 4MNGE 5GZND 2ICWJ 2ZOKA 1FNEA 1JRHH 4OZHE 5DT1H 3ZKXB 4PB9L 1PKQE 5EO9B 1LQSR 1P4IH 3GMLA 1EHXA 1VGKA 1N6QH 1DBJH 1I1FB 4HHAA 3QXAA 5DT1L 1DQDH 3VH8B 1V7ML 1D6VL 1MCIA 3O6KL 4N0UB 2BDNH 4GAJH 4RGNE 1JZ8A 3MRCB 4JZJA 5E9DA 4MB4A 3MRMA 2GITB 1JGDA 2DJSA 3CSBA 5D96C 5KSUB 1JTTA 4HJ0C 3VRJA 5KSAD 3KGRA 3X11A 3NTCL 4L8CA 4DKEH 4NNXA 2WK2A 3BYTA 1OAZH 2CUHA 1NBZA 1KTDA 4OZIA 4LFHD 1IQDB 1YC8A 5DJCA 3VMNA 2VXUL 2V9QA 1BPVA 3LQAH 3TPKA 1GPOH 1JWSB 3VFNB 4FA8A 4YK4B 3ARDC 1ZT4A 1ZVYA 1J1XH 4C57C 2VXUH 2FCBA 2XQYK 4BKLA 3TBWA 3LH2H 5KG9A 4MJIE 1YZZA 4QF1B 3GSVA 4WO4D 1T83C 2VE6B 1QEWB 2XQYG 5BJTA 3CD4A 4Z6AT 4PP2B 1HQ4B 3GSVB 3KPPB 4YO0A 2P47B 3WFBL 1HEZB 1U8IB 2R2BA 2BRRL 5I8CB 1Q8MA 4J1UB 3RUGA 5IQ9A 2P5EB 1J11A 1L6XA 5F1NB 4NIKB 2BSED 3TIEA 1JHLL 4G9FB 3QUYB 2VL5A 3RJQB 1F4HA 5EORH 2CDEB 4RMSA 2Z91A 3DV6A 1HWHB 2RHEA 2PYEE 4PJXF 5C09D 1YNTA 4ONGL 5MERB 1NFKA 5HHPB 3QEHB 4XZUB 3MBED 3TIEB 2GJZA 4EI6B 2IPUK 5J6HB 3VXQA 4YR6A 3F58H 3IU4H 5E7BA 2HYMA 4DAGH 1G7QA 3OKKA 2WBKA 3HUJA 5IG7A 4LEXL 5FA3B 2CDGA 4FS0A 4IRJB 1QEWA 2QSCH 4PRNB 5ICZA 3QJFA 2ZNXA 3UJIH 3VDAA 1T1XB 4Y4HA 4U6HB 4GKNB 2VLRD 2ZPKH 4RMWA 3FCTA 1I7ZB 4GAFB 3BDBA 2OLDA 3EZ8A 2YBRA 4NUGH 3PQYD 4AY0A 3CFJA 3L95A 2QEJA 5I1JH 4O02H 1Z5LA 4JCMA 3D3VA 5KSBF 3DARA 3HI5H 1EA9C 2CIIA 4LKXB 4LPYA 1B0RB 5HY9B 2X7LB 4OV5B 3QEHA 4XZUA 3KYNB 4OD3L 3TZVA 1UM4H 3EDKA 3NH7L 3DUSA 4OD3H 1IC5L 2O93L 2XN9B 2FO4A 1NGZA 2I9LB 4K9EC 2VL5B 3CGTA 3EIFA 1OCWL 2A6JB 1NGYA 5HHMB 4UDUA 3P0YL 3P9WB 4PJIB 4U6TA 4R4ND 5BOZG 2W9DL 4FZ8L 5DQ9A 3QCVL 4MQ7A 4KJYB 4RGND 4IHOA 3KPOB 4KJWC 3U79A 1PZUB 4KHTH 3MRRA 1U8PB 5E6YA 2J5LB 2PUQT 1E4KC 2HG5B 5ELIA 3ARGC 2VUYA 4F33B 3IXAA 1WCQA 1N64H 4PLJD 1DVFD 2FSEB 3H6JA 4EI5D 4JDVB 5GRUL 4CVXA 5E2WH 3MRFA 4MA1B 4ZS7L 4AH2A 3D25B 3VD5A 1T89A 3GBLA 3LKPB 4MNQB 1QR4A 4PS4H 1EO8H 1RY7B 1BZ9B 3EAKA 5CHNB 4XMPL 5JIPA 3MLYH 1G7IA 3KJ6L 2CIKA 2A77H 3T0VA 3GHBL 1SYSA 1CU4H 1RZJC 2EEBA 1DBKL 1GIGH 5ESQB 2NY5L 2EDLA 4H0GA 2JJTA 5JIHA 2CH8A 5JW3H 1KCLA 1A7BA 5CINL 4NQCE 3S97C 3W9DB 1X5YA 5LXGH 3VXPA 2BOBB 1A22B 4Z7UE 2UZYB 2XQBH 4ERSL 1EHLH 4FQCL 1LHZA 4YXLH 2GITA 2NY4B 3OZ9H 1RZGA 5C0RL 1OWRM 2XKSA 1BM3L 2HVKA 1FFOB 4MA8L 1A6AB 1IFHH 3WD5L 1XF5B 3NZ8A 3T77A 3DURA 3ZT5A 3L3GA 1Q0YH 1WSST 5IMKB 3KPSD 3ARVA 4XNMB 5KS9E 2FATH 3MPCA 3LKNB 3SDCB 4OTXL 1OB1A 4MXVF 4HK0A 1FDLH 3OKLA 4ZYKB 3LKSA 5DD5L 2VLJA 3BKML 1MFAH 4PJ8D 1T1YB 3MLZH 4N1CA 4U1IB 1LNUA 4NRXA 2ZG3A 3IDGA 4BQ6A 4J8RA 3P73A 5SWSE 3TESA 3OKOA 2AJVL 1IGTB 3BKJH 4PJ7A 4WTXA 5FHAH 5HHOA 1QLRB 2NY4D 3LRSA 4FQIH 2P4AB 5EOCJ 4YBQD 1BM3H 1C8PA 1S5IH 2IBGA 1KJMB 3HS0A 4PJIA 2XZQL 4LLVA 5L2KD 2X4NB 4G9FD 5BQ7B 3KPSB 1CLYH 1PG7X 2WLYA 4NBZB 1KJVA 4NOBA 1T89C 4QLRA 3RAJH 4YHNA 3VXRB 1KUMA 1U2CA 1P4BL 1QBML 5BW7A 1GCFA 1DBML 1F97A 1JIBA 2DQTH 3FO0L 3BT2L 1YYLL 5E8DL 3RGVB 4KK6C 5H2BA 3TVMD 1A47A 4NWUH 3BP4B 4U6VL 3V9FA 1EFQA 5J06A 3EO0A 4HFUL 4L8BB 2XZQH 5MEND 3BP7A 1BJMA 2ADGA 4XC3H 2E9BA 3CVHB 5DFTA 3QUMB 3WLWC 1XIWA 2X9XA 3GSQA 4H8WL 5GRXG 3VWJB 3F7QA 1RUKH 1SBSH 3MRPB 1WZ1L 4BQ9A 3NCBB 3B5HA 1UVQB 3QHZL 1OGTA 3RY6C 2OTWA 4OZFG 4WEUD 2Z93B 5D7IA 5KVDL 4E41A 3I02B 3BPLB 5JNYB 4X99A 5FYKL 4P3CH 5GS0H 1YN6A 3C5ZB 3RZCA 1DN0A 2X4RA 3GJFA 1E4WH 4OZHF 4LIQH 4LLDA 2W65B 2NY2C 2AQ2A 4F7EA 2HKHH 1FL5B 3AVEA 4JPWH 4UIMA 5HY9A 4XP6H 4UAOB 2YUWA 5HGHB 1YY9D 4P4KD 5HYEA 1A7QL 1DVFC 4LLWA 4G9FA 4HH8A 2D3VA 4G43A 4L4VA 4HX1A 2R9HC 1YMMA 4L9LB 4F15B 1IE5A 4ZTPL 2Z4QA 4M8VA 3FQUB 4KRPB 5BVPH 3ESVF 4JM2C 1MCOL 3S36L 1D5MB 2BZDA 1ACYH 3AB0C 3Q1SH 4G9DB 3DHJA 3HLAB 4M48H 2EO9A 1HXYB 2XN9E 3HUJF 2EKSB 4HUUA 3ULUC 3K4AA 3KJ4B 1UWXK 1CT8B 3OAYH 2NTFA 3LSOA 5LAXB 4K9EH 3H7LA 4KC3B 4XNQB 4BUHA 1LO3L 1O0VA 5K9OA 5FM4A 5B38G 4NM4H 4BSWA 3RPKA 4YQXL 3KPMB 3NA4A 3WJLA 5DHVH 4HDIA 4TN9A 5KBNC 5GGUB 5I1HH 1F4XL 5EO1B 5INDA 3DYPA 1WTGT 4X5XB 1X3DA 1MJ8L 4WWKC 4XT1C 2MSPA 1FO0B 4Y5VA 5D7LD 4NQUA 4XCNA 5KZCD 1S9WA 3LPGA 3WS6C 4XCYA 2JJSA 1G84A 3NPZB 5FAAA 3IJSA 1RJLA 5CP7A 3QZWG 4PJ8C 2P8PA 3T3PF 5D7LA 3K8MA 3R8QA 1W0VA 3MLTA 1Z2KA 3MRQA 4Q9CA 2Z8RA 5JZ7C 4JO3L 3WS3A 5I73C 3TO4C 1DJSA 2Z31D 3TNNB 1ZA3B 1S7VB 2W9EH 1JMXA 3KPRD 4CMHB 1QSEB 3VD3A 3DX7A 2NY6D 4HAFA 3UTTE 3MROB 3RDTA 5FM5O 1WAAA 5E70A 3TN0D 5BJTB 3TWCH 2RQ8A 1PQZB 2Q6WA 4DEPC 4MDIA 1J05A 1P5VA 2R2CA 4DW2H 3QQ3A 3G6JA 2IQAB 3BX7C 2FH6A 5HHNA 1Q9WA 2QADC 3N9GH 4FMFA 1JPSL 3I50L 5D70L 5J1AA 1TPXC 4WNQB 3FB6B 5KSAB 4J6RH 2W9DH 4E42B 5I15H 1F4YH 3HN3A 3WJLC 1G7LA 5GGVL 1BFOA 3ABZA 4K23L 5D5ME 3UP1A 2ZCLL 3DHMA 1P4LB 2HT2D 5FYKH 4XXDA 5BZDA 3MJ6A 1MLBA 4OFDA 3ME0A 4G8EB 3MFGB 4AM0B 1KJ2B 2K7PA 4Z7VE 3FT2B 4GG8B 4P5TD 5DTFB 2NY5C 1BWWA 3G6DH 2B4CL 5HYIA 1RZJL 2AXJA 4YC2C 2D03L 1KPRB 4LASL 5L7XH 2Z9TA 1VENA 1VHPA 3EJYD 2E6JA 3S36X 4RIRA 2XTJC 8FABB 5HDQL 2AEQL 1W8NA 1T66D 3LN4B 3I75B 2HLFC 5HDQH 3VXRE 1RULL 2J8UF 1WCBA 1PVHA 3EYUL 3IVKB 3FFCD 1NANI 4Z7OF 2FJFA 2V2XA 1A8JH 1UENA 4GO6B 1T1ZB 3I6KA 1KLFA 3FFCE 4NQXA 1A3LH 2MKLC 5EU6D 3VJ6B 1NLBL 3B8YA 1A6TB 3FB6A 1ACYL 5KSAA 2PYEA 4XCCH 4CDHA 5EUOE 1U95B 2I24N 3QUZA 3GMQB 2Q6WB 1NCUA 2ZUXA 4PYHA 5HVWA 3HE6B 5CJQH 3FQWB 4XTRC 1AO7D 1XT5A 3BGMB 1MFAL 3O3UN 4AEHH 1JPGB 4PIRF 2HVJB 4DUWA 2VSCA 1PSKL 5C9KA 2FR4A 4GKZA 2P8LA 5A16A 4JM2D 3HFMH 1IMHC 1FVEA 4LP5A 4CGTA 4MXWL 1F45A 1K4DA 1UB6A 1MCCA 4UOW0 4OQTH 3ULUD 2GTWA 2Y23A 3G08B 1PFCA 1UB6B 1CGSH 1R5VB 4HIHA 1XGRA 2RCSL 4OCXL 3B3IB 1F3RB 5K59F 1JI1A 4FN0A 4I77H 3H2WA 2XFXB 4ZAKA 5F7LB 5EO1A 2XG4A 1IGCL 1NL0H 1XGQB 3W9EA 2P24B 4D9RE 2R8SH 1IFHL 2DDQH 1O7VA 4H5SB 3TCLB 1XCTB 4KZEL 4PGEA 5KSBB 5DC9B 2VDLH 3U7YL 4TOYL 1T22B 1T3FB 3HMXL 3V4UL 3P77B 1R5WA 2JJTC 3TJHC 1CLCA 4XVSL 4HF5L 4Y5VC 4JGJA 5TF1L 3H9YA 1F3DH 3C8DA 4JPWL 3VFWA 2VWEE 5ICXA 3D0VA 5DD0H 3NMEA 3QFDB 4C55A 3S37L 1HKFA 1C12A 1OF2B 2Z31C 1YPZA 3RVXD 1F2XK 4TTGA 1JNHA 2A9ML 1RIHH 2HH0H 3WFEL 2NR6C 3GIZH 4LPUA 4PJFA 3KYKL 3E0GA 1W0VB 3MLTB 1GZQA 3PWUB 4H26A 1E27B 2IAMA 3V4VL 4FMKA 2VMFA 2YMXH 3AM8A 1U0QA 3WHXB 2FWOA 4LOUC 2GYSA 4Y89A 5JW4N 2OR9H 5IW6B 3D3VD 2DWEA 4XBPB 3IS1X 5ICYA 1ZT7B 4LNRB 1NUGA 3RWCA 2ESVB 3VCLA 4OB5H 1LO5A 2IFFL 3JBG7 5IVOA 4C56A 3ARFC 4ZS6C 5HHXL 3ET9F 4LSQH 5T3XD 1P7KA 1MHPL 1I8IA 2IH3A 3TT1H 2Y07H 2C3XA 3BJ91 5DVMA 4NKOA 4HF5H 1KCVH 4P57A 3WXVH 2WINA 5CJBA 2NTFB 3QJFB 1NLDH 2UYLB 4PBVC 1NSNL 3CCHA 3MLUL 1HXYA 2P45B 2Z35A 2YS4A 3GKWH 1IM9D 1JZ6A 1Q94A 4G8IA 4OBRA 1RPQA 5CZKA 3FB7B 4YHML 3K2UL 1ZA3A 2IADB 2OCFD 2EXYC 5IMLB 3ARGA 3KYOB 5E5MA 1H3WM 2PR4H 1RJZA 2F53A 4QYOB 5GRWA 5EUKA 4A2MA 4PRAA 2A6DA 4R8WH 3RUGF