4G8EA

Crystal structure of clone18 tcr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
201
structure length
201
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVLNTGGFKTIFGAGTRLFVKANIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved human T cell population targets mycobacterial antigens presented by CD1b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords alpha chain clone 18 TCR
total genus 36
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2012-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eA02
2DJSA 1JNHB 5DD1L 3Q6GH 1J9CT 3C09C 3RIFK 5B39A 3NIGE 1S9XA 4PJBB 5JIKA 1FYTB 4MCZB 4NZTH 4Y16B 1LO4L 2VC2L 5J3HC 4JN2B 5E7BA 1UFUA 5C07A 3NZ8A 4L3ED 4L8BA 5MEOB 4HKXA 4WY7H 3RWFB 3SKMB 1CICD 3OPZL 5IF0A 2QSVA 3S36X 3BAEL 2OQJA 2B1AH 2J6EA 4KJYA 3CDGA 2ICEA 1K9TA 1JGVL 4P4RB 1MQKH 4X4ME 3VGDA 4LF3B 1H3TA 1S7QA 4DUWA 1LE5B 4OKVB 1DUYB 4NWTH 5E8PB 4XPHH 1BOYA 3JSSA 5I15L 4Z0BH 1F6AA 3RVWC 1X5HA 3ULUD 1X44A 1TZIB 3TCXA 3ARWA 5EU7C 3WKML 1EMTH 1FFOA 1Q94B 4NBZB 2XPGB 1QACA 5I2IA 4GAGH 2A9MH 4PJ9D 5GGVH 5CILL 3ULSA 1G7IB 1TMCB 3QI9A 3ZKMD 3QH3A 5SWZB 3C5JB 5JR1H 2P7TA 2Z31A 3PE9A 1JI1A 1KCSL 2F53E 2GITA 2Z35B 1E6OH 3BJLA 3WDJA 3RAJL 3HZVB 1YEKL 5CUSH 5F9JB 3QNYA 2W91A 3MLTB 4R3SA 4Z5RB 3M8OH 5F1IA 2FH6A 2DLFL 3KPMA 4X8JA 1LWRA 4OF6A 1VGEL 4PG2C 3ECBB 2BNRB 2N56A 3D3VD 3IF1B 1YEFH 5J12C 1C12A 1F6LL 3VFRA 1VA9A 5GJTH 3MYJA 4JPVL 5EO9A 1KEGL 4MQSB 5ITBL 1LO2H 5DURB 2IFGA 4XNXH 1HSAA 1NGZB 1ZKAA 4U2ZA 2ZUYA 4FG6C 2UUDK 4L9LB 2DKMA 5HI4D 2ZCKL 2CH8A 3FQWA 5J9PB 2QQKL 5SX4I 1KJ2A 1R6VA 4YHIA 2DQIL 2FCBA 4M48H 1UKTA 5HDLA 5HVHC 1GPOH 1EK3A 1J11A 2BY1A 1G7HB 2C7UA 3TA3A 2VLLA 1JZ6A 5E03A 4M8QB 5E00B 3FT4A 1AC6A 2MCPH 1P7QD 3T4YB 4MDJA 3UTSE 2E9JA 5IVXE 5E2JA 3QXDB 1UM4H 4Y4HA 1NFDE 2XY2A 4LHUG 2P43B 2AK1L 2H3NB 2XWTB 3ZMRA 3PV6B 3MNZB 4PP2A 1N0LA 4OCNC 4XP1H 2F5BH 2G2RA 4CW1B 1JGLL 2DBLL 1S9WB 4NQDA 1PLGL 3DROB 5A16A 1U3HC 2GSGB 5D1XA 4APQA 3K46A 3SJVA 1E4KA 4GKOA 3BW9A 3QHZL 1ACYH 5KVDL 1DANT 4DZBA 2Y72A 4O9HH 3O4LD 2J8UE 4XNZB 3GJFK 5KSBB 4C83A 4YDLB 3GJEB 1DQML 4LPWA 1OLZA 4UV7H 5GRVL 5HYSA 2CMRL 4TNVK 4R4BA 3K8KA 4HXBL 4L3CB 4V1DD 4HUWA 5I8EA 3U4EB 1T21A 3HPJA 1RZJH 3MJ9H 4BFIA 4O4YH 4GKZA 5TE4H 4P0DA 3U9UA 3RDTC 1QSFB 4UIKH 1S7TA 3NTCL 4MB5A 5K9JL 3L9RB 1PG7W 1D7FA 6FABL 3TNMA 2OTUA 1O7VA 4HKJA 2VLRE 4FQLH 3MC0A 3CVIH 5KANG 1G0DA 3WIIL 3WFHA 2XWBA 4HWNA 5MERA 1A7OL 4HK0A 4N5ED 1KG0B 5IFJA 5FV2A 5IHZA 1YYML 2OYPA 3UTTD 3UZEA 3ZTNL 3KPSB 4LGPB 2H32A 1R0AH 1BHGA 3ALXA 3QO0A 1KN4L 4LDEB 4G42A 1TQCC 3OAZK 2IAMC 2QADB 1IAKA 1OTTC 1EO5A 1BJMA 5E1AB 4X4YB 5H35A 4ODUB 5GS0C 3VGEA 3MXVH 4JFFB 4XP9H 3PQYE 5GS1B 4RDQG 2PO6B 4M7LH 5FCUH 3X11B 4AIXA 4M1DH 2R1XB 4PJXB 4UT6L 4MZ3A 2OZ4H 1I1AC 1GGIH 1A14L 1A7QL 4K07A 2P44B 1HOCA 4G43A 3TCLA 5IB1B 4JGJA 2SEBA 4G9FB 1JPST 2DJ4A 3TO4B 1GXEA 3PP3H 5D5ME 1AIFA 2WBKA 2V2XA 4JZJA 1VGEH 4M1CC 4M7LT 5D6CA 5FO7B 1N2RB 3WJLA 2QSQA 5LWYL 1XR9A 3DTXB 3FQTB 4I3SH 4WFHD 2IALB 2YC1B 1QLRA 3FFDB 3VGBA 4AH2B 5KSVA 2AEIT 5HPMA 1QKZH 3AREB 5T3XH 2D0HA 3NH7H 4ZS7H 3BZ4A 2C5DC 1ZHKA 4WWID 3WS6A 3FT2A 3ARFC 3ARFD 3QUYC 4L4TB 4WGWB 5ESVA 2XN9E 5EZLA 1QQDA 5BJTA 4P9HH 3VFNA 2HAZA 3DBXA 4GW1A 1YZZA 1EGJL 2FEEL 3L3HA 2P24B 3WHXB 2ZSWB 2NY2C 2C3XA 4D2NA 3B2UC 4UUJA 2X05A 2BVYA 4R4ND 4Q9QH 4E41D 3BFOA 4U1IA 4W70A 2G60L 2X4OA 1AQDA 2Q86B 4JO1H 3NA9H 1ZLWH 1T3FB 5IROC 4X6BB 4RFNB 5JZ7C 5EOCL 5E2VH 2H9GB 4BQ9A 5HD8D 2AJ3A 4JFQB 1J0ZA 5D71H 25C8L 1T7WA 4P2CG 3UBXB 1EVUA 2VE6B 4K3DL 5BS0E 3QIUA 1JK8B 5J11B 2R0KH 3VW3L 4BZ1L 3W81A 5C08E 1YEKH 4Y4FA 1Q9KB 1AGEB 4MD4B 4AG4H 3FT3A 5ICXA 1INDH 4EIZC 1VEPA 5LBSL 1TIUA 3L5JA 4IMLB 3T2QA 3WO4B 2GTWA 3P0GB 2FZ3B 4IJ3B 3O6ML 2XY1A 4XPBL 3DX6A 4DVRL 2X10A 5A3ID 2ZPKL 3KPPB 2Y4SA 4X99B 1P4LB 3IRPX 1W72L 4O2CA 3LN4A 1IEHA 1SBSH 2XG5A 5GRUL 4LU5L 4YC2C 4LSVH 4EN3A 4L3EB 3FO9A 4BUGA 1WFUA 2ATKB 3O3BA 1T20A 3WN5C 2EDKA 3HZKA 3HE7A 1A9EB 2VDLH 3KJ4C 3ZHDA 1J1XL 1RULL 5BRZB 1EFQA 2DQDH 2YN3A 3EFDH 4LAQH 4AM0B 4LSSL 3BT2H 3MLVH 4F7EA 4QRPE 5IHLB 2VQ1B 1UC6A 4QOKD 4TSCL 1UACL 3I3DA 1FCGA 4GQ9L 2X4PA 4PGEB 3EYQD 4X9IA 2QLVB 1JWSA 1FFNA 4WFED 3EYUH 3ZT7A 3RTQA 4L8SC 5FYKD 1MHEA 5GS0D 3O2DL 1LO3H 3D39A 3V6OA 1G6RA 4WDIB 5EZIH 4ZTPH 2VABB 4KK9C 5JHLL 3UTTE 4DAGL 1SY6H 5DR5L 1R3LB 3VXUA 3SQBA 3IB4A 5F3BB 5DHYA 5F96H 2AQ1A 3UAJD 3CZFA 4PREB 3Q1SL 4RDQF 3BQUD 2ATPA 4P59L 3HE6B 1JNLH 2CKNA 4PY7A 4WENB 5K9OB 1K8IA 4U05A 1UZ6F 3ZE0F 5GGRA 2W59A 3PABB 5B8CB 1N4XH 5J6HB 4ALAH 1MJJB 4V1DA 1YN7A 2X89D 3LSOB 1NCWL 1P6FA 2P48B 3V4UH 4KHTH 4HWZA 1YMMD 1XF4A 4HH9B 2JCCA 2YXMA 5I15H 5DWUH 3MJGX 4JFFE 4MQTB 2GHWB 5BCAA 5D2NB 4Y7MA 2V9RA 1IAOB 2A6JA 4Y5VB 3MV9E 4KV5F 4PJXE 4NHCH 5JHDD 4ZPTA 4GH7B 4HEME 4I0KA 3G08B 1BD2B 1BIIB 1SY6A 5LQBL 4JAMB 2NLJB 4W6WB 5MHSD 3VWKD 3P9WB 3VFWA 5HHNA 4K9EH 4Y4HC 3F7PC 2PNDA 1N0XH 3ARZA 5SWQA 3QPQC 3HMWH 1NUFA 5CJOL 4JFZL 3LDBC 1SYVA 3ZKNC 2VAJA 1MFEH 4YDVB 3ULUL 5F1NA 3HN3A 5GGQL 4GT7A 2AJVL 5L0QC 2DLFH 5CIPA 4BKLB 1SJHB 1FO0B 3CFBB 3DVFA 1KC5L 3TFKD 5I1LA 1Q0XH 4EJ1C 3PHQB 5IUSA 4WWKC 4XPTL 1C5CH 5BZWB 5C8JA 5KAQG 2EXWD 4JRXE 2AEPL 3Q2CA 3LKNA 4JZJC 3U1SL 4M3JA 4LHQB 2CLVA 3TVMB 3I85A 1R3IL 2Q8BL 1DE4A 4HZLA 4R8WH 5L88L 5KZCD 4NGHH 4WU7A 2CIIA 3DOSA 1WAAA 4Y5XA 3JTTB 5C08D 5F89B 3RHWK 4LLUA 4JHBA 3LPGA 5DUBA 5D7IA 5IP4A 4PB0H 5FHBL 5FDWB 4W4NA 1JYVA 3HZMB 4MNQB 3TT1L 5HY9B 3V79C 1N4XL 3L3DA 3GSNL 2IQAA 3NIFF 2VR5A 1MVFA 5EU4B 3RL2B 4KKLC 2DL9A 4EUPB 5C6TL 1MCWM 5DEGB 5K33A 3AGVA 5BMFL 4WW2B 1J1PL 4F9PA 1XMWA 4WHTB 4RMUA 1HI6A 5D1QB 3L5WB 4CNIA 5D4QA 3FKUS 5KVEL 2NNAB 1RPQA 3KYOA 4MYWB 4YHNB 1XT5A 5H2BB 4NC1E 1J5OH 3SDCA 3ULUH 1N5AA 4I48B 3GSXA 2VKXA 4NQDD 1TJHL 4WW2F 5IHUH 4RMWA 4UQ3A 2HG5A 5D1XD 3BPCA 2RFXA 2XRAH 4POYA 4HK3N 1JN6B 2VDRH 5I30H 1KSRA 3MFFB 1TVBA 2XZCH 5D1QD 5EFIA 3SGEI 3UTPE 3ESVF 3P4NA 4X6FA 3VWJA 1M05B 3HS0B 1VADB 3WXVL 4D0DB 3V7MA 4NM4L 3QHTC 3PWJB 2JLLA 2D7OA 2V7HA 5EZJB 2FX9L 5E8NB 1AC0A 3MBEA 3OXSA 1J7VR 4Y2DB 3U7WL 1P5VA 1U6AL 5KG9B 4HQQH 2VLRD 4HW6A 4Q6YA 5JXEC 1WTGT 1PBYA 2XV6B 1NFIA 3Q48A 4QRRD 2X1OA 3DVGB 1CXFA 3FRPG 3RPIB 1UM6H 5C92A 1H8NA 3DNKA 1FSKC 3O45B 4P2RD 1EX0A 4JPWH 1IL1B 4FABL 4OTXL 1M7DA 3TPUA 3GFUA 2NY5L 8FABB 4R4FL 4HPOH 4Y4KB 2PTTA 2H26B 4EI6A 4L8SA 2DOCA 3EFDL 1M7IB 1YC8A 5HHPA 4NUJB 1WFTA 2A6IB 4KKBD 3DURA 3KGRA 2UWEE 1E0OB 1OAXL 4M02A 4OLEA 2PYFA 3PP4L 2HKHL 1JF1A 3JWDH 4P2QB 4U1JB 1RULH 3IGAB 5ISZE 4G8EA 1HCVA 4OJFL 3UYOD 1GOFA 2R23A 2YRZA 1KJMB 3BH8B 5DJYA 2V2WA 1KB9K 1U8MA 5I74B 5SWSB 3I6GA 5E0QA 3L6FA 4FZEH 3WFBL 4M93B 1N59B 5IBTL 2Y5TA 2Z92B 5HHMD 3MV7A 3D0VB 3GM0A 2MNUA 4MAYC 1RFDH 2ZG3A 4CU6A 2ZJSL 1QBBA 2Q76B 5I1GH 1ZT7B 2B20A 6FABH 3FB8B 4CN4A 2BVEA 3BVNB 4HULB 3BXNA 2VSDA 2XKSA 2OTWB 3S36L 3BP5A 4KQ4H 4B5EA 3VXUE 3ZDXE 1Q72H 3QO1B 1FZMB 1BBJB 3A0OA 1U9KA 1A1NA 1JGDA 3G5ZB 3RDTB 4NKIL 1RUMH 1Y6MR 2BMKB 4JG1L 5B3JF 1CE6A 3QIBA 3WUWG 1QEWB 2YD6A 3IDJA 5D1ZB 3M45A 4L8DA 3CPLA 4PTTB 3HRZA 3K2UH 5C0GA 4F37K 2VJXA 4XCYA 1JF5A 1S7UB 2EEBA 5DI8A 3OV6A 5DA4A 5HHVH 5J8OA 5IBUB 4M1GL 3O0RH 4GRWE 1CFNB 4PD4K 5C0CD 4PJCA 4BUHA 5DS8A 1LP9E 5GSRA 3PXHA 3VD5A 4M43H 4M9PA 3MO1A 1FN4B 1UWEL 2F54D 1YUHA 3MYZA 2ERJB 5CZXC 2BNQD 5FYKH 5GS0H 2VZVA 5LVEA 1L9MA 5GHWL 4LRNH 5I66A 12E8L 3OAYH 3TBVB 5DXWA 1EAJA 1KXVC 1UJ3C 1XGPA 5H8DA 4YXHH 3DLQR 1GIGL 4LGSB 2VO5A 1YNTA 3MV9A 1RZKL 1X7QA 4TUKL 4YBQC 5F7EL 5DJ0A 1HWGB 5J56B 5JLZB 4TVPD 4RGNC 3UPCA 1PQZB 3IDXL 5CJQH 5CEZH 3RJDA 5BV7C 1UWGH 1SMOA 3AREC 2UZXB 3OG6B 3P11L 4CVXB 4EN3D 3CU7A 1AD0B 4YDIH 5DDHB 4K9EC 1A7PL 1T1XB 4OLUH 4XBPB 4KMTH 2Z9TA 1U93B 5CAYB 4IRJC 3V7AG 3D0LB 1LO5A 3ALWA 4M6MH 1NEZA 1A5FL 1KIQB 4QRSA 5FEBA 4TSCH 2EDXA 3DMMC 1H3UA 1N5YH 4UNUA 2X7LB 4RZCB 4MA1C 2DQJH 1AKJA 2W60A 4H88H 5D7JB 3RZCB 4F7TA 4D3CL 1KTDA 1KGCE 4G7VL 1K5NA 1ULVA 4N1EA 3ROOB 3IJSB 1RIVH 3HR5A 4UIMB 4YHOH 3BGMA 3QA3A 4HWBA 4AEHL 2EIEA 1HHKA 3VMPA 4PLKC 5JOFB 3KYMA 3ZYOA 2FJFA 2VDRL 4LCWE 4LLYB 3EJZD 3JUYA 5ACMA 4JDVA 2YHGA 4N0FB 3VFPB 5J11C 1Z6JT 3BZDA 1RV6X 2O61B 3KXFA 2PR4L 1XIWC 2EKJA 1I4FA 5HYJE 5JO5A 1A1OA 5B38B 1FIGH 1JNNH 3C6LA 2JJSA 4P2YA 5E2TL 2DI9A 3I6KA 5IMKB 1TJIL 3WNKA 1CQYA 3UJJH 1X6NA 4GRLD 4NGHL 3IDUA 2OP4L 3NABL 2L7JA 1J8HB 4R26H 2NQCA 5KVGL 5CMAB 4OZ4B 3TJHC 1E28A 3CNKA 2E6QA 3DYOA 4X6CF 3PWVA 5CHNA 1N6UA 4HXBH 2ED8A 5JHDA 3AM8A 4XGZB 3QUYB 5BOZG 8CGTA 1EVTC 4JANB 4RBPH 1S9VA 4ODHH 5KW9L 5JIIA 4NJAL 1P84J 4YWGH 1IM3B 1S8DB 2GJ6E 3QDGA 4I4WA 4PJXF 4N90E 3NA9L 3O41B 1LD9B 4Y1AD 5I75B 2FJGA 4JKPH 2NYYC 4YHMH 3THMH 1CL7L 2ZCHH 4NQVA 3MJ8A 5IMMB 1JPSL 5FUZH 1WUNT 1CXIA 3H0TB 4HGMA 5L2JB 2PCPB 5ILTL 1UENA 4HV8A 3SJVD 3RUGB 4JO2H 4MB3A 1I8MB 1MCOL 4GKNA 4PRIA 4YPGB 2VL5B 1MF2L 5DJDA 2R56H 4Y19E 4N8VB 1B0GA 2R4RH 4OCYL 4XWGL 3FAWA 5GISH 3O4OB 4IRSD 5ID0A 3CX5J 4XPGL 2B4CC 1DANU 5J13B 4KRPB 4OZGB 1T80A 4PJ8B 3QUZB 4OUUA 3RVWD 2PYEA 3HMWL 3RVXC 3GNML 3O2VH 5CEXA 4DJMA 3NFNA 3MRKB 3FRUB 1QFWL 5AWNH 2IPTH 3TVMD 4QXGL 1MCPL 3MV7D 1MCFA 4PD4J 5HHVL 5I1IL 4MSWB 3KYNA 1QLEL 1F13A 4D0BA 1DQQA 2P5WD 1T4KB 4LEXH 2HFGL 4PYGA 5EIIA 3GSOB 1R24A 4WW1A 4WUUA 1HHGA 4N8CH 3FB5B 1AI1L 1NCAH 3DMMA 3W5MA 1AGCA 2WBWB 3P4MB 4G8GB 2DYPD 3B5TA 4NQCD 1GJIA 1LK2A 4JLRB 5L2KA 1VERA 5L8JB 3IDMB 5IEHB 1ORSA 5F71A 2QQQA 3U0PB 1WT5A 3L7EA 1MCEA 1HIMH 4CJ0A 3QRFM 1K4CB 2A9NH 1WBYB 3LEYL 1KBGL 3ZTNH 5HGBB 4I18B 4H20H 3TZVD 3LKPB 2KQNA 4XCCL 2Z8VC 4S1DC 5BW7C 5M7QA 3SDDD 5F72S 5ANME 1NPUA 5FXCH 3P77B 5FA4B 3V4VL 1BQSA 1KJ3H 4ZQKA 4JY4B 2AJYL 5B4MD 4YHML 4HKZB 3T1WA 3G9VA 1G84A 1I8KB 4HIIB 1DBAL 1M1SA 3MRDA 5TQ0H 5DZOA 5I1JH 1LP9A 3MLSL 5FA3B 4OJFH 3MRHA 1ZA6B 1HINL 4PRBA 4XXDA 1H5BC 3BHBB 1TZGH 4TTDD 1AD9B 4NKQB 3EAKA 3UMTA 3L3IA 1N64H 2NY0D 3RBSA 3D3VE 4GSDL 5D2LE 4U1KB 1NBZB 5D7JD 1W0VA 1E4KC 4PJGF 1HIML 4M62H 2X4SA 5E5MA 4OAWA 1RJZA 4MZ2A 5FYJE 4PYHA 1CG9A 3SBWC 1G7MA 1A3QA 1I7TB 1BREA 3CDYA 4NKOA 3NCYS 3K8LA 4POZD 1DSFL 2EH7H 2M8XA 2JJSC 2R2HB 4XNYH 4FQ2L 4YR6A 1YEGH 3PL6B 2F15A 4XVSL 1QRND 2HT4D 4QWWC 1A5FH 2IAMA 4QOKB 2C3GA 4L3EE 1QBML 4W4OA 1D5ZB 4XC3L 4BZ1H 3GNMH 3NCYP 3MRGB 1D9KA 4HKBB 1BM3H 2AKRB 4KK8D 4W6XB 4L4VB 3RNQA 1PG7X 3TLRA 4NQTA 5DTFB 3UTQB 2BNQB 3AM8C 3FFCE 5DQ9A 4BYHA 5I76A 3MR9A 4BM7A 4L8CB 4YZFE 1P7HL 1HSBB 4H0HB 2MQ3A 1LO2L 1KJ3L 1U92A 4KMTL 2W0KA 5GRXG 1U91A 1K3ZA 2H2PD 4YDKH 5C0IA 1CI5A 2P1YA 4JFHD 1U8JB 1A6AB 4ZMAT 4XMKL 5ERWA 1IAIL 3SDYH 3GO1H 3BMWA 2EE3A 3ZKSD 2VDPL 2I9TA 1RVFL 2HJFB 3EYFA 4FQQA 2EKSB 3RWJB 4HJGA 1ADQH 3DV4A 4F33B 2OR8A 1U8KB 1WZLA 1ZLSH 5E94A 4HS6B 4Z77A 2VXVH 1FHGA 3OGCB 5GGVY 4LSUL 3ESUF 3QJHA 1ZHNA 1QLFB 3G5XA 1NMCC 1LO3L 1MJ8H 3TBTB 1BQLL 5AD0A 4I5BB 2NW3A 1A7QH 4PRIE 5BS0A 3GI9H 4ZXBC 4P23A 4R96A 3LS4L 1FYTD 1B3JA 1FNEA 2UYLA 3QWOB 5E9DB 5DMIL 4TTGA 2VDLL 3QNXB 4DUXA 1PEWA 3C6LC 3QEGH 3BPLC 4Z76A 1IC1A 1TZGL 4M6AA 4E41B 2W9LA 1YDPA 2UZYB 5EULV 1KCVH 4JFOA 1A7NH 1NBYA 5C71A 1MI5A 1U8HB 5A2FA 1KNOA 1BEYH 3BE1L 1QFUL 2NXYC 1IEBA 4WCYL 5GRUH 1Z9OA 4KUCF 4BSVB 1U8IA 2Q6WA 1TQBC 3RU8L 4ZD3H 4PJDF 4XWOD 4PGJA 3CH1A 2C3VB 3C8KA 2LAAA 5I18H 5CZVH 2XNAA 3RVVD 1CXKA 4HIXH 2HP4A 1WIUA 4YX2H 4K3HA 3OAZH 2PYED 2K1MA 2JCCF 3QDAA 5HGHA 3MGOB 1KJVA 3S37L 3KJ6H 1I7UB 5C3TA 4L3AA 4D0CB 4CMHB 2CKBB 1IBGH 1FVDB 4LHUB 5IJVA 1TVHA 4UU9A 4FA8A 2EE6A 3QT2A 3PWLB 2R0ZH 4U31A 1BVZA 4X5WA 3VRLF 1QLEH 5E4IA 3MA7B 3ROLA 2YUZA 2X9XA 4X6CB 1FLRL 5ESQA 1LK3L 2GJJA 4MQ7B 3O11B 3ZZ1A 4G8IA 1CLYH 3BKYL 4MVBC 2DI7A 2HT4C 4QWWD 5CP7B 4F7CB 4UILH 1RZIA 4NO3A 4P49A 2QSCL 4QHNB 4K23H 3OL2A 1KYOJ 4AK1A 4PGBA 4HQQL 5FV1L 2CGRL 2FSEA 4JDZA 2J6EL 2PW2A 4MA3A 2YEZA 3MREB 3RTQD 1S3KL 1MHPL 3IDYC 4PG9B 3SDDA 5LXGH 3QG6A 1DR9A 1Q9LA 4L4JA 2C9AA 3QI9D 4HDIA 3IDNA 1W0WB 4TSBL 1WSST 1MH5B 4LNVA 2NY1C 1MRDL 3GO1L 1FZKA 1EHLL 3BUYA 5L2KE 3MLPA 1V3MA 3AU1B 4L29A 3WE6B 3T3PF 4QTIH 5IQ9B 1H0DA 2FO4A 4PJ7B 5GGTA 4PJIA 1I75A 5E8OB 3ULUE 2Z8RA 5GZND 1NGPH 1XGYL 4N90D 1MCNA 2R0LH 4GRLC 3GMLA 3C6SA 1Z0MA 3I9GH 1IEAB 4JM2A 2XKNA 5KANI 2NY1B 3D3VA 1RQ5A 5KS9E 5D9SA 1OSPH 4E0RB 1DQLL 2AEQL 4PGDB 3VDCA 2OJZH 1TTGA 3RVUC 3Q6FB 4R2GC 2X4UA 4NBYB 3A67L 4HFWA 3U4BL 1INEL 4TSAH 3LN5A 4Y16A 2FYYA 3BSZL 1A14H 5C07B 1MRFH 4X7SL 1ZWIA 1NCDL 1CBVH 2PF6A 1KT2B 5IIEB 4MJIB 4U1MA 2J7LA 3NCCB 4KJQC 2BDNH 1P4IH 2OP4H 1P9MA 4LLQA 3VWKA 5FUOL 4GBXC 3C8DA 4PLOB 1GZPB 2UWEF 4YFLF 3MCG1 1MRCL 3SGKC 5H37G 3RKDC 4W4OC 1MHHA 5ADPL 4UI2A 1OAQH 4XNQB 5IR1B 4GRMB 1QA9B 5ICYA 2A6DB 1CN4A 4P46A 4P4KB 4G5ZH 4XNMB 3QFJB 2EIDA 4DTGH 1ZHBA 1SBBA 3QXTA 1YY8A 3V4PH 1J18A 3F12A 3MV01 2OL3L 2VAAA 4HWEH 2BHZA 1MFAH 2XQYG 1ZE3C 1OAXH 4G6FD 4LLAA 3BQUC 2BNUA 1WJ3A 2DWEB 1VFAA 4K7FA 1I7ZA 2NY0B 3VU2A 4OGXH 3TT1H 5HGDB 2Y1VA 2B1AL 3OGOE 3FQRB 3B3IA 3QBTB 1J8KA 5HVGB 3H9SD 3WNLA 1AO7A 5EOCH 1KB9J 4KWUA 1AH1A 3D6GA 1ZT4A 2O5ZL 3EOTH 4XVTH 3VXSB 5JORA 1NGYB 5L88H 2VC2H 3TH2T 3QUXA 2ZKHH 4UDTA 1BQHB 1QRKA 4PJDB 1Z5LA 4DKAA 4PUBL 4U1HB 1IAIH 1YEDA 4JVUA 5MEND 3WDIA 2V6HA 4J4PC 4LPYA 3LKQA 1WWWX 3IDXH 3OKOB 4JQVA 3DX9B 2EO1A 1P2CB 1DVFA 1R3JA 3KXFE 2Y7QA 1A3LH 4HEPG 4TPRH 2H8PB 2OSLB 3C5ZD 4H20L 3PNWB 4KK5C 4ENED 3N50A 1VB9A 3D25A 2AJSH 4H8WC 4Z7UA 3MRCA 1AE6L 3WS3A 2NYYD 2OCFD 1Q0YH 3RZCC 3V5DA 3TFKC 1J87A 4YHIB 3VXMA 3F5WA 4U2YA 5DK3A 3PDOB 4JFDA 4NUGH 1P4IL 2BNRE 3MOAH 3QPXL 3P0YL 2AERT 3WUWA 4KHXH 3ILPA 3VI3F 3RRQA 3TV3L 1A21A 2E27L 2P8MA 1U3HA 1TLKA 1H3GA 4M9OA 1F3JB 3BKMH 5ITBH 4U1NB 3S7GA 1I1AA 1GGIL 3S3PA 3DROA 3GI9L 1Y0LB 4WHYG 5D70L 1NANI 2FX7H 5EC2A 3LD8B 2ICWB 4PJFF 4WEMB 4LAJH 3G6JE 3UTZB 4UINL 5DVOA 1XGYH 1BECA 4NN5B 3S37H 3PF2A 1MVUB 2HVJB 3RVUD 5F70A 2EDQA 3MRJB 3SDAD 5HYSB 3ARDC 5HI5D 1FJ1B 4F15B 5FYJD 1MSPA 4CKVX 4XCFL 2C1PB 2B5IC 1I9JL 4I0PB 1U6AH 1S7WA 3L7FA 4R4NC 4LCWD 4JFDD 3UYRL 1FH5L 1ZGLP 3GSQA 2BERA 2DQFB 4IIQC 3U79A 4C56E 1S5IH 2OTUB 1RUQH 4UILL 3P73B 3T08A 1SMAA 5KSUA 3EYUL 3I75A 3IU3A 4LSDA 4NN5C 2FH8A 2Z8WC 4QEGA 2N4IA 2ZSVA 1GGBH 5A2IH 3S88H 2IJ0C 2Z4QA 3QG7L 4K3JL 4U1LA 4JREB 4N0RA 5KS9A 2AEPH 3KYKH 4S0TD 4NNXB 3TIEA 1JPFA 5GIRB 5JDJA 4YNYA 2VWEE 4KHXL 2X44D 3BEWB 4YE4L 1JGVH 2HJKA 4ZDHA 1FVCB 3B5GA 2YPKB 4P5KA 1FNSH 4OB5L 4YPJA 5BXFB 1MLBA 4CBPA 2I07A 4Z7VE 5IB2B 2VSCA 3VXQA 4IOSD 4TQEH 2DI8A 4PJGB 4ZNEA 2W0FA 4QLRA 1JHLL 2WIIB 4WY7L 1W72B 4ONFH 3DXAB 1NGWA 1IC5L 2EXYC 4TVPE 5FM4A 2C26A 2OR9L 5C07D 1RVFH 2Z93A 2NZ9C 2DQHL 1OAUH 4Y4FD 3UTSD 4MNGB 4G43B 1HOCB 4PGZA 1Y6NR 4ODXB 2V5RA 4WU5B 1I85A 3RBGA 2ZUQB 4JHWL 2D9QB 5FM8A 3CFKB 2XWJA 4TQEL 2HT3D 2MCPL 4JREC 1IGIL 5DQDH 1UJTA 5C0RH 3P9LA 4Y1AB 1KIRB 3F62A 3SGKA 1WV7T 3OKLA 2FLRT 3L3KB 2NXZC 2ADFL 4HS8L 1KB5A 5E95B 4ZAKC 4KI5C 3S88L 4XC1L 4NYLA 1NCDH 2EDNA 4RNRB 2CRIA 4RAHA 4TNWF 4XRCA 5L9DH 3RIAF 4UTBH 3E6HB 3MMEA 4GS7C 5E2WH 2CR3A 3RGVC 4RFEA 2DWDB 2YSSA 3A67H 3ARQA 3NIDE 3QULA 2O5YH 3BPOC 4NQCE 3RKPA 4D9LH 1NCWH 3LQMA 4UOW1 4LEOB 5KAQF 5TH2B 1FGVH 1A0QH 4FN0A 2YWYA 2VZTA 4RAVB 2JB5H 1U8LB 43C9B 3KNBA 1JUFA 1YQVH 4HIHA 3SPVA 2JJTC 4M61A 4HWEL 3DX8B 4Q6IA 2F54A 3QIWB 4QT5B 5DQJA 1G7PB 1K6QL 1T3FA 3OKNA 1RZ7H 4C4KO 3U2SB 4P59H 4QTIL 3RTQC 4R7DB 3HR6A 4GRLA 1R5WA 1H8SA 2HWZH 1AR2A 4MD5A 5IWLA 3VRJA 4D9RD 1B2WH 3SGDI 3VXME 2J88L 3ARGC 3NN8B 1OHQA 2XZAH 4NJAH 3QZWG 4OT1H 3QIWD 3ILQD 1I3UA 4LLMB 1DFBL 1E6JL 3C8HA 3FB6B 5K59E 2NTFB 4EI5D 4X4MA 1CLOH 1URLA 2XN9D 4RAUB 3ZE2F 4HGWB 1JPSH 5FUZL 4OZHF 4BZYA 1C7TA 3UTTB 2CLRB 2ADGB 1EGJA 3QXVA 1PSKL 4WJ5B 2EDWA 3BT2L 4WV1B 1CL7I 2OBGA 2X89A 1VGKB 3JWOL 1C8PA 3B9KC 4OZFA 3SGJA 5IESH 4JQXA 4LVNC 3ZKND 4RFOL 1EEZA 2W38A 3VGAC 2HFFA 5I6XB 1XCQB 5EU6D 4XCNA 1AP2A 1KPUA 1NEZG 5CZKA 1LEIA 4PRID 2UVEA 4G7YH 2BX5A 4FQIH 1JWUB 1A2YA 3OJDA 5FB8A 3QFDA 1BWMA 1WWBX 4L5FH 2C1OB 4XNYL 3UZVB 4YHYC 3RQ3A 5E56A 4N0UB 4ZO6A 5B39G 4FFZH 1MIEH 1OGAA 3O6MH 4PJ5E 5I6XC 4NO5B 5I0ZA 5JXED 5F7NC 1BVKA 2VRAA 1XGTB 3MRQB 1RY7B 1QFWI 1IGTA 3BGFC 4P2OB 1FFNB 4KKCC 1CU4L 3X14A 1VKXB 3B9AA 2J8UB 1K4DB 1NBQA 5DVMA 1LEGA 4UOJA 1MRCH 5KN5A 3JWOC 1A3RL 3WLBB 3RGVD 4JM2D 1QO3B 5GJSL 3BP7B 3NFPA 2BCKB 4I2XA 5E8EA 3TN0D 2VDNH 5E6IB 4PRPA 3CZFB 2B1HL 4IM8A 4R97C 1G7LB 3G6DL 1K8IB 1F97A 4EVNA 4JO1L 3ARSA 2F5BL 5BV7L 5I1EL 4YHZL 4DOHE 2HTKC 3RIFF 1ND0B 4NO2A 4ZFFA 3UDWC 3RPKA 1G7QA 3LIZL 5C6PB 1PW3A 1U3ZA 1ZTXH 4FFYH 5A2LH 1JBJA 1T03L 2P46B 3NCFB 2FEDC 4JG0L 2OX5A 1T83A 2RAMA 4X9FA 3MRPB 2RBLA 3AS1A 5FCSH 4RA0C 3GHEH 1ADQA 5LBSH 2ESVA 1YMHB 3O0RL 1U95B 4QRPB 5I16B 4JJ5A 4ZD3L 3RU8H 4PV9B 5JPMA 4YEFA 2CK0H 2IANE 3KLAA 3PXJA 5BVJB 3ARDA 2ORBH 5ANMA 3GJFH 5EU3A 3P30H 3ZKQD 2KZ1B 3BKML 5IW6B 4LLDA 1BX2A 1DVFC 4D8PA 1Z0NA 3IDGB 5INDA 2M1KA 4OZGF 1AR1D 1FO0A 3CFBA 3VCLA 4U6YA 4AENA 3QXWA 2BSSA 4JPKH 1CYGA 3CDCA 1O5DT 3O2WH 4GG6F 4KH2A 4RGMC 1WBXA 3DGGA 3EHBD 3TJHD 4S1QL 5HHOE 3OR7B 4XNXL 1K8DA 2GCYA 3DHMA 3GIVB 2F54E 1VENA 1V3KA 1WBZA 2P5WA 3IFPA 2MQCA 1D5MA 5C0FA 5IB4A 2JJTA 4FQ2H 5D2LA 4OFKA 5DK0A 3QYCA 4HZLB 2J8UF 4FZ8H 2B7DT 5F44A 4LCCB 4KI1A 4FQLL 3GHBH 4Z7NF 5SX5K 5T3XL 3SGDH 1HQ4B 3EDJA 4NQXA 3HPLB 3VXOB 5HYQA 1ZEAH 3AC0A 3QUKA 5D7KE 2J6EH 4K3EH 1Y18A 4J3OC 3WNPA 2JELH 4QRUA 2VLJA 3TJEL 4G6AC 3FQXA 5F9OH 4G6AD 4PB9H 2GTZB 43CAA 4LDOB 4KUZH 1JFQH 2ERJC 2RGSA 3QDME 1OP5K 4AG4L 4Q6IC 5I1GL 4OZIE 3AB0B 3EO9L 3SBWA 3DO3A 4YHOL 3RL2A 3PGCB 4G7YL 4HG4J 3U46A 4X5XB 1T03H 5TDOA 4J3WA 3BP6A 5GGSA 2FL5A 3T65B 5T1MB 2HFTA 5C0JA 4X9BA 4HJ0C 1DTUA 1PZ5A 2IPKB 3I50L 1FYTE 4QHUB 3BIAX 3B6SA 4E41E 5I1JL 2VISA 4R8WL 5CGMA 2BSED 4S1SH 3T0AA 3TIDB 2HG5B 4RISH 1UXSA 2CMRH 1DBJH 1J0IA 1F3DH 2NY3B 4MNQE 3QQ3B 3I50H 2EIZB 1PJ9A 2VLME 2ZG1A 2DLGA 4LVOC 4EDXB 1M71B 2AK1H 3QHZH 1BQLH 2B2XH 3FONA 4OM0L 2EDHA 5D7LA 4YFEA 4O2EA 2XN9A 2CKBL 3GKWH 1RFDL 1SJEB 2FDBP 1J05B 3O3AB 2PW1A 2GSIA 3FHAA 2OI9C 4Q2ZB 5FYJU 3O4LB 3W2DL 3HE6C 5BRZE 1B4JL 2NTSP 5K9KA 4NOBA 3OXSB 1AXSA 3CSPA 3H7BB 1HHHA 4XTRD 1C5BH 4XTRC 4WTZA 2RIKA 1OB1A 1T1WA 3O6KL 4G3YL 5BV7B 3GHBL 1NFIB 3BSZH 3IDIB 4NPYA 5HJ3B 3F7YB 1EAPB 3OXRB 4WO4C 3ULVC 4JZOB 5KVDH 2YPVL 2A6KB 2WUCL 3OKMB 2GJZB 1T89C 3VJ6A 3O4OC 1DBKH 4AJ0A 5IESL 3I9GL 4JG1H 5F9AC 4KK5D 3OX8B 4ENEC 4KROD 8FABA 3AXLB 4UV4H 2IBBA 1AGFB 1YEFL 4QY8B 3FQUB 1I8IB 3HRPA 5HYJA 3OJVC 2ZOLB 2IWGA 4F8QA 1Q1JL 4HJJL 3SDDC 3STLB 5I30L 2ITCA 4P48A 4N1CA 1LE5A 5C0ND 3MRIB 3T2NH 3VXNA 2WQRA 1I1YA 2H45A 5E8PA 4NP4L 2DLHA 5ADOH 5D7LE 1E6OL 5E4EB 3RGVA 2E8YA 2YK1H 3IXTB 4P2QA 4NSKB 3C60C 4YEEA 1Q9OB 4OSUL 2NW2B 2DQHH 3SO3B 4OCMC 4H5SA 3O6LL 1JV5A 2B0SL 2Z8SA 3QXAB 4HIEA 1P6AB 4HX1B 4XH2B 2P8PA 4NFBA 5F7MC 2AXFB 5ITFA 3ARFA 2FHFA 3IKCA 4DN3H 1UYWL 3IFNH 4YHZH 5DD3H 1QR4A 2BJMH 1IGYB 4JB9H 4JPIA 5D70H 4YWGL 3UDWA 2P7TB 2Z31B 1WZ1L 4JO3L 3FB8A 1PDKA 1ETZB 2G9HB 1MFBL 2GITB 3GDBA 3BI9X 2E7BA 3CVHB 1QFWH 1OSZA 1REIA 3EDEA 3QO1A 4UTBL 5E9DD 4DFIA 1A3RH 3SDAC 2BNRA 1RUPH 3C60B 4MCYB 1ES0A 4WI7A 1QFWM 1JGDB 3MRLB 3QEQA 5DK2B 4NZTL 3RDTA 3HCVB 3KJ6L 3BDXA 2VKWA 2HJLA 3TNNB 2B1HH 1NC4B 1ZA3B 1A22B 2APBA 3CPLB 4P5MB 3VFVB 4XB8A 3P2TA 4U6VH 3T77B 5DD1H 2GT9A 3GUTB 3JZ7A 2CXGA 4PR5A 1OAUL 1OAYL 3QFJE 2PYEE 3T8XB 4PRHA 5C3LD 1A4KB 3SCMB 5DGRA 5E6ID 4XPAL 4P57A 5HHOA 1YN6A 3CFDB 5B8CC 2EDYA 3PL6C 1WEJH 3MNVB 4NKMB 1FL5B 1E4WH 1L7IL 4FTVB 3GSRA 3BH9B 4Q0XL 2DM3A 4K7PL 2VXTH 5EDXA 1RUQL 1JTTA 4JR9H 1JWMA 4GAFB 4LSTL 3RWGB 4ZAKB 4CU7A 1JIBA 5IBLD 3MPCA 4M03A 3RWEA 2FATH 1H15A 1FZOA 4CVXA 5DFVC 2ZNXA 3NABH 1T04B 1VFUA 3L3GB 5BZDA 5AYUH 2BK8A 1N6QH 2AEWA 2VTFA 1J88A 5LG1A 5IJKC 2LU7A 5FOJA 3QDGD 4DAGH 2YA1A 1G1CA 3NGBC 3UX9B 4JCMA 1BLNB 2VDPH 4PTUB 4B0MM 3QIUC 4JY6B 4Z7VF 3FOMB 5E5UB 1DQJB 4HUWB 2AJSL 3RWCB 1JHKL 2P47B 1JNLL 3K8MA 2E7HA 1DP0A 5SX4H 4WUKH 4Z7WA 3MSPA 3U7WH 1D6EA 1N8ZB 1A4JA 5T1KB 5JR1L 5F7WC 1KUMA 1IGJA 4UQ2A 1XGUB 4PJ7E 5TJWK 5JOFA 3T1FA 1FV1B 4OF5A 4RRPA 4ZUUB 1HH9B 3PIQA 2ZKHL 4PY8I 1L7IH 2XWBB 3FB7A 3TN0A 3KXFB 3RUGF 4ODHL 3U82B 3T0WA 3VFOA 5KW9H 1F4WL 3MRRB 4WHYH 5FDYA 4PLJD 2C3WA 1A7BA 2NCMA 1AHWA 1K3IA 3GSVB 4ZUWA 1FAIH 5JHDE 2GEEA 4HUUB 5FAAA 1S7VA 4LOUD 4FP8L 1ZV5A 5C07E 3WEXA 3QPXH 5DD6B 2FNBA 3VFSB 5C0EA 2VXTL 1I9RH 3W9EB 5AG9A 3UJIL 3D87B 3MV8D 5CGTA 3P4OA 1T2QH 2DDQH 1WLHA 4C4KT 1FQ9C 5TPWH 4ETQA 4YXLH 4BA8A 5DMKA 2XXMB 3QDHA 3S4SA 1I7RB 3BP4B 3KS0J 1G7JA 3SY0B 5JHLH 2W65B 2ID5A 2H1PH 3TBSB 1LNUA 1CF8L 1VACB 2Y5EA 4WW2C 4XMLH 3PHOB 5FO7A 3VG9B 2YD9A 3FO2A 3R06A 1JZ7A 3V6FA 1I1AD 4AEHH 3VI3E 1BBDH 1ZLVH 5DHVH 4XP6L 1IQDB 4PRNB 1BZ9B 3FFCD 3LKRA 1WC7B 5KSVB 4KKLD 4FMFA 4P4KD 4LP5A 5ESAA 5C1MB 4RISL 5T5NF 3RJQB 5T5NG 5KVGH 1RK1A 1CT8A 4NRXB 1EH9A 4O58H 3KPNB 2VLRB 3EYVB 5DRXA 2E3VA 2F8XC 1MLCA 4U6HB 1OTUD 4L9LC 2J4WL 4IS6A 1BF8A 1T66C 4ZFZA 2ZP0T 3V6OE 2F53B 5HDQL 4JGUA 4ZOAA 4QNPE 3FTGB 4G5ZL 4AIZB 2C4XA 3GGWA 3MROB 4GG8A 1JRHI 4KRNA 4H1LA 5AAWA 7FABH 4IRSB 2MFNA 3WIFA 1RHHB 4KAQH 3IU4H 5DSCB 4N8PA 1T89A 4AMKH 4QHMA 4C58B 4DN3L 5DHVA 4OFDA 3WL9A 1P7QB 3BDYL 4PJEA 1MWAB 3VD3A 3Q5YA 4MAYD 1FH5H 3K0WA 4XCEB 4XZUB 4WW1B 12E8H 4HAFA 3I02A 4WUUB 2UWEA 5I19H 1WT5C 5I1KH 3QAZB 4YK4C 1OAQL 2GFBA 3AS3A 2IF7A 4NP4H 3RP1A 3ULUC 2DQEH 2HVKB 3DRTB 2NY3D 4IOIB 1BGXL 1KLUB 1NBVL 2AJUH 4CADA 2IMNA 4F57H 1KPRA 1W8OA 3TH4T 2ADJA 5IG7A 4YK4B 2MHAB 4YHPB 4YDIL 4IOFD 4I0PD 2EXWC 5EUOA 4ELKB 4KRMB 5AYQA 1DLHA 1N6VA 3MV7E 2HKFL 1CLOL 4MHHI 3EGSA 4JY4A 1NBVH 2AJUL 2VXUH 3EYOA 3IXAA 1S7QB 1RZ8B 4I2XE 1U8PA 4ALAL 4JRXD 4MNQD 1A6UH 4X8XA 1AE6H 4LASH 5IVZB 2XZAL 1HYSC 1EBAA 1NFDB 2F58L 1IJ9A 1FFPA 2M26A 3V9FA 1TZIA 5D7IE 5H94A 3SDAA 1Q94A 2E9IA 1HK6A 1YYLH 3MOAL 3LVEA 4XAKE 3MX0A 2VN4A 4NQSB 3PQYD 2QADC 2P45B 3ORJA 1R5VB 2YUXA 4JG0H 1A6TA 1AY1H 1XIWB 5EG6C 4UTAH 2JTDA 1UXWB 3SE9L 3EOAB 4I1NB 3BZFA 4HWUA 3SE8H 1G6RB 3BN9D 5E5MB 2EEAA 3QEHB 2XTJE 5GGUA 3K80A 4K3DH 2AI0H 3HC0B 3G5YB 3NZ8B 4DN4H 1NLBL 4N9GA 5HYEA 4LBEB 3T09A 3NCBB 3MGTA 5KSAD 1KCVL 3RWDB 3QIUD 2GW5A 4LLWB 3BQUB 3WJJA 3R4DA 5FKAA 2AP2A 3GJFB 4FOMA 4QKXB 4P4RA 1GHFL 3HKFA 4R26L 2YPLA 1EERB 4NWTL 1CZ8L 4YR6B 3DIFB 3MV8E 1X5LA 2IADB 5J6HA 4J23A 3TWCH 1MJJA 1BF2A 1UH2A 5F8RC 2UZIH 4QCIA 1YN7B 5JA8B 4MWFB 3OZ9H 3O3DB 4J7RA 1FFOB 1FNAA 2I60L 4RIRA 4Z7WE 4YIQB 5DGQA 1S5HA 1LVEA 4Y19D 5EUKB 2KH2B 2PR4H 5J9PA 2HFEA 4JO4H 2A6JB 4Q74A 3S5LG 4Y5VA 4PJ5B 5C2UB 3ARTA 4OZHA 2J5LB 5I76B 1CD1A 2XA3A 1AY1L 5I18L 5HTSA 5C6TH 4YDJB 2GUOB 1RU9H 4PRAB 1EHXA 3L5IA 1ZEAL 1U58B 3OKKB 5TFSH 5L6YH 1UZ8B 2IPUG 5F1IB 3K4DA 2KZWA 4KGLA 3VRLE 1ED3B 4PRDB 3V6ZB 2NY2B 4BH8B 5LGHL 1CGTA 5CWSA 1RJLB 25C8H 4Q9RL 5CEYA 1IAMA 2UY7A 4P3WA 4WWKA 5T33H 5C9JB 1RUKL 1BEYL 5DRZB 3L5HA 1XZ0B 2DAVA 1MJ8L 1BM3L 2ADIA 4JKKA 3VFMB 4NQDE 4TN9A 1PG7L 1QSZA 3RDTD 2JJVA 3DI3B 3W11C 5IOPB 4PJAF 1HEZB 3M17B 4J4PD 4HLJA 3FMGL 3HI1A 5HGAA 1NAKH 4YHLL 3UBXG 1T0MB 3LCYA 4U1GC 5MEQA 1RJYB 3QQ9C 4S2SA 1TENA 1YDPB 3LB6C 1UB6A 3NAAH 4OI9A 4TTDC 2H6PB 2WINB 4Y0GA 4LPVA 4PJHE 1OQOA 4PRPD 5EOQH 3VE0A 4LRIA 5FO8B 3L3OB 3U36B 3BZEB 4P4KC 3BMVA 1F11B 2DDQL 4P9ML 1U8NA 5BV7H 1D3CA 2X09A 3OKEB 4YAQB 5BS0D 1CIDA 2H2SD 3GB7A 1AO7E 3L95A 2QBWA 1R3HB 3F7VB 3L3JB 1ORQB 2XXCB 1L0XA 4QXGH 3ZL4L 1TTFA 2HT2C 4MA8L 1NMBH 2CDFB 1A6PA 2LV4A 5HI5C 1F4YH 4OF8A 4JQIH 1C5BL 2IEPA 2X4NB 2QTEA 3DMMD 4M7LL 5FCUL 2HLAB 5HGHB 2LVEA 1IZJA 4K7PH 4JFEA 1BOGA 5C0DA 1N5AB 4H26A 5TQ0L 4OFIA 3V5HA 1I7UA 4PJAB 3X12A 4OZFH 4UQ3B 3STZA 3REVB 3VRIB 3ES6A 2PO6A 4XI5C 3U6RA 2A74A 1T21B 3HPJB 1D5BA 2V2TA 3V0WL 3DETC 3ARGD 4I13B 1LEKB 4MAYA 3DYPA 3TZVA 3MA7A 5JOEA 4U6TA 5E9DE 2V5MA 5GZOC 2Y06L 2F9BT 1EEYB 4GUPB 5EWIL 1IGIH 5FO9A 1KXQE 3E3QE 3KPLA 3VMOA 1ZT1B 3TYGL 4WNQA 1MFNA 3VXUD 3V0WH 3PWJA 5JW4R 1CFQA 2ZOKB 5F88B 1GPOL 4HK0B 5TGBB 5SWSE 3TM6A 1OWRM 2FSEB 1RIHH 1JRHH 3EYSH 1S7XB 4AH2A 4G80B 3ZKXC 4N5EC 3SDDB 1CDUA 3PUCA 5TE7H 2D7PA 5FHAL 3RX8A 5DJXA 4Q97A 5JQ6H 2R2EB 5E8DH 1ZHKB 3V52H 1NMBL 7CGTA 1IRAY 5HI4C 4I18C 5I9QB 3O9WB 1NC2D 5D93C 4L29B 4W6YB 2NR6C 3QG7H 4K3JH 2XQYK 4ZSOB 1YMMA 1RJCA 1RZGA 1T1ZA 3QNZA 2Q3ZA 4PJXA 1GC1H 5E8DL 3V52L 1MFBH 4X7TB 4ONGL 5CCKH 3ZYZA 4BK5A 3TPUB 4DKFH 2EYRB 2R1YB 3DUUB 3QDJD 4JFHE 5F9OL 5D9SB 3PWNA 4BQ6A 1S7RA 2PTTB 4EI6B 4U0RB 4KXZH 4PJEF 4FQXB 1FRGH 2SEBB 2ITDB 5I1DB 4M7JH 2HWZL 3LEVH 2D3VA 4OF3A 3ARBD 2OK0L 1JPGA 1UWXK 5EO1A 5B4MC 3RL1A 1OLLA 1T0NB 4G8EB 1HXMB 1OWWA 1YNLL 3HI6L 3S97C 4F7MB 4Y4FB 4OV5A 1NDGB 1JHKH 2ESVD 3AY4C 3H9YA 3WN5A 5TDPA 4LLQB 1MCHA 5DRWA 2F74A 4KK6D 5D8JL 1Q1JH 1CK0H 4JM2C 3GMQB 4KK8C 3HNSH 2EDFA 1RZ7L 2Q76A 3KPPA 2A6DA 4P4KA 4XNMA 3WSQL 4A6YB 2FGWH 1GC1L 2OJZL 2LU4A 1UCBL 5LJYH 5K59F 3MBED 3MJ7A 1X3DA 4OLXH 3ET9F 4XT1C 3VFTA 4PLKD 3OG4B 5TDNB 2YA0A 5GISL 3G04A 2ATKA 5C08A 5J6GA 5GZOD 3EJJX 1S78C 4MD0B 3W0WA 2IPTL 5HDBE 4TUOB 2GAZB 3QDMA 1Z9MA 4QGTA 3O8XA 4XPGH 1VFAB 3OWEA 4WUUD 3MLUL 3Q3GA 3HAEA 2IH3A 3QUYD 2Z91A 3ULVF 1II4E 3FHQA 3B3IB 4QHKJ 2ADFH 3RFZC 1GIGH 4U7SA 3NH7L 4JKPL 1K2DA 4U3XA 3KAAA 3WYRA 2J12B 3QB7C 1PKQE 2DQTL 1CFSA 5DMJB 2A73A 3TZVC 5DEFA 5GSRB 4WI2A 1Z5LB 2ARJA 3D2UA 4NKDA 3MRFB 3NZHH 2DKSA 4LKCA 1NJ9A 1SEBB 4M43L 4HJJH 3GMNB 1IC4H 1WIPA 1VFBA 4RGND 5I8CA 3QZWB 1GHFH 4YDLC 3JV6B 3KLHD 1IKNA 4UV4L 1WQVT 4KZEH 4BSWA 3C5SB 5GSVB 1OAZH 1YNTB 3BDBA 4M62L 4JFEE 4HCRA 4OI8A 4TRPH 5CLWA 1NLDL 4DVBA 3F5WB 5DJAB 3SE8L 4HIJB 4NWUH 4KPHL 4KTDH 1PQZA 4HS3A 1JNNL 4F2MB 3WUZA 3QUXD 3PDGA 5JOPE 1BZ7B 4HWZB 3BAEH 1FVEA 4YBLC 1UB5A 2VQ1A 3EO1A 1XF2B 3KWWA 2PXYD 4XXCC 1H3PH 1AFVL 3ETBF 3W11D 5EC1A 2BJML 2P42B 5JTWA 1JZ3A 3QCUH 4FFZL 1MHEB 3D69A 1F3JA 1BFOA 3REWB 5I1AA 4FHBD 2D03H 3RNKB 1BAFH 2AJYH 5ID1A 1Y0LA 3FOLA 3TYGH 3RZCA 5SWQB 4OCSL 3DVNB 3SE3C 5T3ZD 3MRNB 5I0DA 3NAAL 4P2OC 1AGDA 2HYMA 4ELMA 5JQHC 2I60H 5DJ2A 4YDVA 1KCUL 4PJ9A 1CLZL 4Y5YC 2NX5E 3E6FA 4ODWB 1T5WA 4PY7B 3AAZA 2BNRD 2XTLA 1QRNA 3MRJA 2WBJD 4GRWB 2OXGA 5D1ZC 2FJFB 5MENB 1FJ1A 1MI5E 3I2CH 4JDVB 2BDNL 2QV2A 1KFAH 4ZNEE 1QD0A 1I9IL 2C1PA 4NO0D 5B38A 4F58L 3IETA 4N8CL 1DBMH 3UP1A 1A9BB 1GOGA 3H9SB 4DW2L 4WTZG 1HH6B 2VIRA 1FDLH 3VG9C 2DM7A 3KPOA 3EO0B 2FJHB 1FE8H 2KKQA 2CIIB 1D5XB 5CJQL 5CEZL 4MXWH 1E28B 4LSPH 2L4OA 1UM6L 1MQ8A 3WIHA 3O2VL 1MRDH 1EHLH 4WO4A 4XP4H 1JZ2A 4G6JH 4DQOL 3VGFA 2CO7B 1A02N 2DMCA 2M2DA 5CSBA 4FQHA 2K3TA 1MY7A 1N3NB 3PWPA 5DJ6B 2BOCA 3O6FB 5DVKA 3PWUA 5IHBA 2JB5L 1XH3A 3EKCA 4LSPL 2P8LB 3O2DH 5A3IC 2AABL 3QDGB 1Q38A 3F6IA 1JCKA 3EFFB 1NC4D 2WBJA 1SJHA 4MJ4A 4ODBD 2JE8A 3RZWA 4PBVC 2NNAA 5ISZB 1AQKH 3B9EA 1C5DA 4LQFL 4MNHB 4TUJB 3U48A 1FL6A 4WU5A 4FXGB 3SKMA 4WWKD 3MFGB 4M00A 4X7CC 1CGVA 3LEXA 3UYPA 4MA1B 3BPCB 2HN7B 2JJUA 4F3FA 1CXLA 1RUKH 1BGXH 3RGHA 4ZO8A 1IGML 1TVBB 5ID0B 4LPUA 3O6FC 4APQD 3IJYB 2RQ8A 4YHKH 1CLZH 2Z31D 3MRBA 4C56B 3OPZH 1NUDA 1JTOA 4IDJL 4RQQA 3U83A 1X5JA 1YYMH 4PP1D 4LPTA 1IKFL 1G9NC 5L8KB 4PJIE 4RX4D 1FO0L 4KQ4L 4C59B 1JGLH 1CDYA 3WFDH 1EV2E 2IQAB 1QVOB 2B39A 4LVOB 5KSBF 5EORL 3QDJB 4FXKA 3RIAK 3EHBC 4TNWK 4F9PC 1PYWB 2XFXB 3WIHH 4RAVA 3FJTA 4K8RC 5E2UL 2PTVA 1FIGL 1FO0H 3RY4A 2R0KL 1OGTB 3DV6A 4GSDH 3WFEL 2VITA 1W0YT 4EOWL 2EDBA 3BE1H 4EQ2A 4P5TA 3U2SA 2RB8A 3T4AB 3ARUA 1QSEA 2DLEA 1MJUH 1AO7D 3CVIL 3WIIH 3WLWC 4EI5B 3SE3A 1ORSB 3U0PA 4FNLH 1S9XB 1Z3GH 4OQTA 4PJBA 1S9YB 1EFXA 2HT2D 4HXAH 1HINH 1T5XA 3DECA 3V5KA 1TZHA 3IF1A 5A40E 1WBYA 2CDGB 1AFVH 5CD5C 1IVLA 5JNYA 1RIVL 5EO0B 1RURH 5C09A 5DMIH 5IF0B 2AXGA 4JFED 3P11H 1AXIB 4L8SB 2R8SL 4KJYB 1ZXQA 1ZGLA 4HGKC 4RAUA 3VWJB 3MODL 1BBDL 4PY8J 3WO4C 2HRPL 2NY0C 5DRNA 1RMFH 4OKVA 4IJ3C 2KPNA 4S1RH 1I8KA 4HIIA 5D5MB 5CKAA 2VLKA 3QIBD 3QRGL 1ACYL 1R3KB 3HUJB 1KJ2B 5I19L 4L4VE 4KY1H 4OT1L 4H0IA 5DUMH 4DGYL 5FGCB 4I3SL 4JFXA 4Z78A 4PS4L 2NXYD 1OF2B 3D0VA 4K71B 2C7UB 3BESR 3GHEL 1JNHA 2AS5M 5D72H 4LCUB 4NC1C 5F9WB 3DUSB 4KAQL 4G9FD 3TO4D 1FLRH 4X7FC 1X6LA 1MY5A 1YQVL 4ODTH 3P9MB 1S7SB 3S37X 1S3KH 2OTWA 1ZS8B 3MLTA 4O5LL 3WFCH 3CJJA 3BP5B 5IV2B 3UC0H 4OFVA 2FX9H 4TOYH 4ZXBA 1UVQA 2Z31C 4APQB 1RZKC 3LQAH 1QBLH 3QR2A 4G8FA 5HHPB 2BSTA 1J0KA 3CFEA 1U3YA 3VFRB 3QWRA 4XX1G 2X70B 2IBZY 3NPSB 5D1ZA 5ETUB 3QXUA 3NVQA 1BFVH 4QOKA 5HHXL 1R5IA 4GW5A 2V5YA 4I2XB 4YX2L 3IGAA 3NCJH 1PGRB 5C0GB 1MFCH 5EU5B 1MCOH 5F9WC 4GKZB 4U6VL 5IW3A 4FQJH 4XMLL 1AHWC 5KJRL 3UTQA 1BVLA 2G5BA 1T1YA 4XMPH 3CUPA 5D1XC 3J7HA 3T0EC 3MLWL 4XNUL 1B2WL 5DYOB 3O6FD 3T3ME 4IRJD 3SDCC 1X5IA 2YS4A 4X83A 5IKCA 2VLJD 2VNCA 3MGAA 5C0IB 3NPSC 4Z5RA 1EA9C 2V5SA 3TT3L 1QR1A 4N8VG 1FZMA 2YD8A 4L5FL 1NAMB 4OGXL 4R7NB 3GMOB 1FNFA 2H3NA 2XWTA 1UADC 3PV6A 1BFSA 1C12B 5IBTH 2I9TB 1YMHA 1YPZB 3N1QC 3OF6A 1MCCA 5C86A 5I16A 1PD6A 4PJ9C 1MCBA 2JCCE 3LS5H 4XXCA 5JDSA 4Y8DC 3TT3H 4L8DB 4PB0L 3WS6C 1C16B 4M6OH 5EB9A 4XBPA 4I5BA 3UTOA 4R96B 2RCSH 1XF3A 4EZMA 4D8PB 5MHSE 3QWOA 5INDB 3C08L 5CZXD 2QSTA 4P46C 4PLNC 4UDUA 3VCLB 1BWWA 4RZCA 4R9HA 3UROR 4JQVC 4XMKH 4M7ZC 4EXPX 2DF3A 4KVNL 4LFHD 4NDMB 1KTDB 1Q8MA 2VR9A 1TDQA 2F19H 5JQ6L 5D93B 5EUOE 1UJ3A 4OQ1A 1G9ML 4X9GA 3E3QC 5DR5H 2YBRA 3PWPE 5DEZA 1D9KD 4M8QA 3F58L 3SN6N 2VH5H 5E00A 1IM9A 3MBXH 1B0RB 2BFVL 4OGZA 3V0VA 1NGQH 4N0FA 1JHLH 3VFPA 2GI7A 5DJ0B 4LCCA 2DYPB 4NQCB 1W2KT 3FT2B 1TXKA 2G2RB 3HPLA 4JFZH 3I3EA 5HDOA 1JGEB 3EOBB 1UACH 4XVJH 3QUKB 2Y6SC 4QTHA 1FORH 2VLJB 2CLZB 3FQXB 2CPCA 1U3HD 3O4LE 3WDHA 2OMBA 1MCQA 3SCMC 3C5ZB 2G75A 2QQLH 5AUMB 3QCVH 2HH0H 1NEZB 2Q86A 2X4OB 3B2VH 2BNQE 5CMAA 2MKWA 2IANB 3TYFA 3RWIB 5DD0L 4PP1C 4H25A 5C0AA 4KHTL 4JFYA 5D7JA 4F7TB 1G9MC 4KRPD 4POUB 5EOQL 5DUPH 3ZDZE 3O6LH 1G9MH 2B0SH 2APWA 3SKOB 3ZSTA 1JVKA 1S9VB 4MJID 2XZQH 2FD6H 4KY1L 2O5XL 3INUH 4WVRA 3BPNB 3MRMB 1QG3A 2WAHA 4HH8A 1Z9LA 4F7CA 1NDMB 3ZO0A 5MERB 4PV8A 1CLCA 4LCWA 2A83B 2VMFA 1G0XA 4IMLA 5D6DC 2RCSL 2MOVA 3JUZA 1B6UA 1YQ2A 4OZIB 1WCBA 3VW3H 4UINH 1PG7H 3FN3A 2PUQT 3GMMB 5ABDE 2H32B 1ZSDB 4GKNB 1RURL 4PRIB 4YPGA 5D7LB 4X0KA 3CD4A 3LRGA 1QPPA 4AEIH 1DBAH 3MLVL 1KEML 5EBGA 3VFGH 5EZLB 2DQDL 4UT6H 5JIHA 1NAKL 2IBZX 3WE6A 1XF5B 3ZE0E 4OZ4A 3O3BB 4OBSA 3VGAB 1T20B 2E27H 3HZKB 4LOUC 4P2QE 5T1LD 4NQED 2AK4E 3LPFA 5F21B 1DN0A 1CICB 1E4WL 3ARPA 2BY0A 4JM2B 3GSUB 5FHAH 4LU5H 1NC2B 1JGUH 3VXPB 3TCLB 4PGDA 1JMXA 1HYSD 5HVHB 1FLTX 2K7PA 4F80A 2X4UB 4MSWA 4PGEA 4X4XA 1FNGA 2X4QB 4LKXA 3GSOA 1JTPA 4FZ8L 5FK9A 2F53D 4XAWL 3UTSA 5IMMA 5IROA 4RGOH 3FQTA 2DKUA 1J1OL 4DUVA 3P4MA 4G8GA 3JVGA 2EDLA 1KPVA 4IDJH 2YC1A 4HV8B 5CEZD 2P5EB 2YD4A 1V8HA 4JLRA 1NAML 3VXUB 4GXUN 5HHQA 5D71L 5HPMB 1I8IA 4OLZH 4JKWA 3T2NL 3LN9A 3ARBB 1OPGL 4PBWD 3IRZA 5HHXH 2ATPB 5EU6B 1EHAA 5DD5L 5EORH 2FZ3A 2AW2A 5IBLC 4I18A 5FYJL 4JDTH 3LKPA 1Z2KA 4XNQA 5IR1A 5FYKU 4AIOA 3VH8B 2EICA 4LQFH 3EDFA 4ZOBA 3RWHB 2PYEB 2NXYB 3BUTA 1QSVA 4TOYL 5LGKA 3CSYB 5C9KA 4WFHE 4U1IB 3NFNB 3IKCB 1NLBH 4H8WL 4NZRH 3FO9B 4JZNB 1XF4B 2JCCB 3P0VH 1GZQB 1PFCA 4HHAB 4NRZB 1G9EA 4JO3H 1MF2H 1CE1H 3BHBA 1I1FB 3LH2H 5IB3A 1F4AA 3GM8A 4D0BB 3QUMA 2EYTA 3BX7C 4JAMA 1NGPL 1R0AL 2J8OA 3OR6B 4PJIF 2KQMA 3FB5A 1YA5A 4YHYB 3G9AB 3RA7H 4P9HL 1GGCL 3ULVH 2DN7A 5GS1C 1MIMH 1A1MB 4P99A 3GKWL 1QHOA 1CFBA 1BQHA 4PJDA 4KVCL 5MEPA 4MVBD 3KDMA 3DYMA 5LWYH 5EA0L 4EXKA 3G6JB 4JO2L 4XNZC 1G7MB 1I7TA 5J0BA 5ILTH 4LSSH 4NM4H 1WZMA 2BHYA 2OL3A 5DHYB 4X99A 5IEKB 2Y7QB 1UM5L 2VZOA 1EFXD 5A2KH 4X98A 3W9DB 1H3VA 1UQSA 5KSBE 1ZVSB 4KZDH 4RGMB 3SCMA 2F8OA 4YO0B 5I74C 1TJIH 3PG2A 1DE4B 4EI5C 3LKOA 3LMJL 4QXTA 5C0CA 2YOCA 3QJFB 2R0ZL 3MRGA 4HKBA 4OCXH 1XCTB 2YN5A 2XPGA 1X5KA 2AKRA 4MJIE 4P9HC 3MNVA 3IAPA 2OS7A 4HUVB 4J3VA 3BN9C 3QPQD 2X42A 4KFZC 1RK0B 2BNQA 3S36H 3ARGA 3EO9H 1BAFL 5DJZA 3QH3B 5SWZA 4ONOA 4OQTL 4ISVB 4AMKL 5E08L 2GK0A 1FZOB 2RHEA 3B9VA 3G6AA 3QUMH 2ZJSH 4EBQH 1WISA 5F7UA 2J5LC 1RZJL 4KK9D 5F3BA 3FCTA 3LB6D 4Q9CA 5D1QA 5FKPA 4MLSA 3VFUA 1PX4A 4X6CE 3UPRB 4UIKL 3DXAE 4ZPVB 4FQQB 2X4RB 5JPNA 4KZDL 2AGJH 3QDMD 1AJ7H 5F3HB 3BKYH 2Q8BH 1HZHL 3TBTA 4J3XA 3SCMD 1MELA 4PBXA 3O2WL 3GMRA 4JKLA 4ZYKA 5EFIB 2R2BA 1V7ML 2HLFC 2BVOB 2NY3C 3WHE1 3QNXA 5D7LD 1Q0XL 3P30L 3VMNA 5INCB 3IU3B 15C8H 1A7PH 1JZ4A 1EO8H 3BIKA 1ZK9A 4GBXB 3X13B 5LKNA 2V7HB 2EXYD 2K9UA 3N9GL 1JPFB 3FT4B 1DDHA 3U9PH 2FLBT 4Y2DA 4B50A 4GLRI 2EC9U 3JVGC 3UJTH 2I07B 5IB2A 1QFHA 5DEGA 3H42L 3DV4B 3P0VL 1W72A 2GSGA 1DUZA 2XZQL 1ZTXL 4FFYL 4RMTA 1CGUA 3QJHB 3L5WA 1SEQL 5C0BE 3NCMA 3ARXA 3BO8A 1IL1A 2EE9A 4MNGA 2NW3B 3BWAB 4HKXB 4YHNA 2R15A 5H2BA 2VXSL 4X80L 2FB4L 1JI2A 4C83B 5BVPH 5D7JC 1OT2A 4JQXC 2MJWA 1Z9SA 2Q87A 4MXWL 2RFXB 1TETH 2R0WH 3CDGB 4R4BB 1T0PB 3QEGL 1NFDF 2Q3AA 4ZUVA 3FO2B 4MX7B 4IBLT 2H32H 3B9KA 5CS7A 2A6IA 5DQDL 4K71C 5F7LB 2QR0B 1JYNA 4Y5XB 1HKLL 3CFIC 1DUYA 2VB5A 5CD3B 4LNRB 4URTB 5KSAB 3E2HB 2PYFB 1HXYB 3F7QA 3IVKA 1FORL 1DEEB 1MI5B 1U8HA 1MCJA 3OKDA 3B8SA 1VADA 4F15C 4MNQA 1ZMYA 5IHUL 5F7DB 1U8IB 4JDTL 4P2RB 2FBJL 4WI9A 3OAUL 3N06B 1KG0A 3MV7B 4W81A 1Q72L 3HAEG 3QUZC 5KVEH 5K9JH 3C8KB 5HDBF 1UKQA 1T83C 3MBEB 1VPOH 4MAUH 1MEXL 4WW2A 2MMXA 1PKQB 2GIYA 4YFLI 5KG9A 4IRSA 3CX5K 1ZANL 4FMKA 2NX5A 4HDIB 4HC1H 4DKEH 3HZVA 3S35L 4M7KH 4LVHC 3SDCB 4MD5B 4GRWH 2GJ6B 1BBJA 3NFSL 2CKBA 1KB5L 1KIPA 5ENWB 4IRZH 4I9WE 3R1GL 1MWAA 3LQZA 2DD8L 1U8QA 1KCRL 2BOBB 4NCC2 5TE4L 1WEJL 3I6LE 2CSPA 5B3NA 3ULVE 3JWDL 4IOFC 5FGBA 1PLGH 5IFHL 5EO9B 4D94A 2W9EL 3OB0K 5DI8B 3MBEC 4NWUL 4NFDA 6CGTA 2W9DL 5D6CB 4OD3L 1CFTB 3LAFA 4RMVA 5EIVA 3FQWB 2PXYA 1EHNA 5ACZA 1O0VA 1KT2A 4I8DA 4U1MB 2PW2B 4QXUH 3QDJE 4IIQB 3BH8A 4PJEE 5IVNA 1EEZB 1WITA 4PGCA 3I6GB 5CGYD 3ULVD 5J57B 4K94C 1Q9LB 1FFQA 1C08B 1AP2B 1IC5H 2DQIH 5EPMA 3TA3B 4LHJB 2COQA 2A1WH 1QQDB 3CSBA 1MHHB 2FBJH 4NNYB 1CTNA 3T4YA 2D0FA 1FL3A 1AI1H 1NCAL 1U3JA 5ICYB 1MUJB 3HMXH 5I1IH 1N0XL 2BC4A 1FGNH 2ZUSA 1LE9A 4PP2B 3HLAB 3MACL 3GMLB 4IHOB 3C6SB 4OLXL 4LEXL 5EOTB 3DWTA 2XKNB 3QUXC 5I8KH 2JK5A 4GMSH 4Y4KA 4P2OA 4DGVL 5CSGA 3SJVB 1UA6H 4U6XB 4TYUA 1TJHH 3EOAA 1TETL 2R0WL 1U93A 4EUPH 2FYYB 4K7FB 5KSBA 4O02L 3QCVL 3HZYB 4JRXA 4GMSL 5DJCA 4GG6B 3MNWA 5DVNA 1EJOH 1KLGA 2R56L 3UC0L 3ISWA 1KENL 5IMOB 2FGWL 3SO5A 3VXTA 3C6LD 2FEDD 2AJZB 1QSFA 1F2XK 4GFTB 4N0CD 4C54A 3U7YH 1MAKA 2ICCA 2XA8H 5SWZE 3X17A 5CSZB 5ICZA 4U0RC 2ILLA 3GMPB 5FHBH 5IQ7H 5C0BA 3BPNC 4M1GH 2X5PA 3EOYG 1FC1A 1QYGL 1OQXA 2CIKA 1NKRA 4Z0BL 4ERSH 4EN3B 2HFEB 1FNHA 3U7YL 4M7ZB 4CVWA 3MRPA 3NPZB 4ZFOB 1JF6A 1ZLVK 1FGVL 4AT6A 5GS3A 5KVMC 4NRYB 3HNVL 2BSRB 2DB8A 4GAJL 4UMGA 5J06A 4ODUA 4PJCF 4Y8AA 2CUHA 1GVIA 5DDHA 4O2FB 4Z95H 4F7EB 4KUCD 5BVJA 4DKFL 2VXSH 1AO7B 1CDJA 3KHOA 4PJHF 5AZEL 1LO5B 5C6WH 2EH8L 2XTJB 5JMRA 2DTML 4R0LB 4XNUH 5IB1A 3H9HA 4B53A 2ZUUA 2VABA 3H3BC 4G9FA 3TO4A 1XGQB 1MWAL 1S8DA 1KTKE 5FOBA 4D9QD 3V4VH 4YQXL 5T1LB 1ONQB 4CMMB 2GYSA 3VWKC 5EC2B 5EOCJ 4OD2A 3OKOA 4U7MA 4JHWH 4PJAE 4NQVB 5CP3H 2HTLC 3GEWB 3EUUA 3T0DA 4KMLB 3HG1A 3FFCA 3IFPB 3JWDC 5IMLB 5LCVL 3FFDA 3QCTH 3S96A 3WS3B 4H88L 1CXHA 3QWRD 3JTSB 1BPVA 2IFFL 1RZFH 3ABZA 1KELL 3BZ4B 5MEQB 1T7YA 1N7MH 5JW3L 4JFDB 5FYLL 2WANA 4WV1C 4V1DE 3R8BB 4JRYB 2EE2A 3WBDA 5LGJB 2ZWLT 4HH9A 4KDVA 4QRUB 3JV5A 4GOSA 5IVXA 3TO2A 3P3YA 1YPZE 1ZOXA 2VN7A 4Z7NE 3I84A 4L4VD 4DKDC 1JP5A 5BRZD 3C87A 4HUMB 4ZPTB 1U8NB 4HUXB 2R0LL 2VOTA 1TPXC 2WNGA 1FG2B 4KKAC 4XBGB 3S3SA 1CDIA 3NMEA 4J6RL 4I77H 5FF6B 1AJ7L 2BVTA 4U1LB 1E4XH 3SDXA 4FQCH 1ORQA 3OBAA 5IVOA 5TDOB 2X4TA 4HCRL 2CD0A 3KLDA 4ORGA 3UJJL 2FEEI 5C0JB 3QQ4A 1WF5A 1UGNA 3O3UN 1EGJH 4LCIH 4XBEH 2IH1A 3JBG7 3ROOA 2Y36H 3H6JA 4DTGL 1R24B 1M6OA 1NMAL 3DSFL 1ERNA 2AI0L 4Z7WF 5GRZA 3QEUB 3CFJA 1GRWA 3PGDA 5IB5B 3WKNA 2F58H 3KYMB 3TIDA 5L2KB 1Q9KA 5DFVD 5B39B 4OGYL 4Q58C 4QRQA 1ITCA 1A3LL 1NGWB 5I1LB 4YUEL 1OTSC 3AS2A 2O61A 1JFQL 1KTLA 1NCBL 1P4BL 3BEVB 3UCRA 2Z93B 4MGXA 4Z8FL 4XP5L 1JMZA 4EDXA 4WFFE 4L8BB 5HHME 1MEXH 5MEOA 5IFAL 1MCRA 4ESKA 3RUGA 3SKNB 3C6LB 4MA7H 1YNKL 3Q0HA 3L5XH 3MUJA 1M7XA 1MOEA 1IGCL 1UT9A 2VXQL 5FA4A 2WUCH 1SJEA 2XTJD 1IILE 4ELME 1WTLA 2O5ZH 5JW4M 3VA2C 3TBWA 1J8HA 2ZOKA 5F88A 4DEPB 1XIWD 3KPRB 2ZSVB 4LPXA 2AQ2A 3MRDB 5D7IB 2E6PA 1HILB 4PRBB 1KACB 2PO6D 4OLUL 4DVRH 3MUGB 1KYOK 1FPTH 3GBLA 2NY7H 4QF1A 5JW5A 5I2IB 3D1MC 4FXLA 3PQYA 1D5IH 3O8XD 5BXFA 3HC3L 5TF1L 3KPTA 3QQNA 1JYWA 3O41A 1RZGB 1HNFA 3UO1H 5EIIB 3BGFB 2X40A 1QRNE 4WHTA 5FYLD 2ZCLL 1DQDH 2ORBL 4OAWB 1I85C 5F9JA 3RA7L 4X7EC 4Y4KD 3S35X 2NY4B 5BQ7B 2YD2A 2C3HA 4YH6A 2ITCB 2YKLH 3UJTL 3TWCL 4FZEL 3P9LB 3SKUD 1CE1L 3MLYH 4K7PY 5B8CA 3GZKA 2IAMB 4DFHA 1TCMA 2NY4C 4UOW0 5D7IF 3IT8D 4D0DA 1INEH 3WXWL 5FECB 3PHSA 4MXQC 2I27N 1MCKA 1IGYA 1LP9B 5D2NA 5FA3A 3LV3B 4QRRA 5IJKA 3V8CA 4BH7A 5EZJA 4AEIL 1OAZL 3ULSB 2E8ZA 4KJWC 1HSBA 5C0BD 3TO4C 3QHFL 2DTSA 2EC9T 3MLZL 4AEEA 2VDKH 4TVPL 4Q6IB 1YYLL 3D18A 1A6ZA 2E7LA 2Z35A 2FHBA 5HHNB 2VLLB 3G04B 5C08B 2WW8A 5EA0H 1U8JA 3IDMA 2C1OA 1HDMA 3CMGA 1FYTA 3ECBA 3B83A 5DJ8B 3HAEB 1CU4H 2NX5D 4LSRH 1EXUB 2VZUA 3FB6A 4P3DB 1S9WA 4XPFL 2Q20A 4NQDB 1TNNA 4HT1H 2X9WA 4M48L 1AGBA 1JNJA 4HCRH 2APFA 3ZKMC 2ICEB 5C2BL 4HGWA 3SGJC 2VUOA 4XC3H 4WIQA 1KLFA 1HSAB 3H7LA 2A2QT 3GI8H 2QHRH 3GIZH 4UNTA 4AY0A 3LKNB 5B22A 1FE8L 4LDLB 5CP3A 5EBLB 1IKNC 1SM3H 4FRWA 4Z7UE 2CLVB 1FZJB 3IFLH 4TSAL 5DLMH 4Z0XA 2VLKE 3MCLH 4O51B 4ZFGH 1F3DJ 2V2WB 2R2CA 5I1CH 4BSWB 4BQBA 3RNQB 1DL7L 5DUBB 3FL7A 1IAIM 4XCNB 3MXVL 2BVQA 4GXUM 4XP9L 3ZT5A 4U1GB 4RMRA 1KNOB 1YJDC 3OJDB 4EDWH 5BMFH 1YEJL 4APQC 3L3DB 1B6DA 3GBML 3MXWL 4MDJB 3SDYL 1SVCP 1U92B 4QRTA 3IAGC 1QFPA 2XZZA 1BZ7A 4G9DB 1P5UA 3W5NA 3DO7A 3JXAA 3DRQA 2F5AL 3L3GA 1V7NH 4NCDA 4XPFH 4CW1A 2AQ3A 1INQA 5FUCC 3U30B 4RWYH 1SJXA 1KENH 1A7OH 1YJDL 3S34H 3D9AL 1XF1A 1CGYA 1A64A 4G6MH 1S9KC 2J4WH 4JY6A 2BMKA 2KL6A 2LVCA 3VDAA 3ULVL 2BVPB 2WZPD 1GL4B 4X6DB 4JFFA 1CLYL 1KJ2H 5AG8A 4Y5YA 5EBWA 4GMTH 1Q9WB 3G5XB 4LLVB 4OFYD 5T1KD 1HHIA 3WXVH 2VERN 5IJVB 3OHXB 4LSVL 4LSQH 1NGZA 4OZFG 1WIOA 1S7UA 3U4EA 4P23B 4NM8H 4XP6H 1D9KB 3FN0L 1QNZL 1FNEB 3AAZB 4M5YL 4KK6C 1F5WA 1I9EA 1S7TB 1OW0C 1NCNA 4HF5H 3S5LA 1MCIA 3BD4A 3TN0B 1L7TH 4YGAB 3IETB 4NO3B 2GCYB 5F1KC 3H9SA 1AHWB 1MHCA 5HHOD 5TE6L 4NZJA 3MBXL 3GK8L 1GYAA 2IPUK 3RUGE 3V95A 4FFVD 5DK0B 3KPRD 2QKIB 4WRLA 4PJ8C 4A6YH 2KUTA 1NUGA 5CLTA 4OD1H 3EDKA 3NACH 2VYRE 2E7LC 4PJ7F 2EDEA 3A6CL 1FZKB 5BJTB 1MWAH 4QRPA 1N26A 3MUZ1 3L3HB 1ZHNB 4NT6B 3KLAB 4OBRA 1E27A 5E8OA 3N85H 4GKSA 3X11A 4G6FB 3HE6D 1X5GA 5BO1H 3PWUB 5ACLA 4ONFL 1LHZA 2Y07H 1KIQA 2G5RA 3GJEA 1LNUB 3BKJL 3HNSL 5AZEH 3HNVH 4LIQE 3X3GL 4XHQA 3NFSH 4J1UB 5CEZE 3UBXA 2OJEB 3HR5B 4UIMA 3U9UB 3BGMB 2Q7YB 2OLDA 4P46D 3CLFH 4NM8L 2VISB 5GJTL 1RIUL 4WTWA 1IMHC 5DA0B 3C9NB 4G8IB 1KBGH 4YGVA 5DJYB 5ADOL 4HKJB 1BQHG 4BSVA 3FT3B 5ICXB 4GMTL 4W68A 4LFHG 3AREA 5AZ2L 3PWPD 3MXWH 3HHRB 2C4FU 4GAYB 4IS6B 3CH1B 5JO5B 1MNUL 2C3VA 2GTWB 2DJUA 3NGBB 3FONB 1MFEL 3FTGA 1EMTL 1IT9L 4NN6C 1P7KA 5I17B 2NPLX 1P4LA 2YD1A 4P3CL 3RVVC 2Q7NA 1HQRB 1XR8B 2FHCA 3RX5A 4M4RA 4TULL 5DFTA 1QVOA 4K2UL 1MREL 4HUNB 2AJXH 4L3EA 2X6MA 4OLYL 4WFGD 5K9KB 4UT7H 2CDEB 3MV8A 2AJ3B 5ALBH 2DQCH 4KTEL 2DM2A 5BRZA 3I02B 2VITB 3QUYA 3X3GH 3IDJB 4MNGE 5HGDA 2JB6B 4FQCL 5J1SC 3IDIA 2N7AA 4E5XA 4N0YL 3QIUB 1LMKA 3BD3A 3LZFH 1ZT4B 5F6IC 4DGVH 3KS0H 4MD4A 1KPRB 4Z7VB 3RTQB 4LCYA 2Q8AH 3QUXB 3ZYJA 3MJ8B 3N85L 1S78D 4MJ2A 4U1HA 2VDOL 1CWVA 3OQ3B 3C60D 5T3ZE 5D72L 2EH7L 2DM4A 1QLRB 1QPXA 2EIBA 3VG0L 4BQ8A 4PG9A 4NNPL 3EGSB 2VDKL 4TVPH 1QZ1A 1G0YR 2ZCHL 3VXNB 4O2CB 2V17H 3TBVA 3MJ9L 3MLWH 5D5MA 4JN1H 1CXEA 3PJSA 1FAKT 1FFPB 3B9KD 4PPTA 3O4LA 2LTQC 15C8L 4GW1B 5KJRH 5CJOH 2FIKB 3DXAD 5E2VL 4PJIB 1BIHA 5H94B 2HA1A 5JLZA 3FQNA 4H5SB 4YE4H 3EJYD 5DF0A 4UUJB 1RI8A 2XG4A 3H7BA 2XQBH 5I1HH 5GZNC 4MJ6A 4IMKA 1XIWA 1XGRB 2QEJA 5KOMC 4X6EA 3F7YA 5D1QC 4HFWB 1QNZH 2V7NB 5TF0A 1YEIH 4DOHB 5DHXB 5F93C 1RUPL 3HC0A 1UYWH 3IFNL 2WP3O 3FQRA 3D39B 2FWOB 1Z3GL 3V4PL 3N1GC 5DC9B 3RWDA 4GQPH 1LILA 4UZGA 5GGRY 1DBBL 3C60A 3S35H 3FAXA 1K5NB 3H42H 2ZOLA 1I9JH 5GHWH 5MENE 1X5AA 3SKJH 4PREA 2YZ8A 1WWAX 5HXMA 1RUAL 1I1YB 1YEDB 3WV0A 4HD9A 3FMGH 3UO1L 4Y2DC 5E70A 4Y2DD 1CGXA 3IXTA 3MA9H 4JFFD 4RMQA 4PS4H 1IT9H 3O3DA 4FFWC 4XP4L 3H9SE 1CL7H 2FR4B 3LN4B 4I0PA 4NZUH 1I4FB 3C2SA 2P8PB 5EUKA 1I3GH 3LSOA 1YEJH 1C1EL 4HBCH 4AYFA 1MRFL 1EZVX 2J1KA 4OZHB 4LVNB 1NSNL 1RIUH 4PJHB 2BNUB 5CBAB 1ZA6A 4XXDB 2ZUTA 3WO3B 2VDQH 1YN6B 2DQGH 3T04D 5FUOH 3SJVE 4OZIF 2OZ4L 3CFCL 1IZKA 5JW4Q 4K8RD 3WUWB 3WCYA 5HI3C 4OCWL 4KU1A 1KN4H 3TESA 1NBZA 1NAMA 1DLFH 3CXHJ 4G6KH 3E8UL 4ONHA 1O7SA 5GIRA 4YNYB 3HI5L 1JWMB 4ZG1A 3MRLA 1NCBH 3CMOH 3QEQB 3HE7D 4U1NA 4QYOB 2YPKA 4Q9RH 3LQAL 3VGHA 1IC7H 4I4WB 4JO4L 1NC4A 5F1OB 2IQ9L 5KOVC 4FQPA 1U2CA 4EQ3A 5CIPB 3PP3K 2Q1EA 1UG9A 3M1BB 5D96C 1DVFB 4WGVB 2ARJQ 4DGIL 3HE6A 1NCTA 2IMMA 1RU9L 3MUHL 2FX8L 3GSWB 1HHJA 1SJVA 2WP3T 3ZHLA 2VL5A 3U9PL 3AY4A 4LL9A 1J12A 1B0GB 4OGYH 4NDMA 4FG6D 3GSNB 5F6HI 4YXKH 4Z7OF 1D6EB 3EOTL 4XVTL 1A4JB 4NN7B 1ZVHA 4MQXD 4KDTA 5A2JH 3VDBA 3H3KA 5HVFB 3B9DA 5D7KD 3VE0B 4LIQH 1SQ2N 4MB4A 2DS4A 3KLHC 3ILPB 4DN4L 3O8XC 4OM1L 3UTPD 1CD9B 1M05A 3HS0A 5CEXB 4BFEA 1M4KA 4MJ5B 4FABH 4JFPA 1NLDH 1DBJL 1U3HB 1YEIL 2EZ0D 5CJ8A 1KELH 3D85B 5C0AE 2Z4QB 4LP4A 3QULB 1I1AB 3SGEH 4QTHB 2I24N 2D7TL 4K3GA 1DQQB 1YEEL 2DIJA 2I5YH 4NZDA 4R2GD 5IK3B 3LRHA 3UTZA 3KNBB 1JUFB 4HIHB 1FVCA 1NANH 3BKCH 5DD6A 5AUMA 3LKSA 5F7EH 3W0WE 3DMMB 2CUMA 5JXAH 2I25N