4G8EB

Crystal structure of clone18 tcr
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
247
structure length
241
Chain Sequence
GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRPPLTTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords alpha chain clone 18 TCR
publication title A conserved human T cell population targets mycobacterial antigens presented by CD1b.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 241
sequence length 247
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eB02
5DO2D 3CK0H 4NJ9L 4PJFE 1KB9J 1UM5H 1CFTB 1BOYA 1WZ1L 2XQBH 2AXJA 1UWEL 2Z8VC 1YMME 1T1WB 2Q3ZA 4MB4A 3QXDB 5F3HB 3EBAA 1J0YA 3UJIL 4IJ3C 3ROLB 4KI5D 4D0CB 1MJUL 2ILLA 3CFCL 4EQ3A 1Q9KB 5LQBH 4NWTH 4KDTA 1YNLL 4LDEB 4F37F 4U6YA 3P4NA 4PRDA 5BW7A 4TVPH 3RL2B 1UXWA 4OTXL 3KJ6H 4QRUA 1BWWA 4NBXB 1NBVL 2YR3A 1BBJB 1EMTL 1WVZA 3ULUL 1BJ8A 2GK0A 4BQCA 3Q6GH 1JL8A 4JY5L 2H26A 4J3SA 1ZA3B 3A6BH 4NUGL 3HNVL 4MNGE 1BHGA 4FZEL 3VRIA 4AYFA 4FFZL 3LKOB 4Z7OF 4G42B 2CSPA 3VFVA 3N1QC 3HN3A 3ZTNL 2A77H 4ALAH 2IBGA 5DSCA 2X4NA 3FFDA 2N4IA 1L9NA 1YEEH 3E3QC 4RNRA 5C0IB 2VXSH 1R5VA 2J8UB 2P5WB 3QJHA 2YN3A 1NBYB 4XXDB 1OP3K 4PJDF 1ORQB 2BVPA 2OSLB 1OT1A 3MLSH 4Y5VA 3WFZA 1G9NC 4NQDE 4X5WB 4JRYD 5E6IC 5A2JH 3D9AL 4Q0XH 1C16B 4PY8I 1FL6B 4NHUB 2UUDK 1OARL 4Q9QH 3H9YA 3ES6B 4MAYA 4L3EA 5T3ZE 4G8EB 2VLMD 3V6FA 3TNNA 4OIIH 2IPKB 3UTZA 1FL5B 4EVNB 5J56B 1R3JB 1U95B 4CADB 2HA1A 4Z7VF 2MKWA 3VXRA 1NH6A 4S2SB 4NN5C 1VFUA 3PG2A 1XIWC 4EDWH 5LGJB 5BVJB 4UU9B 1C5CH 5CJQH 3LS5L 1AKJD 5GIRA 5JW5B 1EO5A 2R0KH 4UIMA 4KQ3L 5D6CA 4HCRL 1CXKA 4PJ7A 5FYJU 3MRRA 4ODTL 4OI9A 2WUCH 5HHMD 3RY6C 2CD0A 3GIVA 2QKIB 5DRWB 2FL5B 2C3XA 4AQ1B 1I3GL 5L2KB 1S7TB 4UOW1 1AO7D 3T77A 1BREA 1D6VL 3OR7B 4CL7A 3X13B 1AD9A 1MRCH 5TPWH 3RVUC 4HPYH 2ZG2A 1NC2A 2OL3L 2L0DA 5GISH 4ODHH 5D5ME 3U36A 2AJZA 3UTSE 4PRHB 2F54D 3FO1A 5EIIB 4HKZA 2P46B 4LPVA 3OZ9H 1FJ1A 3MOBL 1I4FB 1BEYH 2JCCB 5LVEA 1F90H 2FX7L 2O61A 1CU4L 1IGIH 1HI6A 5HHNB 5BOPA 2VZSA 4QXWA 1U91B 3O6MH 1QFHA 3SKMB 4FS0A 5CKGA 1RUML 3IFLH 4QY8A 3D48R 1MY7A 4XNUL 1CFQA 1ZT1A 1JN6B 4M43H 5F21B 1R5WA 5SX5H 5C1MB 3NCCB 1D3CA 4BJLA 5C07A 1CLYH 5C0FB 4J4PA 2AKRB 3TZVC 2QR0B 4LIQL 1Q8MA 3AM8A 1ZLSL 5AYUL 4X7CC 3MGOA 1XCTB 1FNGA 1KPVA 4KROB 3BVNA 4NC1E 5EORL 3MV11 1V7NL 1ZLWH 4NUJA 1I1AB 4GAJL 2HAZA 5FV2A 3FQWB 3RWFA 4P23C 4A2LA 1AGDA 3V5DA 4G80B 2QSQA 1MHHB 1IBGL 4EI6A 4AIZB 5FFLA 3IF1B 1MIMH 2Y4SA 2DTML 4P2QD 4KTEL 1IGCL 4W4OC 3HFML 2VZVA 4UTBL 4A6YL 3UJJH 5E08H 2OTUA 4M00A 3AS2A 1A7PL 2ESVA 4WEBH 4ZXBD 4AM0A 5E0QA 3H42H 4GOSA 2WUBL 3Q48A 1H5BC 4JQVA 1G84A 4M03A 1JZ8A 5IMLA 3D39A 1ZSDA 4YFEA 4Z7NE 5EBLB 3CXDH 5MEPA 3RY4A 3L6FB 4LCCB 4PS4H 2GCYA 3RTQA 5IJKA 4RMQA 5ACZB 5BS0A 4LPUA 8FABA 3O3UN 1MCRA 4NGHL 1FBIH 3O41A 3EZ8A 2Y7QB 4KMLB 3DOSA 1BFOA 2NY4C 4MJ6B 4BZ1H 3RKDC 4M62H 1CLZL 4NQSA 1J9CT 1MCKA 1KCSL 4PRIB 5C08D 3NCEB 1EJ6A 3V6OC 3CC5A 1F3DJ 2AEQH 4MXQD 2QLVB 4NNXA 3RIFK 3TN0A 1XFPA 4TPRL 1RD6A 2XY1A 4QRPA 3GNML 2HWZH 4POUB 4OI8A 3F58L 4X6DB 1Q0XL 3S4SA 3SE3A 4GRWB 4HBCH 4PLKD 3Q3GA 4OQTL 3RDTC 1EFXB 4EKXA 1BFVL 1FFOB 1U58B 3C5JB 1LHZA 2VXQL 3LOWA 4OCWH 4WUUE 3G5YB 4QXGL 1MWAA 2A9NH 4Z18A 3U1SH 3MRKA 3B3IA 5FYLL 2B4CL 4MVBC 1FL3A 2DQCH 4PGCA 2A74A 4XNQA 1LNUB 3JXAA 2Y07L 4YR6B 3IXAA 2DM7A 1L4IA 3BGAA 4Q74A 1WBXB 3UC0L 3TO4B 2DQDL 5INCA 5AD0B 5H35B 4F9LC 5C09A 4NPYA 3TPKA 3TPUB 2G9HA 1A6TA 1IGTA 2H32B 3WL9A 3P0GB 3GSQA 5GJTH 4LCUA 4JM2C 3P77A 4ZPTB 1KIQA 5B3JE 4BKLB 4PJ5A 1CDCA 2V17H 3IDXH 4C55A 1S3KL 1BQHA 3EYOA 4JHWL 5FGBA 4YXHH 4HPOH 3LQZA 1MCOL 4EUPA 4RDQF 4LHUD 4XCNB 4P2OC 4QCIA 1ZGLB 1FYTA 3DX6B 3QFJD 3MRJB 7FABH 5IVXB 5F3BA 4EN3B 5KSUB 3W0WB 5GS0L 4O58L 1AE6H 1UJTA 1JZ5A 4JPKL 1HEZB 3RNQB 2Z31A 4LSSH 4X6CA 1Z3GL 3P4MB 3SCMD 3VD9A 2FB4H 2NY2D 1K5NA 4XXCC 2BRRL 1LEKA 2BVYA 1BMGA 4CMMA 1DQDL 5J9PB 1B0GB 2LV4A 3CGTA 1HXMA 4H8WL 3QUXA 4NHCH 4ZOAA 5FM8A 1G7JA 5F7WC 3SGEH 4DKDC 1QKZH 1SJXA 3TWCH 1JPGA 3QB7C 4PJFF 4P9ML 4GQ9L 4B41A 1GZPB 3ARDD 2Q76B 2DL9A 4QOKB 3IFPB 3IU4H 4X0KB 1SY6A 4F57H 1ADQH 5GSVA 2B1HL 2I5YL 1RZFL 4MSWA 3V6BR 3L3OA 4L4VA 2F53A 2EH7H 2UWEE 3QXVA 4UQ3A 4OAWA 4M8VA 2ZG1A 3O4LA 3M8OH 1BGXL 2EE6A 2YEZB 4Z78A 3KGRA 2ADIB 5AZ2L 2A6IA 3LRHA 1S7SB 5JDJA 3F12A 4OKVA 2V5SA 3MUJA 1NCCH 2VLJA 3SJVA 1WV7T 1BQLL 4Q9RH 4KXZI 4EOWL 1SJEB 2DN7A 3VDAA 3ARVA 3GHEH 4F58L 5DD1L 3CFIC 4JN2A 3I6GB 2E7BA 4S0SD 4NZRH 1M05A 3BKCH 1F6AB 1ACYL 2BC4A 3TA3B 3IVKB 3KNBA 1G9ML 1KNOB 1DQMH 3PL6A 5CBEA 4FQLL 2VZUA 4RBPH 3OTTA 2CIIA 4FQHB 1RZGA 2IAMD 3FB8B 1JVKA 5HYSG 3LH2H 3MBEC 4HIEB 3NIFE 3X17A 2CJUL 2R2BA 3QZWA 2EYRA 3GI8H 2X4SA 3TNMA 5I8CA 1G0XA 4ZFZB 1CICD 1CT8A 1KJMB 2IEPA 3G5XA 3H3PH 5MEOA 2PR4L 3AS3A 3VFOA 3MXWL 3V4UL 5I1KL 4LCCC 3DVFA 3ZDZE 4X6EB 1RIUH 4M61A 2PUQT 4Q2ZA 1UGNA 1QRNA 2CK0H 3TJEL 1AGCB 3BKJL 4G8FB 1MCNA 4FMKA 1L7TL 1CZ8L 4LSUH 4KZDL 2BDNH 2D9CA 2HTLC 5EIQA 2C1OB 2B4CC 5DJDA 1YNKL 4GT7A 2V5YA 5SX5K 5ISZE 5DR5L 3BQUB 3O9WA 4QT5A 3ZKMC 2VABB 1IFHH 4HGKC 1DQQA 2IANE 3OGCA 4DKFL 2W92A 2OP4H 3MLXH 4XPGL 2R69L 5DJXA 5MHSE 1LDPH 2XN9D 3CLFL 2MNUA 4KC3B 2NLJA 4PPTA 4XMPL 1ZLWK 3VXUA 1KPUA 4JLRA 3SDXE 5E2VL 3HNTH 4UV7H 1SVCP 1OP5H 4U6YB 3O6FD 3P4NB 4PRDB 1CI5A 3NA9H 2XKSA 2YUWA 3L3GA 1J1OL 1UXWB 5I1IL 2VDQH 3ARBA 4QRUB 5CGTA 4OLZH 2CQVA 2KDGA 1ZKAA 2GK0B 2DQUH 2HRLA 4TUJA 5ADOH 1EFQA 2H2PD 2H26B 2OR9H 3O2DA 5C0CA 3VRIB 5GS0C 5T5FL 1HWGB 3MNWA 3R0MA 2ZKHH 3VFVB 4HX1A 2P5EE 2FCBA 4L8BA 3RRQA 1D6EA 3I6LE 4Y1AA 3DWTA 4NT6A 5IBUG 3P11L 4PYHA 4APQA 3MLVL 5DSCB 2X4NB 3FFDB 4RFOH 4RNRB 2BVEA 1DFBL 2PXYA 1R5VB 2GW5A 1DL7L 4ENED 3QJHB 5F88A 4OCYL 2BVPB 4XB7A 4Y5VB 1EGJH 2IH3A 1K6QL 4MB5A 5D70H 1HWHB 1P4BH 3S37H 2CUMA 2H3NA 2DI8A 4HFUH 1KTLA 1XAUA 1TCRA 1UACL 3BEVA 1Q38A 5EZOH 4EN3C 5A16A 1RZ7L 4MAYB 4L3EB 5KVFH 3V6FB 3TNNB 4PD4K 3UTZB 1MFBH 1NPUA 4GQPH 4JQIH 4ZPVA 4YX2L 1WQVT 2VDLH 1U6AH 2Z8SA 4PJDA 2E9WA 1NBQA 4HEPG 5D2LE 3VXRB 1G7HA 4ZMAT 1XH3A 1KCRL 1PQZA 4JFEE 5JW4R 5CBAA 1DBBH 4Z7NF 5HGBA 5GIRB 2DRUA 4PGDA 4RAHA 1EHNA 2B5IB 4UIMB 2X41A 4OF8A 5D6CB 2DQTL 3IAPA 3EW3B 4P5MB 2JB5L 5JO5A 4YHKL 4PJ7B 4G7VH 3MRRB 5TE4H 5K9QG 4XVJH 3GIVB 4UAOB 1TTUA 1INDL 2P47B 4JG0L 1KEMH 3TV3L 5C0AE 2I25N 5IVZA 3I2CH 4K71B 4Q97A 2C9AA 5GGUA 5HI4D 3T77B 4QRRD 1I9JH 2F5BH 4EI5D 5LAXA 2HLFD 1AD9B 3FFCD 3G5VA 5JIIA 2IH1A 3IETA 1NC2B 5F7MC 5JTWA 1G9MC 3PABA 5FGSA 1MFNA 4IRSD 4P46C 5D1ZA 3U36B 2AJZB 4DOHE 3FO1B 3KJ4B 5LWYL 1QFPA 5FF6A 4IRJD 3R06A 4HKZB 5HYJD 2HG5A 4LEXH 3RVXD 1MCJA 3WXVL 1FJ1B 3BZ4A 1JJUA 3UEZA 3ZT7A 2FGWH 4QRQA 5D1XC 5DZOA 4N1CA 5IESL 4M9OA 2O61B 4ETYA 1QP1A 2IBZY 3HMWL 1HI6B 3DX8A 4PJEE 4TQEL 3RGVD 1O7SA 4KK8D 1F13A 4W68A 3MRIA 1Z9SA 3QDJD 5ID1A 4V1DE 5DD5H 4GS7B 4QY8B 3CPLA 1CFQB 1ZT1B 4TUKL 3EFDH 1R5WB 5HYFA 3QDME 5EO9A 1HHIA 2Q8BH 4FQ2H 1TNNA 4JFYA 4ZUWA 3QA3A 1LP9A 1WTLA 3QHTC 5C07B 4PLNC 5IJVA 3W82A 1AC6A 5CEYA 3MCLL 2H41A 1CGTA 2MPAL 5CZVL 5I8EB 3ZYZA 5E5MA 3MGOB 4CUCA 4HG4J 1FNGB 1KPVB 3BHBA 3BVNB 4U1HA 2LVCA 2P48B 3FN9A 4MQ7A 1LO5A 4I0PD 4NUJB 2AI0H 3QWOA 4LHUG 2ORBL 3RWFB 2VDPH 1AGDB 4DTGL 1OB1A 3N1FC 1A47A 4KVCL 4RQQA 4XGZA 4P5TD 4EI6B 3CDYA 4OZIA 3HTLX 3NBNA 2V5TA 2ZUSA 3V0VA 5IEKA 4S1QL 2HFEA 2R0LH 4LDOB 1CFSA 2OTUB 2ESVB 1A3QA 4QYOA 4AM0B 4G5ZH 1X44A 3TJHC 1PDKA 1OQOA 4JANA 5IMLB 3D39B 3A0OA 5MEPB 3Q2CA 1YEHH 2GCYB 4S10A 2Y25A 5D93B 3RTQB 3AC0A 2OZ4L 5BS0B 4LVOB 5T3XH 3L5JA 8FABB 3BP6A 1C7SA 4J3UA 1WFUA 2DBLH 3O41B 2AJVH 5FHAH 3U4EA 5HJ3A 4IRZL 4NQCA 2BNQA 3QNXA 5EU6A 1G6RA 1OQXA 5B3NA 1BFOB 1H15A 5EC1A 1MPAH 4NQSB 1YJDL 3BUTA 4OZHA 1WEJL 1OPGL 4Z6AT 1FFQA 1YMHA 2VSDA 5BMFH 3B9AA 3CC5B 4NNXB 3TN0B 4RBPK 1XT5A 1LO3L 4KKLC 4QRPB 2DLHA 5BW7C 3FKUS 5FDWA 5HVHC 3IKCA 3S4SB 1NCAL 4CN6A 4LNVA 3Q3GB 3MRBA 3W2DL 2GHWB 3G6JE 1OHQA 5I16A 2F58L 4XHQA 4C56D 5D2NA 1QHPA 5ETUA 1MWAB 3MRKB 4Q9BA 4NRZA 4K07A 1FL3B 4PGCB 2A74B 4XNQB 5HI5D 4KDVA 4LARL 3WJJA 4PB0H 1QD0A 4NZTL 3IXAB 5DK2A 3UTTE 3EJYC 4M6OH 3HHRB 4E41E 3MLTA 1VEMA 1HZHH 1KOAA 4KJWC 5INCB 5CKAA 1FSKB 4WCYH 5C09B 4NBYB 4NPYB 5ITBH 2G9HB 4GW1A 1A6TB 1IGTB 3WL9B 5L7XH 3GSQB 2FRGP 2OMBA 3PGCA 2E9BA 5DUML 1R6VA 2L4OA 4LCUB 5HI3C 5C6PB 4BA8A 4Y5VC 3P77B 3NCMA 1KIQB 4XCEA 2Y6SC 2E8ZA 5MEND 2D7MA 4PJ5B 3S6CA 1P4LA 5CLWA 3FZUD 3RU8L 1MIEL 1BQHB 3EYOB 4MAYC 4LPXA 1UKTA 4S1RL 3LQZB 3CVIH 4P3DA 1X5LA 2OJZL 5D1QA 3VA6A 4EUPB 3L5HA 4QCIB 4PJXE 1FYTB 3CFKA 4LSTL 1B3JA 5DJ8A 3MNZA 4HS8L 1OP5K 5I1HL 5JOPD 5F3BB 1FO0A 2FYYA 5CAYB 5I8OH 2M26A 3KR3L 1J1XH 3RX7A 3DMMD 2Z31B 4PRPE 3BD5A 2B5IC 12E8L 4WFFE 3ZDZF 1SYVA 3QIWA 4X6CB 4I18A 3VWKA 4R6UA 1K5NB 1TPXB 5E94A 1LEKB 3N0PB 4N0YH 5GRZA 4R3SA 1RJZA 4CMMB 3W5MA 2FJHA 2EDRA 3WUWA 1O0VA 1HXMB 4K71C 4OCSH 3QUXB 5HHOD 1MCPH 2A1WH 1G7JB 5IEHA 4Y19A 1A6WH 5JW3L 4JFFE 4WFEE 1FFRA 3SBWA 1JPGB 3PQYD 4PY7A 2YUVA 2O5YL 3NACL 3O8XA 5E2WL 4JN1L 5GZND 2JJTA 3GRWL 4UT7H 1FGVL 4U7KA 3KXFD 1UJ3A 3VFTA 3MRCA 3T0EC 5GSVB 4NCDA 4MSWB 1FE8H 2AERT 2RHEA 4K7PY 4KJPD 3L3OB 4L4VB 4P59H 1AXTH 4W6YB 5FGCB 2F53B 5GS3A 4Y4KA 1UQSA 2H1PH 4UQ3B 4OAWB 4LQFL 4RMRA 4WJ5A 5HBBA 4YFLI 3O4LB 1HINL 5I1EL 3TIDA 1YMMA 4Z78B 4R8WL 1WC7A 1E4WH 2A6IB 4HC1L 1CF8L 2OR8A 2P24A 3F12B 5D8JL 2MQ3A 4OKVB 2VLJB 3SJVB 4NYLA 2NZ9C 2GSGA 1KEGH 1N0LA 3BIAX 4YHPA 4MMXC 4NIKB 4K3JL 5I18L 3BOVA 3K4AA 4JN2B 1I8LC 2RB8A 1ULVA 1M05B 2R56L 3EOBA 3WLWD 2BC4B 5J6GA 3W11C 3C8DA 3D25A 3KNBB 4DUXA 1KC5L 3AREA 3PL6B 5CBEB 2B20A 2YXMA 4G6AC 4MNQD 4MNGA 2BCKA 2YK1H 2CIIB 1EERB 3GHBL 4WW2C 5E8OA 1RZGB 4K9EH 3QEQE 1N6QH 1NKRA 3OGOE 1HH6A 2HFFA 4YXLH 1YJDC 5KVDL 2R2BB 3P0YL 3QZWB 4Q6YA 2BY1A 3HG1A 3MV8A 5HHXL 2EYRB 4C4KO 4HLZG 2X4SB 5T1MA 2DB8A 1QR4A 3TNMB 5I8CB 1YECH 5I19L 1ND0A 3B2UC 1CXEA 1N64H 1CT8B 5KVGL 3EOTH 3BPNB 1W0YT 4OT1L 5BQ7A 5IFHH 3G5XB 3AMLA 4YHZL 5MEOB 3U0WL 3QCUL 3VFOB 4GXUN 5D2LF 4NQDA 4C58B 3RTQC 4M61B 5IJKC 4Q2ZB 1TJGH 3BI9X 1QRNB 1OGAE 4LVOC 1EHXA 2MCPH 4NO5A 3FN0L 3UTOA 3TT3L 3QDAA 2J7LA 5DJDB 5E1AA 1MCHA 5BV7L 3O9WB 4M4PA 2ZUXA 4QT5B 4XNYL 5CEZE 3A6CL 2IFFL 1DQQB 4LLWA 3VWJA 4Z0BH 3OGCB 4K8RD 5INDA 5JXED 5DJXB 5I6XC 1P5VA 3JV0A 5C0BE 1WTGT 1VCAA 3OF6A 3SE3C 4ZTPH 2NLJB 3CX2A 3WN5A 3V4PL 1WLHA 3VXUB 1KPUB 4JLRB 1CWVA 4H1LG 4YIQA 3CH1B 1BZ9A 3MV7A 3L3GB 1JPSH 2HMIC 3ARBB 4TVPE 2R29H 4ORGA 4RAUA 4DQOL 3EYUL 3SKOA 1J0IA 1BQSA 3QUZA 4XI5C 2XG4A 2I26N 2PW1A 4P2RD 2AABL 3HC3H 4TUJB 3RWEA 4PJEF 2R4RL 5C0CB 4DVRH 2DQEH 3ULVD 1AD0A 4WI6A 1RPQA 3UPCA 1U8MA 3KDMA 1OTTC 3MNWB 4RGMC 3CXHJ 1P6AB 3ZT5A 4IMKC 1YPZE 4L8BB 4V2BA 2VIRA 1D6EB 4Y1AB 4NT6B 4X8XA 4MD4A 2FH8A 2Y23A 4APQB 4ERSH 1QLRA 1U0QA 3MNVA 1BM3H 4QTIH 5DD3H 3T0AA 2PXYB 3BN3B 3V9FA 1X9QA 4JRYA 4XVUD 5F88B 3VXSD 5GGSA 1S78D 2VDKH 9CGTA 5HYSA 4MJIA 3MUZ1 2NY5L 2IH3B 1FLRL 2YPLE 1VFMA 2H3NB 4U3HA 3UAJD 4YHLL 1KTLB 4RMSA 1TCRB 3CZFA 1WFOA 3BEVB 5A16B 4F7PA 1DSFH 4G8GE 1LO2H 25C8H 4YHOH 2YUXA 4ZPVB 4OSUH 1JZ6A 2HJKA 4PJDB 3OV6A 3GI9H 1IM3A 3B5TA 1KBGH 3MOAL 3NH7L 4NKQB 4G9FA 1AKJA 2P8PA 1QYGH 1G7HB 1N4XL 1TPXC 1XH3B 1PQZB 1KCVL 5CBAB 1JNJA 4N8CL 5HGBB 4YDLB 4PGDB 4XPFL 3E6HA 4JM4H 2BSTA 3Q6FA 1DLFL 2R4SL 5JO5B 4JO2H 4WWKA 5SWSA 1MWAH 1A7OH 2W0PA 2K3TA 4OI7A 1AO7A 1KCUL 3V7AG 4OCXH 4QXUL 4TRPH 4JAMA 3E6FA 3GEWB 5IVZB 3MODH 3THMH 3BPOB 5GGUB 4OFDA 2WM0A 4AIOA 5DUPH 5LAXB 3MZTA 1RHHA 3G5VB 3IETB 2IH1B 2F54A 4TYUA 1PGRB 1KELL 4WTWA 3PABB 5MEQA 3LPFA 3S36X 1IMHC 3KPSD 3FRUA 1GGBL 2DIAA 4HBQA 1L0QA 4TNWK 5D1ZB 4BSJA 2BVTA 5KSAC 3QUML 5FF6B 4TSBH 1QZ1A 3R06B 2HG5B 3G6JF 5FUZL 3BZEA 3BZ4B 4K7PL 2XG5A 1RFDL 3MC0A 5D7JD 2DQIL 3E3QE 1H8NA 1T5XA 1WT5C 1DDHA 1HHGA 2X1OA 2XTJE 3K80A 3QI9C 4QRQB 5BRZE 4NP4L 1ZE3C 2D4DA 4KY1L 1SVZA 2X09A 3HMXH 1JPTL 1I7RA 3EJJX 4RWYH 2FEDD 3UTPE 3DX8B 1D5IL 5D7LE 3MRIB 5ID1B 3S8WA 1RK0A 1OAUH 1ZEAL 3PHQA 4NN6C 3CPLB 2EZ0C 4Z77A 1FGNH 3JSSA 3RZCA 1UC6A 3KLSA 4HKBA 5EO9B 4UILH 2JJSA 5L9DL 1HHIB 4JFYB 1GZQA 3IJSA 2IGFL 5DLMH 3D3VD 3QA3B 1LP9B 4ZUWB 3VD4A 1CDJA 2DQGL 5IJVB 5CEYB 1T3FA 5D71L 4PTTA 3BP4A 4JFPA 1A9BA 3GGWA 1WICA 5E00A 3J8F7 5E5MB 5TE7H 3BHBB 4U1HB 2HT2D 1JP5A 4PJIA 1OSZA 2DJUA 4GAGL 1GRWA 2EDKA 2I07A 4MQ7B 1LO5B 5EOCJ 1CN4A 3QWOB 1OB1B 3RWDA 4RQQB 5IB1A 5D7IE 4XGZB 5AWNL 4OZIB 2P8MA 4KMQA 4PJXF 3CVHL 4ZXBA 4HT1H 3OAZH 1IAIH 3V0VB 5IEKB 4LBEA 1QSFE 5FHBL 2XWJA 2DYPD 4PD4J 3QIBD 2HFEB 1CFSB 4GMSH 1SY6H 4QYOB 4IOFD 3HE6D 4ENEC 5BZDA 1JZ7A 3LZFL 2LQRA 3U2SA 3WHXA 2XQYK 4QHNA 5GGQL 2DQJH 4JANB 1D9KA 3C2AL 4ONFH 2ADFL 3DECA 4C59B 5J11B 1UKQA 3DSFL 5M94B 4PJ9D 3BP6B 3AB0B 3T2NL 1H3PH 4BQBA 1MJ8L 5HJ3B 2J5LC 5MI0B 3U4EB 1XGUA 4NQCB 2YMXH 2BNQB 3WIHH 3QNXB 5EU6B 1G6RB 5CJ8A 1T7YA 5E99L 2X05A 3T1FA 3BH8A 1SHMA 5EC1B 3VFNB 3H6JA 5B38G 3KPQA 4OZHB 4CMHB 4HK3N 1FZOA 4HAGA 2NXZD 1YMHB 1F4YL 1MHCA 1NFKA 3RVWD 3QISA 4M1DH 5K33A 1YNTA 2VUYA 4OGYL 1XF3A 4I3RH 5HXMA 4XTRD 3BDBA 1UT9A 4WW1A 2AQ3A 5FDWB 4AL8H 4G3YH 3VXTA 3IKCB 3ARBC 5IQ7L 3MRBB 3CDCA 3GMQB 3OAUH 1ONQA 1FNLA 3BE1L 4M5YL 1M7XA 5I16B 4WHTA 4P4KA 4Y5XC 5CJOH 4FQ1L 5D2NB 5ETUB 2AGJL 3VMNA 1L9MA 2WBJD 5E8DL 4YHML 3RVTD 2VO5A 4D94A 4RMWA 4NRZB 5A43C 1T7WA 4P99A 1FFPA 5LXGL 3OR6A 1ZGLP 4O5LH 5DJYA 3B9KD 3LDBB 5DK2B 4DVBA 4WTZG 1X6LA 3NCJH 4AJ0A 3MLTB 1J5OL 3F8UB 4IRJC 4UNTA 3LEVL 4M8QA 2PXYC 5EB9A 3EDKA 5C0ND 4GW1B 5I1GH 3PGCB 2I27N 4F7TA 4KJYA 4XCEB 5KBNC 5IR1A 4RGND 1HILA 2MJWA 4XNMA 1P4LB 3RIFF 2VQ1A 1DN0A 3WD5H 4LHUA 1P9MA 5E5RB 4NO3A 4HZLA 1GGTA 4LAQL 1ZLUH 2D7QA 2BNUA 3WNLA 1OAQL 4P3DB 1RJYA 3QQ9D 2FIKA 5D1QB 4ZS7L 1VFBA 4M7JH 3CFKB 4PRBA 5DJ8B 3MNZB 1FO0B 1IC5L 1ZVHA 1R3LA 4XPAL 2FYYB 2WWMD 5DMKA 4BZ2L 3S3JA 2BERA 2ERJB 5HHVH 3BAEH 5EZIL 5DS8A 1SJVA 4XPBL 1SYVB 3QIWB 3QDGD 4LSQL 4I18B 2VH5L 1MRFL 3VWKB 3D5OF 4WI9A 1F58H 1EIBA 5E94B 2EKJA 4R3SB 1NAKL 5AEAA 1RJZB 2FJHB 3NFNA 3HR6A 4P5TC 3WUWB 3H7LA 2BOBA 5FB8A 5AZEH 2MFNA 1J05A 1J10A 4M5ZL 5IEHB 4Y19B 2YZ8A 4NJ9H 3ARDA 5I0ZA 1WZ1H 3KPRD 3O2DH 1UCBL 1UWEH 4PY7B 3O8XB 3VFMA 3WDJA 1GGYA 4L8SA 3UJIH 4K3EH 5D1ZC 3VG0H 3RHWK 1UJ3B 1X4ZA 2CDGA 4M4RA 3VFTB 3MRCB 2MQ0A 4FFYL 1DQLH 1YNLH 1F42A 2XTLA 2UZXB 4AIXA 4L29A 4PREA 3MACL 1CDGA 1OW0A 3GMLA 1VDGA 2ZUUA 4OTXH 4Y4KB 1UQSB 1VA9A 2J8UE 4ZS6D 2P5WE 4WJ5B 3MRLA 5E03A 1EMTH 1JTTA 1NGZA 3TIDB 3ULUH 1YMMB 1XCQA 3WUZA 1G7LA 1WC7B 1WWBX 2P24B 2HTKD 3HNVH 4QHLA 4FZEH 1DN2A 3MOQA 4FFZH 4NYLB 1MHEA 2GSGB 3O6LL 1IT9L 1F6FB 4YHPB 3RI5K 1F8TL 3TCLA 1KTRL 1A6AA 1OTUD 2X1QA 2Z92A 3EOBB 3F7PC 5J6GB 2P7TA 3D25B 2WP3T 3MRGA 2IAMA 3AREB 4MQXD 4JQXA 4MNGB 2FX8H 2ZUYA 2BCKB 3L3IA 1F97A 5KZCB 3BD3A 5E8OB 3H3KA 1HH6B 2HFFB 5E8EA 4KKAC 1OARH 2V7NA 3TGXA 3HG1B 4K23H 3MV8B 2QSCL 5T1MB 3ECBA 5C6WH 3FMGL 1MLCA 1ND0B 1FDLL 2X89A 2D7TH 1RIHL 5BQ7B 1A21A 4UQ2A 1UEYA 4B0MM 4OGAD 4S1SL 1XF4A 2XPGA 3BJ91 2CO6B 4NQDB 3IAGC 2VR5A 5I15L 2ICES 3LS5H 2ZUQC 2DJSA 3H3BC 1J87A 1EEQA 4KMTL 4XHJD 4PRHE 1IAMA 4KQ3H 4NO5B 3TVMA 5DK0A 5MI0C 2JIXD 4ODTH 3F7VA 2JCCE 1NSNH 1C08A 5E1AB 1N2RA 3UDWA 1G9EA 3U83A 3P73A 5D2LA 2FJGA 2QHRL 2XN9A 4L4JA 4LLWB 3VWJB 4KTDL 4UDTA 1QBLL 4Z5RA 4F7CA 1QLEL 4EIGB 1IZKA 4OFIA 1RU9H 5CIPH 2OL3H 3O6FA 1ERNA 4KAQH 3WN5B 4DGIL 4YIQB 2YKLH 5J1AA 3BP5A 2WK2A 1BZ9B 3MV7B 5T3ZL 4OF7A 2DWEA 2XWBA 4XWOC 1KJ2A 1B0RA 4NQUA 2EC8A 2EYTA 4ORGB 4UNVA 1N26A 3OAZK 4RAUB 3SKOB 3QUZB 1AXIB 1MCWM 1CU4H 2PW1B 4JFHD 1NBZA 1KXQE 4RIRA 2P5ED 2XZAL 5DFVC 3RWEB 1NL0L 5K9QI 1RUMH 4HHAA 2NY3B 1AD0B 5J13B 4XNUH 1JGUH 2OK0H 1T89A 1U8MB 4AZ8A 3KDMB 3MV9D 4HUXA 4Y2OA 2A83A 3VGHA 2J6EL 2VIRB 2OI9C 3K3QA 4MD4B 1XF1A 2AEWA 1W72L 4R26L 1S5IL 3UBXG 1FYHB 4H20L 4LIQH 4FQIL 1QLRB 5IHUL 3X14A 1ZLSH 3MNVB 3CFJA 1IC4L 4LFHD 2NMSA 4JRYB 5ICZA 5GGSB 2YXFA 5HYSB 4MJIB 2HH0H 1V7NH 4OB5L 4XMLH 2YBRA 4XCFL 5BO1L 3QCTH 1J8KA 2VITA 1I85A 1REIA 3CZFB 1IBGH 4P49A 2XZCL 4F7PB 2DTMH 5D7IF 4KTEH 1VSCA 1FCGA 3HFMH 1J0JA 2ERJC 4PRIE 4UTBH 5A40E 5FM5M 2HJKB 1BF2A 4XWGL 1IM3B 3QIWC 4WHDA 4U0QB 2WUBH 5GGRA 4I18C 3EO9L 4G9FB 1AKJB 1JTPA 2P8PB 1UWXH 1GC1H 1IQDA 3DYOA 5F7UA 2W38A 1I9RL 4X6DE 3DXAD 1LE5A 2ITCA 3E6HB 5HHMB 4PGJA 2H2SD 1GIGH 3S97C 2BSTB 3Q6FB 5LBSL 1ITCA 4WWKB 1D5ZA 5SWSB 2O5XL 2V5RA 4M1CC 3VI3E 5EOCL 3SBWC 1AO7B 4QRRA 4CBPA 3KVQA 4EI5A 4X7DC 3TYGL 1KCSH 4JAMB 3E6FB 4NO2A 5E5UB 1JCKA 3RPIA 1UJ3C 2QQKL 4IRSA 4M7LL 1RHHB 4O2FA 3K4ZA 3GNMH 2F54B 2DLIA 5DVKA 5F7EL 4MA1C 3M17A 3F58H 2ZUTA 4H1LA 3SE9L 2NR6C 1Q0XH 4Y4KC 5HYJA 5MEQB 1SMOA 3FRUB 4OQTH 4RCAA 1ZLUK 3DHJA 4X6BA 5JHLL 2JLLA 2VXQH 4HK0A 4F7MA 4OLXH 4WV1C 5DZNA 1QVOA 3BZEB 4QXGH 1F4XH 3C5ZD 2EEBA 1T5XB 1RIVL 1DDHB 1HHGB 5FYLH 3RGVA 5ESVA 3QDJA 4JO4L 1VFAA 3HE7D 1I7RB 3OQ3B 1NGXA 1EEUA 4HS3B 3GBLA 1MVFA 1JRHI 1RK0B 1IL1A 2APVA 3RA7L 1FNEA 3PHQB 1FO0H 4Z77B 2BSED 5A2FA 5IVXE 3RZCB 4HKBB 4WFHE 5FCUL 5IBUB 3W0WE 2DQDH 4NCC2 4XPHL 3IJSB 1R3IL 3LEYL 3VFRA 1BFTA 3BX7C 3I75A 3AREC 3ZYOA 2X4OA 4FN0A 5F70A 1T3FB 5D7SL 4PTTB 3BP4B 4JFPB 1A9BB 3GGWB 4L5FL 5E00B 4I0PA 5GGTA 1EK3A 1S3KH 3NA4A 4PJIB 2BVQA 2OM5A 4JHWH 3O45A 1OSZB 3KLDA 3RJQB 2I07B 1SJHA 4NKOA 3WFCL 3T0XA 3RWDB 5IB1B 1ETZA 2OXHA 3VE0A 5IGXL 2X2YA 2P8MB 1LD9A 4ZXBB 1QBAA 5GS0H 3MLZL 5EO1A 4LBEB 2XWJB 4JPKH 2BZDA 4QOKE 1X5HA 1BIIA 4XVUC 1KXTB 1U8HA 2RQ8A 2LABA 3WHXB 5BZDB 3U2SB 4PJBE 4QHNB 1D9KB 2BRRH 5IBLD 2ADJA 1PZUB 3H9SD 1DQDH 2HT3D 5JIKA 4PJXA 4KTYA 1GSMA 1HOCA 2YRPA 3KAAA 4H8WH 2OQJA 3PXHA 3K8MA 1T03H 5D6DC 1XGUB 2FHFA 4X4ZA 4D0DA 1Z5LA 3T1FB 3BH8B 3HZMA 3KPQB 4P9MH 3GKZA 1FZOB 1JFQL 1MHCB 1FVDA 3LRSA 4FNLL 3VDBA 4OFYD 5B39G 4ZFOA 2GUOA 1YNTB 3ZE0E 1QOKA 1XF3B 4ZUSA 1KGCE 2B1HH 2I5YH 1BP3B 1RZFH 2EO9A 5IV2A 1W0VA 2IWGA 4WW1B 4UT6L 3VXTB 2YD5A 3ZHKA 2KKQA 3R1GL 5LGHL 3STBA 1IKNA 3SDDC 1ONQB 3QUZC 4XCCL 1AXSA 2J8UF 4WHTB 4P4KB 1MF2H 4NNPL 5AZ2H 1U3HA 3N9GH 5EN2A 4PLOB 1AGEA 2R15A 2NY3C 3UTTD 2LFGA 3MGTA 4EOWH 1FFPB 3OR6B 4Z8FL 5EUOA 4PYGA 1NGWA 5DJYB 1FNFA 2W1NA 3X3FL 4F58H 4DVBB 3KHQA 4PUBL 4U6VL 3MRFA 3UXFA 4GBXD 1ACYH 3BH9A 4PBXA 4M8QB 1G9MH 3HI5H 5GRWA 5MENA 1IM9D 3EFFA 4FQLH 5D7JC 5HD8C 5DVMA 4F7TB 3K1DA 4FFVD 4XBEL 4GLRI 4KJYB 35C8L 5IR1B 1HILB 4XNMB 2R0WL 2VQ1B 4KK6D 5IB2B 4FQXC 4BSVA 1T7ZA 1DN0B 4JPWL 4U1MA 4NM8L 4LHUB 3SGJC 5T33L 1MFEH 4OZGA 3MR9A 2DJ4A 2CJUH 4NO3B 2ZSVA 4HZLB 4BK5A 2BNUB 5ELIA 5JHDA 4JO3L 1RJYB 2FIKB 5L8JB 2BOCA 3RWHA 1VFBB 3QIUC 1E4XL 4PRBB 4PRPD 4BFIA 4NC1C 1CGSL 3GIZL 1R3LB 2FECI 5DMKB 2PR4H 4OFPA 4KRPD 3H9ZA 3MXWH 3V4UH 5I1KH 3SCMB 3SDCC 2NY2B 4I2XA 2NY0D 5DS8B 2VLLA 5FO9A 5D72L 2B2XL 3TJEH 2NXYD 3BKJH 4WWKC 1CZ8H 5DD0L 4KZDH 1WITA 2AJXL 5HHOA 4JFFD 1Q0YL 2R39A 3QYCA 3NFNB 1YNKH 3QHZH 4IEFB 5ERWA 2BOBB 2JCCF 5FB8B 5DR5H 5B38A 3ARPA 3PQYA 1J05B 3KYMA 3ARDB 3M1BA 5CCKL 3QJFA 4XPGH 2R69H 3DUHA 2DQHH 3U6RA 3VFMB 5FYKD 1KN2L 4L8SB 5ID0A 4POYA 3WFBL 3FT3A 2XRAL 2XT1B 4M02A 4HUUA 4RAVA 2CDGB 1URLA 5E2VH 1ACZA 1DANT 2W9LA 1EDQA 4L29B 3MYJA 4PREB 1S7XA 3GMLB 5I1IH 1UM6L 5DJZA 2ICWA 3MRLB 3LS4L 1NGZB 1AFVL 1XCQB 4KH2A 1G7LB 1A6VL 2MCG1 3IDYC 5HYIA 4IOIA 5C0BA 3OKEA 4QHLB 2PF6A 1FG9C 1UWXK 3C9NA 3FT4A 1VEOA 3RZCC 5ANMA 2E3VA 4WEMB 1NAML 1MHEB 4POZD 5DHXB 4L3EE 4WTZA 2ATPA 5FM4A 4EEEA 3TCLB 1F4HA 1AGFA 4Y8DC 1A6AB 5F89A 3P11H 3MYZA 2Z92B 3MLVH 1OL0A 2HN7A 4LFHG 4MNQA 5TFSL 3U82B 3Q5OA 3VXRE 2P7TB 1Q9WA 2J88L 3OB0H 1DFBH 3MRGB 3OJVC 3EYFA 1DL7H 2IAMB 1HKLL 3PDGA 1BZQK 4WHYH 5T1DL 3TBTA 3U7WH 1EZVX 3EIFA 4OCYH 4JZJA 5J3HC 3L3IB 1YN7A 1MCEA 3WDIA 1NDGA 2XOTA 4PJ7E 4XB8A 5F1OB 5E8EB 3NVQA 4FTVD 2VL4A 2V7NB 1RZ7H 4HWBA 5GGVY 1NCTA 5E1HB 5KSBA 3LMJL 3ECBB 1UVQA 4ONGL 3BFOA 1MLCB 4DGVH 3R0NA 4YX2H 5C0RL 2ED8A 3REVA 4UQ2B 1D9KC 2RCSL 4FFWC 1XF4B 2XPGB 1NLDL 2YPLA 3G9VA 3EYQC 3FO9A 4Z95L 3PHSA 3TBYA 1NCNA 4RMVA 4X6DF 2D03H 3TH2T 5KS9E 2DQTH 3TVMB 1C7TA 1N7ML 3ARSA 5DK0B 5I30L 2JB5H 5JR1L 1CIDA 4YHKH 3BPLC 3F7VB 4WENB 3VXMD 5JXAH 3VI3F 1C08B 1INDH 1T0NA 1N2RB 2ZCKL 4NBZB 3GSNL 4V2CB 5JXEA 1CL7L 3P73B 1CFVL 5D2LB 2FJGB 1PY4A 1MHPL 4GRLD 2XN9B 3NOIA 4HIXH 5T5NF 1EEZB 1XF5A 4UDTB 3OXRA 4Z5RB 3FQUA 4R90L 4NM4L 4F7CB 1NMCC 1W2KT 3MLUL 1XGYL 3TIEA 5F96H 1CDYA 3QHFH 1T2QL 4JHAL 4HXAL 3O6FB 3JWOC 1X5XA 5C07E 5LWYH 2EXWC 3QCVL 3QSKB 1W0WA 3PWPD 5J1AB 3K8LA 3BP5B 1MQKL 4XAKE 2DWEB 4P2RA 2XWBB 1KJ2B 4DJMA 1B0RB 2EYTB 3NGBC 2VKXA 2ED7A 3RIAF 2BVOA 3S34L 2LU4A 5IESH 3NCFB 3HRZA 3ULSA 2Z93A 3HMWH 5JORA 1CE1L 1NBZB 1IGML 4RIRB 4XP6L 4W70A 1NC4D 3MRDA 1I1YA 1YZZA 1NMBL 3ET9F 2ZUWA 5EU4A 1F3DH 1NMAH 4HUXB 4Y89A 2A83B 5IVXF 3FO2A 4FQPA 3NTCH 4J6RL 3OKYA 1OAXL 2NYYD 3MCLH 4ZS6C 4JVPA 3VXSA 2MPAH 5CZVH 3X14B 3CFJB 3ZE1E 1DBML 3LQAL 4PG2C 3D39E 4YUEH 4AENA 5ICZB 1CD1A 2VDML 2YBRB 1J18A 2ORBH 4EQ2A 1FORL 4Z0XA 4DTGH 2EDOA 4WY7L 2M8XA 4KVCH 3F6LA 3TCXA 2VITB 2CDFA 2HLAA 3VGAB 5J7CC 1PSKH 4IIQA 4S1QH 1J88A 3U4BL 4KHXH 2W07A 2NTSP 2IFGA 2WZPD 5GS1A 5GGRB 2D4FA 4QRPE 2IMNA 2H8PA 1IQDB 2QEJA 4PJBF 1P7QD 1UZ8A 4F2MA 4U33A 2V7HA 1PD6A 4CRPA 1I9IL 4U6XA 1KB9K 6CGTA 2ITCB 1LE5B 4LPYA 5D7IA 3Q5TA 2JJWA 5K9OA 4OZ4A 1BWMA 3DI3B 3MLWH 4YC2B 3PJSA 3L95A 5E2UL 1D5ZB 2UZIL 5B22A 1RULL 3CIQA 1E6JH 1LO0L 5EA0L 5GXBB 4QRRB 3NMEA 1QBMH 1KUMA 1A4JA 1WEJH 1ZT7A 4EI5B 4L8SC 4NO2B 1ZAGA 1T0MA 2K7QA 3FN3A 1F4WH 1FRGL 3MGAA 3RPIB 5IB3A 2XKNB 1LO3H 3IDIB 4IRSB 3KPSA 3BWUC 2E9JA 4O2FB 2LU3A 5KN5A 4S1DC 3ZE0F 1TMCB 3M17B 2FHCA 4H1LB 5HYJB 1NCAH 2D7PA 5C09E 2VL5A 3W2DH 4AG4L 5BRZD 1V3MA 3W5NA 4X6BB 4HK0B 4UOJA 4F7MB 4PR5A 1X5YA 2F58H 3FB5A 3ALPA 1QVOB 5KOVC 4K3HA 4W4NA 4PJ5E 3DV4A 1J0ZA 5E6ID 1IVLA 5D7LD 4D9LH 1AP2A 3RGVB 1RZJL 5ESVB 2VSCA 3QDJB 4ZO7A 4X99A 1VFAB 1QACA 1Z9MA 1QTYT 4DZ8A 1NGXB 4HWZA 3STZA 2W9DL 4ETQA 4MYWB 4R0LC 1IL1B 4QXTA 6FABL 1FNEB 4TSCL 3O2WL 4JZOA 3GB7A 3BKYH 3UBXA 3VFRB 4KDWA 3KLHC 3I75B 5ALCL 5FAAA 2X4OB 4PLJC 1T6VN 3VXQA 5CD3A 5DUMH 4F7EA 3EHBC 2QTEA 3K8KA 4I0PB 4MQSB 2EKSA 3PP4H 3RU8H 2BVQB 3O45B 1UYWL 5HHQA 4S1RH 3B6SA 1YC8A 1SJHB 2OJZH 4OLYH 4I3SL 2ICWI 2PTTA 4NKOB 3GMPA 4TNWF 4LSTH 4EXKA 2DYPA 4WUKL 4HS8H 5HDQL 1ETZB 3VE0B 4AEHH 1E28A 5I1HH 1LD9B 2FEEL 2Y06H 3HE6A 3E8UH 4GXVL 4O02L 4YFDB 4ZNEA 4R96A 5GGVL 3RVUD 3KR3H 1SEQL 2XA8L 3PHOA 1M4KA 1W8OA 1WCBA 2AJUL 3BISA 1QNZL 4E42A 4KK5C 12E8H 1BIIB 1U8HB 3TVMC 3SKUD 2VDNL 4PJ9A 4U3CA 4NQVA 4FQJH 5T1KD 4CKVX 2ADJB 4YHIA 1Q1JH 4L4VE 2C26A 2F53E 5FGCE 5TE6H 4PJXB 1U42A 4MDIA 1HOCB 1E4KC 3I85A 2OQJB 2WNGA 4WI3A 4D0DB 5JW3H 1Z5LB 2YD9A 2GKIA 4FMFA 5F97E 3HZMB 5JIPA 2O5YH 3KPOA 3NACH 3SJVE 3CVHB 2H6PA 3MLRH 4JN1H 3OB0K 4NFCA 1EVTC 2YD8A 3FJTA 1FVDB 1KIRA 3LRSB 4ODSL 3GRWH 1U8NA 3LN4A 1FGVH 1IGJA 1MCDA 4ZFOB 1LK3H 2GUOB 2I60L 4ZUSB 3K0WA 5IV2B 1JYNA 1W0VB 3QDHA 3TZVD 1JTOA 1BBJA 4JFDA 2J4WL 5CFHA 3QH3A 3UMTA 4HMCA 2DM4A 1JNLL 5IFJA 1MFAL 3JWNC 4NSKA 1HINH 1AXSB 4I4WA 5EG6C 4R8WH 4GO6B 1U3HB 4HC1H 5EN2B 5I71B 1CF8H 1AGEB 4P23D 3KPPA 3B9KA 5D8JH 5IMOA 3MGTB 1EH9A 3FB7A 1DP0A 3GMNA 4MCZA 3ARWA 4WFGE 4QRTA 5EUOB 1NGWB 1T21A 2HVJA 4K3JH 5I18H 4MWFA 1XGRA 1Y6NR 1OD9A 2RIKA 3NCBB 3MRFB 4NZDA 4XMKL 3G6DL 4ZAKD 1KLGB 3BH9B 4NO0D 3OWEA 5MENB 3EFFB 3C5ZC 3T2OA 1QRNE 4C83A 4KUCF 3GHBH 4LKCA 4BSVB 1I85C 3DNKA 4G6ML 4U1MB 3TC9A 4PGBA 4OZGB 3MR9B 5KVDH 1LVEA 4PJ7F 2NY4D 2ZSVB 1L6XA 3B5HA 5HGGS 3RKDD 4LLDA 5JHDB 1U95A 2BOCB 3RWHB 5I19H 1JMXA 3OG6B 4BFIB 3NFPA 5KVGH 4OT1H 3GJFH 3V0WH 4YHZH 1OF2A 3L9RA 1I8MA 2EE2A 5CS7A 3C09B 3QDGA 4L4TD 3RVVC 2GJZA 2VR9A 4GLRH 2DWDA 4I2XB 1RSFA 4Y2DA 2VLLB 2YD2A 3PGFH 1MFCL 3VXUE 5FO9B 1JWSA 3FN0H 4LCIH 3B9EA 3FO0H 5KS9F 3ILQC 4HUWA 5HHOB 1JBJA 3WO4C 1FAKT 2X1WL 3OX8A 4KQ4H 5D96B 1RZJC 1CTNA 3KPRA 5ERWB 5B38B 5BV7H 1MVUA 2YPVH 3K2UL 3PQYB 3KYMB 5JOEA 4XNYH 1S7VA 4XP1L 3M1BB 2VDOL 1TQCB 4XX1E 2NY6B 3FRPG 3QJFB 5C0CE 3WFDH 5B39A 2YOCA 3U6RB 3PV6A 5ID0B 1O7VA 4KGLA 4KU1A 3FT3B 4OLVL 5K9JL 5KAQF 2FGZA 4LGPB 4HUUB 3C5SA 1OLZA 3V4PH 4RAVB 4Y1AE 2P5WD 1YYLL 3O6KL 5I2IB 4NN7B 5SX4H 2VAAA 3MYJB 1S7XB 3P30L 5L0QB 2B8OT 4DQOH 3EYUH 5DJZB 2ICWB 2LE9A 2X10A 3T1WA 2RR3A 2AABH 3ULUE 5F44A 4F33A 4IOIB 5C0BB 4HLZH 3OKEB 4BH8A 3ARYA 3O81A 4LSRH 4P2OD 5DC4B 1LWRA 3C9NB 3FT4B 5ANMB 3JVGC 2AK1H 4QF1A 2ATPB 2H9GA 3DHMA 4N90E 1I1FA 1AGFB 1Q72L 3ZLQC 5I1DA 5F89B 2FIRT 4R2GB 4H5SA 3I9GH 5FK9A 3A67L 1FAIL 4ESKA 4UINH 2HN7B 4MNQB 3UO1H 1Q9WB 3D2UA 1A9EA 2KUTA 5CEZL 3ZE1F 3TBTB 1EHLH 5KTEH 5C86A 2VKWA 1P7KA 2NY5H 4I5BA 4JZJB 1YN7B 1FLRH 4LVNC 1IJ9A 1G6VK 2PYED 5L2KD 5GRUH 1NDGB 3WJLA 3ESUF 1VHPA 4YHLH 3RHWF 2FHBA 3FAWA 5I9QC 5KSBB 1KB5A 1UVQB 3FOLA 5LQBL 1JGVH 5JW4M 2X4UA 1I9EA 3JZ7A 4OBSA 1TVBA 3ROOA 2VUOA 4HH9A 3WYRA 3T09A 4PRHD 3REVB 2VNCA 5GRVL 4JDZA 4YO0A 5FKAA 5L88L 2F5AL 4P9HC 1KCVH 2YPLB 3RBGA 1EGJA 4N8CH 2HJFA 2JIXA 4TOYH 3FO9B 3Q6GL 3TBYB 3UBXI 3N85L 4Y88A 1A02N 1DLFH 3RI5F 4NZUL 1D5MA 4WI8A 4HGWA 3WIFA 5DURD 1T0NB 3V6ZA 1KCUH 2X70A 1SYSA 1DBAL 4RX4A 1XF5B 1YEEL 3OXRB 3W9DA 3FQUB 2VXSL 1KELH 3JTSA 3TIEB 4PBWD 3O3EB 1LP9E 3JV6A 5JUEH 4I9WE 5FYJD 4Q0XL 1W0WB 3EDJA 3OXSA 5FUZH 1Y18A 1K8DA 2MMXA 4P2RB 3W9EA 1RFDH 4YBLC 1JWUA 2DQIH 1NCBL 4JDVA 5F6HJ 3IB4A 2BVOB 1GGCH 4NP4H 4LMQI 3HRZB 4YZFE 5DFWH 3ULSB 2Z93B 5JORB 4ZFGL 4DCQA 1P1ZA 5B8CC 3MV9A 3MRDB 1D5IH 4LSVH 5ALBL 1I1YB 3TYFA 2R2CA 2PN5A 1ZEAH 4OZIE 3L1OL 4LCYA 5IVOA 5EU4B 5JIHA 5L9DH 2R0KL 3FO2B 4EIZC 4U2YA 5D71H 2WUCL 3VXSB 4TNVK 4PJGA 2XWTA 3ARGA 1X4XA 4FXKA 1I3UA 3LVEA 4U1JA 1G1CA 4AENB 1T66D 2HTLD 3WCYA 3GSUA 2W91A 1RUKL 1CD1B 32C2A 4F9PA 4PRID 4Z0XB 5KG9A 2C3HA 3ZKMD 4NQCE 3O3AA 2BNQE 5EU6E 5AWNH 3SY0A 2CDFB 5GISL 3CVHH 3UZEA 2HLAB 4LOUC 1UG9A 4OZHE 3HI6H 4IIQB 1JGLL 2J8HA 4DEPC 3LZFH 2D0GA 5GS1B 2EEAA 3ZMRA 3DXAA 3SO3C 5GGQH 2H8PB 3LSOA 1F90L 3WKNA 1CG9A 1QFWL 1KJ3H 3C2AH 1UZ8B 2ADFH 4F2MB 1IGIL 1KIPA 2OYPA 2V7HB 2P4AB 1KIUA 1HYSC 4U6XB 1A0QH 3ZKXC 5D7IB 1IILE 5K9OB 4TULH 4OZ4B 3EO0A 3GUTA 1I3RA 3T2NH 5JA8B 3PJSB 3IFLL 1RMFL 3L95B 5D2NE 4XNZB 2NY6C 2ZCLH 3HZVA 5FEBA 1A4JB 1ZT7B 5L6YH 2E7LC 1CLYL 2VQTA 4PJBA 4LK4A 1F4YH 1T0MB 3EDEA 3C60C 4G8IA 4Z7WA 4P57A 5F9OH 2YHGA 3D0LA 3ZDXE 3P0VL 5IB3B 1OSPL 1WFTA 4NN7C 3KPSB 4PY8J 1S5HA 5KN5B 1RHFA 1BBDH 2A9MH 3IDJA 4UTAH 5L0QC 3KWWA 2VL5B 4Q6IC 4AEEA 1MREH 1YQVH 4M5YH 4PR5B 5BVPL 3WE6A 3FB5B 4FQ1H 2CKBL 3HE7A 3DV4B 3IJYA 3QEUA 3RFZC 3GJFK 1AP2B 5E8DH 3PWUA 1J12A 1FZKA 5C7XH 5E08L 1EAPA 1VERA 2R1XA 1RVFL 4X99B 4EN3D 5LXGH 4WFHD 4LQ1A 3H42L 5CWSA 4DZ8B 4HWZB 3STZB 4ETQB 1MY5A 2CGRL 4R2GC 4QXTB 3CXDL 5C6TL 1J5OH 1PVHA 5C92A 4JZOB 3GB7B 2LTQB 3UBXB 5IWLA 3GO1H 3VXQB 5CD3B 4F7EB 2EC9U 2YC1A 3MJ9L 4M62L 2VLKD 4JKPL 3U48A 4CGTA 2EKSB 2VE6A 1V8HA 4PGEA 1N0XL 5HHQB 3B6SB 4H26A 1OAQH 4WO4A 2HKHH 2XZQL 2PTTB 4GW5A 3B83A 4Y19E 3GMPB 5IHBA 2DYPB 3T2QA 4KZEH 4TN9A 5E8PA 1E28B 5CD5C 3SQOH 4XPAH 3HE6B 5C9KA 4PJCA 4R96B 3BP7A 2EDWA 3PHOB 1WCBB 5EZIH 5FOBA 1KACB 4XPBH 4E42B 5HPOA 3H9SA 4C54A 5D7KE 4P46D 1SMAA 2A9NL 2VH5H 1MRFH 2F8XC 4PJ9B 1MCFA 4NQVB 1F3RB 4YHIB 4Y4FC 4QRSA 2DQCL 1A4KA 4N8VG 4MDIB 1A5FH 3VGBA 5D1XD 4M5ZH 1IEBA 3OKOA 2NXZB 3V4VL 4OFYA 3V79C 4WTXA 3ARFA 1KGCD 3KPOB 1D5BA 2H6PB 5GJTL 5CJXA 5EIVA 4KFZC 1KIRB 4DUWA 3TA3D 1U8NB 3GSVA 3LN4B 5I73B 1IGJB 4GKZA 5JNYA 3HUJA 4YXHL 3S5LG 4JFDB 3QUYC 1JYXA 1MSPA 3QH3B 2YRZA 1F5WA 5IFJB 1ZHNA 1EHAA 4NSKB 4I4WB 4JRXA 2OX5A 4LF3A 7FABL 4P3CL 3KLAA 1ZWIA 3X12A 2QSTA 4Z7UF 3VFGH 3KPPB 3B9KB 1MAKA 4LRNH 5IMOB 3ULUF 3FB7B 4HWBH 3GMNB 4MCZB 2BRQA 3HI1A 4QRTB 3HG1E 4NKMA 3MV8E 1IT9H 4U0RB 1T21B 2HVJB 3B9VA 5IM7A 5KVMC 4LSSL 4MWFB 4JFZH 1XGRB 3QBTB 4QO1A 3MTRA 4HG4K 2XTJC 1T1ZA 4HIHA 1IM9A 2VDRH 3V52H 4LSPH 3TJHD 3IU3A 3O3DA 1MELA 2Z9TA 4RGNB 1BVKA 4KHTH 4G6FD 5LJYH 5CSBA 1FCCA 2YPKA 5EOQL 4C83B 4YFLF 4Y8AA 1QKZL 4MX7A 3TWCL 2E27L 2G5RA 3U0PA 4LKCB 1B4JH 4PGBB 1FFNA 1TTGA 4K8RH 3IU4L 4LLDB 1VADA 2QSCH 3U79A 3VD7A 1ADQL 3FMGH 5DHYA 2R2HA 1FDLH 5DI8A 3QO0A 4OLWL 1UB5A 3NFPB 1EO8L 3V5KA 4KI5E 1OF2B 3L9RB 5FA3A 1AQKH 4KKLD 3T0VA 5GRXG 1I8MB 1K85A 3BDYL 1SBSH 3QDGB 4XC1L 4YDIH 2GJZB 3M8OL 5TDPA 1E0OB 4LASH 4P5MA 2DWDB 3O4OB 1NEZG 4Y2DB 4IBLT 4KMTH 1J11A 1JWSB 1ITBB 5IW3A 3L3HA 1NCCL 5EU7E 4Q9RL 4HUWB 3MV7E 4NWUH 1AHWB 4PIRF 4GRMA 4JM2F 3OX8B 3GHEL 2ZG3A 3KPRB 2GIYA 3ULVH 1YEGL 2YRLA 8CGTA 5E4EC 1MVUB 2R8SL 5H37G 1S7VB 4N5UA 2AQ1A 1WBZA 4UDUA 4UIKL 4HJJH 3WIIL 3DO7A 4HMEA 3CFEA 1TJHL 4KKBD 3B9DA 3EJYD 1QLEH 5B39B 1AI1L 3K7UA 3PV6B 3QXTA 5KS9A 5GHWL 3UYPA 4KJWD 1HNFA 3C5SB 3BIBX 2CR3A 3LH2L 1LP9F 15C8L 2X9XA 3QAZB 5HI3D 3MO1A 2CO7B 2F9BT 3BGMA 2VAAB 1KYOJ 2Y6SD 3IS0X 3GI8L 1PY9A 3AAZA 4JRYE 1LEIA 4G6KL 3P3YA 4MJIE 4LLVA 4MAYD 2CDEA 3D18A 4AEFA 4YZFF 3A6OA 4JJ5A 2XZAH 2RGSA 4F33B 1NL0H 4I8DA 4BH8B 1PG7W 1JMZA 1RIUL 4JY6A 3F5WA 2IG2L 4OZIF 4QF1B 2H9GB 2J6EH 1I1FB 4QEGA 2ARWA 4YHNA 5I8EA 5I1DB 5J12C 5FK9B 4H5SB 4R26H 1W72H 4LSUL 3K1KC 1YEDA 5E9DD 4H20H 4FQIH 2GEEA 4G9FE 1DBKH 3ARUA 1IC4H 4RRPG 3D2UB 1A9EB 2Z8WC 1JI1A 2ENSA 1IFHL 5DEZA 2PO6A 3PGDA 5ILTL 4OLUH 1EUTA 1P7KB 4FTVA 4I5BB 1GAFH 5HHME 3MMEB 4YH6A 2OP4L 3MLXL 5KW9L 5SWSE 1BPVA 1BX2A 2EO1A 2XZCH 4AMKH 1AO7E 3IDMA 5SWZD 1DVFC 4I77H 4TTDC 4ZAKC 1KB5B 1ED3A 3FOLB 5J57B 2X4UB 4OZHF 4UV7L 3DRTA 1TVBB 3ROOB 4XWGH 1H3VA 2QADB 4HH9B 4YWGL 3EO9H 4JDZB 5FYJL 4YO0B 3T0ED 3SDYH 2F54E 4HJGA 4OLZL 5FKAB 1I9RH 1AHWC 2HJFB 2JIXB 2DQUL 3LD8B 1OAKH 1TCMA 2OR9L 4PV9A 5J1TC 1JHTA 2NX5D 4R97B 2AXHA 1D5MB 3LPWA 1XR8A 4HGWB 5EOCH 3WIFB 4GRLA 2AXFA 4HQQL 3VDCA 3V6ZB 3TYGH 4PB9H 2NZ9D 3FRPA 2X70B 1SYSB 2VMFA 3GZKA 5FGRA 1R3KA 5ICXB 5DJ2A 4RFOL 2QQKH 3W9DB 5C07D 2HFGH 2VOTA 4M7LH 5CJBA 3P40A 3ZDXF 4DN3L 3OJDA 5F7EH 3JTSB 2X4PA 3SEPA 2ICEA 3PWPA 2VLRD 3SE9H 2Y5EA 3W11D 1U8QA 1RZ8A 3F7RA 3JV6B 5D70L 3S37L 3VU2A 5TGBA 5IT2L 1UZ6F 4YNYA 3OXSB 4G6AD 1E27A 1EO7A 3SDAA 4JFOA 2P43B 3DTXA 1Y18B 1K8DB 2EIEA 5DRXA 3W9EB 1JWUB 3PNWA 1IQWH 4JDVB 5CZXD 1NC4A 1TZIA 4PJIE 1KCKA 3JTTA 1IKFH 4ZO8A 2EDLA 1EPFA 5T1LD 2HRPL 4YXKL 4D3CL 4DCQB 1P1ZB 3BT2L 4P2QE 1NGYA 3MV9B 3GM0A 4JPIA 1X5IA 3RA7H 3TYFB 2ESVD 3B2UD 4QHMA 2C4FT 4HD9A 4LCYB 1DBBL 3UPAA 2Q3AA 1DJSA 5FCUH 4XPHH 3LEYH 2EDTA 1RURH 4QKXB 1A7RL 1V05A 1UH2A 3RTQD 1T1YA 2D0HA 2GJ6A 5D7SH 3HB3D 4PJGB 5BS0D 2VRAA 2XWTB 3ARGB 4FXKB 4L5FH 4U1JB 4JO1L 3HMXA 3I2CL 3WHE1 3HLAA 3GSUB 3L7FA 32C2B 1LDSA 2F5BL 4HMDA 4KVNH 1DANU 4M6NL 1MRDL 2WAHA 1VPOL 5KG9B 3O3AB 5C08E 1PZ5A 5IGXH 3SY0B 1FN4A 1I7ZA 2FZ3A 5F93C 5LGKA 2L7UA 4Y2DC 4ZYKA 1P7QA 4LEXL 1S7WA 2FD6H 3DXAB 1GJIA 3LSOB 4ISVA 1CG9B 1FQ9C 3SOBH 1KIPB 1RUPH 2WWKO 4AK1A 3MPCA 2HMID 5F6IB 3EO0B 5CUSL 3GUTB 1I3RB 5DD5L 4OGXL 4XI5D 4XVTH 2YA0A 3EFDL 1RJLA 2Q8BL 1U3YA 3HZVB 3HC0A 4OZFG 1PEWA 5EFIA 2KZWA 3AVEA 4PJBB 2D9QB 1JFQH 3KPNA 3AS1A 1OTTD 4FNLH 4G8IB 4Z7WB 4P57B 3D0LB 3UP1A 2N56A 3WFHA 3K74B 1S5HB 5CP7A 4N5EC 2Q20A 5H8DA 3IDJB 4PJ5D 1CLOH 4WI7A 4X80H 3KWWB 3R1GH 5LGHH 2CRMA 4Z7QF 3T8XA 5E6IA 3WIHA 3UCRA 2Y5TA 3KPTA 5I1CL 3WE6B 1WK0A 4M3KB 4NNPH 3CXHK 3HE7B 3IJYB 3QEUB 3BIKA 3OAYH 1FYTD 3PWUB 2AQ2A 1FZKB 1EAPB 1EJOH 2ZOKA 2R1XB 4U6TA 3JUYA 3IXTA 3RUGF 5CWSB 4XBGA 3X3FH 1IAIM 2H45A 1BJ1J 4YLQT 5E2JA 2Z4QA 4KROC 4K3DL 4Y4HA 1HHHA 5JZ7C 1XIWA 3L5IA 4G43A 1T7VA 1KTDA 1I1AC 2Z0BA 1YY8A 4OD1H 2DBLL 2AJVL 2ADGA 2IJ0C 3WKML 4XBEH 1I8IA 2YC1B 3T0BA 4AQOA 4P3WA 1LE9A 2VE6B 4B5EA 2DM2A 2C3VA 4PGEB 2G2RA 5BMFL 5J06A 4X9IA 3HAEH 4G6JL 4H26B 4JO3H 2R0ZL 1O5DT 4WO4B 3B2VL 3LCYA 4GW5B 1T0PB 4ZFFA 3C08L 5E8PB 3FQTA 1CGSH 3GIZH 4PJCB 4ZG1A 4KI5F 3BP7B 4OF6A 1UFUA 4L4VD 5ADPL 3NIGE 2F53D 4N0UA 5T1KA 5MP6L 4WHYG 5FOBB 1I3VA 1T66C 3H9SB 4FQQA 3MJGX 1QSZA 4R97C 5KSAD 4TSAH 3O4LD 4FG6C 3PDDA 4JPVL 4U7MA 4X7TA 1J0HA 5DD0H 3V8OA 2AEPL 1YQ2A 2AJXH 4QRSB 5IFAH 1CBVH 1A4KB 1Q0YH 2Y36L 3S88L 4PB0L 2ZSWA 4HJ0C 4MGXA 3SHSA 2VLJD 1FC2D 3QI9D 1FZJA 4M6OL 1JHLH 3VMOA 1IEBB 3DETC 3OKOB 1RQ5A 4KPHL 3Q1SH 5CCKH 3LB6C 1HZHL 5DF0A 2FO1A 4A2MA 1U92A 3LKQA 3ARFB 1D5BB 5L7XL 2EZ0D 4LP5A 3WFBH 4HXBL 3MX0A 5EZJA 1CFBA 4F15B 3NZHH 2XRAH 3GSVB 3TZVA 4RMUA 3CH1A 4GKZB 2UVFA 5JNYB 5K93A 2YA1A 2V2XA 4ORZC 3HUJB 4Z76A 5CSGA 5IUSA 5KANG 2BSSA 1SM3H 2O26U 1N3NA 2XKUA 4QLRA 1ZHNB 3VI4E 4P23A 4G7YL 3LS4H 4NJAH 4JRXB 4LF3B 4NNYA 5GQBA 3TO4C 5TF1H 3KLAB 1ZWIB 2YSSA 3X12B 4W4OA 1J1XL 1CYGA 1EBPA 3WNOA 4GKOA 1NAMH 5EBMA 5I0DA 3HI1B 4ZO6A 3ISWA 5FYKU 5CZKA 4NKMB 1KB5H 3H2WA 5IM7B 5HDBE 5B21A 3F7YA 4CNIA 4HDIA 1T1ZB 4HIHB 1IM9B 1JZ4A 1Z2KA 3ARGC 5DJAA 5TFSH 4XP5H 3IU3B 1CDIA 3O3DB 4QGTA 3WXWH 3QNYA 4Z7UA 1BVKB 3GBNH 4OCSL 1HKLH 2EH8L 5EOTA 1MCPL 5T1DH 4NQEA 4OLEA 4RWHA 3L5XH 3LKPA 2EIZA 2YPKB 5DHVA 4F9PC 3BUYA 2CMRH 4NRYA 4MX7B 1M6OA 4JB9H 3C6LA 3U0PB 1TIUA 3U9PL 3VW3H 1J1PL 3D69A 1FFNB 4UT7L 1E6OL 3WS6C 1VADB 1ZANH 1BD2D 3LMJH 4ONGH 4ELKA 4F8QA 5DHYB 1NLBL 2R2HB 4KRPB 5DI8B 4L4TA 2XN9E 3QO0B 1UB5B 3V5KB 3W39A 4R4NC 5FA3B 1Y0LA 3RDTA 1DLHA 3PUCA 4HWNA 2NXYB 2D7OA 5TDPB 2X7LA 3ARBD 3AS0A 4HGMA 2RBLA 1E4WL 2DS4A 5F6IC 4N8VA 3L3HB 1N7MH 3PWVA 1OT2A 1EV2E 5I30H 3SGDI 3BSZL 5K59E 4GRMB 3DVGA 5C0CD 2ZCKH 4HS6A 3GSNH 1CFVH 1G7IA 1MHPH 5DYOA 4GAFB 4UDUB 1WBZB 3DO7B 1EXUA 1A1NA 1B6DA 2B1AL 4X98A 4R90H 3MBXH 3CFEB 4NM4H 3F7QA 1X6NA 3U30B 4F9LA 5I75B 5KS9B 3DIFA 3RWCA 4JHAH 4HXAH 2YK1L 4HCRA 2O93L 2BNRD 4JM2A 1KT2A 1RI8A 2PXYD 2PTUA 4LU5L 2D3VA 3TFKC 3S5LA 2SEBA 3C87A 3MO1B 1FPTL 3BGMB 2ID5A 1MQKH 4U05A 1VEPA 3AAZB 1LEIB 1CDUA 1DUZA 4PJIF 4LLVB 4LCWD 1N64L 1IGMH 2CDEB 1YEJH 3D18B 3EOTL 4P2YA 4XP6H 5IFHL 1QSED 5JW4Q 4JJ5B 1RAMA 1A6UL 2ZPKH 4NC0B 3TA3C 5F7HA 1NMBH 1PAMA 5CIPA 2OL3A 3P9WB 4MAUH 1IAII 1FH5L 3NPZB 1MEXL 3F5WB 4JY6B 4OFKA 2MCPL 4PGZA 4J3TA 4YHNB 5IWLC 3BGFB 1MJ7L 1UB6A 4J6RH 4XXCA 1YEDB 1CCZA 4IM8A 5JMRA 1DBMH 3LQAH 1OCWH 1GOHA 4X4MA 2PYEA 3DO3A 3CX5K 2PO6B 4I1NB 5ITFA 1QFWI 4IMLA 3PGDB 3P9LA 1FLTX 4Z0BL 4FTVB 2VDMH 4WO4C 1C8PA 5H94A 1FORH 3MJ8A 4LLUA 1J8HD 4WY7H 1OP9A 3MRPA 1JNHA 1BX2B 4ZTPL 3IDMB 4QRRE 3ELAT 1ED3B 3U4BH 1HN1A 3FFCE 3DRTB 1FP5A 1L0YA 3QWRA 3QNZA 4MJ4A 5D1ZD 5KOMC 3DURA 5I1LA 3J7HA 1K9TA 4J12A 2R29L 1BIHA 1MJJA 1NEZA 2X1XR 5E70A 4HJGB 3OAYK 5SV3A 3FOMA 3BQUC 5HYJE 1I9IH 5I8KL 2A2QT 2BX5A 3DVNA 2QQLH 2WV3A 1U41A 1C5BL 4ODXA 4PV9B 2YD1A 2DQEL 5DZLA 3VFNA 4UB0L 1JHTB 4KUZL 2UZIH 4LVHB 2C1PA 1RULH 1XR8B 3BRFA 4GRLB 4H0IA 2AXFB 4NOFA 5EA0H 4A6YA 4M48H 4X8JA 2QQQA 1OAZH 1YYMH 3QDJE 4F15C 4KDTC 5F7DA 1RZKH 1R3KB 5DJ2B 5DEGA 3IFOA 4I9WD 1C1EL 3E2HB 3OJDB 3GMQA 4HKXA 2VDKL 2X4PB 2ICEB 3PWPB 3SE8L 1T1XA 1U8QB 1KTKE 1RZ8B 4AG4H 5TGBB 4YNYB 3ZE2E 3MBEA 1XZ0A 2IALA 1E27B 3SDAB 2YN5A 1LMKA 4JFOB 3DTXB 5DRXB 1LO2L 1QQDA 25C8L 3REWA 5L8LB 3PNWB 2CLVA 1NC4B 1TZIB 1CGUA 1RZJH 3JTTB 4OSUL 4KKAD 1CR9L 4KKBC 1NGYB 4RFNB 4E0RA 3LN9A 1JHKL 2W9DH 4JPIB 1DUYA 1AGBA 2A38A 4QHMB 1AY1L 4KK9C 1F6LL 4OQTA 3O2WH 5FUCE 2EECA 3OPZL 4W81A 4JM4L 5B4MC 1Z0NA 1T1YB 1WWCA 1MWAL 2GJ6B 1A7OL 1CXLA 2P44B 4RRPA 4D9RE 3OHXA 4DKEL 1PG7L 2RFXA 4QTHA 4NOBA 1QFOA 2D2OA 2NW3A 4NQCD 5EU6D 2EDEA 3HLAB 4P5KA 2GYSA 4R9HA 2EDFA 3L7FB 1MI5D 2BFVL 3UYRH 1L7IL 3K4DA 4JHZA 3IFNH 1AIFA 4WI4A 3MA9L 3V7AE 4WUKH 1PZ5B 1Z9LA 3D85A 1FN4B 4IJ3B 5HVFB 1QA9A 2HVKA 4GXVH 1YEKH 1I7ZB 2FZ3B 4MJ5A 1LGVA 4TSBL 1SEQH 2XA8H 2XYCA 3SQBA 2K7PA 5F1SA 3T4YA 4M3JA 1ZVSA 4ZYKB 1P7QB 4K9EC 5DMJB 4GMTH 1S7WB 3NIGF 1CLCA 4UAOC 4LLQA 4ISVB 3G08A 4L8DA 4RWYL 4XWOD 4C56E 1NCWH 4Y16A 2JKXA 4HV8B 5E7BA 1I1CA 3WS3A 2V6HA 2AK4D 4RA0C 1ZK9A 3G6AA 4X7SH 4B7LA 4PJ8A 2GAZA 4UILL 4AEIL 1RJLB 4U6HA 5DFVD 5DLML 4H88H 3HC0B 4TNVF 5EFIB 3T3MF 3KJ4C 3KPNB 5EUOE 1TETL 2BSRA 3FQNA 2R1YA 1PFCA 2AJ3A 2I60H 1HSBA 2VXUH 5TE7L 4ZOEA 2HT4C 4KRMB 3WFHB 5C8JA 5CP7B 3IS1X 3FONA 3NZ8A 1JZ3A 1BQUA 1H0DA 5JLZA 1BAFH 3NABH 4RISL 4N0CD 1JNLH 5MENE 3T8XB 1MFAH 5E6IB 1KPRA 1JNNH 2Y5TB 4GS7C 1BECA 4ZDHA 1WWWX 3VI4F 3BIKB 4D0BA 2K1MA 3WSQH 4OZGE 4YQXL 2ZOKB 4GMSL 4GSDL 4J4PC 1SY6L 3IXTB 2VAJA 3RPKA 4XBGB 5JOPE 3FB6A 5JHDE 1MFDL 3AM8C 1JUFA 2Z4QB 4J3XA 5HDBF 4Y4HB 4XMKH 3QIWD 1HHHB 1XIWB 1N6UA 3WMSA 4G43B 1KTDB 3CZJA 1T04A 1YY8B 2VLKA 4XVSH 1HQ4A 2ADGB 5CZXC 2ZZUT 2YMXL 4I2XE 5CGMA 1WCQA 2DDQL 2LVEA 1I8IB 4WHCA 3RUGA 1P5UA 4XP9L 4OD2A 1LE9B 4I0CC 2W0KA 5HHOE 2C3VB 4XAWL 2G2RB 4M1CD 2L7JA 2AJYL 4FQCH 4FXGA 4M7KH 3VGFA 5GZOC 4JQVC 1GPOL 1LQSR 3PQYE 4OM0L 5FYKH 2DD8L 4ZFFB 1SBBA 3FQTB 4G3YL 1PLGH 5D93C 2WSKA 3HB3C 4P46A 3R4DA 5F9DC 2VN7A 2NR6D 3NFSL 4N0UB 4Y4KD 5T1KB 1T80A 4IDJH 4FQQB 3CSYA 2B0SL 5BXFA 3GBMH 2V2WA 2ZNWA 4E5XA 1OAYL 4X7TB 1YMMD 5D1XA 2CUIA 4ZTOH 1M1SA 5F7KC 4O5LL 2ZSWB 3TN0C 2R9HC 5K59F 3F6IA 3K2UH 1FZJB 2FBJH 4XP1H 2G60L 2VDOH 3FCTA 1HQRA 1U92B 3LKQB 1R3HA 1RY7B 2OTWA 3CMOL 4PFEA 5ANME 5I17B 1FC1A 5EZJB 2IPTL 4OLVH 2X9YA 3TZVB 1FNSH 3ARED 4BK4A 1YYLH 3TP4A 3O6KH 4EBQH 2V2XB 1WFNA 3SDAC 4K55A 3BMWA 4Z76B 2WBKA 1AJ7L 5KZCD 4MNQE 3KYOA 2BSSB 3P30H 1N3NB 3MUGA 4P23B 1ORSA 4BUGA 2VN4A 4NNYB 1RUQL 4I3GA 2YSSB 3TBWB 2FX9L 4Q58C 3EDDA 1FSKC 2X9WA 5F6HI 3VMPA 5EBMB 4RGOL 2DICA 5KSBE 4PG9A 3STLA 1A7NL 3F7YB 5TQ2L 4NQDD 3D0VA 4CNIB 2HKFL 3V5HA 1WAAE 4HDIB 1MH5A 5FGBC 2E7HA 3CSBA 5DJAB 1WBYA 5T3ZD 3LKRA 3QNYB 4Z7UB 1TZGL 5CEZH 5EOTB 1HSAA 4NQEB 4DAGH 3LKPB 2EIZB 1QFUH 5DHVB 4DK6A 3BUYB 4DN4L 3O2DL 4MXVE 4NRYB 3ZKNC 2NY4B 1M6OB 1KN4H 1P4IH 3C6LB 3VWJD 3D69B 5JQ6L 4K3EL 2Z31C 3VG0L 3I50L 1NANI 1XGTA 5IB4A 4ELKB 1DQLL 3OSKA 3OF6D 4IOSD 4L4TB 2OJEA 3W39B 1ZVYA 1Y0LB 3RDTB 1DLHB 5L88H 2F5AH 3MV7D 5FUOH 3UJTL 3QUXC 2BJMH 2X7LB 2MWCA 4JG1H 1J7VR 3N85H 3IDUA 4N8VB 3QUZD 3SDDD 4AT6A 3PWVB 5IVNA 1K3ZA 5DGRA 4NZUH 4J1UA 4XP4L 4P2RE 4HEME 4LRIA 3DVGB 2NY3D 4HS6B 1TVDA 4XPTH 1FIEA 3UTSD 3ULVE 1G7IB 3CJJA 3T2PA 1DBAH 5DYOB 5DT1H 5EU3A 1OLLA 1EXUB 1A1NB 3HNSH 4CU7A 3KHOA 2IF7A 4X98B 3X3GL 2HJLA 1S9VA 3DIFB 3RWCB 1LO4L 2FX8L 4JM2B 2EXYD 1KT2B 1NUDA 3S5LB 3SGDH 2VXTH 1JGDA 4YBHA 1J86A 2VC2L 3HR5A 2SEBB 2DBJA 5HD8D 4MJID 3VXSE 4OV6F 5KJRL 3ZE2F 5CILL 4K23L 3V0AC 1NCBH 3BO8A 4FQXD 4F80A 1KLFA 4HS3A 3FT2A 4P2OB 2F19L 1DUZB 5TF0A 2D7TL 4ZFGH 2WANA 4WDIA 2IBBA 1UM4L 4WI5A 2XICA 5ALBH 1QEWA 4CN1A 4O4YH 3V2AR 3QIUD 4Y4HC 5CIPB 1VGKB 2OL3B 3WBDA 3PL6C 5BJTA 3L1OH 1GCFA 3IT8D 4AH2A 4BUHA 4G9FD 5E9DA 3RAJH 1QR1A 1N5YL 1UB6B 3SDCD 3UTQA 2ITDA 4H0HB 1NSNL 2ZJSH 3TT1H 2DLTA 4KV5F 4WWKD 4YEFA 2V9RA 5SWSD 4LAJH 4P2QA 2PYEB 43CAA 3B5GA 2EIBA 4O2EA 5ITFB 4IMLB 3RP1A 3P9LB 3QG7H 1RUKH 4M6AA 3BPNC 2BY0A 5H94B 3RKPA 5SWZA 3MJ8B 4LLUB 1CGXA 3MRPB 4X4XA 1JNHB 1RU9L 2G5BA 3KYKL 1UENA 4KAQL 2P1YA 5A2LH 1JGLH 1H8OA 2YKLL 3T0EA 1NGPL 3QNZB 4PP1D 3ZSTA 1G0DA 3DURB 5I1LB 3KPSE 3U46A 1MJJB 1NEZB 3BRDA 1KF9B 3FOMB 2EEDA 1QFWH 3DX9A 3O9WC 2NX5A 3LIZH 5C2BH 1G9NH 4EDXA 2MKLC 5DMGC 3DVNB 4JFXA 5C08A 5DURB 1IRAY 3EZJB 4ODXB 1TQBB 5FM5O 1B0WA 1RMFH 1JGUL 2VXVL 2OK0L 1KFAH 2C1PB 4A6YB 4X8JB 5KVEL 1NUNB 3RZCD 4NQTA 1I8LA 1MCCA 4WGWB 5F7DB 3ZL4L 3QEHA 3QPQC 2VLRA 4WUUD 5DEGB 3P0VH 5EUOF 1OSPH 3IFOB 3ALWA 3D3VE 4HKXB 3QXAA 2OZ4A 2E6PA 1RV6X 2HH0L 3WEXA 3EO1A 1T1XB 4KKCC 4XMLL 1NFDA 1SEBA 4WW2A 3RWGA 4C57C 1G6RL 3QCTL 5CSZA 3MBEB 4B7IA 1XZ0B 4MA7L 2IALB 4XCYA 5BVPH 3RX8A 5E6YA 4HF5L 5J3HD 2CKBH 5DA0B 5T1LA 1QQDB 2N7BA 3REWB 3N1GC 5F9JA 2CLVB 3INUL 3LY6A 3GSOA 1RVFH 4LLMB 5F7LB 4OZGF 4JE4B 4APQC 1YEFL 4E0RB 1DUYB 1GC1L 1AGBB 4JKLA 2CGRH 4JRWA 3LKNA 1XGPA 4YPGA 5C6TH 3C6SA 1WZKA 1JE6A 4RDQG 2NY1B 4ZNEE 1YUHA 2AXGA 3BN9C 1GIGL 3ULUC 1D9KD 1IGFH 3EJZC 4FFWD 1A7BA 4L1DA 1G7PA 4O00A 5IB2A 3WUWG 1CQKA 3EYQD 3OHXB 3MJ9H 4NRXA 2RFXB 4QTHB 2KL6A 3C6LC 4JKPH 3QFJA 2NW3B 4UBDD 1RZIA 1HCFX 1VKXA 3C8KA 4LMQE 1T5WA 1N0XH 4P5KB 3CX5J 2IQ9H 1NGQL 2YWYA 1CD9B 4X4YA 2FR4A 3PP3H 3T65A 1T4KA 2XZQH 3VGDA 2O5ZL 1AIFB 1HNGA 2ZCHL 3N50A 3CDFA 3D85B 4GG6A 2VJXA 1TITA 5GGSY 3SCMA 3O0RH 3HRPA 4UNUA 4YDLC 1QA9B 2HVKB 3H0TA 1HIML 3OKMA 5LCVH 3WLBA 1CGYA 5EU5A 2NY7H 4MJ5B 1GL4B 4FABH 1CDBA 4OLXL 5FIEA 3T4YB 1ZVSB 1AC0A 2BXYA 4X7FC 1WF5A 5EC2A 1N59A 4ONHA 1F4XL 1TJIL 2EXWD 3BKMH 5FO7A 4LLQB 3AMKA 4P4KD 3G08B 4L8DB 4JFDE 4FZ8L 3QEGL 4NQXA 3ILPA 3BPOC 2W65A 3G5ZA 4P0DA 4DGYL 3BWAA 3MRQA 4Y16B 4ZUVA 3WS3B 4KI1A 1MCWW 3AU1A 1NQBA 3G6AB 1FO0L 2I9TA 4L9LA 4PJ8B 2GAZB 3V4VH 4U6HB 3UZQA 5DJCA 3VXOA 4IMKA 1MJUH 2N1KA 3CFCH 1U3ZA 3CU7A 1TDQA 2BSRB 2JJVA 3FQNB 4LKXA 4J3VA 2X4RA 2FDBP 2R1YB 4ZOBA 2AJ3B 2KZ1B 1HSBB 4WIQA 2VR4A 5C8JB 3PE9A 3FONB 1NBVH 3NZ8B 3CU1A 1H0DB 5JLZB 4O51A 4RGNE 2J3SA 2X4QA 4JY5H 5DHVH 3LHPL 3BPCA 1KPRB 4M7LT 3RWIA 4PJHA 5ICYA 5I66A 4NUGH 4O2CA 4ZDHB 4P3CH 2XACC 5GRVK 4D0BB 4OV5A 2PCPA 5FDYA 3GRWA 3ZTNH 3CLEL 2A0LC 2W9EL 3FB6B 4ZSOA 5CGYC 3U7AA 1JUFB 5KSBF 1PKQE 3ZT6A 5MERA 1WAAF 3V95A 1YEIL 1WZLA 3QDGE 5L8KB 1T04B 1Q9OA 2NTFA 2VLKB 2DKSA 1HQ4B 1OM3L 1T03L 3O2VL 3D9AH 5EOQH 4HC1A 3SGKA 3RUGB 4DW2L 4YE4L 5KANI 2AV7A 2E27H 4OD2B 4MXVF 1PG7X 1CICA 4CN4A 4OCRL 3HCVA 1X7QA 3KPRE 3MJ6A 4FXGB 4K2UL 3ARZA 1SQ2N 1WIOA 4OLWH 4WU7A 1EO8H 5A3IC 5J11C 5DDHA 5JDSA 3BDYH 4P46B 4XC1H 4S1DD 5KSAA 3AB0C 5ISZD 4HCRH 4MS8C 4QGYA 1OTSC 1MF2L 2IAND 3CSYB 3N9GL 5BXFB 2C4FU 1TQBC 2KQMA 2V2WB 4E5XB 4P4RA 1GXEA 1WT5A 1JGEA 4CMHC 5D1XB 5MHSD 3QI9A 3E1F1 5DJ0A 3S3PA 1I3GH 2DIJA 5JA9A 1UXSA 1UA6L 1D6VH 1YEGH 1EEZA 2Z91A 4P48A 2R8SH 2EC9T 3I3EA 3GJFA 4OZFB 1GC1C 4JREB 1EX0A 3ULVF 4NDMA 3FCTB 3NAAL 4UIKH 3WIIH 1K3IA 1HQRB 3HC4L 1TJHH 3HI5L 1R3HB 3R8BB 1AI1H 2OTWB 5DVNA 5GHWH 3T3PE