4G8EB

Crystal structure of clone18 tcr
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
247
structure length
241
Chain Sequence
GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRPPLTTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved human T cell population targets mycobacterial antigens presented by CD1b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords alpha chain clone 18 TCR
total genus 50
structure length 241
sequence length 247
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eB02
3MUY1 3NCEB 1MHEB 1KB5B 1KN2H 1HHJA 3AUVA 1QFHA 2IPUK 2ZG1A 4ZTPL 3MLUH 4C83B 2HN7B 3CCHA 5DQ9A 1XCTA 2WM0A 4LDEB 3QUYB 2JIXB 2OR9L 5JW5B 3L5IA 3UXFA 1CXIA 1HI6A 3ZKXB 1JYVA 3VGAB 4C59B 4QCIA 1CDCA 3H7LA 1FRGH 4ZUTA 3FRPA 4APQB 3KHOA 1OP5K 2P5EB 3HZVB 2W60B 5FGSA 5KS9B 1RI8A 1YA5A 3VMOA 1FFPA 4S0SD 1UZ6F 4LIQL 4R3SA 2IH3A 4PJXA 5DJYB 3TV3H 3QNXB 4HFUH 2AABH 5IB1B 1AC6A 1A1OB 1XF5A 3ULSB 5F7EL 2H8PA 4OZFG 2VABB 4D0BA 1G7PB 1R3HA 5C0BB 3QEGH 4OZ4B 4WEBL 3TA3B 3IS0X 3PGCA 4G9FD 4NQVA 3VGEA 2OR9H 4JPKH 1G6RL 1XR9A 2V2XA 2C3VB 2HFGL 5HGDB 3VXUB 3PWPA 1SEQH 1YEJH 1INDL 5CBAA 5HHPA 1RK0B 4OSUH 2ICWI 2ZSWA 3RAJL 4JFYB 3MV9D 1TZGH 5E0QA 1ZLUH 1TZHA 4JFDA 1QSFE 3EUUA 2KUTA 3WMSA 3D5OF 1M7XA 5JXAH 1LK3L 1VADA 3X14B 3VWKD 1FNEB 1R5VB 5IBUG 1HDMA 2E7BA 2R23A 5FECB 1HKLL 4TSAL 2ENYA 1FL6A 2FWOA 2X9YA 4MA3A 4OB5H 4OIIL 2CLVA 4PIRF 2QADC 3D85A 3O9WB 1D5MA 3BXNB 4OZGB 3RWDA 1NGZA 3TBSA 1P6FA 4TOYH 3UBXI 1UJ3A 4BZ1H 5FFLA 3PQYA 4BK4A 1O0VA 4F15C 3LB6C 4IHOB 4P9HH 3QEHA 1NLDL 4XRCA 3TN0C 2DTMH 3MRLB 2NXYC 3HE7A 3FFCE 2R4SH 1GGIH 1LO5B 3JTSA 4KMQA 4ZSOB 4PGDB 3KYOB 1I1FB 4GBXD 2EDNA 5CEXB 2VAAA 2BVOA 3D9AL 2VLRB 3QEQE 3S5LB 5DR5H 4X4XB 1KENL 4M5YL 5CJOL 5IR1A 3FQXA 4N8CL 4PJGE 1H5BA 3DYOA 3S3SA 1CE6B 3QXUA 4XPGL 2B0SH 4UT6L 3S35L 5D7KE 3WXWH 3EHBD 4FABH 5D4QA 1N0LA 3GMQA 1X7QB 3WKNA 2NYYC 4JG0L 1CXEA 3CUPB 1LEIA 3GSRA 2E27H 2B7DT 2HJLA 2RB8A 1OTSC 2VQTA 3ZE0E 5JOPE 5E1AB 3F7PC 3G6DH 3GI8L 4FZ8H 3TH4T 3UDWA 4L9LA 4YPGA 1UM6H 4PJFA 3DHMA 2XZAL 2IAMD 3V95A 2B1HH 1TNMA 2HT3C 4HXAH 4LLYA 4XVJL 1G9EA 4XPTH 3PDDA 2GJZB 3X11A 1K5NB 5CCKL 3CSPA 3BUYA 2R1YA 4TVPL 3KPNB 1CS6A 1P9MA 5BVPH 3D9AH 1YEKH 2AI0H 2FATH 1CE1H 1ZLWK 4JPIA 1KJVA 5A2JH 4LPUA 2VDOL 2X2YA 1G7IA 4I13B 3EYQC 1BOYA 2XFXA 4MHHI 1KUMA 4Y4KC 3QCTH 4NOFA 5C08B 2P24A 4KVCH 3UDWC 1IZKA 2YD2A 2DKSA 1FZOB 3JZ7A 1AD9B 5C09B 2F8VA 1KYOJ 5E8OB 4K7FB 1IQWL 1U8NB 4PGDA 4U1NB 1EEZB 1MFBL 3U30B 4MDJA 3MODL 3PGFL 3VWJA 4LL9A 4WDIA 15C8H 2DLGA 2CRYA 4PJEF 5D2LA 5FM8A 1DBML 5B38G 2P47B 5TQ2L 1MHHA 5DQDL 3S4SB 1S7TA 4ZS6D 2FEEL 3P2TA 1OAUL 2WQ8A 5GSVB 3UTTE 5DJZA 4Q9QL 1K8DB 3E3QE 5C0IA 1ZGLA 4G80B 3GJFA 1URLA 5I8CB 1MFDL 5E1AA 5EH1A 3H0TA 1L7IL 4ZS7H 1X5LA 1XF3A 4OCSL 1LP9A 2P49B 1EBAA 1A4KA 1QFWL 1VGEH 3ARDC 2D0HA 3O6LH 5LQBL 1TXKA 5IV2A 5JZ7C 1P4BL 4L29A 1CDHA 3GSQB 4WV1C 1I75A 2Y36H 4JM2A 3DXAE 1I9JL 5E99L 3VFMA 4K3EL 3HNVL 4WUUA 3DMMB 3IU3B 1XGQA 3PDOA 1J5OH 1FL5A 3EO0A 4EJ1C 1QP1A 5BV7H 1B4JH 5GGRY 1DQQB 4GW4A 2BSSA 2FD6L 3MCLL 4R26H 4XNQA 3T4AA 1MCNA 2ARJA 4I0PD 2AV7B 2BNRD 4J3SA 4WEMB 2DM4A 4UILL 4MJIA 3SCMC 5A3ID 1CICB 1BHGA 2DD8H 4WTZG 3GM0A 2X4QA 2R4RL 3FO1A 5TDPB 5CP7A 4KXZH 4Z7UB 5T1DL 3RVUD 3CX5J 3RDTC 1MCQA 1UCBH 4DOHE 2BY3A 3CC5B 3QAZC 4YNYB 4ZFOA 3EDFA 5GRWA 1FZOA 4CU8A 5GS1C 4H1LH 4N9OB 3B8YA 1KN4L 3RZCA 3MZGB 3PF2A 4P57A 4Z95L 1L0YA 1MUJA 4NQCA 3T3PF 3QHFH 4PP1C 1NMCB 4OF6A 4W4OA 1S7UB 2CO6B 1UQSA 4K7PH 4G8GB 1PQZB 2QQLL 1BP3B 1C7SA 4JFDE 3OKEB 4FNLH 4GMTH 4ZQKB 3S97C 4M5ZL 4PJ9D 3BKYH 2DB8A 5DK0A 1XR8A 1FFOB 3X3GL 1HDMB 3W2DH 2IALB 2BVYA 5D5MF 3STZA 5IEKA 3ESVF 3MRHA 4ORGB 3BMVA 3K2UL 4I2XB 4J8RB 2UUDH 5T1MA 2D7TH 1D5XA 4WY7H 2YSSB 4OGYL 1U3HD 4HQQH 5INDA 4G9FE 3MNWB 3QNXA 3KPLA 4ZPTB 3NIFE 3D3VA 1V3KA 2QV2A 4J3UA 2FX8L 1RIVH 2VDPH 2DAVA 4HWZA 1OY3B 1U8HA 3RGVB 3BPOB 4JY4B 3ET9F 5D93C 3FQWB 2CDEA 1JPTH 3VFSA 4OFVA 1ORQA 1IGIH 5C0GB 5IFJB 1SJVA 4L3ED 3MGAA 4KQ4L 4AEHH 3QP3A 1T0MB 3FQRA 2CRMA 4JJ5B 3R06A 5IB5B 2EDKA 5JOPD 1B2WH 4L3CA 2ERJB 1I7TA 4YWGL 2F5BH 4LIQE 3FZUD 4IOSD 2VDRH 3QQ4B 4NQCE 1HHKB 2HVKA 3B5GA 1X5YA 3FO2A 1EIBA 1W0VA 2QJDA 4WHTA 5F8QC 3IDYC 3S6CA 3QUZD 1DBKH 1AGCB 4X7TB 5EO9A 3DGGB 5F9OH 2E27L 1Y6NR 2BHZA 2Y5EA 5I73B 2NY7L 1BOGB 4C56A 3IETB 5K9JL 5JW3H 4S10A 2K7QA 1J0YA 5ETUB 2FGZA 3FO9B 4IHOA 1U8KA 4CMMB 4HGMA 2DBLH 4HAFA 1CZ8H 3TWCH 3I9GH 2R69L 3GI9H 1CIUA 5HHXH 3ARBA 3HRZB 3QWRA 3RWFA 1FLRL 3DVFA 3EOYG 1IFHH 3GHEH 2WIMA 3O4LE 4HUWB 4WU7B 1IGYA 5FYLL 5DJAB 3RP1A 5CJXA 4S1RL 3WL9A 3MBEC 2Z4QB 5HVHC 3HCVA 4KVNH 3S96A 1RURH 4GRWF 3SKOB 4R4BB 4GLRH 3QH3B 3T3ME 3TV3L 4XNMA 4EN3B 3NZ8B 2AKRB 4HFUL 2YD4A 4KV5E 3Q5TA 4UQ2B 1CLOH 2X89A 3CPLA 5DUMH 5F7HA 2IFFL 4Z7QE 4P2OB 1W72H 1PLGL 3QDGA 3PXHA 1CGVA 3VFRA 4OFKA 1ITCA 1LNUA 3IJHA 43C9A 2EZ0C 5IHUH 3P73B 2XT1B 4OF0A 1IBGL 1NGYB 4KJQD 4NDMA 3E6HB 4RAVB 1YY9C 4J1UB 3O2DA 5J8OA 1C5BH 4HWEH 4KKBC 3CVIH 1LVEA 4LAQL 3U4BH 4XBPA 5KOMC 1U8PB 2L7UA 1YDPB 4JRYB 4Y5VB 3N9GL 1A64A 2ZWLT 3WIFB 5DJDB 3T8XA 3V7AE 3DIFB 1RZ7H 2AJYH 4UINL 5EU6E 4ZDHA 3MQIA 3MOAL 4HJJL 3VCLA 1DEEB 3QFJA 3A6CH 1C08A 2DDQH 4JM4H 5BO1L 4Z0BL 4NN7C 2BJML 3S34L 3BOVA 3MJ6A 1Q0YL 4WWKB 2WUCH 4L4VB 2EKSA 5IJKA 2DWDB 4XT1C 1NAMA 3ARXA 1Q72H 1KEGH 1KCRH 2F15A 3ALWA 3IXTA 4MCYA 5KSBF 1ND0B 2DTML 5EU5A 1T0NB 3VXTB 1PZ5B 4L4VD 5C71A 1YPZE 4Q9RL 4MCZA 1SYSA 3VWKB 3ARGD 3AM8A 3ILPB 1OCWL 1TQBB 2VMFA 3O3DB 4PRIE 3U4EB 2GSIB 1J8KA 3WUWA 3BKJL 3DARA 3EJYC 1A2YA 5IOPB 1RHFA 5E6IB 3QRGH 1KLFA 1XFPA 2YC1B 3L3OA 4YHIA 3MO1A 1FN4B 3GO1L 1XT5A 1HWHB 7FABH 4EI5A 4NN7B 4X6CA 3I6GA 2XY1A 3EYFA 3RWGB 5GZND 1JRHI 12E8L 3MYZA 3VFRB 4JGMA 4NN5C 1JZ8A 2WV3A 5IMOA 1L9NA 4WI8A 3LY6A 3VD5A 3TVMD 4CAGA 1IC5L 5TE6L 5DT1L 4APQA 3QCVH 3NIGF 3EO1B 4EI6A 5T3ZH 5IIEB 1NAMH 3V6ZB 2VLJD 2I24N 4L8BA 3BPNB 1JWSB 4POZC 3SGDH 5IROA 4HCRA 4JN2A 4NRYA 2X05A 4MJID 5JHLH 5KS9E 4HIHB 3S3PA 4ZUWA 5KZCB 5HHVH 1P7QA 4W4OC 5ISZB 1DR9A 3TBTB 3QSKB 2VLKE 5C0EB 1I8LC 4L3EE 2VXSL 4YHNB 2WWKT 5LCVH 3G6DL 4YNYA 2NR6C 2DLFH 3PJSB 1FNSH 5I1GL 2C1PA 4A2MA 3BO8A 3L3HA 4HKBA 4Q2ZB 2JLLA 2ZUXA 5EC2A 1PKQA 1T5XB 1P4IH 2P4AB 1GGCH 4LF3A 2XZQH 1OGAE 4OQTA 4R0LA 5AZ2L 4O2FB 4G42A 3VI3E 4FQHA 1JWMA 3QEGL 2Y06L 1K4CA 1CFNB 5BXFA 4PJEE 3ZKMC 1GJIA 4PJ8A 3MUGB 2Z92A 4DKEH 1I85A 3PWJB 2CKBA 4IRSB 4M61B 2C1OA 5GISL 1EJOH 3KXFE 1FL6B 2FWOB 3FB6B 1LDSA 5DJ8A 5KVDL 3CFKA 4MXWL 3W5NA 2IF7A 5EZOL 4UMGA 4LPVA 1JPGB 1EUUA 1H3WM 2Q7YB 4HK3J 1YYLL 4OFDA 5KN5B 1NCWL 3TVMC 2FEDD 1SEQL 1YEJL 4G43A 4NO3A 4P2OD 1QR1A 3KWWB 1MCWM 1D5XB 3HE7D 5EO1B 2B1AL 4KY1H 5DD6B 1OVZA 4RGNB 3U9PH 3QUKA 3GK8L 3MRRB 2J5LB 5IESH 1ETZA 1NCBH 4G7VL 4G8FA 4IM8A 1A7NH 1LEKB 3V5HB 2D0FA 3S5LG 3WIIH 4LARL 1ES0B 4TSCL 4MD4B 4WWID 1PYWA 5ITBL 3P9LA 3RWFB 2IAMB 3VGHA 5DQDH 1U36A 4JHAH 4JQVC 2VXTH 3QCUH 4PFEA 4QRRB 5EB9A 5ISZA 4YH6A 5HD8C 4LCWB 4ZXBD 4BZ2H 1CFSA 2XTJC 5FDWB 1C5DA 4OZHA 4KKBD 1WLHA 2XA3A 1CFVL 3OKDA 3OAUH 5T1LD 1JCKA 4FQXA 1MREL 1F4AA 4MQ7A 1RFDL 2F8XC 2DM3A 4LGSB 4LF3B 4YC2B 2ITCB 1ZLVK 4DOHB 3CZFB 43CAA 1SBSL 2NXYB 4RISH 3QUXC 2B4CC 1BJ1J 3UJJH 4NFBA 1M71A 1O7SA 2IEPA 4F9LA 4AEEA 3QWOA 2NY1C 2VC2H 2XXCB 2MKLC 3KYMA 1P4IL 2DI7A 3O4LD 4P2RD 4ZO6A 4KWUA 1QZ1A 3RDTB 2JCCE 2BY2A 4FZEL 4N5EC 32C2B 1J0JA 1RULH 4HPOH 1I7ZB 3EDDA 5E6ZA 2EH8H 3WLBB 4GUPA 4NM8L 2MOVA 2Z0BA 3EBAA 3REWA 1NFDB 1G7QA 3AY4C 4UINH 3TT1L 1DBMH 3UX9B 3WHE0 5EUOE 5BZWB 1IEAB 1OD7A 5IW3A 4DQOL 2P5WB 5L6YH 2WBJA 3FTGA 2O5XH 3KR3L 2XKSA 3E6FA 1N64L 4KU1A 4OLWL 5I19H 1EERB 1QBLL 4BSVB 1EZVY 3BPLC 3QPQD 1ZVSA 3CK0H 4PJXE 5D2LE 1KG0B 4RWYH 4QNPF 1MHHB 4RZCB 4LLUB 1Q9OB 1HXYA 3RA7L 4OCXH 1P53A 3MJ9A 4DKAA 2YOCA 4H26A 4GAJL 3LSOA 1ZGLB 2OL3B 3MRQA 3QHFL 4KPHH 1B2WL 1AY1H 1N8ZB 5E8EA 5LKNA 4PJHA 1QFUL 5CJQH 5D1QB 4OUUA 2K1MA 2ATKA 2BOBA 1LP9E 3LPFA 2JK5A 5D5MA 1FNGB 3RWCA 5ERWB 3ZDXF 1A6TA 4IMKA 2PO6C 1UM4L 4OZFB 4M6NL 4LSVH 3BAEH 2EDLA 3MV01 4NCC1 2EDXA 4U1SB 3NAAL 3DURB 1U8MA 2ZCKH 3QFJD 2IFGA 1J1PL 3ISWA 5EPMA 3JV4B 2D0GA 1JN6B 1QFPA 2EIBA 4JAMA 1VENA 5CJBA 5JW4N 1ZA6A 3CFIC 1WZKA 5D72L 1A3LH 5HYJA 1CIDA 4J4PC 3REVA 5FECA 2Z8VC 3MRPB 3RZWA 1XGPA 2CLZB 4ZUSA 4OLWH 4BK5A 1QSFD 2VLLB 3FOLB 5DWUH 4AH2A 5TE6H 3SJVA 2DKMA 1U3HC 2WWMC 4XAKE 4XP9L 5I8OH 3SDXE 1A02N 2VDKH 2RBLA 3MRBA 1L7TL 5ESQB 5JIHA 2EYTB 4KV5F 3RKDC 2VIRB 5IHUL 1YYLH 1LE5A 3SQOH 4FQCL 1KJMA 1S78D 5MI0B 1OAXH 3AC0A 4PG2C 1JIBA 5SWSB 5IMLB 5DC4B 4QT5B 1QPPA 1EGJA 1TTFA 4KUCD 5EZJA 3WFBL 3ZE1E 5E2WL 4U6VL 5D6CB 1F3DJ 5T1DH 1PAMA 4PB0H 4WI4A 2I9TA 1MLBB 3TC9A 5LGJA 4D9LH 3FT4A 2HKHH 2NW2A 1MCPH 2GFBB 3RBSA 2HG5A 2D7NA 3ARPA 3KXFA 1J0HA 3O4OB 3WFEL 1JP5A 3SDYL 1B6DA 3LH2H 5D8JH 4OCXL 4ELMB 2FBOJ 2J3SA 2QKIB 4PRPA 3VXNB 4K9EC 1S9WB 2YPLE 4NFCA 4U1KB 4X6FA 4HF5H 4HIHA 3UP1A 3MBED 4WUKH 4YDKL 4IRSD 3RY4A 3T0WA 5FYLH 4ENED 5CEZE 1U8JB 4LSQL 3WJJC 2VDOH 4ZXBC 4JRYE 1KTKE 2OK0H 3HG1A 1QPXA 4M5ZH 4X9FA 4RIRA 4B7IA 4R7DB 5GSRB 5EOQL 3H42H 1AR1D 2Y6SD 1UG9A 3EDJA 3N85L 1JPSH 5IBLD 3GFUA 4K71B 3UPAA 3UYPA 3PWVA 3QDMA 4OQ1A 2X7LB 3MLSL 3SGDI 3DUSA 4OZGF 3W11C 3O4OC 1AO7D 1HHIB 1BWMA 1BQLH 3CNKA 2VXUL 5KSAA 4KDWA 4ZFFA 4U6HA 4NHUB 4FFZL 4G8EB 1BFVH 3TJHD 5L8KB 4HD9A 1YN6B 4NSKA 4HBCH 3VWJD 1IGIL 5DVMA 1FBIH 3MUHL 4DCQB 2JJVA 1UZ8A 1F4YH 1MFEL 3VXSB 5MERA 1NFDF 2NY4B 2BNQB 1RMFH 4XWOC 5E2UH 3OKKB 4JREB 5D2NC 1UWEH 2OL3H 5DTFA 4PJAF 1GRWA 2GEEA 3WKML 4P9MH 35C8H 2WLYA 2X4SB 4PRPE 1D5BA 3QWRD 4P23C 2IWGA 4NKQB 3RDTA 4KROC 1A7BA 4GO6B 4XH2A 4B53A 3F62A 1JGVL 1V05A 1I3VA 3QUMB 5D7LE 1FNHA 3DJ9A 2H9GA 3VI3F 3SQOL 4M7ZB 1ZLVH 2YD5A 4X5LA 4NN6B 2BERA 1YMHB 1KEMH 4ONGH 5ISZD 3WNKA 5F96H 5D7IF 3KYOA 1U8QA 3PIQB 5ID1A 1NCDH 2ATPA 3RUGA 1BZ7A 2DRUA 2EXYD 2V2WA 3O9WD 3OHXA 1YMMA 3QQ3B 4AM0B 5E7FA 5DRXA 2MSPA 3IYLW 1IGTA 3TT1H 2GJ6B 1QVOB 4Y8DC 1X9QA 4P9ML 5JDSA 2VLKB 1N6QL 2O61B 1QD0A 5I17A 4FTVB 1VKXB 5EZIL 1NFKA 2F58L 4Y4KA 1JFQH 3EOTL 4Y1AA 5EUKB 2R23B 1F02I 5FOJA 1IQDB 2BOBB 2OJZH 1QSZA 1J0ZA 1YN7B 1HHHA 5M95B 3WXVH 5EO0B 4WEBH 3VU2A 1GGIL 4GAYA 1NCUA 3RTQA 2GJZA 1UH4A 1BQLL 4FQPA 1JNHA 5B38A 4WTXA 3HR5B 2OJEA 4PRHA 5H37H 1C7TA 4JHWL 3JV4A 3C08L 1S7SB 3NCBB 1MAML 2YRPA 5BZWA 3EFFB 2RAMA 3W9DA 4JCMA 4F2MB 5EWIL 3WDIA 3U36B 5TH2A 1T03L 5FM5M 4JRXB 4KDVA 2OMBA 4APQD 4K8RC 3IDXH 4MLSA 3K1DA 4TVPH 1A3QA 3VDBA 1NPUA 3RZCD 5I1AB 4Y4HC 2NY0C 3AAZB 4LCUA 3UPRB 1HXYB 3O3BA 2DDQL 1XGTA 5HHNA 4FFWD 4E9LA 2PR4L 3H8NA 5K9QI 2KBGA 4M62L 3MV8E 3KPTA 1P7QD 1BJ1H 4U1JB 4MB4A 2R2BB 4BKLB 1S5HA 3RKPA 5AWNH 1JV5A 4H5SA 3V7MA 2YEZA 3LKNA 5JUEH 3SQBA 2QQNL 5C08D 3HE6D 1IGJB 1RUPH 1NC2D 1HH6B 4LU5L 3D39B 5I8EA 2P43B 3WO3B 1TCRA 2QBWA 3LKRA 4PRAA 1KENH 5CJOH 3I6KA 2EE2A 3SGEI 1AP2A 4P46B 4DGIL 5DF0A 3BN9C 3NACL 5J57B 3OB8A 4YBQD 5J89A 3Q5OA 1ZA3A 2PW1A 3I02B 2XWBB 1MH5A 1EV2E 2YPLD 1B9ZA 3FRPG 4YFEA 1WITA 3KPSB 1DQJB 5FIEA 5CZKA 4ZNCD 2JJUA 4XAKD 1FG2A 4Z8FL 3QUZA 4ZUSB 1DVFA 2IPUG 1T6WA 5IEHA 5FGCB 4KRPB 3ARQA 3QIBA 4NYLB 2EEAA 4F7PA 3RZCC 5L0QB 1T89C 5L2KB 4MAUL 1G9MC 5IW6B 5EBLA 4YDJB 5AWNL 5ITBH 1M7DB 5ALBH 4UUJA 4PJ9C 4U1MA 4N1HB 5IB3A 4APQC 4G6FD 5CCKH 2VXTL 2UY7A 1CT8B 2ZKHH 5EA0L 3FOMA 5ESAA 1QO3B 5F1KC 1RZGA 2RCSL 2YKLL 4PD4J 5D2NE 5HGBB 4WI9A 5KSUB 1FP5A 5C6WH 4LCCA 4HHAB 3F7VA 3SDDA 4CU6A 1SY6H 3SBWA 4QWWD 3QG7L 1BLNA 3OTTA 1QEWB 3KG5A 4XMLH 4OLYH 4U1IB 5GS0H 1UJ3C 2ICWJ 1NBVL 1Q0XH 4LLQA 1HSAB 1YEIH 2A9MH 1MLBA 1AKJA 5GS0C 2CKNA 3V6OC 5JTWA 4KK8C 4U6HB 4FQLL 2AGJH 4XNZB 3KPQA 1DN0B 4FQJL 2NY0B 4QRUA 2P5ED 4ACPA 4P4KA 5GSVA 1GL4B 3RY6A 1YEEH 1FZMB 1BVLB 5ESVA 5AYQA 5F7MC 3SE4C 3ULVC 4Z78A 4ONFH 4FXKA 3MBEA 1V3JA 2Y06H 4XPAL 4AYFA 5CUSL 1WBYB 5E08L 3O8XA 1BQUA 1T20A 1ZLSL 4NZRH 1S7XA 1A6WH 1N0XL 4AMKL 5DC9B 4UT9H 4NZUH 4YIQB 1N6QH 4P46D 5H2BA 4QOKE 5GGVY 3ZHKA 1YNLH 5I16A 1CGSL 1BD2E 4Q9BA 1UGNA 3IKCB 1QKZH 2AEPL 4M1GH 1SY6A 4B41A 4RAUA 1AY1L 3W0WA 1FIEA 2AJXH 4N0CC 1YNKH 2R2HA 4KJYB 3VFWB 2JELL 4D9QE 5D2LF 1KOAA 1VDGA 4JY4A 5C09D 3IDJB 1J05B 4X80L 1S9XA 5C0JA 2VL4A 2XWTA 4LRIC 2FB4H 3MV7B 4J6RL 1QBML 5HYEA 1KBGH 1UADC 4UT7L 2VZTA 5AUMB 3QUYC 4OLUH 1XH3B 1FVCB 3AGVA 3MREA 3DYPA 4KMTL 3K0WA 2ADIB 3TNNA 3WNMA 1KCKA 1ZHBA 5TFSL 1FC1A 1YNLL 4K3GA 2R2EA 3LQAC 2F5BL 2P8MB 1JHKL 4Q97A 5KVGH 4XH2B 4XNUL 2ORBL 4GXUN 4GW1A 1OM3L 4JVWA 1DEDA 1GZPB 1OGTA 2WWMD 3EO9H 5B38B 2H9GB 5I66A 4RMTA 2OJEB 5CAYB 4YHPB 1OAKL 2ICEA 1ZGLM 2QSCH 3BDXA 4X6DE 2XQYG 1E27B 3OGCA 5DD1H 3ZSTA 3C8KB 1A7OL 1FIGL 3WFHB 3L95B 2V7NB 5I1EL 1QA9A 2W0FA 3P4MB 4PG9B 1BBJA 2OLDA 4LFHD 2D9CA 3AXLA 4YUEL 3I2CL 3MNVB 4PY7B 5LBSH 5FYKE 3SDCB 3SE8L 5TF0A 1MRFL 4YHKH 5E7BA 1PKOA 4MJIE 1RIHL 1MCEA 3GMMA 3LB6D 5DMIL 1XF4B 3CD4A 1T3FA 2OM5A 4K94L 3HMXH 1DQDH 3BW9B 5CEYB 3KJ4C 4YDIH 3L7FB 1SM3L 1LNUB 3IT8D 4U2ZA 5A16A 2W07A 2AJXL 5FKAA 1JHTA 2B2XL 1MLCA 3LEXB 4GOSA 3AS1A 3PXJA 3T0BA 1GH7A 1CF8H 3FZUC 2FH6A 2HTKC 1W0VB 4BH7A 5BZDB 2HTLD 2VLJB 3SDDC 5IB4B 1LP9F 3EJJX 4FS0A 1U8PA 3H7BA 2ZZUT 1XCQB 3BRGC 3MA7A 1IBGH 4PV8A 2EEDA 4AT6A 1LWRA 2H3NB 1HZHH 3WBDA 4WU7A 3G5YB 1YY8B 4Z8FH 1MHCA 5IMMA 2PW2A 1M05B 2AERT 5HYSG 2Z4QA 4OZGA 2VXSH 3WNLA 4ZTOL 4XPBH 1TPXB 3MRIB 2NY6B 5EC1B 2AKRA 4LHUB 2X6MA 4FQ2L 2ITDA 5HYFA 1ZLUK 3F5WA 1OTUC 3SE4A 3P9MB 4TNWF 3TJHC 1Q94B 3QDGB 3RVWC 3ZZ1A 2MPAL 6FABH 4AJ0A 4NM4L 4RFOH 3RX8A 5D6CA 4E0RA 2P46B 2OTUA 3V52H 3VXOB 1Y18B 1A7RH 1TVHA 4JFPB 5I6XB 4LVOC 4OZHE 3CFCL 3HC4L 4FNLL 2XWBA 5F70A 1JL8A 1RJYB 5J9PA 2V7HA 4NNPH 3NN8A 5B21A 1G9NH 3QZWA 1NCBL 2CDGB 2CJUH 2DIJA 2J8UF 4PY8I 5B4MD 1D9KD 4X83A 4MQTB 3MROA 5J1AB 3DGCR 2GK0B 4PG2A 5HYSB 1U8JA 4MJ2A 1KEML 3BZEA 2KH2B 4RGOL 1L0QA 3MRKB 4UQ3A 3IFLL 4YLQT 2EDDA 3E8UL 4R96A 4C4KO 1AQDA 1GPOH 5HI4C 1L4IA 3QDMD 3O6KL 5E4EB 3VW3H 4V1DD 5HGHA 2F5AL 3B3IA 5EOCL 2E9BA 2WUBL 4IMLB 2H3NA 4D9QD 1KPRA 4ISVB 2FSEB 5BRZD 1YEFH 3SDDB 1UWXH 5JIPA 2DMBA 3EYSL 2IC2A 4JVUA 4WW2F 1W0WA 4OI9A 3F7YB 3GMRB 3O8XC 1XGUB 3UZEA 3UTQA 4O4YL 4LLQB 5DI8B 3PWUA 1KYOK 4ALAH 4H0IA 1IC4L 4QRPB 5C0JB 1P6AB 4RGMC 5CBEB 4CUCA 2FIKA 4JVPA 5IBLC 1YECH 3VH8A 1XGYL 2V6HA 4HPOL 1I8LA 4NC1E 4PP2B 5I18L 5SWSD 2GT9B 5SX4H 1HEZB 4OSUL 2A9NL 1Y6MR 5TDOB 1G7LB 2VISB 4NM4H 4RFOL 3ALXA 4DAGL 1Y0LB 4G6KH 5IGXL 4BFGA 4N0UE 2AXHA 3N9GH 3MRDA 4MWFB 3SCMB 2XKUA 1UCBL 1B0WA 1VPOL 1P7QB 2V5SA 4DK3A 2UVEA 2FO1A 3D69A 5KANG 3U7WL 1WAAE 5GQBA 3OAYK 4NCC2 3VRJB 1W8NA 2HTKD 2OR7A 1YMMB 3RRQA 4JHZA 3E2HC 2FBJL 4JJ5A 5E94B 4P3CL 2EE9A 4RDQF 4BZ1L 3MGOA 1P1ZA 4AQ1B 1GIGL 3U7YL 1ACYH 3T65B 1RUPL 2JJTC 2H8PB 4MSWB 4NQSA 4PV9B 5EULV 4IS6A 1D7FA 2OP4H 4XC1H 1AJ7L 3T77A 5CP7B 3RVTD 4KKCD 2NW3B 5FYLE 1A7NL 1J5OL 4EUPH 1RAMA 1U95B 2VDQH 1W8OA 1XR9B 4LU5H 4X6BA 2XG4A 3PWLB 3MJ8B 3D0LA 4L4TD 1MCLA 4PJGB 2Z8RA 5I75B 3CFJA 3T0XA 4DZBA 1DSFH 4PUBH 4PRHB 3H9SE 1LEGB 2G9HA 2DKUA 4JQVA 4N9GB 1AH1A 2Y25A 3J7HA 3GNMH 4Q6IB 1I7RA 1G7HB 2JTDA 1AIFA 4QRQB 4Y2DD 1X5ZA 4AEIL 5KS9A 5BZDA 3HMXL 5E00A 5CKGA 4LSPH 2H26B 3FONA 4NBYB 2GJJA 2VN4A 3VXSD 3HPLA 4NWUH 4M1GL 5F89B 2YN3A 3CFEB 4L9DA 3CSYA 2A6KB 3RVTC 4PGJA 1L6XA 2W0FB 1WISA 3QRGL 4QOKB 5AG9A 4M7JH 3QQ9C 3NCMA 1UB6B 5FKPB 5DR5L 3TH3T 1AHWB 4WFHE 1N7MH 2KZ1B 2Q6WA 5AG8A 1I9IH 3L5XH 3WFBH 3VXMA 4HUVA 3AB0B 5D6DC 3QCTL 1IAIM 3SKMA 1B6UA 1RJZB 2DLFL 4YK4C 4LHUG 1BQHG 2YPVL 3LCYA 3A0OA 1KGCE 4LCWE 3WUWG 3BRFA 1ZTXL 1AQKH 1PBYA 3CSBA 3WIHL 4JRYD 3CUPA 3B4NA 1LEIB 4MJ6A 5ID0A 5B39B 4ODTL 3NA9H 1NCNA 2B5IC 1INEL 1R3IL 1M71B 5IVZB 5DD5L 1EX0A 3TCXA 2Q86A 3GIZL 4M7LT 2WBJC 4OUUB 3CDFA 4KZEL 4G6ML 2V9TA 1RUKL 5FYKL 1FC2D 2IADB 4M62H 3KYKH 5C0CE 3DVGA 3KPMB 2VQUA 3ZYOA 5D96C 4JDTL 5FK9B 4HX1A 3VXPA 4LP4A 3W39B 5JHDE 2H1PL 5GGSA 3R1GL 2E3VA 3LRSA 3REWB 3U82B 3FRUA 4JR9H 1CD8A 1M05A 2IANA 3BWUC 2GCYA 1ACYL 4GBXA 1F6AB 2EIZA 3K7UA 1UXSB 5JXED 2VZOA 3MJ9L 4TQEH 1K4DA 2R15A 2FGWL 5C7XL 4R96B 5J0BA 1G7QB 2EXYC 4MAUH 4LLWA 1IKNC 4NNYB 1SEBA 1P9MC 4UU9B 4UZGA 3BRDA 2R0LL 3ARDA 1I1YA 1OARH 4P59L 4R90H 4JZOA 2OS7A 1H5BB 2VDLH 4S11A 3ARFA 3X12A 2BC4B 1QOKA 5DJCA 4BELD 1A4JB 3BQUB 1QSFB 4M43H 2I25N 4XPFH 4AENB 4YHYC 2RQ8A 1CU4L 3L6FA 4QTHA 5IW1B 4TYUA 4WFFE 5HVFB 5FF6B 1NJ9A 3Q2CA 5SWQB 4F7TB 1JGEB 1JRHH 3EDKA 5D7JD 1K9TA 3C5JB 4X5WB 4PJ9B 5A40E 1CLYH 4YPGB 3O11A 1MEXL 4NWUL 4M1DH 1A6TB 4N0FA 2W9LA 2NPLX 2E9IA 2WANA 1OAZH 1IKNA 4YE4H 2JCCF 2DM2A 1MHPL 1FQ9C 3GMOA 1S7VB 1EA9C 2Y5TA 2IAMC 1YEIL 2A9ML 3BGAA 4G8IB 3FFCB 4EZMA 1JYNA 1VEMA 2HKFH 1YC7A 4TULL 3GIVA 5DQJA 3PHQA 4P2OC 1I8MA 4F3FB 4HUXB 1R3IH 3C60D 3GSNL 4FXLA 3B43A 1JNLL 2DI9A 3H3PH 4ODVH 3QNZA 3W11D 3IFNL 2NYYD 4I0CC 4XWOD 3GMLA 3R8BB 3MFGB 4MNGE 4DFIA 4EVNB 3MJGX 2XI9A 1I3RB 2CK0L 4LPTA 1CGUA 5DFTA 2VDLL 1F6AA 2XNAA 1RVFL 2AEQH 1UXSA 1CD9B 1F11B 1H9VA 3IJYB 5BOZG 1A6ZB 2A6JA 1FGVH 1MOEA 4JFFE 3P0VH 5I6XC 2F74B 5J11C 2CKBB 4O00A 5SWSE 4QNPE 1FVCA 3UBXA 1T7ZA 5DXWA 5ACZA 4X7FC 3FB6A 2PNDA 2VE6B 2HP4A 3BHBB 5DFWH 4Y19B 4BQCA 2NY5L 1GOHA 2APBA 3RTQD 1KJMB 2RIKA 1U8LB 2V9RA 5GHWL 1ROWA 2GFBA 1U95A 2CR6A 3RNQA 4BKLA 4RA0C 2BCKB 4U6YA 1R0AL 3P4OB 2NY6C 4Z7UF 1GYAA 1S7TB 1BEYH 3BP4A 2DOCA 3F65A 5FUZL 5BV7L 4P4RA 3LAFA 3IVKA 3WJLC 3MGTA 5CHNA 3IJSA 2JJTA 2DYPA 2Z31A 3T0EB 4Y4HA 1JPST 4NM8H 3D1MC 3P0YH 1T7YA 2EXWC 2YZ8A 5FB8A 3MLTA 3RWHA 3C8KA 2ARJB 5C08E 4HGWA 1WIUA 3SE9L 1E4WL 4NRXB 1SJHB 3O0RH 5C0AB 1QA9B 5C70A 2ZPKL 4GQ9L 1F58L 2CMRH 2OR8A 3QUML 2W65A 3DMMA 1S3KH 2QR0A 4N0RA 3ULVL 3QUMA 5IT2H 4HFWB 3AXLB 4DTGL 1MPAL 4HK3N 2N7AA 5CD5C 4YO0B 3CSYB 3LQZB 5T1LB 2RJMA 3BPCA 3QG6A 5C0AE 4OCYH 4ALAL 3LS4L 4KQ4H 5TQ0L 3RTQC 4AEHL 3EO9L 2CIIB 5F3HB 5F7DB 3IFOA 1LO0H 4KHXH 4L8DA 4G5ZH 4WGWB 5EORL 3WCYA 4X99B 4LSVL 3TN0D 1T0MA 4NO0B 5HPMA 2ZG2A 5DK3A 1R5IA 5J56B 4R97C 5F1NB 5EZLA 3O3EA 4HHAA 3VFOB 3CFJB 2AK1L 1RUQL 1UA6H 3FCTA 4ZUVB 3U1SL 3OKEA 1RZIA 1EAPB 1R24A 1BQHB 1VA9A 1UACL 3Q3GA 3QIBD 4NQCB 4OLXH 4QY8B 3RFZC 1ZK9A 3P40A 3E8UH 1N5YH 3ARZA 3L3JA 4QRPE 4DUVA 1KIPB 2AXFB 1AXSB 3OXRA 3JWDC 3RIAK 3QQNA 1F00I 3RTQB 2YWYA 3D3VD 1S3KL 5IT2L 3ULVH 5T3XH 4TRPL 5I2IA 1PSKH 5T3ZL 2FZ3B 2V5YA 1MI5D 3D39D 2LVEA 3LKSB 3MR9A 2H6PB 4LRIA 3OJDA 1HWGB 5T1MB 4AIXA 5DYOA 3EW3B 5EUOB 4Z0XB 4PRBA 1NUNB 2SEBB 3C8DA 4DVBB 1QLRB 2XA8H 4KQ3H 4XVUC 4PRNB 2ZOLB 1IGML 4O2CA 5E6IC 4Y0GA 5H94A 1RK0A 2DF3A 1H3PL 4M6OL 2I9LA 4KDTC 3SKJL 3UAJC 4N90E 2IAMA 3U6RA 1UVQB 4PJFE 4JO2H 1BZ7B 4PJEB 3WFEH 3P4NA 2VJXA 2XZQL 4U1JA 3U0TA 5E9DA 3L3KA 3CMGA 2JB6A 5DD0L 5ANMB 5IVXE 2A6IA 4FQ2H 1U0QA 3B2UD 2VAJA 1T1WA 4NWTH 1UYWH 3OKYA 2J6EL 2HLFD 3V5KB 2CRZA 5DUBA 2CD0A 4OCYL 4HKJB 1FGNH 1H8SA 5H37G 2D4DA 2OZ4L 4KJPD 4JRWA 4F58H 4K3HA 1JNHB 2OZ4A 1NMBL 3WS3B 3M1BB 2ZOKB 1UJTA 2MMXA 2UY6A 2OYPA 3NCFB 1G9NL 3I75B 3ARFC 4N0FB 5DURB 3ZDYE 3VXQA 4KK8D 5E2JA 2PXYA 1OP9A 2NTFB 1KXTB 4LLVB 4A2LA 1RZJC 3GMOB 2LE9A 3VXRA 1KPRB 5CEZL 1GC1C 1N2RB 2D3VA 3A6OA 3PHQB 2HRPL 4JKMA 3KPRB 1CICC 5L2KA 5DURD 4GW5B 1N5YL 4PB9H 2WWKO 3S8WA 5AAWA 2J8UB 1BECA 1DANU 1OAZL 5KVFL 4JM2D 3V4UL 4XP6H 4MA3B 1YEHL 4NPYA 4MCYB 3WHE1 3WDHA 5IM7A 1T7VA 1WWAX 2JJSA 2FLBT 4X4ZA 1QLEL 1NMBH 4IRZH 3GBML 4NKMA 1ZHNA 5DJ2B 2DMKA 3UTPD 2ZCKL 1MWAA 4YR6A 1ZVSB 5DEGB 1AO7B 3DX9B 1JHLH 5HGAA 5DMYA 3QYCA 3AU1A 1KJ3L 4CADB 2NY0D 5GZOC 4H0HB 5IQ9B 3S88H 2XN9B 4O02H 4XBPB 3TVMB 3QQ9D 3HZMA 2ZUQB 5DJ0B 3MLYH 5HGDA 3FT3A 2BVTA 5E2UL 1MCJA 3S37H 5D7SL 5DO2D 5J6GA 3MRMB 1MPAH 2HLAA 4NNXA 4Y5YC 4QXUL 1I1AD 1Q72L 3QNYB 3WFDH 1QFWH 3UTSA 5ERWA 1LDPL 3T2PA 3JXAA 4QRUB 5FM5O 2W9EH 3H6JA 2CXKA 4TUKL 4M1CC 2HJLB 4Y19D 4RRPG 4FXKB 4HJ0C 2DI8A 4XGZA 2X4TB 1RZ8B 4PJCE 3MFFA 5L7XL 3GMLB 4AL8H 1B4JL 3HFMH 3B9KA 1MQKH 4IDLA 2PYEB 4P23B 5JR1H 2XG5A 2XTLA 1ZA6B 4M02A 5F9JB 3D87B 3VFUA 4LAQH 3S36L 1ED3A 1D5IH 2MHAA 3DV4A 2PW2B 1HQRA 5IB3B 4WCYL 3NA9L 3PG2A 1RJLB 4MA7H 4EUPA 4M4RA 2ERJC 3GKWL 3QBTB 4ZFOL 3VXTA 1DBAH 4G6MH 4OCMC 4BUHA 2X44D 5E8OA 5F7EH 4ERSH 1B0GB 2W1NA 2FDBP 1NANI 4I18B 2NX5B 5E2TH 2QHRL 1JE6A 4RMSA 4W70A 1F4HA 1LP9B 1NEZA 3CH8A 2ADFH 3TP4A 2NXZC 4G7YH 3HE6B 3ROOB 2V5TA 5GRYA 4UDTA 2M26A 4EBQL 4HG4K 1JF1A 1EBPA 2HJFA 4W6WB 3HZKB 4DGYH 1AGEA 1OLZA 3OB0H 1WBYA 3MLZH 1NCAH 3RNKA 3V0VB 1K2DB 4YAQB 1FZJB 1CGTA 2Q8BH 2X5PA 2AJSH 3WHXB 1LK3H 1KIQA 1H3PH 5D1XA 3D39E 5IQ7L 1QBBA 1D9KA 1HSBA 1YMHA 4PJAA 4PJ8C 3QB7C 4LQFL 2MCPH 3FQTA 1XF2B 4LCYB 4JFEE 4KMTH 4P5MA 2H2PD 3G6JF 2AS5M 4KTDL 4I18C 4IIQA 3HI1B 1FZKA 3ROLA 5C8JA 4Y16D 1VCAA 4OF8A 5DJ6B 5C6TL 4WFEE 5TF1L 3PDOB 3VRLF 3TZVA 1B4RA 3IDJA 5DJYA 5EC2B 4U31A 1GVIA 4L8SA 4XMPL 3MV9E 1PYWB 3JBG7 5HGHB 3ARBD 4GG6E 4HS8L 2AK4D 3GSOA 1VB9A 4MVBD 4E41D 1F4XL 5EN2A 3ABZA 3TFKD 3NFPA 1FFRA 3CFDB 4Y1AB 4XNYH 2DQFA 2IQ9L 5KSVB 3BO8B 4XMKL 4Y4FA 4M48H 4RA3A 3RWEB 1KIUA 5FM4A 3WYRA 3SY0A 4CVUA 4V1DE 3VFTA 5HD8D 4JM2C 5CBAB 4HK0B 1T7XA 4PGEA 2W0KA 5SV4A 1EDQA 5DK0B 4S1DD 1TTUA 1JZ6A 2G5BB 3L5XL 4MQXD 1HCVA 5JPMB 2A6IB 5CGYC 5IVXA 1KC5L 1MFCH 2GITA 4FXGA 1GXEA 4BUGA 2FJFB 2YUWA 3RL2A 3QAZB 3FHAA 5DJ8B 1ODAA 4OB5L 4OIIH 2WMPA 3MCLH 1EFXD 3HAEA 3ROOA 2PCPB 4HC1L 1J87A 2YBRB 3DBXB 2F53E 2COQA 2HFFB 2F54E 2GAZB 3RWIB 5TDOA 1O5DT 4F7CB 3LQAL 1F3JB 1E0OB 4NKDA 4YAQA 4AZ8A 5IGXH 4F9PC 2GTZA 4WHYG 3L9RB 1JI2A 1FNFA 1IM9D 3K4ZA 5MP6L 2NZIA 4D3CL 4U33A 1PFCA 5IJVA 1CLCA 3QUXA 4GRLA 1V7MH 5DFVD 4LP5A 1BWWA 5GS0L 3QDGD 1I7UA 1HIML 2R0KH 4GW5A 1I1CA 4I3RL 1IAIL 3MMEA 2AQ2A 3LOWA 4NQXA 4JY6A 2O93L 1T1ZA 3B9DA 1JYXA 1HHKA 1HHGA 2ZSWB 1KTDA 3FQWA 1IC1A 5BW7A 3EYUL 2ZJSH 5EU4B 4ODXA 4I0PB 3ILQD 4CVXB 4BZYA 2ILLA 5J13B 2M2DA 5IB5A 4IS6B 1NUGA 2AJSL 4RBPH 3MRJA 5D1ZD 4NKIH 4MB3A 3BDYH 4QGYA 3QIUD 2EYSB 3QULB 1CFQB 4XPFL 4L9LB 5FA3B 4LVNB 1DN2A 3ZTNH 5BS0B 5HI5D 2V5RA 1CD1A 1OTSD 3DETC 4ONOA 5EOCH 1U8OA 4G8IA 3MXVH 3DRQB 2R1WB 3MV7E 3KJ6L 4WO4B 4M8QB 2VR9A 2JJSC 4L4TB 3VWJC 9CGTA 1HXMA 4WU5B 5DZNA 2E7LC 4LOUC 1MCKA 3DV6B 1MREH 5C92A 4LDOB 4M03A 3HE7B 1CK0H 3MRIA 1D5MB 1NGXB 4V2CB 4NZDA 2VAAB 3TBVA 3IETA 5FCUH 1YPZA 3MRKA 4UQ3B 3GUTB 1KEGL 4PGBA 1QHPA 2YN5A 3O4LA 4R7NB 3H9SD 2PO6A 3PQYB 3ZDZF 3FOLA 4FA8A 5BMFL 3CFCH 2ICES 4CW1B 1RZJL 2DJ4A 3QUYD 4NBXB 3C5SA 3C6LA 3STLB 2HMIC 3ZL4L 4XCNB 2NTSP 4YZFE 4PTUA 1NBZA 5HHOB 2VKXA 1J1PH 2J4WH 1A0QL 2X10A 3QEUB 3V6FA 3FQRB 2EDOA 3WD5H 5C07B 5IMLA 2JB5L 4I18A 3VRJA 1DL7H 3VMPA 1KCUH 1ZTXH 4PB0L 5DJDA 4HIJB 3BYTA 1A3RH 2G75A 3DPBA 2ATKB 3T1FB 2DQIH 4Z7QF 4I77H 1OB1A 3GSVB 2A74B 3ZE2E 1LE9B 5EIIA 5DA0B 1PW3A 3D0VA 2HG5B 4J1UA 4P2RB 4TN9A 4XB8A 3DXAB 3WLWD 3IDNB 1ZS8A 4TOYL 5ECJE 1I9JH 1E4XI 5E99H 1XZ0A 5FOBA 1HH9A 4Y4FC 1RMFL 1J86A 4OD3H 3C6LC 4L29B 4DVRL 4R26L 1H3TA 2A77H 2J4WL 3QXAA 2IAND 5IEHB 4L8DB 3ZL4H 3G5VA 5GRJH 1YDPA 3IGAA 4JRYA 1CXHA 4P2QA 5C0RH 1KIRB 1HYSD 1E6OH 2WNGA 4E41E 4J7RA 1K4DB 4YDIL 1HINH 4EXKA 3VE0A 4HUWA 1IGYB 4K7FA 2NY7H 4MMXC 5GGTL 3ZKXC 4CRPA 1N6VA 2XQYK 1JBJA 1D9KC 3TIEB 1EAPA 1R24B 2PXYC 4XX1G 5JMOC 3U4BL 3L3IB 4AIZB 3F58H 4LMQI 4QF1A 1MJJB 1B0RB 2A6DA 3CXHK 4UDTB 4KKNA 4CMHB 1NAML 5CZXC 5IVXF 2YPKA 1T6VN 3FL7A 1HYSC 1CTOA 4P2OA 1IAOB 4OZHF 1AXSA 3OXRB 4UNUA 3BD5A 3AS3A 4RGND 4BJLA 1OD9A 1CXKA 1TLKA 1AKJB 1JGLL 4MD5B 1E4KA 4KI5C 2A2QT 2OL3L 2PTTA 2X4PB 3E2HB 3M07A 3UJIL 4MLIA 5MERB 5DLMH 3SCMA 5HJ3B 5ICYB 4UIMB 1FORH 4P3DB 3KPPB 4NC0B 1FFOA 3SKJH 2PCPA 1ZANL 3LPGA 5A2KH 1D5BB 4IIQB 1S9YB 1BVZA 1DL7L 4HEPG 4TUOB 2V7NA 1YQVH 3PGDB 1V7NL 1BJ8A 3GSNB 4P2RA 4X6FB 4XXDB 3PV6B 4WW1B 2UWEF 3HPLB 3ZE0F 3SDCD 4D9LL 1P4LB 3IFLH 2CLRB 3O6FC 4LARH 2FECL 1IT9H 4NCDA 5K9KA 2FYYB 4HWBA 5TE4H 2X4RB 4WHDA 3V6OE 3LEVH 2BOCB 3G6JA 2CUHA 3CFBB 5DEFB 5GGTH 5K59E 2ZSVB 4GG6B 5TPWL 3KS0H 1ZT1A 1A1MA 4LHUD 5D2NA 4QXGH 3U4AA 2PYEE 4YHLL 1MCIA 1DUYA 4XZUA 3PWNB 4G6FB 4MD0A 3S7GA 4EDXA 5J6HA 4K8RL 5KJRL 3PL6D 4NUJA 2C26A 2QLVB 4JFFA 1C12B 4X9IA 3T2NH 2Z91B 4PRIA 4Z0BH 4ZO8A 1AKJD 5FO9A 3UCRA 1T04A 3S35H 3B9KC 5HHMB 5ENWA 1T5WA 4RISL 3CVHB 1INQA 3GSUA 2AJZB 4MAYA 2FRGP 4XCEA 4P4KD 3RGHA 5AUMA 5L7XH 4UAOC 2X1XR 1M6OB 4GJTB 1IAII 1T5XA 4WV1B 4QHKJ 2OP4L 4XC1L 2A83A 4DW2L 3LEVL 3P77B 3MLZL 3TJEH 1VFAA 3KPMA 3WIHA 3DVNA 4I3GA 1J8HD 1J7VR 5MHSD 1P2CB 4ZFZA 5E5MB 3JUZA 3AM8C 5E8NB 2Z92B 2DL2A 1HQ4A 4JO1H 3IJSB 1XF1A 3LD8B 2YHGA 1RIUL 3NIFF 4IOIA 5L88L 1NLDH 5L9DH 4GW1B 4MNQB 1B3JA 4A6YL 2VRAA 2I60L 3L7EA 3GMPB 4G9FB 5JPNA 2HH0L 3QIWA 5TFSH 4JQXC 4WEUD 3VRLE 4I48A 3QQ3A 1F4XH 4AM0A 4YHPA 3GUTA 3UJIH 3NBNA 1MWAH 1MI5B 1KNOB 4N5ED 4IOFD 2MTPA 2HT4D 3OF6A 2DQIL 1JGDA 5FYKD 1JNNL 2EO9A 2GJ6D 2BHUA 4UAOB 2C7UA 2AEIT 4CVXA 1G84A 2VABA 1TJIL 4U1LB 3TVMA 5J12B 2VWEE 2X70A 3F8UB 3JV6A 4Y1AD 4HIEB 5FHBL 2DYPD 1CN4A 4GRWH 2B39A 2YXFA 4NQVB 1LGVA 4AL8L 4LLMA 1ITBB 4MJ5B 4BSWB 3BZ4A 4BFBD 2VO5A 3VFPA 2AK1H 3NCYS 5FUCC 3KNBB 2Q87A 1BOGA 1PDKA 3GO1H 1X3DA 3SDAD 3RJQB 3Q6FB 2R56L 2O5ZH 4GKOA 4WJ5B 5DHYA 4G3YH 1S7SA 1SVZA 5KVEL 1F8TL 1XIWC 2J8HA 1N0XH 4GBXB 1GGCL 1A9EB 5CWSA 4NZUL 1ZHKB 4L4VE 5CP3H 3SJVE 1CYGA 3LV3B 3FRUB 3T2QA 2IPTH 3C9NB 5E08H 1HQRB 2VZ3A 2RGSA 1U91B 2BVUA 1WVZA 5KSBA 5GJTL 3R0NA 3VXME 1TDQA 4QRPD 5JHLL 1CR9H 1PD6A 3BJ91 4Z9KB 1RFDH 4X4ME 5A1AA 3TF7C 3GMPA 4G9FA 4JN1H 1IILE 2L7JA 2BXYA 4DVBA 1H15B 3H9ZA 1HIMH 2R0KL 4XP4H 1QNZH 1KBGL 4PBXA 3HE6A 3BDYL 1MI5E 1CE6A 1YYML 3SPVB 4ZODA 5E8PA 5FXCH 2GSGA 5JMRA 4EKXA 4HKZB 1Q9WA 4H20H 1TQBC 2FJHB 2YR3A 4DQOH 2WBWB 2BVOB 1E6OL 1T4KA 5FHAL 3IJHB 2AK4A 5D1ZB 2FB4L 3ZTJG 2V2TB 1N4XL 1FYTA 2R8SH 4JANB 4TTDD 2WIIB 3BP5A 2IANE 4N90D 2YZ1A 3T1WA 3K2MC 4R8WL 5D6DA 3QI9A 4PJIF 4P5MB 5GZNC 1VADB 5FHBH 3V2AR 3DO7B 3MLWL 4Q0XH 3P0VL 5HYJE 4NO2B 1AGFB 1DCLA 3MRNA 1I85C 2ZUTA 4NC2B 2ICWA 1P7KB 4KAQL 4BYHA 4OZGE 3P9WB 1OGAD 3FFCA 4FQIL 4F7PB 1NFIB 4YXLL 5JHDA 1PY9A 3FFDB 3OR7A 4UNTA 3K46A 4MZ2A 3HI5L 3QISA 3V4PH 3MJ9H 2F19L 4TQEL 4CL7A 4DUXA 3BIKA 1NFDA 3KYNB 3C8HA 2QADB 3O9WC 5CINL 1E4XH 5D2LB 1Q38A 5JOFA 1LO5A 3JTSB 4IRJA 4RGNE 3N1PC 4RFNC 4ZPVA 3W0WE 4F9LC 1FL3B 4NIKB 3MLRH 1K3IA 1QO3A 3RVVD 5JW3L 5DGQA 4MCZB 3UYRL 1CQYA 1N59B 2VZSA 2UWEB 3D18A 1IAOA 2CR3A 2Y23A 5GRUL 4L5FH 1GZQB 4WWKD 4M4PA 4EEEA 5DJ2A 3IFPA 4QRTB 1A7PH 4AY0A 3T2NL 4JFXA 2FEDC 4H26B 3N1QC 5IV2B 3C2AH 5CBEA 4EI5B 5DZOA 2E7MA 2AJUL 2OTWA 2BMKA 3THMH 3K8LA 5F88B 4RQQB 4WFGE 4Z7OE 2BVPB 4NP4H 3AMLA 2BSSB 3OKLA 4HS3A 3QO1A 4H88H 3H0TB 2P8MA 3U7AA 3UJJL 1K6QH 5CJ5A 1UWXK 1C1EL 3SO3C 1TITA 4RIRB 3VFNA 3O3AB 2R0LH 2Y6SC 4ELMA 4GKNA 2EC9U 1J12A 1I3UA 1EO5A 5CJQL 1H0DB 3OXSB 4KI5E 3FT4B 4F7MB 1GPOL 2KZWA 4BQ8A 4HC1H 3IKKA 3O45A 4O58L 2J5LC 4P23A 1FV1A 3ZTNL 5CUSH 5ABDE 1UXWB 4YHOL 2P7TA 2M8XA 1JZ4A 3QG6B 3SDXA 5HI3D 4HULB 1VACA 4LFHG 5JQHC 2EYSA 1S7WA 2R1XA 4ESKA 5I75C 4G8GA 1WEJL 5ADOH 3S88L 3BD4A 2HRLA 4NQDE 1CVRA 2D03L 3I6LD 1JZ3A 1F58H 2CMRL 4LASL 2ZUSA 1K6QL 3GSWB 4AEIH 3UMTA 3CFKB 5GGUB 4Z7VE 4DTGH 4MDJB 3PNWA 5DSCB 4MQ7B 3F58L 3WLWC 1KCRL 5CLWA 2BSRB 4PY8J 4G8EA 3IDGB 4F37K 3H9SB 2W9EL 2PKDA 2AV1A 4MXQD 1XCTB 1YEDA 4HUNB 1QRNE 2E8YA 2P48B 5EBWB 3P0GB 2W0PA 2D9QB 3M1BA 1TZGL 4BH7B 3FN0H 3S36H 4GAGH 4WIQA 3AS2A 3C08H 3RZCB 5L0QC 3KXFB 1YJDH 3NH7L 4C4KT 8FABA 5IHLB 3P4LA 1RUQH 1UA6L 4QHNA 3SE8H 1L9MA 1IGCH 2YD1A 3GRWL 3QHZL 2YPLA 4M3JA 2R9HC 2ICCA 2P8LB 4XCCL 4PJAE 1V7NH 4O2EA 3BMWA 4K9EH 4H25B 5IBTL 3U0PB 2NY5H 2GJ6A 3O41A 4OFIA 5EU7E 1RK1B 1TVBA 3QXTA 1CBVL 2BSTA 4HBCL 4S1SH 5KW9H 5HDBE 2BNRE 4M9PA 1U8HB 4HMCA 3RGVA 5I15H 1NC2A 5I1DA 2ZOLA 3KLHC 3O6LL 3HC3H 5LAXA 1DFBH 3MV9A 1Q9OA 4Q9RH 3KPLB 4ZPTA 4K23H 4MJ5A 1QFUH 5ADPL 5CIPB 1JHTB 4JFHE 4DN3H 3DUSB 3FMGH 4ZTPH 5I18H 4XVSL 4GAYB 2JJWA 4WFED 3MPCA 3OPZL 5KBNC 1HKFA 1BM3H 2BVQA 3MRGB 3VRIA 4XB7A 1T22A 4KJWC 4E42B 4Q6YA 2EDQA 3F7QA 1EUTA 3WEXA 4HQQL 3E1F1 5BQ7B 5FOBB 1A9BB 4CVZA 1DBBL 1RJYA 4CKVX 4F3FA 5D70H 4RGNC 5D93B 2E6QA 1CLZH 4WNQA 2DQEH 5IHBA 3HRZA 3BP5B 4TSCH 5GS0D 1IZJA 2O61A 3ULUL 3D2UD 3VXSA 5K9JH 2MFNA 3Q0HA 4ZQKA 3Q48A 4JFDD 2EYRB 1BVKB 1IEAA 4FP8H 3RVXD 4OI8A 2C4FU 1EEYA 2Q7NA 3LMJL 5DEZA 5AZEH 3LN4B 4UB0L 5T3XL 3LEYH 1LO4L 4GUPB 4KZEH 1OAQL 3ARVA 3C09B 3TCLB 2IJ0C 2BHYA 3CPLB 3T04D 4RNRA 3FMGL 4M7KH 4HT1L 3PGCB 5C0NC 1BZQK 1H8OA 4X4YB 4FQQA 4YXLH 5E5UB 3SGEH 4P5TB 2UWEE 1KXQE 2XV6B 3K4AA 4Z76A 3U30C 1NBYA 3E3QC 3RUGE 1DE4B 1FNGA 5I0DA 4KI1A 3IRZA 2R0ZH 3PWUB 4WFFD 1FFPB 3DSFH 2XWJA 3TJEL 1FYTB 1RPQA 5GJSL 3UZVB 2EC9T 4GBXC 5JNYA 1RIVL 2VDPL 1OSZA 3EYVB 5F6IC 4YJZL 4K3DH 4PJDB 3P73A 3C5ZB 3FO0L 3MCKB 1FVDB 3VGDA 5DDHB 3IAQA 4D0DA 3L3DB 3QUXD 1FDLH 1MFAL 3KPOA 2XA8L 1JV5B 4H5SB 4KRMB 1AQDB 4WRLA 4ZD3H 1HHHB 2FX9H 4Z7VF 3D25B 4X8XA 4HS3B 1BD2A 4QKXB 1INDH 5DJXA 4XVSH 4N8VG 5D1XB 4ZS7L 2VDMH 1AE6H 5F93C 2VDRL 4NJ9L 2VITB 3OG4B 4XGZB 1M7IB 1NCTA 3FQTB 1UENA 1XGPB 4JN1L 1DFBL 4PTTA 3U2SB 3MV7D 4OCLC 5IW6A 1BLNB 1EEYB 3LKPA 4JFFD 1ZE3C 5JZ7D 2P42B 4JREC 1MFNA 2ADFL 3DIFA 3ARDD 1IL1A 2E9JA 3ECBA 1B0GA 3HNTL 5KTEH 2WQRA 3SDCC 1CI5A 4MS8D 1AGBB 3C5ZC 2UWEA 2J88H 1AJ7H 3INUL 1T21A 5DO2C 2XNAB 3BIBX 1U8NA 2W92A 5A2LH 1YEEL 3B5HA 2R9HD 3TPKA 3MXVL 5KG9A 4JKLA 3DMMC 2ADGB 3LQMA 5D9SA 4PLJC 2FL5B 1SQ2N 2YXMA 3KJ4B 4PP2A 3QDJB 3OQ3B 3JTTB 1JZ5A 1DQMH 1QQDB 4P48A 5CILH 4Z76B 4WV1A 1ZVHA 5FO8B 3DYMA 5IF0B 4UILH 4HZAA 3RNKB 3ZKQD 5BO1H 1J8HA 2O5XL 3MLXH 2H41A 3KVQA 2Y07L 2IBZX 5CZVH 5E8NA 2X4UB 2AW2A 4XBEH 1RV6X 2I9TB 3CLEL 2GT9A 2R8SL 2FJFA 4N9GA 3A6BL 1A2YB 2PO6D 1G1CA 3C6SA 5GS1A 1F42A 3KLAA 3L3OB 1G7HA 4XP9H 3H9YA 3NPSB 1WFTA 1LE9A 4LCCC 4YDLC 3QO0A 1U8IA 4GT7A 3ARYA 2UUDK 2P8PA 5MEOB 5ICZA 2DQDH 4RBPK 5C3LD 1VFUA 3DI2B 3IU3A 2CIKB 3ULVE 1FV1B 1J1XH 3ORJA 3B8SA 4HGWB 1FAIH 3RQ3A 1KV3A 1NMAL 5L8LB 1JWMB 1RZKL 3UYRH 5JIIA 2OI9B 4YDJA 1IGFH 2NW3A 3LIZH 3PWJA 4Z18A 3FO1B 15C8L 4YHNA 1FJ1A 3S37X 1D6VL 1OF2A 3RY6C 3KS0J 4G3YL 4JE4B 1G7JB 4P2QD 4E41B 2Q20A 4NQSB 1JHKH 4XWGH 25C8L 4ORZC 2Q7YA 1IMHC 3TO2B 1ZSDB 3VDCA 5F6HJ 3ZHDA 4LKXA 5MEQA 1JFQL 1G0DA 3EOTH 3X3FH 4PS4H 3IKCA 4OFPA 2IBGA 5KG9B 2Y36L 2FJGA 4QHMB 1JUFA 1P5VA 4OKVB 3IDIB 3F7RA 3DUUB 1DN0A 4WHYH 3NFSL 3DVGB 3QJHB 1EFXB 3MRFA 4YPJA 1CFNA 4GFTB 5BXFB 2IH3B 5C1MB 3M8OH 4QHNB 5EU7C 4I3RH 3PP4H 4NQED 4NP4L 2A6KA 4MQSB 1FZMA 3O6FD 3S4SA 1KPUB 1MJ7H 5GGRB 3SCMD 1HK6A 2X4QB 4LLDA 1AD0B 3FONB 4L3EA 4JRXA 4LIQH 3QEQD 5C9JA 4G80A 3O2VH 3P11L 4JFQB 3MOQA 2BP3A 3PGFH 4G8FB 3ZMRA 5IP4A 4XHJD 4LRNL 2PO6B 1JYWA 4C58B 1IT9L 2XQBL 4LSSH 1EJOL 5HHQB 2GIYA 5BVJA 2HA1A 2VH5L 4M7KL 3TYFB 5DMGD 4XTRD 2P5EA 4MJ4A 4QYOA 2J8UE 3TO4C 2AK4B 3MCG1 4P5TA 4PJ8D 5CSGA 4LEXH 4ELKA 2ARWA 5GHWH 4G5ZL 4XCNA 4M5YH 1CU4H 5T3XD 1I8KB 2UYLB 3KDMA 1S9XB 1KCSH 3ZLQC 2NY4C 5EO0A 1A9BA 4HG4J 4CNIA 4P49A 3CSGA 1CGXA 1KCVL 5FYKU 3RWDB 5ICXA 4C56D 4PRDA 2IH1A 4OF7A 2PYED 5FA3A 3TPUA 4P46A 2DQDL 2H2PC 3SDCA 2W0LA 4Z7OF 2PN5A 2E6JA 2AJZA 2C3VA 4KK9D 4K94C 4U3HA 5DQ9B 1MJ7L 1JUFB 4FQXB 1JPGA 5B3JF 5CEXA 4C56B 5KSAC 4X7SH 1JPFA 2ESVB 1VFBA 5HDBF 1H8NA 4GG8B 4R0LC 1RJCA 4J3TA 3JWDH 3BIKB 5TGBB 3PDGA 1E4JA 3GSXA 1WTLA 2C4FT 2XPGB 5DMGC 4WW2B 4ZD3L 4EUPB 2N7BA 4NHCL 5I71B 3RVWD 5J3HC 3LHPL 1CD0A 2DWEA 3LN9A 3DROB 1XGTB 1ZT4B 4XI5D 1LEKA 5D7LA 3SOBH 3DX8A 4PS4L 4R4BA 4LDLB 3OGCB 1ORSA 1EH9A 2ED9A 2B0SL 2NXYD 4HPYL 4LPXA 1DVFC 4UT6H 2P5EE 5DLML 1DDHB 3SGJC 4HIIB 1UKSA 4I2XA 4J8RA 5E5RB 2NY3C 3LS5L 3QEHB 4UQ2A 4XRCB 5D7JA 1K5NA 2ZCLH 1RZFL 4PJDF 5DRZA 2VERN 2G75B 4X8JB 1QSEE 3MCKA 4EQ3A 2ED7A 3L3GB 3QO1B 3WXVL 2XZZA 3FT2B 4KTYA 4QRSB 2EDFA 2JK5B 1AR2A 3RWCB 1BGXH 5HBBA 4U05A 5DD3H 1EGJL 1S5IL 1BD2D 3T1FA 3MGTB 1AXTL 2ZCHL 2NY6D 1FHGA 1DSFL 2X4PA 2VDNH 2PTTB 1A22B 3B3IB 1LO4H 2BFVH 5SWZB 1QBLH 1IGCL 1MCWW 4Y5XC 3VXRD 5DK2B 3OF6D 1DEEA 3QFJB 1CDUA 4LVOB 3IU4L 4K94H 4OQTL 1MQ8A 5ALCL 2OK0L 2PR4H 1UXWA 4L4VA 5L2KE 5CZVL 1SM3H 1Z3GH 4YIQA 1EHLH 1EEZA 3DURA 5T1KA 3N85H 1IE5A 4YDKH 5I8OL 5F97E 3ILQC 4RMRA 2XPGA 3NCJL 1AGCA 5ACZB 1OGAB 1NSNH 5IMKB 4LSQH 3TIDA 3X13A 1CICD 3HMWH 3UTTD 5HPOA 1BGXL 1FO0A 4MNHA 1A6VL 1KJ2A 2NW2B 4U6YB 5FUCE 4AH2B 1V8HA 1XF3B 4K3JH 2FCBA 1C12A 2ZUVA 4FHBD 4HBQA 3ES6B 1GGBH 4JDVB 4K2UL 4G6AD 1L0XA 3NAAH 3MBEB 3PE9A 3MACL 1LO3H 4RSVA 1INQB 1RZKC 3GSUB 4J3OC 4QTIL 4GXVH 3M45A 3WNOA 3ARUA 3EZJB 3I9GL 25C8H 3L3JB 2B2XH 3NCJH 4QT5A 2V7HB 4PJBA 4NUGL 1T1YA 2LTQB 1BBDH 1IC7H 4GAJH 3WDJA 1MFAH 2Y9RT 1NGWA 1YECL 2QQQA 4V2BA 4PB9L 4CN4A 1ULVA 4KTEH 4GKSB 2DQUL 1DUZA 2W38A 4Q0XL 1D6EA 1S7XB 1XGRB 2EC8A 4X7EC 4NRXA 1MQKL 2YMXH 2XTJE 2W59A 3ARGC 5B39G 2HT3D 1JNJA 1WBXB 3CH1A 4UOW0 4X99A 1FZKB 4PJCF 3NIDE 1VGKB 1SY6L 3H9HB 4LSRL 3NPZB 3F6LA 1GCFA 5HYJD 5BS0D 3U9UB 2MCPL 1F3DH 4R2GB 3AREA 3PWVB 3I85A 3QDMB 4MQXC 5MEQB 3Q6GH 4XNQB 5KW9L 1OPGL 2AXGA 3GI8H 4FZ8L 5IMKA 4Z7WE 4OJFH 1XF4A 1HOCB 1UYWL 4Z7VB 4OKVA 5I76B 3HB3C 3SDAB 2OTPA 3QJFA 4QXUH 4JQXA 4LSDA 3SDYH 3T0VA 3KLHD 5AAMA 4AMKH 2UZIL 1K8IB 2VL5B 3CC5A 4W68A 3IDMA 4EBQH 1R3KA 2VR4A 3HMWL 1NGXA 5EORH 2E7HA 5F89A 3MLVH 3DO3A 4HIXL 4X0KB 3FN9A 3D3VB 2H2SC 1UWGH 1CFTB 5F8RC 5DUPL 1IGMH 4QLRA 2AJ3B 4F80A 5GRZA 1CLZL 5BV7B 4PGCA 5DD6A 3GRWA 1GC1L 5C9JB 1QFWM 2J12B 1TMCB 3EYUH 4FQQB 3BKCH 2W60A 5IFAH 3PJSA 2I5YL 4JM2B 4MXVE 1ZWIA 4PJ5A 3DECA 3V4UH 2PTUA 4ODHL 4RFEB 5BVJB 5K59F 2BVEA 2W9DH 2DQTL 4OGXH 5IB2A 1WCBB 5GS3A 4D0BB 4OLEA 4QYOB 4JFOA 4I48B 3QIUB 1OL0A 4FQXD 4GRLB 5B39A 2BNRB 4ODWB 1JK8A 5EFIA 1FO0L 1AHWA 2ZKHL 3OSKA 2CDEB 4OT1H 2J1KA 4IRSA 2Y07H 1JGUL 3GM8A 4JZNB 1N6UA 4GXUM 4NQXB 1GOGA 1MVFA 4MSWA 4CNIB 4U1GB 3VFPB 3DGGA 1U2HA 5EIIB 5E8PB 4XAWL 3ULUF 4LK4A 3B2VH 3HRPA 1MEXH 4HWUA 3S36X 3JWNC 4FTVA 4NOBA 2PYFB 4ZXBA 3ZYJA 5J7CC 2OBGA 4M7ZC 3HZMB 43CAB 3BZ4B 3L1OL 3SKMB 3C60A 5I76A 1MFCL 3BWAB 1EVUA 1IQDA 3RDTD 2F54A 4D8PA 4GG8A 2EXWD 2FHCA 2CLVB 5T33H 3GMNA 5DHYB 4OJFL 3IDMB 4PJ7F 2G5RA 1I1AC 3NACH 1KT2B 4LNRA 1VHPA 4B0MM 3IAPA 3KPRD 4P2QB 4Y89A 3SDAC 4IRZL 3ZT7A 1DQTA 4G6KL 4HWBH 5C6TH 4JO1L 2R69H 3GI9L 1UJ3B 1HXMB 4WU5A 1ZV5A 4GRLD 1NC4B 2FHBA 3QDHA 4NPYB 3VA2C 4ZUUA 4IEFB 2GUOA 3O6MH 1FCCA 1QLFB 3PHOA 1A4JA 4ZSOE 1ED3B 2P8LA 3CVHH 4QRRD 2ITDB 4JQIH 3KWWA 5EBGA 5F7KC 1J1OH 1WT5A 3JTTA 3CU7A 3DMMD 4OM0L 2DQJL 1CL7L 4Y5VC 4J4PA 3C60C 4LLUA 4F7EA 3O3BB 5T5FH 3VG0H 1IC7L 4LAJH 5E03A 3DSNA 4FZEH 4K23L 1NCWH 1QR4A 1QVOA 1G6RH 4UIMA 3G6AA 4HWBL 4OV5B 1T4KB 1GHFL 1F5WA 4PJ7A 5F7WC 4CGTA 5I1JL 1I7ZA 4TUOA 4WW2C 5EUKA 4UTAH 1PG7L 3V4PL 4F57L 5MI0C 2WLZA 5I0ZA 4K9EL 4U1MB 3UEZA 2N4IA 4AENA 2YPVH 4RAHA 1MH5B 3BGMA 3WHXA 5I1LA 4ZS6C 1KJVB 3G6JB 4NBZB 1A1NA 4LEOB 1S7RB 1W0YT 1BAFH 1DQLH 3CZFA 3FO9A 1BX2A 4X6DB 4U3CA 3UTZA 1RU9H 1MIMH 3HZYB 3F6IA 2O5YL 4ZSOA 4Y19A 5EG6C 1BFOA 3BP6B 3KHQA 5KZCD 1LO2L 1RUMH 4I4WB 1L6ZA 2CH8A 4YBLB 5SX4I 3WFCL 1QG3A 5I1IL 3TT3L 3PV7A 5D1QA 5JXEC 3VGGA 5KSBE 3OJ2C 4JRXD 1WFUA 2Q1EA 4OLVH 4S1DC 3ZDZE 3UPRA 1R3LB 3SKUD 4M93B 1VACB 2YRLA 4EN3D 1JPSL 4NKOA 4OLYL 4EVNA 4BSJA 3WXWL 1HEZA 5LVEA 2DBJA 2DYPB 2ID5A 1T89A 2BMKB 1GC1H 1I4FA 3OWEA 4Z7WA 4PUBL 1CDIA 1AQKL 1AGDB 1D3CA 2A6DB 3MO1B 4Y5XB 5DMKA 2G5BA 3WFZA 4EDWL 4JO4H 4YX2L 4IIQC 4O51A 2OSLA 2BCKA 4PJBB 1EPFA 2J6EH 2XTJD 1K8IA 1NCCL 4M00A 4OZIA 4KGJA 5FO7B 2VZVA 3FQUA 2W65B 1MELA 4M9OA 2MCG1 4PJXF 3BZDA 5B3JE 4GKSA 1RSFA 4EIGB 1TJGH 3VXNA 5I30H 2F53A 4U1HA 1IM3A 3O2WL 1FG2B 4YBQC 3CDGB 4XMKH 1WGOA 4Z77B 2LQRA 1OM3H 3OAYH 4KVNL 1WZ1L 4BA8A 2D7TL 5LQBH 3QXWA 2P24B 5D1XD 2D7PA 2QADD 5B8CB 4FQCH 2DL9A 4PTTB 2UYLA 3KDMB 3OX8B 5D70L 1J88A 3MLSH 4IDJH 5C0CD 5DHVB 1NSNL 3FO0H 4RX4D 5DMIH 5SV3A 2X1QA 4XVJH 2JB5H 5IFAL 3HG1D 5CSZB 4FMFA 2CLZA 3K74B 3KNBA 1OSPL 2NR6D 3WNPA 4HFWA 1FDLL 1N26A 4AQOA 5DD5H 3MNZB 5DWUL 4J2XA 5IUSA 2NY3D 4KZDH 3B6SB 4ZO9A 4HF5L 5C0CB 4JO3H 4NJAL 4HK0A 2PXYD 2V5MA 3VFOA 2EIDA 1A7PL 4Q74A 4MXWH 4ZOAA 4A6YH 4EIZC 4Y2DB 4PLKD 1WSST 3QIUC 1II4E 4H8WH 3X17A 4QY8A 3OJDB 5GGVH 3MV7A 1EHAA 2F19H 2UV3A 3BQUC 3KPRE 4QTIH 5DTFB 4XX1E 3NIDF 5C0ND 2AV7A 3R4DA 5DRNA 1PZUB 1G7PA 5IEKB 1IJ9A 2BNUA 4I1NB 5FGBA 4PJ5D 3MZTA 3GZKA 3ESUF 1M1SA 2JIXA 4L4JA 2I07B 1A6AB 1ADQH 1WIOA 2V2XB 3OGOE 4O5LL 1Q1JH 5KN5A 5IFHL 2VXQH 4TUJB 1LILA 1RZJH 3O6KH 4LMQE 1OOAA 4RNRB 5FUOL 2QR0B 4KRPD 1U8QB 3PIQA 4CMHC 1MRCH 1MUJB 4UT7H 3VXMB 4HUVB 1TVBB 2AJUH 1YN6A 4NSKB 5D1ZA 1BBJB 2AEWA 5FKAB 4N5UA 3UO1H 1MFDH 2I9LB 1IGTB 1A7RL 3BQUA 4RRPA 3NCYP 4Y4HD 2SEBA 4A6YA 3QEUA 2FO4B 4WHCA 4ELMF 4ZXBB 2HVKB 1QRNA 1YMMD 5CSZA 5ALCH 5TDPA 2HFEA 2X4SA 2VTFA 1LQSR 3DNKA 5A16B 4IJ3B 4PJCA 4HH9B 5KVMC 5HVHB 4MDIA 4HKXB 1DLHA 1NL0H 4PJBF 4RCAA 3BKCL 2DQCL 3L3DA 1UM5H 4PGBB 4HWZB 2NY3B 5LCVL 2IANB 3S9DB 3X14A 2XY2A 1KJ3H 2HT4C 1ETZB 4OGYH 2FZ3A 4RGOH 2D7QA 1I3RA 1Q0YH 1JMZA 4R3SB 4PJXB 2OXGA 1QRKA 4U1GC 5GGQL 2P5WA 1F11A 1HKLH 3AAZA 4L3EB 2GHWB 4PREB 3DRTB 3ES6A 3F5WB 4FP8L 4LSSL 3QIBC 3OKNB 1EXUB 4OIBA 2XYCA 3TA3A 5EZIH 5INDB 1I7TB 3MRMA 4PJIE 1SJEB 5EC1A 3O11B 4IOFC 2ADGA 4JHBA 4CJ1A 3U6RB 5A3IC 5ADPH 2VXVH 1T2QL 3KYKL 4CADA 5GGTA 3D39A 4HIXH 4PJFF 5DGRA 1BM3L 1J8HB 4JG0H 4J3VA 3L5WB 1XMWA 2EDHA 3IVKB 4XP4L 1U8KB 4NKMB 5IKCB 3QPXH 3RGVC 5I1LB 2XFXB 3MACH 2LV4A 3TLRA 3KPSA 3SJVB 5CINH 1JTPA 1V5JA 1S7RA 4Y4HB 2VITA 5EU6B 4PYHA 4H8WC 5IQ9A 3D2UB 5HYSA 1IEBA 1MJUH 3GHBH 3CH1B 3QIBB 4NQCD 4NYLA 5T33L 1NDGA 3D25A 3FHQA 1UB5B 4YFLI 4C56E 4YDVB 2P8PB 5MEOA 1IM9B 1J11A 4S2SB 1X5HA 2R1YB 3KPNA 3TYGL 2L4OA 4I4WA 5SWZD 3VXRB 4HSQA 1CZ8L 4Z77A 4G9DA 3AREB 3LH2L 3G08A 2IPKA 5IBUB 2P5WE 3FQNB 1TQCB 4JZJC 1U58A 1YEGL 3GHEL 3LKNB 3VG0L 3RX5A 1BIHA 3N1FC 3MRBB 3BT2L 4P46C 5KSUA 3THML 5JUEL 1LD9B 4NDMB 2X1WL 3MYJA 1MIEL 2PYEA 1L7IH 4HLZH 1TPXC 5J13C 5IWLA 2VXVL 5J6HB 4OM0H 1I1AB 1LE5B 3DOSA 1X7QA 3BP4B 3BGFB 3GMQB 1A4KB 3K8KA 3ZDYF 4U0RB 1DDHA 1CQKA 5F9OL 1J0KA 3BZFB 4JKKA 1MCRA 1RUAH 3DSFL 3VA6A 2DM7A 5FCSH 3W82A 1X4ZA 3VWJB 6CGTA 4NO5A 2XZAH 3GJEB 1MVUB 5DJ0A 5L2JA 4ZNEA 1U8IB 3ULUE 1FGNL 3X11B 3OKMB 1HCFX 2OI9C 2NQCA 1FZJA 3ME0A 1U41A 2VKWA 3IXTB 5GISH 1RURL 3OKLB 3RL1B 2F5AH 3DETD 4F33B 4LVEA 1S9YA 3HG1E 1A14H 1Y6KR 2DWDA 2H6PA 3MLVL 3RA7H 1G7LA 1CGSH 3JWOL 4LSUH 4ODUA 1GGTA 3CK0L 5I9QB 1ND0A 4H88L 4S0TD 4KKCC 3T09A 1X6NA 4Y5YA 3QUZB 1ZANH 2ESVD 4YFLF 5BCAA 2ZJSL 4Q2ZA 4L8SB 1REIA 1KTLB 5AD0A 4X6CB 5B4MC 4WWKA 1LEGA 5C8JB 3HFML 2CGRL 1CICA 4JO4L 4YX2H 1UC6A 1I7RB 1M6OA 2W9DL 3VJ6A 4LHQB 1T04B 5CD5D 1NGQH 4HDIA 3OBAA 3EIFA 1DZBA 4X6BB 4XPTL 2VDML 1EGJH 2OQJA 2Z8WC 3SE9H 3VGAC 4D3CH 1MRCL 3S34H 4J12A 3G9VA 2EE3A 4YUEH 1OAUH 1QTYT 3T77B 4PRID 1RZ7L 4YWGH 1SHMA 3VGFA 4Y4FB 4NO3B 4PJCB 3CLEH 4EI6B 1J9CT 3OKKA 4ZUUB 1AD0A 2CO7B 3K3QA 4MYWB 4QHLA 5CEZH 4YHZH 1U6AH 5JQ6H 1HSAA 1RUML 4GS7C 2HVJA 3MRRA 1Z5LA 2HJKB 1ZLWH 2ZUQC 1BREA 2NMSA 1RQ5A 1QBAA 1VFMA 3BN3B 4LEXL 3RWGA 3L1OH 1R0AH 3C9NA 1RJZA 1N2RA 1E4XL 1HHGB 1T7WA 4NGHL 3P30H 4J4PD 1FG9C 3VD7A 4QXWA 4YBHA 4PPTA 1IAKA 4U1LA 3QI9C 2HFFA 1YMME 4GAGL 1KCVH 1NMAH 5C0BA 3DTXB 5E8DL 3W9EA 4URTB 3W2DL 4YXKL 3RUGB 1WUNT 4FFVC 3CFEA 3WIIL 1F45A 5DRXB 4HKJA 4FQ1H 2LTQC 3U9UA 3EOAB 1VGEL 4UOW1 3ARED 4LLAA 2VLKD 4NT6A 4TTGA 3SY0B 4OTXL 3QHTC 2IG2L 2YS4A 4N8PA 2G60H 1WK0A 1C8PA 1CVSC 3ARGA 4LLVA 2BVQB 4YE4L 3VRIB 5LG1A 2YMXL 1LO2H 3LV3A 3PABA 5FUZH 3UC0H 2GITB 2H1PH 5HTSA 3R8QA 3AB0C 1WZ1H 1FH5H 4CVZB 3TN0B 4J6RH 4M8QA 4PGZA 4F37F 3H7BB 4HMDA 1QKZL 2AEPH 1UWGL 5TE7H 2VDQL 2XACC 4Q6IA 1QNZL 4L4TA 4AT6B 4L3AA 5BW7C 2C1OB 3O6FB 3ARWA 5CGTA 5EWIH 2A77L 5SWZE 5BS0A 2R29L 5IQ7H 4OM1H 4DK6A 2AJVH 3DX7A 1TNNA 4POUB 3EFFA 5D71L 2R0ZL 2P5WD 5FK9A 5F9JA 2C3XA 1NBZB 4JY5L 3VI4E 4HUMB 1VFOA 1BAFL 3I50H 3S5LA 3DRTA 3HR5A 1F8TH 1XF5B 4BSVA 2BDNL 4FFZH 4XNUH 1T3FB 1FVEB 1NC4D 4OFYD 5EO1A 2GCYB 3ZYIA 4X9GA 2E6PA 4LPCA 3X13B 1IEHA 3R06B 4S1RH 5CIPH 3TNMA 4IJ3C 4KPHL 3TWCL 3D18B 3IAGC 3W9EB 4YR6B 5HHPB 3WL9B 1PEWA 2HLAB 1T2XA 5HHOA 4AG4H 3PP4L 1X4YA 2GSGB 4ODXB 1NEZB 5FA4B 4CJ0A 5J1TC 5FO7A 4HJJH 1TVHB 1OTTC 1T66C 4JFPA 4NQTA 1L7TH 3ULSA 4K07A 4JFED 3S3JA 4MS8C 2IMNA 3NMEA 3K2UH 1IC4H 3B9AA 3BEWB 3RKDD 4XP5L 3I3DA 3MA7B 3TT3H 2L0DA 3FB5A 5E9DE 5I8EB 4WHTB 2CDGA 4DGVH 3QWOB 1YUHA 4YFDB 5DK2A 2PYFA 4OLXL 1P7KA 1IEBB 2X4OA 5F3BB 3BFOA 5IFHH 5BMFH 1KSRA 4JAMB 1RIHH 4J23A 5D72H 4GRLC 4N8VB 3O0RL 3NGBB 4W6YB 3NOIA 3G6JE 4JKPH 4CDHA 3QA3A 3I3BA 3IDNA 2XTJB 4LHUA 1HN1A 4X7SL 3VWKC 5MEPA 2MNUA 3L7FA 1KJ2L 1NGWB 1INEH 3U46B 2HKHL 1YC8A 4GRWB 1PGRB 2EDYA 1JI1A 2AQ1A 1QEWA 1V3MA 1QACA 1KLUB 4XC3H 1Z2KA 5C09E 3HC3L 1Q8MA 4I2XE 1ZS8B 5T3ZE 4Y16C 2QEJA 2YD8A 2FATL 3H3BC 1JGLH 1JHLL 2BY0A 1A6UL 5CD3B 4R4FH 2QSQA 5F1IA 1QSEA 3FB7B 1A5FH 2OJZL 1UH3A 4HPYH 1GGUA 3ULUD 5IK3B 3GSRB 5D1XC 3LSOB 2F54D 4JFZH 5HJ3A 1PVHA 3E6FB 3MRFB 5I74B 3GGWA 1CG9B 5DZLA 5TE7L 3HNVH 3BISA 5LGJB 1NEUA 1OTTD 1QQDA 1T66D 2UZXB 4LCCB 1YEHH 3N1MC 4UIKH 4FOMA 3ULVF 1BFTA 5FYJD 2OXHA 4OAWB 3H9SA 3BQUD 1KPUA 5GGRA 2EDTA 3PV6A 4WW1A 5IOPA 4U1SA 1OSPH 1XF2A 3F12B 1BF2A 4U1IA 4L8SC 3RL1A 2LAGB 2BRRH 5GRJL 1ZA3B 3I02A 4MX7B 1JNLH 2YD9A 4ODVL 1OP3H 1KIQB 2QQKH 3V52L 2FEEI 4OF5A 5GXBB 5TJWK 3T0EE 1ACZA 4P2RE 4NKDB 4X9BA 5EUOF 4BFEA 4ODUB 1G7MB 3MLTB 3BGMB 2MPAH 4R0LB 2HJKA 4KFZC 4Z78B 4QXTA 2DTSA 3ULUC 4KK6D 3NFPB 4PRIB 4WUUE 1MIEH 1Z9LA 4NC1C 2X42A 5EIVA 5EPMB 4BFIA 3MBXL 4NGHH 4UDUB 1MY5A 2X7LA 1E4KC 1BBDL 2ZP0T 4JFZL 3C09C 1V3LA 3REVB 2BNRA 5I8KL 4XCEB