4G8EB

Crystal structure of clone18 tcr
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
247
structure length
241
Chain Sequence
GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASRPPLTTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha chain clone 18 TCR
publication title A conserved human T cell population targets mycobacterial antigens presented by CD1b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 241
sequence length 247
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g8eB02
1U41A 4XNUH 3GSNH 5SX5K 2BSSB 3GMPB 4F3FB 4NNXA 1QLFB 1EHLH 4GG8B 4WI5A 1MWAH 3BUYA 4XB7A 3W9EB 1H5BB 4HWZA 4XCYB 3KJ4C 4XTRD 4ELMA 3K3QA 1UM6H 2Y06L 4GG6E 4ZO7A 5A2LH 1LILA 5GS3A 2A6JB 3MJ9A 5FUOL 4P9HL 3BDYH 4WEUD 5KSBA 4XP6L 3T0BA 5GZNC 3PIQA 1CG9A 1A2YA 2PXYC 3KPRA 1FFOA 1FNGA 4XAWL 2ICEB 2BNQD 3IFOA 4NQED 5HHQB 3DARA 4HPYH 2GCYA 3K8KA 1QBBA 2EKSB 1RFDL 4KJQD 1JNLH 4FRWA 2R0LH 3QXAA 3KXFA 4ZUWA 5T5FH 3P9MA 5F21B 3DURA 3QHFH 3OKKA 4ONGL 1MCHA 2PYEE 5GRJH 1OF2A 2CDFB 1TZIB 7FABL 1VFAA 3PHOB 1MRFL 4XNQA 3BYTA 3EZ8A 3NZ8B 4G6ML 4DTGH 4UQ2B 1EEZB 3TO2A 4NFBA 1CLZH 1Z0MA 4QNPF 2R56L 1A7PL 2H45A 1NGWB 4JZJB 3O3UN 4K23H 1GIGL 2XN9A 3HG1B 2W0FB 3CPLB 1EMTH 1K2DB 2F8VA 2N56A 1KELH 5IG7A 4NT6B 1VADA 5IVXE 1AJ7L 2VRAA 5D1XB 2CKBL 2JKXA 1IGMH 1IARB 5T1KB 4P46D 2DLFH 3ULVE 4UQ3B 4AIXA 3LN4A 3S37L 5IW6B 4PUBH 5I1CL 3LSOB 3SDCA 2DQTH 4L29B 5KSVB 2VDPL 3IF1A 3BZDA 1PKQE 1YC8A 4HLZH 3WE6B 4IOFD 1U36A 4CADA 3ES6B 1WZ1L 4NN5B 4M6AA 1T04A 4AIZA 2DD8H 2G2RA 4U6HB 1Q8MA 4OCRL 4Y2OA 1WBXB 3V8OA 1WEJL 3WD5H 4LGSB 1FSKB 3KPRD 5ALCL 2KKQA 1AGFA 1CQKA 4I4WB 4I3SL 4F37K 3RZCB 5F7EH 1AD0B 5BZWA 1EZVY 5E00A 1IGIH 4ODVH 4R4BA 1JTPA 1OTSD 3KXFD 3LH2H 3LDBC 1LK3H 2QBWA 3ULUD 1NCAL 1HH9B 3JV5A 4Y16C 5GS1B 1EA9C 4JY6B 3U7AA 5H35B 1VGKA 3REWA 1F3DJ 3DI3B 5I66A 4HXBH 3ZTJG 2W60B 5EOQH 2VDNH 3P0YH 1RHHA 1TETL 1N5AB 1LDSA 2XTJC 3L3HB 5DMYA 2XN9D 1RUPH 1G9ML 3NVQA 4W4OC 5DDHB 2HVJA 4N8CH 2ZUQB 5I8KH 4WO4B 1VGEH 3TT1H 2IPTH 1RAMA 4WEBH 1ADQL 1V3MA 32C2B 1A0QL 4KMTL 2VL5B 4MQ7A 5IMMA 1S9YA 3A67L 3SDCD 2NTFB 3G6AA 3HI5L 2A6KA 1AQKH 3IDIB 3TCLA 1IGJB 2FB4L 3T4YA 5HYQB 1MY7A 3HMXA 2DI7A 2PO6A 2YRZA 3GIVB 2HTKC 1JMZA 4M5YL 1J88A 5EOTB 1NAKH 2CH8A 3WFCH 4L8SC 3K2UL 3ZYJA 3IRZA 4FTVB 3Q6FA 3BRGC 2XFXB 5C0BE 1AIFA 2MCG1 2W91A 2H1PL 4M4PA 4OLXH 5CFHA 4PRPD 3VE0B 3BMVA 3VGEA 4PTTB 3HG1E 2WUCL 5A43C 1GGCL 3CD4A 1S7WA 2FNBA 2OXHA 4ZO6A 1HCVA 2IANB 1UCBL 1V05A 3RU8L 2DAVA 5F7DB 4AH2A 3ZTNH 1P4LA 3PWNB 3IJSA 3H0TB 4PRNA 5E24E 1MIEH 2JTDA 3UBXI 4CBPA 5CWSB 3DROA 3IDMA 4GMSL 1XCTB 2QSQA 1DEEA 5J06A 5GIRA 5IB5B 3MRPB 3MLUH 3VMPA 4N0YL 4YWGH 1MI5A 4IOSD 5B4MD 4QRSB 1LNUB 2WMPA 2G9HA 3EOAB 3WYRA 4IEFB 1P2CA 3QWRA 5EPMB 2LFGA 4OF0A 5DGRA 4FMKA 4HKXB 4MS8C 3BPNC 2A73B 3NIDE 3AM8A 2CUHA 1NC2A 5D1QD 5DJAA 1N5YL 3T4AB 2EDOA 5FUOH 3RWHA 1GGIL 2VLKB 4XP6H 4XAWH 4GOSA 1K4CA 2FL5A 4HWBA 5C9KA 1RZ8B 5DVLA 3T0EC 3QXUA 2J6EL 3SKOB 2VDMH 1XF5B 3EKCA 4AZ8A 3DTXB 2MKLC 4U4BA 4NP4L 4TTDD 3O4OC 3OL2A 2X1QA 2Z92B 3D39D 3NPSB 2W38A 2MOVA 4ONGH 5C09D 1F45A 1I3RB 3MRIA 1HHKA 2D31A 4M6NH 4UIMB 1LO4H 1BWMA 2HRLA 2FCBA 1BREA 4KTEL 4GRLC 1TQCC 3QO0A 1A8JH 1U93A 3MCKA 1U8MB 3MZTA 3GSOA 2FLBT 3AMKA 3D1MC 3M8OL 2PYEA 3DX8B 4QRRB 1A1NB 4UDTA 4CW1B 1MHPH 1ONQB 1JHKH 4WDIA 3MTRA 5F88A 3BISA 1GXEA 5T3XD 1ZVSB 4OJFL 5EO0A 4L8DA 3TO4B 2NY0B 4OAWB 1YYLH 1L6XA 4NKOB 4IJ3C 3EOBB 3WFDL 1J1XH 3BPCB 2CKBH 2XY2A 3UBXA 5AUMB 1MJ8L 1JV5B 5DXWA 2CIKB 4LSPL 5FYLE 3O3EA 1N64L 2O26U 5B21A 4XCFL 1FNFA 3CJJA 4ENED 2JJTA 1MI5D 1T21B 4H88L 1RMFL 5IVXA 2VDPH 3FO1A 4FTVE 2K1MA 5EN2B 5L8JB 2VDQH 4JHAH 5IB2B 2OLDA 1VESA 3QAZC 4NWUL 5F9OL 4B41A 3SBWC 1X5AA 4YLQT 1KF9B 3QWRD 2X09A 3SDDB 3WFEL 1FVCB 1Q9OA 1S5HB 1ACYL 1MJJB 3O8XC 1FJ1B 2X05A 1U3YA 4PD4K 3QH3A 5F1NB 4Z7OF 5DTFB 1RHFA 4F7TA 2QADD 2PW1A 2CLRA 3H8NA 1PKQA 4JQIH 4OCRH 4P4KC 5D5MF 2ED8A 2ZCLH 4UI2A 2H26B 1WEJH 3OKNB 1XGTA 4PJ5B 2IANE 4KRNA 5C0CB 3ROLA 4KQ4L 1KG0A 1XF3B 4ONHA 5ALCH 1WFUA 4LKXA 3F58H 4EN3C 3O6FB 4KDTC 3BN3B 4RMWA 5EULV 4FXKB 2RCSL 1ORQA 1BFTA 5FHAH 4XWOD 1QPPA 2XQBL 1RZIA 2OTWA 5FK9B 4WV1C 3B8YA 3AAZA 2QSCH 3QIBA 3HMXH 1NCAH 5GGSB 1WZKA 3ZL4L 4K94C 3PWJB 3HHRB 3VG0H 3MRCB 4H1LG 2NY1D 1R6VA 2C3VB 1ZTXH 4PGCA 4UILH 3UDWC 1T5XB 3RWIA 5E8EA 1WSST 1O7VA 5FYJU 2LU7A 5LAXA 4LMQE 2PYED 4I8DA 4CN1A 4DW2L 6CGTA 3H3PL 4LVOC 1XGPB 1FRGH 1OD9A 2OYPA 2BSSA 1L7IL 5IV2A 1QLFA 4M7JL 1K6QH 5EBWB 3W2DL 1T83C 4BH8A 2PETA 3D25B 3MBEC 1HKLH 3U2SA 3BN9D 3MRDA 4LSUL 5CIPA 1DQDH 4M6OH 4YDIL 1NFKA 3MLWL 1UJTA 3F65A 5J0BA 2CK2A 3HI5H 2QTEA 5D7SL 3FRUB 5I1LA 3MFFB 5J89A 2X10A 2DLTA 4HAFA 3CSPA 1A5FL 3VFPB 3TP4A 3WUWB 3K2UH 3OAUH 2YOCA 4F2MA 2E5EA 3AREA 3KPPB 5FKAB 3I02B 1CIUA 2H1PH 1XR8A 3DX9A 2ZUTA 5L6YL 4D9RD 2IGFH 3W39B 4TUKH 3PHOA 4HJJH 1AGBB 5F1KC 2HFFB 1WWWX 1XH3A 3D3VB 2WUCH 1VEPA 2IAMC 5C0BA 1HN1A 4HQQH 5GS0H 3WCYA 4WVRA 3S35X 5HGDB 1RY7B 1NGWA 2W0KA 3C09C 3AFLA 1DBJH 4NM8L 2J12B 2UUDH 5DFWH 1G7QA 4MAYC 4FQHB 1OSPL 1FBIH 5D1XA 5T1KA 3C5JA 4GW1B 4I3GA 1A6VH 2HT3C 3L3OB 4MXQD 3BPLC 4N0YH 3UEZA 2E7LA 4C57C 4S1QL 3QUZA 4KK5C 3VG9C 3CFIC 2WWMC 3TPKA 1E6JL 5EO9B 5EH1A 1B9ZA 2X4UB 2W07A 1AY1L 5FEBA 3BPOB 3CMGA 5C0CE 2QR0B 5ACLA 5BXFA 3TBYA 1WBXA 3FT4A 3G6JA 4K3HA 3BWUC 1GGIH 4JVWA 1CVSC 3VW3H 5ELIA 3CFEA 5I74B 4EI6A 4I18A 1RVFL 2J6EH 2FD6L 2ICWI 4OD2B 5I0ZA 4GKZB 4LPXA 3QDJB 3ARED 1N7MH 1G1CA 4X5WB 1J1OH 3ULVH 1T2XA 3JWOH 4ODUA 4HF5L 4PJGF 4E0RB 4ZUUA 4KTEH 1ZLUH 1HWHB 5H35A 1MVUA 1OQOA 3O3AB 5C0BD 3ZKXB 5D8JL 1RPQA 4QLRA 1GZQB 4LU5H 3N1QC 1KIPA 2ZZUT 15C8H 3WDHA 1RU9H 1NFDB 2XTLA 2VDOH 3HG1D 4PTUA 25C8H 4I0PA 1S7TB 4JM2F 3PQYE 1EFXB 4X7TA 5HSFA 1RIVH 3D18B 3WL9A 5D1XD 5LGJA 2YWZA 5T1KD 1SBBA 3O9WA 5E5RB 4LSPH 5BV7L 4A2LA 1JIBA 5DMKA 5DVKA 4XGZB 5K9KA 2Z8SA 3KLDA 4EZMA 3QUZD 4H88H 1RMFH 1G7JB 3Q0HA 4F7CA 4XVJH 5HYQA 1WT5A 4NWUH 5F9OH 3ABZA 4JFXB 1ITCA 3QUKA 5SV4A 3CVIH 5IJVA 2HFTA 1I1FB 3GRWL 3K8MA 1UA6L 3GHBL 3VRLE 3HCVA 3VXMB 3TN0C 4DVRL 1LK2B 4FTVA 4CVZB 5I8OH 3IVKB 3V7AE 4JFZH 3DOSA 2FEEL 1TFHA 1VACB 3ZDXE 4RRPG 1BX2B 3RFZC 3K81A 3OKDB 4NQCE 2YD1A 5CSBA 1S7RA 5ALBL 5KVFL 3F12A 1G84A 3RZCD 2AERT 4YIQB 5CIPH 4GAGH 4JO3H 4KQ3L 2IANA 4M1GL 2ICWA 5E6IC 5DMGD 1H3PL 3O6LH 4F9PA 5EZIL 1JHLL 4O51A 1KIRA 3H3BC 4M7LH 4F7PA 3PWNA 3H0TA 1EJ6A 3T2QA 2MTPA 3H9YA 3VWJB 4HMCA 1C16B 1XCTA 4KPHH 3NA4A 3QI9A 1S7UB 3R06B 1QYGL 4G8FA 3HZKB 4Q9QL 4HT1L 4LHJB 1HE7A 3H3PH 4XC1H 1MFDL 3CX2A 2A77H 3ECBB 5IVOA 3EOAA 2BHZA 2QJDA 4I0PD 4WU7A 3W2DH 1FAKT 4P59L 3D69A 3KHOA 1CXIA 5JORB 4JVPA 3BP4A 4YQXL 2I9LB 3MV01 3P4MB 4GQ9H 4H8WC 5MENE 3O9WD 3BDXA 4PP1D 3C5ZC 4YDIH 1OM3H 2B1HH 3SE9L 3DO3A 3Q5OA 2YMXL 1DVFC 1PEWA 1CT8A 2VZ3A 2FJHB 2LABA 3EYSH 1F5WA 4JFFE 5JXEC 2VZ1A 2VXQL 5FYLD 1RZ8A 3TA3C 4P9ML 3BP7B 4HX1A 4CU6A 4L8CA 1XF5A 5IB4B 3KPQA 5I76A 1UG9A 4FTVD 3SOBH 5E8PB 1LHZA 5D7JC 4JKKA 3S96B 5ETUB 4U1NB 4GFTB 2YPKB 1FPTL 2FJGB 2VQUA 5GZOD 3TYFB 3BP5A 4UIMA 2WZPD 1BQHA 3OKMB 3AGVA 1NFDE 1NAMB 4I5BA 3MRBB 3VA2C 2EEAA 5K9JH 3KYNA 2IAND 4IOIB 4QXGL 4CW1A 1ONQA 4XP1L 4LLVB 1V7ML 5DUBA 4YFDB 5ENWA 2HMIC 1K5NA 1B6DA 1TENA 2Z91A 2XOTA 4ZG1A 3RVTC 1IKNA 3SE3A 5IM7B 1S7QB 3EW3B 1UB6B 4NKOA 5DWUL 3EOBA 3MRLB 1A7NH 4LSRH 4LHUG 3MYJA 3BFOA 2F5AH 4M03A 4QHKJ 4Y1AB 5AUMA 1JV5A 1PJ9A 5MEQA 2WM0A 4TSCH 4JY5L 5KN5A 4CNIA 4KJWD 4ERSL 4TSAH 4OGZA 4KRPB 2DWDA 3PWPB 4Y2DC 5IQ7L 1QACA 2FH6A 2LQRA 1YZZA 4GAYA 4DUVA 1OT1A 1AY1H 4Z0XA 2DLHA 2NR6C 5I8CB 3OB0K 2D7MA 3HKFA 4Q9CA 1FJ1A 1GC1L 4PRHE 4NO2B 5EC1B 1DQJA 2DQHL 5C0CA 4L9LA 1A02N 1O5DT 4H0IA 3ARBA 1OHQA 2D4FA 4YBLC 3MRRB 3O6FA 3UO1H 2WUBH 5BW7A 5M94B 1RVFH 1P5VA 2AJUL 4M48H 1TIUA 2FD6H 3MRNA 4FXKA 1CL7I 5JOFA 4OLUL 5JPNA 3U4AA 3U0PB 4WGVB 1KJ2A 1I1AB 2DOCA 4HF5H 2DQIH 5JPMB 3MRCA 1FIEA 3G5YA 1MQKH 4H25A 1S7XB 4KV5E 4FQQB 4GAJL 2C3VA 2CKNA 3BD4A 3HC4H 4HIXL 1VPOL 4S10A 5I1DA 2WP3T 3WHE0 2HJKB 1D5XB 3VH8A 5DJXB 1ETZA 4ODTL 4NQSB 1NLBH 5I1KL 1QSVA 4DQOH 1TPXC 4U0QB 1Q94B 5C7XH 3NIFF 1A3RL 5GRXG 3FO0H 3L9RA 3TO4D 5KSAC 3RHWF 2O93L 2AK4B 3LHPL 4TUOB 2VXSL 5DJ0B 3D25A 1CLOL 3O4LB 5DEZA 4I77L 1CLYL 1J8HA 3T77B 1IGTA 1TVDA 3RRQA 3OBAA 5L2JB 5EIQA 4G43B 4OD1L 4ZOEA 1FCCA 3JUYA 5CEZL 3PQYA 1ZHNA 1PAMA 1K8IB 4XMKH 3V95A 4LCCC 3WLBB 3MFFA 4RNRA 2F74B 4ZQKB 1T1WB 3LN5A 4WJ5B 1HQ4A 3C2AL 3SGKC 3SDDD 2VLRB 4ZAKC 1FGNH 2EO9A 1A7OH 4FZEL 2OMBA 5E4EC 4PB0L 2H2SD 3WXVL 2MHAB 1T0NA 3NCYS 4PJ5D 4U6YB 3KNBB 5AEAA 5C0CD 3EJZC 3ARBD 4WHCA 1D5BA 2VSCA 4JG0H 1AGBA 3O6FD 4PJHF 3QEGH 2R8SL 2JB5H 3E3QE 2CR3A 5EZJA 4MD5A 4M1GH 3HFML 4XPTH 4WW2B 3OMZA 4NQCA 2DTMH 4NM4H 5DD1L 3DVNA 2O5ZL 5D72L 4BZ1L 4MJ5B 1MUJB 4GBXC 1NBYB 4WY7H 1YEIH 3A6CL 5EBMB 2Z31C 4U3CA 3T3PF 4ZO8A 2BNUA 3MODL 4GW1A 5GHWL 5C0RL 2A38A 5B38B 1U8OA 1QYGH 3L3OA 4Q9QH 4HH9A 2XRAH 1EZVX 1N0XH 1MFDH 1A6TA 1KIUA 1RIHH 2ITCA 4NNYA 4MD0B 4HKBA 4LKCB 1YEKL 5EO9A 3IJYB 5DK0A 1T1YB 2DBJA 3NOIA 3BWAA 1QSEA 1AXIB 2J8UF 2X6MA 3S5LG 2ZUYA 4HIHB 1BECA 4BKLB 4HUMB 1BF2A 3MCG1 5CEXB 5T1DL 5IOPB 3QXVA 4HBCH 1JPTH 2I07A 2BC4B 3VGAC 1D5MB 3SE9H 4NKQB 2W9EL 3I3BA 1LDPH 4X5XB 5F96L 3UPCA 2YMXH 1ACZA 5IBTL 3WEXB 5D7IA 1QRKA 1LE9B 4G7YL 2NQCA 1MELA 3RGVC 1D5IH 1S9VB 2GT9B 3S4SA 5MENA 2VXQH 3WHE1 2X9WA 4RFEB 4R90L 2O61A 4KJYA 2FBJH 2NXYC 3H3KA 5IQ9A 3K1KC 4G5ZH 4BQ9A 5F9WC 1CDCA 5JUEH 1AKJA 1MCRA 4JFFA 3NACH 1YNKL 4P4RA 3ZDZE 3BKMH 3CH1A 4HCRL 2D9CA 1RURH 4NO5A 3KWWB 2Q7YB 5JIPA 1I1YB 4NHUA 1R3JA 1UXSA 1A1OB 1HEZA 2UWEF 2A0LC 1TVHB 4U0RB 4U1LA 3TNMA 2AK4E 5TF1H 3PJSB 1MAKA 1EHXA 3JWDL 4MDIA 1GZQA 3L3IA 3O4LE 4XP1H 4NQCD 3BZFB 1P7QA 1F6AB 5ACZB 3MRJA 1RUKL 5F7YC 5JW4R 5CHNA 35C8L 1S7TA 1DLFL 3EYFA 4C54A 5KJRH 3T65B 5DWUH 2DKUA 3PABB 2DQFA 3PL6B 5EWIL 1JYXA 4PLNC 5D7KE 2LVEA 1KJ2H 4JY5H 3HAEA 5F6HJ 3WIHL 1G7JA 4XWGL 3RY4A 1UVQA 3T2NH 3IDYB 2GTZA 2WW8A 5MI0B 1IM3B 5SWZE 5D2NC 3I75A 4FFWD 4GMTL 1E4WH 1MEXL 2WBKA 5GGUB 1QVOB 1AE6H 3BD5A 1QR1B 3PG2A 1YEFL 3O45A 4O4YL 1LK2A 1RZFH 2PUQT 3ESUF 2WV3A 4U1MB 4CVZA 1XIWC 1OAYH 3GBNH 4PJFB 2A74B 4ODSL 3IVKA 1M1SA 5IW1A 5CGYC 1EVTC 4EOWL 1BBJA 2FHCA 3ZLQC 4NBXB 3HA0A 3KS0J 5IHZB 5MEND 4PRHA 5TF0A 1HINL 4JEGB 2AJUH 4KXZH 5FCSH 4P2OC 4HHAB 4TVPE 3I9GL 3RKPA 4XNMA 1DQLH 4JHWH 3QDJD 1KGCE 3QJHA 2H3NA 2V5TA 4JFFD 4YE4H 3Q1SH 4MSWA 1F58L 3FQUA 1A4JA 3BX7C 4RWYL 4FQ2L 5J11C 3T1WA 2HG5A 4FOMA 1F4YL 4OB5H 3WN5A 4TPRH 4GAJH 3VWJA 1CDGA 1T7WA 4DCQA 3G04B 3JV4A 4KKBC 1VPOH 2CMRH 5IHUL 3SQOH 3QHTC 1S7UA 4PG2A 5E6ZA 2ESVB 5FDYA 5DYOA 1R5WB 2D7OA 12E8H 1JWSA 4XI5D 1GCFA 1P7QD 5GGQH 3RWGB 3PWUA 3QUMA 2HN7A 3UJIL 3LQZA 2ICES 2VXSH 3CU1A 1DLHB 1UKTA 1CLOH 3W0WB 5HYFA 3FB7B 4MCYB 4XX1E 1AC0A 4LNRB 4I77H 4LVNB 4WI8A 1CLYH 3P4MA 1JUFA 4TQEH 3RIFK 1FFQA 5C0FA 3QCTL 1CZ8L 3VDCA 4WI3A 2XKSA 5CEZH 1XAUA 2B2XH 1H3TA 2FJHA 1BQLH 3FCTB 5A1AA 3LEXA 2V2TB 3JTTB 4R2GC 3IKKA 2E6JA 3ZDYF 5FKPB 5HHXH 5CD3A 1FVDA 3O0RH 2MCPH 5E8PA 4ZD3L 1VFUA 4JKWA 4WNQA 4TNVK 3VFWB 4NQDB 2BP3A 2LAGB 5ERWA 4Z95L 3NIGF 5DRWB 3ZE0F 3KR3L 5GS2D 4JDVB 4OGXL 1A3LL 3TYFA 3CGTA 4PRHD 3OKMA 2VISB 4OKDA 1NAMA 4KK6C 1UZ6E 1TLKA 1G7IB 3QRFM 4XPHH 4ZOBA 5LGHH 1KJ3H 5C0EA 3IFNL 1JZ6A 4ZTPL 2VH5H 4AJ0A 2L7JA 3J8F7 5DD1H 4LLVA 2HTLD 2ADIA 5JO5B 2YKLH 1NDGB 3RWEA 2P45B 1S7QA 3G5ZA 4PRAB 3A6CH 1N59A 3D9AL 3K0WA 1OARL 5BVPL 3VWJD 1G0XA 3MACH 1A3QA 3LS5L 4L3AA 5C0RH 1JI1A 4JPVH 3LIZL 2D4DA 2FX9L 4WW2F 3ZE1E 4KUZL 4M1CC 2PXYB 2VLME 3BGAA 1YEKH 4EIGB 4PJFE 1NGXB 5F7UA 1N2RA 4XXCA 1KIQB 2XWBA 1NSNH 4JKPH 3LV3B 5T1DH 4PB9L 5TDPA 1JNNH 3GSUB 2OXGA 4NCC1 1JHTA 3MREA 1VFOA 1FO0L 1NPUA 3QXTA 5IBTH 2Q6WB 2J7LA 2X1WL 3GBMH 2YPLB 2FO1A 4M5ZH 3SCMC 1NUNB 4U33A 5CP3A 2H32B 3ZKND 4APQC 5C6PB 1AP2B 1F3JB 4QCIA 1QFUH 3HNSL 1D6VH 3B9AA 4GH7B 4H20H 1IGCH 4F58L 4YX2L 3LKRA 3HAEH 5ESQA 3S6CA 2DLIA 4MLIA 1MAML 1WFNA 3FO2A 1BFVL 1D6EA 5KS9B 4ISVA 3X13A 2VXUL 3MNZB 3D85A 3AS2A 2WANA 5I1GL 3VD4A 1G7LB 1A7BA 3QDMB 3WO4C 2IH1B 1J11A 3BMWA 4XNYH 5IW3A 4MNQE 3H7BB 3JZ7A 2Z35B 4MCZA 4NQSA 4MZ3A 5FF6B 4CMHC 1KB5A 3WXWH 1AXSB 3IAQA 3ARDB 2O5YL 1QQDB 4CDGC 2Z8WC 3HRPA 2AK4A 1DLFH 4TUOA 4WUUE 1BP3B 3C08L 4IOFC 2CRYA 3B3IA 3O4LA 4WI7A 4WIQA 5EWIH 5IHBA 4Y1AD 2GSGB 2R1YB 4NJAH 4L9DA 5L2JA 3UTPE 4RQQA 4KRPD 4NOBA 4UMGA 4AY0A 3VFOB 3WJJA 3QFJE 2Q3ZA 4U1IB 4DN4H 1SJEA 1T1WA 3LKSB 3GO1H 4GMTH 1WK0A 4GRWB 4WJ5A 2X1PA 1MEXH 4NQDE 3O3DA 1WITA 4PJ8A 4BK4A 4W6YB 1T0MB 2UY6A 5I17A 4J3OC 2QL1A 3S36X 3KLHC 4NO3B 4FQCH 4KZDL 1AC6A 3GB7A 4O4YH 3U4EB 2MHAA 5D1ZC 5SWZA 1JGVH 3CXDH 5T3XL 4Y8AA 2IF7A 4EOWH 3U9UA 3KNBA 1ZANH 4Y16B 2CSPA 5E2VL 3MRMA 5KTEL 1KXTB 2CO7B 3CFDB 3O41B 3P4NB 4OZGF 2ARJQ 1IAMA 3F5WB 3Q3GA 3T1FB 2VIRA 1MJ7L 3QUYC 3CX5J 4CJ1A 1UB5B 4NRZB 2BNRB 2XTJB 1FL5A 2BVOB 1EEUA 2EH7L 2CIIB 5IEHB 1QO3A 1S3KH 3BKCL 4KK9C 5JW3L 3OZ9H 1QPXA 5T1MB 5D6DC 2VUYA 5D6CA 3QNZA 3RQ3A 1ED3B 1DE4A 1EEYA 2AJXL 5CJXA 4JPIB 3NFPB 4MD0A 4LKCA 5D5ME 1NJ9B 1QBAA 4O2FB 3U4BL 1T1YA 2AK4D 2FBOJ 4KTDL 2ERJC 1OW0A 4OLWL 3L5IA 3O4LD 3BE1L 3V4UL 3S8WA 2DQEH 2X9YA 4YBQD 2DM3A 1AO7B 4FXLA 4NIKB 3N85H 2C5DC 2PTUA 5M95B 5E8DL 5ICZA 1CXFA 3TBSB 5DJCB 4P5KA 3HLAB 3CDFA 1S9VA 5TPWH 3BGFC 5D7KD 2R4SH 2VLRD 3CLFH 5MEOA 1P5UA 2NW2A 5B8CC 1TCRB 3CFBA 4M62L 4LOUD 3RTQA 5SWZD 5I0DA 4JHBA 2QQQA 2WP3O 4K8RD 4Z95H 5L8LB 2Q7YA 1YJDL 4OGXH 1A3LH 1FVEA 4RFNC 1A1OA 5ISZE 1DDHB 4N8VA 1ZOXA 1FZKB 1OAKH 5F9JA 2VDRL 2B20A 5E1AB 3VXUE 2ZUWA 4MMXC 4ZTPH 4F57H 3TESA 3IYLW 5E5MB 2Y07L 1F6AA 5ACZA 1QHOA 1RV6X 3QNXB 3GSXA 4EIZC 1EK3A 3MFGB 2AKRA 4JN2A 3D9AH 4LCYA 4TVPD 3T65A 3PABA 5BVPH 3UXFA 1T22A 1R0AH 4JRYB 5HHMB 2IPUK 5DJZA 3LIZH 1FHGA 2FX9H 2YS4A 1JF1B 5CSZB 5DHVA 4D9LL 1H3WM 4WFGE 1IM3A 4X4YB 2CUIA 4X98B 4JJ5B 3T0EB 5KANI 2ZPKL 3E6FB 3FQWA 1F6LL 2PO6C 1TJGH 3V5DB 2I5YH 2B4CH 4YO0B 4PB9H 2NW3A 1KCVL 5HPOA 5T3ZE 3O4OB 4ZXBA 5F1IA 4TTDC 1R3KA 3BJLA 4LLQA 4M93C 2VWEE 3MYZA 5DMIH 1FO0H 5GJTH 3LEYH 1CFSA 3KYMA 4WW1B 1JK8B 4QRPE 3D0VB 4GRLB 4U1SB 1TQCB 5IB3A 4ZPTB 5HD8D 2F15A 1G9MC 4QY8A 3GKWL 4ORGB 3QO1A 1DSFL 3RX8A 3TZVC 5DRXB 1B3JA 4YX2H 3WBDA 1GYAA 2XNAB 5EU4A 3MBXH 3RTQD 1F8TL 1OP3H 3GM0A 4HUNB 4YPJA 1CGUA 3GMQB 1UJ3A 4S1DC 2NY7H 3TYGL 3HB3C 1DN0A 4HJ0C 4IJ3B 3KHQA 8CGTA 4AEIH 2VXUH 4R7NB 1FL6B 1HYSC 2I60H 3QNYB 4B0MM 4KAQL 2EXYC 5TE7L 1VHPA 3D48R 3BAEL 4XXDB 2GQHA 1YEDB 1AR1D 5E94B 4DGYL 4WEMB 3KPSE 3QAZB 1AO7E 1I7ZB 2ZSWB 4N9GA 4H0GA 2B5IC 3DVGA 1CDUA 3C08H 3O8XB 4MNQA 4PRIE 3FB7A 4MCYA 3PL6D 3IETB 3REVA 3GIZL 1BZ7A 2H8PA 3F6LA 1BBDH 3AM8C 2QADC 3DX6B 2YD4A 4WUUA 4BFBD 4PG9A 1Q0YL 5GS0C 4RWHA 1U9KA 4KVCL 1NGPL 3FCTA 4EN3B 1ZHLA 4BSWB 3JTTA 3DUSA 3DSFH 3U7YH 3V5KA 3BUTA 4X4ZA 5FDWA 1GOHA 1PG7L 4BFGA 2H2PC 3DYPA 4KZDH 3L3GB 3QFJA 2VLMD 3DECA 4ZXBD 4YJZL 1INEH 4WV1B 5JHLH 1BQSA 1MCCA 4M1DL 1Q9LB 1AH1A 2Z93A 2P44B 3E6HB 5DRWA 2GK0B 1B0GA 1MHEB 4Z6AT 4U6XA 2FECI 5TQ2H 1UACL 2R2HB 1QTYT 2ZNXA 1D5ZA 2NY1C 3C8KB 3P0GB 3L6FA 1REIA 1UYWL 4Y4HA 4TULH 1MF2L 3QJFB 5D7LB 2EECA 1U8LB 3Q6GL 4QF1A 2HJFB 1FDLL 2X70A 5JO5A 3DUHA 1IKFL 2NY3B 3MBEB 2EIEA 3S35H 3NPZB 1M7DA 3T0EE 4XBPA 3LQAL 4X6BA 3BN9C 3BXNA 4NKMB 3C9NB 2XPGB 5B22A 1NCCL 2AXFB 2JJTC 3PF2A 2R23B 2CUMA 3SKMB 5C0AB 1VB9A 3U4BH 1NGXA 1MSPA 4OKVB 1GGYA 2XACC 4QXTA 3ULVC 3JWOC 1NEZA 3I6KA 2V2WA 4OLWH 1LEGB 4X4ME 4MNQD 1NMBL 3UP1A 3V4UH 3LV3A 2GSIB 4XP9H 5A3IC 4EUPG 1MCWW 5D5MA 3WS3A 3MA9L 4KUCD 1T2QL 1A4KA 5I2IB 4BSJA 4HK0A 3GSWA 5GJSL 1RUQL 4QWWD 1MCPH 2H32A 4FMFA 4BSVB 4MHHI 5A40E 3UTPD 1AP2A 1F3JA 2HFEB 3HMWH 4E5XB 2IAMB 5EU6E 4JG1H 5D70L 5DHVH 4JO4L 3QFJD 1F97A 2Q87A 1WGOA 3FO9A 4YXLL 4YHMH 2NY2C 2OP4L 4OZHB 4NQDD 1H15A 2FATL 2FGWH 4JZOB 5EZOL 2EKJA 3C09B 3BO8A 1YJDH 3QIBC 3KPLA 5I1EL 1ZEAL 3HNVL 5CEYB 3V0AC 1NCWL 4QRQA 4XZUA 4MAYB 3SQBA 1U8PB 3O3BB 1NBZB 5C0IB 4HPOL 1SEQH 5ADOH 1XMWA 4YDVA 1IZKA 1H9VA 4D0BA 4Y4HD 2HJLB 2G5BB 3QRGL 4AG4L 3LRSA 3KLSA 4G8GB 3VG9B 2Z35A 4MXQC 5EC2A 2N7AA 4OIBA 5ISZA 5HGAB 1AHWA 3EDFA 1QQDA 1OD7A 5M7QA 5MEPB 1T1ZB 1QFWL 3VXUA 1NMAL 4O5LL 4QXUL 5H94A 3ZHLA 5T5NG 1J05B 3C8DA 1JTOA 2PTTB 1BLNB 4NWTL 3CVHA 3VGGA 3QFDB 1ZGLB 5HI4C 5CJQH 2R1YA 4JDTL 4YHZH 3MLVH 5ITFB 1CQYA 5GZND 2KDGA 3QUXA 2F19L 1F4AA 2C4FU 3VFOA 8FABA 1XGUB 2ZKHL 3VRJA 5DJDA 1BQUA 2ZPKH 4GXVL 5H37H 3FQNB 5BMFL 1VA9A 4LCUA 3BVNB 4MNHB 2DI8A 1IFHL 5GGTL 4U6VH 4NSKB 2QEJA 5J12C 1NGQL 3RDTA 1RK1B 4KZEL 2YPLD 3U79A 2C7UB 3MZGB 4YGVA 3GMOA 5FHBL 3CK0L 1M7IA 4HKZB 4PRBA 3NCYP 3VDAA 2ZCKH 1U91B 1WCQA 2VZTA 2C3HA 5GRUH 4OCYL 1DSFH 4OZFA 2DBLH 1H3XA 2R1XB 1A6WH 2OL3L 4YHKH 1F8TH 4QRPA 4PJXF 1WF5A 4XMPL 3S7GA 1SBSL 5EORL 3QQ3B 3TBTA 2UYLA 3V5HB 4UNTA 4XAKE 5EU3A 4W4OA 3TYGH 4LQ1A 1IEBB 5LGKA 2G60H 4B5EA 1J0JA 1I3UA 5T1MA 5INCB 1SYSB 2AEIT 5TE7H 5I1JH 3QDMD 3BAEH 3FONB 3OR6A 4NZTL 5DJ2B 4DK6A 4K7PX 1I7TA 1QNZL 5ISZD 5I30H 1U8NB 5EUKB 3EO0A 4HS6B 1HSAB 4O2FA 1VKXA 2V5SA 3L5WB 3UTQB 4IHOB 3VXUD 3P40A 5IEKB 1TZHB 5DUPL 4E41B 4HIEB 3VGBA 4L8SA 3TN0B 1J0IA 1ZA6A 5IHLB 3GIZH 1T1XA 1YPZE 3KPSA 4XPAH 4YEFA 4ZFGH 1DZBA 5IIEB 3MRKB 3HZVB 1JMXA 5EB9A 1MCIA 4JE4B 4BM7A 3QUXD 3TBSA 5K9OA 5DJCA 4LRNL 4PRIA 1ND0B 4QO1A 4OZHE 4I18C 1U8QB 3DVIA 2A9NL 5LXGL 1PQZA 1TCRA 3N1FC 4G7VH 1C12A 4LSVL 5E6IB 4YHYB 1L4IA 2JJUA 2OR8A 1XGYH 1JF6A 1IBGL 1RZKL 3DUUA 1JWMB 2RR3A 4M1DH 4F7MB 3OQ3B 3KPNB 4X7SL 4Y16D 3BKJH 3QPXH 4WFEE 2P8MB 5DHYA 4HLZG 2AJVH 4HGWB 4WFHD 5T3ZD 4LDLB 3HRZB 4XBEH 1P9MC 3MLSH 1OPGL 5C07B 1RIUL 3GMNB 1K4DB 4K3JH 4KVNL 2DM4A 4QRPD 3SGJC 1BFSA 3QNXA 4R96A 4JM2A 5DD6A 5I19L 1PFCA 3KPTA 1F11A 4QYOA 1U6AL 4P99A 3F7VB 3KPOB 3BZ4B 3T3MF 1A6AB 4LSTL 4N0RA 4GRMA 1OWRM 3MRGA 1XGRB 3O9WC 3C5ZB 3RVUC 5ADPH 1JF1A 1ZA3B 4L8BB 1DVFB 3DPBA 1NCCH 5D2LF 1FH5H 3H2WA 1PDKA 1LEKA 2OI9C 1FC1A 3LKPB 4X98A 3P9WB 2HTKD 3B2VL 3WJLC 3QHZH 4X7EC 5I18H 1OAUH 4UDUA 1G0DA 5ICXB 2EYRB 3ZO0A 5C6TL 5CP7B 1S7SA 3BP6B 4LEOB 3VXRE 4PJ9C 3KPSD 4R7DA 1AO7D 3V6OC 3OG4B 5D7JB 1V5JA 5B39G 1WAAF 1CICA 4X4MA 1F3DH 2VXVL 1I3VA 4PRID 4WW1A 3TWCL 5GJSH 2XA3A 2YPVL 1CFVL 2X4TB 3CVHH 5JNYB 5FA4B 2JB6A 1KPRB 4FQJH 3QG6B 4ORGA 5IFJB 5DRXA 1MREL 4JO4H 2EYSB 4L4JA 4TUJB 4F9PC 3EGSA 3GMQA 4V1DB 5T1LB 1KEML 1JCKA 5JHDB 5EU6A 3OTTA 1AXTH 3HNVH 3PP4L 4R7NA 1FL6A 1BVLA 1W8OA 1D9KC 1INDH 5LQBL 4ZUSA 2C26A 3R8QA 1KCUL 2OR7A 1MRCL 3QI9C 4LCWE 3QRGH 4Y2DB 5J1SC 5IGXL 2GYSA 3BD3A 4POZC 5BOPA 3BRDA 3M17A 5CZVH 1ZT7B 2ARWA 2NYYC 3PGFH 2X4RB 1NMAH 2Y23A 2VE6A 3HI6L 3RUGB 4QXUH 1F90L 4MS8D 2VZSA 4OZFH 2AI0H 4K3DL 4MWFA 2GFBA 3ARGC 5L2KB 4ZSOB 5DVMA 2YN5A 4P4KA 4JDTH 3CZJA 5FM8A 3DX6A 4JRXB 4QHMB 5DRNB 2D9QB 1J86A 3ORJA 5FUCE 4YBLB 2ZKHH 4KDTA 3T0ED 1ZMYA 3I3DA 1IM9A 4ZFOB 5FO7B 4AEEA 4MD4A 2DIBA 1KB9J 1G0YR 5B3JF 5IMOB 1IFHH 1G1YA 4JFOA 4PJEB 1Q9LA 3EYVB 4UBDC 3G9AB 1L0YA 2X40A 5C07E 4KZEH 3NFSH 4OTXH 4MX7B 2BVQB 3O81A 4HIIB 1XZ0A 5EZLB 1BJ8A 5FHBH 3VI4F 3CK0H 4GRLD 3UDWA 3X3FH 3VFSB 3C8KA 2BY0A 4R8WL 2GI7A 3SJVE 1YY8A 1MHCB 4S0TD 1JE6A 2C1OB 3VFGL 2P1YA 4XHQA 1DL7L 5ID0B 2OL3H 1MLCB 1TPXB 3C6SA 2YD3A 4ZS6C 2HJFA 3F7RA 4MXVF 5F1SA 7CGTA 4XMPH 1MFEL 4PP2B 5KSAB 1T83A 3I3EA 5E70A 1IKNC 1RJLA 3SE3C 3MV9E 5D71H 1CE6B 1K3ZA 4GSDH 5EU5B 1MFAH 4PJAB 5BS0E 4NKMA 1TTUA 2AXFA 4LCCB 4G6KH 2W0PA 3SKMA 5A16B 2P43B 2PNDA 1I4FB 1LP9B 4GAFB 5F7LB 5EOCL 4ZAKB 4YHPB 5AAWA 3O8XD 2GIYA 4UIKL 2I26N 5E4EB 4R4NC 2JCCF 3HR5A 1SYVA 2GSIA 1YMHA 2VC2H 3IB4A 3RWCA 3PXHA 1QSFB 2H2SC 4L5FH 4P4KD 4ONFL 1L0QA 3MNWB 2V2XB 1ZHKB 2X4PA 4L9LC 2BJMH 4EN3D 1MY5A 2HT4C 4UT6H 5GGVH 1YPZA 2YA0A 4BSVA 4X6CF 1IM9D 1OAQH 1PG7W 2HFEA 1JGDB 5BW7C 3LCYA 2A9NH 5JHDE 4LPTA 2CDEB 2VTFA 2APWA 4X8JB 2BY2A 1TQBC 1OGTB 1D7FA 1RZKH 4OZHA 3OGCB 1F00I 4YR6A 1CFQA 3B8SA 3S37X 4GBXB 4X7SH 1KJVB 2VNCA 3STLA 3VI3E 5CEYA 1F3RB 1BZ9B 3L1OH 2X1OA 2Z31B 4HS8L 5I16A 4F9LC 3VXPA 3O3BA 1Q0XL 2C1PB 4OLEA 4RMRA 5IK3B 1X5LA 5F7FA 1FFPB 4PV8A 1OPGH 5IR1B 3MLXH 2J4WL 1BIIB 4QKXB 5ESAA 3SKUD 4ORZC 5HGAA 3RVWC 4HS3A 4ZSOE 1FNAA 4JKMA 4X99B 1LQSR 3L3DB 5I19H 1G6RB 1T1ZA 4HUUB 4U1JB 5F3BB 1T7XA 1YYML 2VN7A 4JQXC 2PYFA 3MBED 4NHCH 4XC3H 1J05A 5E08L 4ODWA 1INQA 1ZHBA 3RA7L 3ARRA 4OZ4A 4PGEB 4KRMB 1YUHA 4ZNCD 3VGAB 1JVKA 4XAKD 5HYJB 5F89B 5FYJE 3DYMA 4R0LA 4TRPH 1XGUA 3RGVB 4OD3L 1C08B 3DGCR 4PJEE 4N0FB 2DRUA 2BDNH 2NXYB 3NFNB 2IMMA 4HZLB 3VFUA 1DR9A 3T0WA 2RJMA 4XCCH 3SDXB 5F9WB 3BVNA 4YHNB 4MNHA 4U1HA 5TDNB 4YDKH 5EBLB 5F93C 4NDMA 4LQFL 4ZTOL 2D2OA 2WLZA 1IEAB 1KTLA 1RK1A 2VR9A 4CMMA 3RJQB 2VXVH 2NTSP 5CINL 1YC7A 1CS6A 3VXRA 4HKZA 1T6WA 2IAMD 1ORSB 1U91A 4G9DA 4TOYL 5SWQA 2CJUL 2OTUB 1QRNE 5J9PB 1MREH 4ZUVB 2R1XA 5DRZB 4Y4KA 4XVTH 1R5VA 1S5IH 1X5XA 3QQ3A 5FO9A 2Z8VC 4MJ4A 1CBVL 4MAYD 4URTB 2NZ9C 1ODAA 1H3VA 5LQBH 3V0VB 3NZHL 1DUYA 5A2JH 3ZSTA 1YDPA 4PS4L 3HR6A 4DZ8B 5I15L 2XZCH 3FONA 4WFED 4KK5D 4JREC 1RSFA 3EDDA 4MXWL 2XIDA 2WWMD 4G3YL 4OLVL 5DJ2A 5IGXH 4B50A 3FQXB 1U8NA 2R2EB 4PJ7F 4HS6A 2P5WE 5D2NB 5CKAA 4QHKI 1HSAA 1XT5A 2J8OA 3L5WA 4Y19B 3UTQA 2J8UA 4IHOA 1OP5H 2UZIL 4LCWA 1QZ1A 1F90H 4YNYB 4U2ZA 3MCLL 2B0SL 3VCLA 1XIWB 1WWAX 3MOAL 4QRUA 4BH7B 4KI5F 4MJ6B 4A6YA 1EGJA 1WTGT 4IS6A 1A14L 2C3XA 3GSNB 1NAML 4Z7WF 3SY0A 2Y6SC 3H42H 1F4WL 2NX5B 4TYUA 1U8QA 5CMAA 4AQOA 2AQ2A 4IMLA 1QLEH 4P2OB 3OG6B 4NN6C 4BUHA 5FGBC 1MWAB 1OAXL 4AL8L 4C58B 3CUPB 2GJ6E 1YNLL 4K7FB 5I8EA 2ATPB 1OGAB 4N0UB 1URLA 3MRHB 1EHNA 4YHIA 4PJCF 4F7MA 1PD6A 2CLZB 1P7KB 2QLVB 5J11B 1RUAH 2AJSL 3FT3B 3WSQL 3VXRD 3RIAK 5F9AC 1DQQB 2EDLA 1CWVA 2VR5A 3DXAB 3EYQC 5C07A 1E27B 3K2MC 1K4DA 4LBEA 1DL7H 4Y4KD 5C3LD 1BEYH 2ZSVB 3S9DB 3HN3A 3VXOB 1FGVL 3SJVA 3UBXG 3F7VA 3BZ4A 5TDOA 4CGTA 5IFAL 3GMRB 4EVNA 4AT6A 3GGWA 4L8BA 1DVFA 4NQXB 3SDXE 1JGUH 3TF7C 4P2QB 3MV9A 2X4QB 5EO1B 5JXEA 3JV6A 4XCEB 4R2GB 1CVRA 3TA3A 3Q5YA 4LCWD 4EXKA 3CMOH 5BS0A 2EYRA 5BVJB 1KSRA 3TN0D 2PW2A 4LEOA 3LMJH 4JFYB 1HXYA 1JYVA 3V4PL 4ZFZB 43C9A 3UYOD 5GISH 1E4XL 3LD8C 4ZOAA 3WKML 4OF5A 3EAKA 1FCGA 4MJIB 1ZT1B 2JK5B 4OIIH 4HUVB 3K4ZA 2OSLB 3EYUH 1VDGA 2KBGA 1YEEL 4HC1A 5E6ID 5F6IB 5LWYH 4OFYD 4DKFL 3MGAA 4TUJA 1F02I 2YC1A 2R0WH 1QSZA 5LBSH 4BFIB 2HTLC 1EHAA 5JHDA 4PJDB 1IC5L 1S9XB 3OWEA 3LKQA 2F58H 4J8RA 2D3VA 5D2NE 3WN5C 3ZHKA 4NRYA 4O02H 5IFHL 1Q1JL 1QD0A 2DDQL 4LPYA 5C07D 3G5VA 4PG2C 4KKCC 2J4WH 4MVBC 4J3TA 5FXCH 3BESR 1U8JB 2W65B 1OB1A 4FABL 3MV8E 5C0NC 5EUOF 3SJVD 5I71C 2AEQH 4Y5YC 2X4RA 1ZS8B 3NGBC 4G42B 2VQ1A 5E08H 3FB5B 1X44A 5CLWA 2BVPB 1KJMA 2F54E 1JL8A 4WI4A 4OZIF 2ADJB 2VABB 4ZSOA 3GSRA 2DMCA 4NZRH 2AJZB 3ZE2F 1DVFD 4QHMA 4HUWB 5DRNA 3WIFA 3CDGB 3MV9D 3SCMB 1OGAE 4N0UE 2AK1L 1IQWH 2DM7A 5DVOA 5JXED 3F7QA 3BHBB 1JPFB 3SGDH 3TA3D 4APQB 2I9TB 3AU1A 3CSYB 1LO0H 3GK8L 4M6MH 5FO7A 5BS0D 4Y0GA 1FLTX 3X12B 1G9NL 1I3GH 5IMOA 1VCAA 1MCOL 1N6QL 4IDJL 3GNML 1ZT4A 5D7JD 3RWFB 4PJEA 4YC2C 2R39A 3LVEA 5L7XL 2P49B 4P57B 4NUJA 3RX5A 6FABL 1U2HA 2BVQA 3S36H 4X9GA 2P46B 5DVNA 5EZLA 1TJHL 3ULSB 4EI5C 1MPAH 4LAQL 4P46B 3PNWB 3B43A 5FM4A 3WO4B 1MHCA 2BFVL 3V6FA 3THMH 5AD0B 4A6YH 3BIKA 1EGJH 4OGYL 5H2BA 3LRHA 4F8TA 3L3JB 5JLZB 4OQ1A 2HMID 4HUKB 3NH7H 4JN1H 4V1DD 3OJDA 3RVTD 4KDWA 5JHDD 1N3NB 4NNXB 1QRNA 1CXKA 3WV0A 2XKNB 4P2QE 3O6KL 2B39A 1C8PA 4RBPH 3NZHH 1ZVYA 2XQYK 1CGSH 4N1CA 2BCKA 3IU3B 4OLVH 2IC2A 3KYOA 2X7LA 5KSBB 2HKFL 1W72L 5TGBA 4YGAB 5ESVA 3KPRB 1FNGB 3SGKA 4FFYH 2NR6D 3DYOA 1IMHC 5HBBA 2GCYB 4QHUB 3HE7A 5F6HI 2WAHA 1II4E 2A1WH 3KG5A 1EUUA 1CF8H 4MJIE 5CGMA 3MCLH 4K07A 3W9DA 5L2KD 2P5WA 4LLUB 5T5NF 3KXFB 3NABH 4ZUWB 3P9MB 3NCMA 3ARFC 2V2XA 3OKKB 1GJIA 4PY7A 1A14H 5L9DH 3UJTH 1H3UA 1OF2B 4FNLL 1MIML 2HRPL 4HUXB 1T89C 2EH8L 1K8DB 1RI8A 2DMKA 3KYAA 5GSVA 3Q48A 5FYJD 1OAXH 1IAII 2ORBL 4JKLA 1EH9A 1YNLH 1R3HB 1OGTA 3TO2B 2AV1A 3WFHA 1KCSH 3O2WH 2CK0L 5I6XC 4MA8H 3OGCA 4K55A 4GBXA 4KGLA 4WUKL 3SDAC 3OXRA 2XN9B 4D3CL 1BZ9A 2Z31A 2BSRA 2GJ6A 2A6IB 2PTVA 5IG7B 5K59E 3T08A 4YDLC 1MFBL 5C2BH 4OLYH 4HFWA 5F1OB 3FN0L 4N5EC 5CCKL 3LN4B 4KJPC 2XV6B 3AVEA 2B4CC 4FZ8H 1BGXH 1UWXH 4YK4C 3IF1B 4X99A 2ERJB 1QFWM 1UM4L 1NH6A 4HC1H 3FFCB 5FGSA 1CGWA 4JANA 2OK0H 4G6FD 4PGEA 3L7EA 4AIZB 3VGFA 2G2RB 4YBQC 4ETQA 5FOJA 3ETBF 4FS0A 2CLVB 4IIQC 4HJGA 2DQDH 3D0LA 1EX0A 1AGFB 3CFCH 3TBWA 3QIWA 4QEGA 4RFOL 4ZAKD 2CO6B 5C6WH 3HE7D 4PJ8C 3IJHA 1BJ1H 5GRVL 2CKBB 1QSFD 3LEVL 4R4BB 2IPUG 1DQTA 1GHFH 2AABL 4RISL 3V2AR 1E4XH 2FX7H 1IEAA 3EJZD 4JB9H 3WKMH 4UTBH 1MCNA 2JLLA 4Z0BH 3CH8A 3MRQA 3MROA 3K4AA 2OS7A 1VGKB 1ORSA 2AGJL 4FFZH 5I66B 1R24A 5J9PA 3CXHJ 4DKFH 4AIOA 1QFHA 4KHXL 2HP4A 3LPFA 1RHHB 2Y7QB 3PE9A 3RL2A 4GBXD 3H9SB 1UQSA 4HWEL 1IC5H 1WZLA 2Z31D 4RGOH 5FYJH 2HVJB 4QHLA 5KSBE 1HKFA 2XA8L 1KLUA 3C6LA 1Q1JH 2DDQH 3WHXA 2JELL 3GSVB 4TNWK 5IMMB 4MQ7B 1S9YB 2KUTA 5CJXC 2R2EA 3TCLB 5D2NA 1B90A 3T4YB 3N0PB 4UINH 5JA9A 4PJDF 2PO6B 2DLGA 4F33A 1OW0C 4HFUL 3GZKA 1XIWA 2AXHA 4BH7A 3MV8A 4XCNB 1ROWA 1UGNA 3I85A 4M93B 4IRJA 5CZXD 1RZGA 3MXWL 4HGMA 1AIFB 1YQVH 2FHBA 5DD3L 1EVUA 4QHNB 5CJOL 3RGVD 3UTTB 2F54A 3TH3T 4LPWA 2MMXA 2NXYD 4H1LH 1MWAA 3TZVB 1FN4A 1S7WB 1OOAA 2N4IA 4U7KA 5FGRA 4HZAA 1N6QH 4IDJH 4HGKC 3NCJL 4XT1C 2GJZB 2CLZA 1P4LB 6FABH 3IJSB 1BQHG 4FQLH 3FT3A 4LAJH 2A0LD 3BKYL 4RRPA 4O9HH 3DROB 2UZYB 2X44D 3IDMB 3MRFA 3WIIL 5EA0H 4LAQH 1DEEB 4LSQL 5GIRB 3IT8D 1E27A 1G7PA 4OGYH 4HMDA 3FFCE 1MI5B 5AZEH 4R4FH 4PYGA 2B5IB 2G9HB 4HLJA 3ARZA 2DM2A 2ZJSH 1A64A 1AGCA 4BYHA 1MCEA 3P9LB 3DJ9A 1EBPA 2HT2C 3N06B 4IRSA 4X6FA 3F7PC 4XVSL 2CGRL 3C6LD 4BELD 2QADB 1MNUL 1MRDH 1NC2B 2VMFA 1YEHH 4P2QA 2V5YA 2V9RA 1W72H 2X4QA 5FM5M 4NKDA 3LY6A 1K4CB 2W1NA 3BIBX 1YJDC 4IRZH 1I9RH 1CFNB 1VFBB 1M6OB 3A6BH 1XIWD 3RKDC 4ELMF 5TE6H 1CGVA 4ZXBC 3V4VL 1NCBH 5E0QA 5FCUL 4PJIF 3MRIB 1SEBA 4PJXE 4JDZA 4MJIA 1KACB 4GLRH 1HHKB 5E5UB 4HUVA 4NZUH 2NX5D 2MQ0A 2EE6A 2EH8H 2NY1B 3QZWA 4DUXA 2OSLA 2XG4A 1HI6A 3AROA 3H9SE 3QIUC 3QDAA 4P2OD 3QO0B 3X11A 3V6ZA 1U93B 3MCKB 2ORBH 1I9IH 1BM3H 3GSOB 4GW4B 4P2RE 1OGAD 4UDTB 4CL7A 2CK0H 4WDIB 4I0KA 4X9FA 4YAQA 1IJ9A 4M3KB 1C1EL 2IH3B 4WUKH 4EXPX 5ABDE 4L8DB 3ULUF 1UJ3C 5HVHC 1S9XA 2YWYA 2DQJL 4BZ2L 4HXAH 1AD9A 4KKBD 3MGOA 5DT1L 2IADB 3OV6A 3UBXB 5CCKH 3NTCL 2E9WA 3FOLA 4KDVA 5BQ7A 1EXUA 2BRRL 4MGXA 1LO2H 4GS7C 4YFLF 5IVXB 1OP9A 5TFSL 3P11L 3OJ2C 4GKOA 4X7CC 1A7QL 3SE8H 3WMSA 1CFTA 1Q9OB 1SVCP 3UTTE 1IILE 3IGAA 1IAIH 3QH3B 4AENA 4LHUA 4F7TB 3KS0H 2PW1B 3L5XL 2AJZA 3TV3L 2CLRB 1PKQB 4HG4J 1B2WH 3CDGA 2Y9RT 1XGTB 4P2QD 3SCMA 3ROLB 1KG0B 1GPOL 4M7KL 4ONHB 1OP5K 1JPFA 2BOCA 4R2GD 5JXAL 4ZS7L 3CSYA 3WUWG 1KXVC 5IESL 3HUJE 4KY1L 1RUMH 3FOMA 5D9SA 1KEGH 2XZQL 5ACMA 2NY2B 5TE4H 2AABH 2DIAA 1ZSDA 2OTWB 4DAGH 3WO3B 3AAZB 3QIBB 4P57A 3MJ8A 1MCSA 4MJID 3V7AG 2W9DH 3KJ6L 1YEJL 4KK6D 4PGCB 4AK1A 2ZUVA 4P3CL 3RWIB 4PGBA 5E8EB 5LAXB 4Y4HC 5GRWA 4EQ3A 4LGRB 5I9QC 1E6OL 1UZ8A 3PGDA 2GUOB 1I85C 1N3NA 5IV2B 4LRIA 2YR3A 1DBAH 4YUEH 2XKNA 4BH8B 2XA8H 2YA2A 3W5MA 1KTKE 1JNHA 5KOMC 5ILTH 1WFTA 4OT1L 3U2SB 5BZDB 1S9KC 4Q58C 1JWUA 3FB6A 2GAZA 2JELH 3MRDB 5CIPB 5HDBE 4M02A 4PJBF 3IU3A 4M1CD 5SV3A 1VSCA 3HS0B 5I73B 4UT9L 3SEPA 5I1LB 4JZJC 5E99H 4AEHL 5DFVC 2ED7A 1DBML 1JPGA 4QHUA 4FQXA 2KZWA 4K7PH 1I8KA 4LVEA 5JQ6L 4F2MB 5D1ZA 4YBHA 4Z8FL 5J12B 4LLUA 3AREB 3MLYH 1DQML 5E2TL 3MXWH 3P77A 1XEDA 3SCMD 1XR8B 1IEHA 3DX9B 4I9WE 5TQ0L 4HUXA 4APQD 4FG6C 4ODXB 2J8HA 3WLWC 1XH3B 1K8DA 5F3HB 1Z5LB 5KVDL 1B0RA 5C0BB 3QUYA 4JLRA 4YHLL 2ADFL 1R3HA 1P6FA 2QV2A 1CR9L 1X5ZA 3GJFA 4OCNC 3RHWK 4DKDC 3N9GL 2B7DT 1W8NA 2NZIA 3BT2L 1PYWA 3QXDA 2A6IA 2V9QA 5D6DA 3BKYH 1G7QB 3GI9H 2R4RL 1WISA 1IC7L 3C5JB 5BO1L 1HIML 5HY9A 4W6WB 2QHRH 5HDOA 3QBTB 3QUZB 1RZ7L 4KKAC 3OPZH 4RAUA 3PP3H 1AHWC 2HFGL 3TFKC 4LLMA 1JF5A 4XMLH 3FMGL 4K2UL 5GS1C 4D9QE 4B53A 2R69H 1P4IL 3FFCA 5E6YA 4XPGH 3OJMB 2YD5A 3R0MA 4QOKB 3HAEG 3VDBA 1MNUH 5BXFB 4QGYA 4CVUA 3TBYB 1JNJA 3FT4B 4NFDA 3G6JB 1IL1A 1JPST 2CLVA 2NY4D 2YK1L 1CE1H 3QUXC 3S3JA 4J7RA 4XNXH 3CFEB 1UH3A 2FH8A 3I2CL 4EI6B 4I18B 3RVVD 3B9VA 5B8CA 5AWNH 3CZFA 3KLHD 2C9AA 4FQXD 4WO4C 3VI4E 1QHPA 2WINA 4RAVA 4WFFE 2CKBA 3S5LA 4UTAL 5D1ZD 1KFAL 1CDBA 4AYFA 5DQJA 2EDDA 2KQMA 5C8JB 4QXWA 4ODUB 1PSKL 3RDTC 4ZUUB 3CC5B 5JDSA 4B7IA 5E1HB 1J0KA 5GGVY 2AEPL 1MVUB 4C83A 3GJEA 3MGTB 4GG6F 3QUYD 2VWEC 3RNQA 4MAUL 1P84J 3TLRA 1JYNA 3QCVL 4PJXA 5DO2C 2P5EA 1KIPB 1T7YA 1ZLSH 3NBNA 2Y7QA 4UNVA 4BQ8A 3H9SA 3RIFF 4PTUB 4KK9D 3F7YB 4I0PB 4X7TB 1Q72H 4P2RA 4BZ2H 4LP4A 3SDYH 3IS0X 3WL9B 5DT1H 5LGJB 1IGFL 3UMTA 1CCZA 2MWCA 2J1KA 3O9WB 4NQTA 1QLRA 4GW5A 5CLTA 5DMKB 3GSVA 2VDKL 2BRRH 5K9KB 5E2JA 5FB8A 2OI9B 4F7CB 4O00A 5IMKA 4CVXA 3CLEH 3L5JA 1NANI 4RDQG 3QUKB 5IJVB 4TNVF 4AEFA 4P23C 4OUUA 1H8OA 1QEWA 3FFCD 4PJ9B 1NC4A 3HCVB 3INUL 2EDWA 4X6CE 5C1MB 4RMVA 4XCNA 3L5XH 3TV3H 3OKLA 4K94L 2R0ZH 4KHTH 3CDCA 3C60A 4RCAA 4QHNA 3BIAX 3TJEL 1WBZA 3UTTA 1GPOH 4KWUA 1PY9A 1S7RB 2GJJA 1PKOA 3F12B 4LDEB 1EJOL 3TZVA 2ICWB 3WS6C 4Q74A 1ADQA 1SY6L 4LP5A 1E28A 4FQ1H 4HV8A 3EOTH 4WTZA 4O51B 1KIRB 3HUJA 4F7PB 2GJZA 4ELKA 3G9VA 4KROD 1YN6A 1YEJH 4X6DE 1KCRL 1IE5A 1HOCA 2V17L 3QI9B 1EEQA 4G8FB 5IMLA 4L4TB 1E6OH 1AI1L 4BA8A 4UOW0 1NFIB 4YH6A 1BPVA 4QOKE 5K93A 3H9SD 2VZUA 1FNSL 3G6JE 4JM2C 4WU7B 3MMEB 4P2RD 4S1RL 3D69B 2I25N 4AQ1B 3P9LA 1FV1A 3ARGB 2XWJB 3BP4B 4X4XA 3GJFH 5IT2L 1JZ4A 4LDOB 2Y06H 1PX4A 5D2LA 4MB5A 4P9HH 1CT8B 1RZKC 4ZMAT 3MUGB 1J9CT 1T5WA 2NY0C 3ZSSA 2PO6D 5E8OB 2NY6C 1DBMH 3B5HA 4HX1B 4EDWL 4L8CB 3AXLA 5F7NC 1CFNA 1HNFA 1VFBA 1MCKA 2VKWA 1M6OA 1RFDH 2XWTA 3KPQB 4G80A 5I76B 5JQ6H 4N90E 4Z8FH 3KAAA 1WAAA 1KBGL 2A83A 3FHQA 3FKUS 1TJIL 1JGEA 2WBJC 1CICC 3UTTD 1FAIL 4UAOC 5TQ0H 3S3PA 3BP5B 2JE8A 4K71B 7FABH 4RGMC 1IAOA 2J88L 2P42B 1KNOA 1BQHB 1MRFH 4LEXL 3RPKA 2Y5TA 4I5BB 5GQBA 2EDKA 2DQUL 4ODBD 3TZVD 4G6MH 4GW4A 3KYNB 1NGZB 5I1HL 2R56H 4S1SL 4Y7MA 1A7PH 5DUBB 5ENWB 1GGBL 4S1DD 1K5NB 2IALA 2IH3A 2EDRA 2NY5L 1P4BL 2Z91B 1N8ZA 3HB3D 3X3GL 1GIGH 1BOGB 4HJ0D 3JTSB 5FGCE 3U36A 2D7PA 1HYSD 1AJ7H 3MYJB 4PYHA 1MLBA 2EXYD 3CDYA 2IADA 1EUTA 5FYKL 3AB0C 2J6EA 1HIMH 5MEQB 4LIQL 3S37H 5KN5B 4CNIB 3N1PC 2VZVA 5I1CH 4XP5L 2DWDB 2W0LA 1C5DA 3V6OE 5K9QI 3MJ7A 3MX0A 4GAYB 4Z0XB 5EDXA 1WZ1H 1IRAY 4Z7WE 3TH2T 1NC2D 3RWJA 5GS0D 1DQJB 1JRHL 2YK1H 4L9LB 2CD0A 3ARBB 4PJCE 3I2CH 4G9FA 3GI8L 2DWEA 4I3SH 2H2PD 3X17A 3MRNB 3FQTA 1RJZA 1TQBB 5JOFB 5JPNB 4UOW1 4JR9L 2FLRT 1QBLL 1KJ2B 4OF6A 2GY5A 4LARL 1HQRA 1PSKH 3DBXB 4L4TE 3ARPA 3BRFA 3W11C 5I1IL 3G5YB 4H25B 3BSZL 3MNVA 3NIDF 4GKSA 5I1DB 3EO9L 3UAJC 4MAUH 4Q7DA 2YXFA 5FV1L 3VH8B 1ETZB 4I9WD 1GAFL 3QCVH 4H5SB 2ICCA 2XKUA 1TETH 2GUOA 2WSKA 4Z7QE 1C5CL 3L9RB 1XF4A 1G9MH 4HIJA 2W92A 4NOFA 4DN3L 1BOYA 5HDQL 5B38G 3MLZL 4ZDHB 1J8HB 5JTWA 1ADQH 1IGTB 5BZDA 3Q2CA 1N26A 1A0QH 1SJHB 4KMTH 4WHYH 3A67H 3PQYB 1ZHNB 3HS0A 1EERB 4H26A 4LF3A 3QDGE 3DRTA 2FB4H 4RNRB 3LN5B 3ULVD 1HQ4B 2GHWB 3TC9A 3PGCB 1ZK9A 2EDYA 2YEZA 4M5YH 1HHHA 4MLSA 3HC3L 3D6GA 3U46A 2W59A 2I27N 5A3ID 2EDQA 3UTSE 4BZYA 1TVBA 4PR5B 3EJJX 3RBSA 1T0NB 4DZBA 4XX1G 2IQ9L 3MO1A 4D9QD 3BGMB 4Z7NE 4X6CA 1D5BB 4I3RL 3BH8B 4ODXA 5FUZL 4Z77B 5F3HA 5LG1A 1FORL 1Z5LA 3DIFA 1NCTA 1GGCH 5EZJB 4MD5B 3IAPA 3TNNA 4NBYB 1UCBH 4YPGA 5IF0B 2NY2D 3RU8H 4NQCB 4UOJA 3DVNB 3QIBD 4M3JA 1SJVA 4J3SA 5E9DA 1AGDA 4N8VG 1NANH 4ZNEA 4H8WL 1KCRH 1I7RA 2R1WA 4XBGB 4GMSH 2BNUB 4Q2ZA 4NPYB 1U8OB 4JREB 4HH9B 1Q9WA 2LTQC 4OZIE 4NRXA 2EEBA 4C4KO 1CLCA 1A6TB 1K9TA 1AI1H 3RY5A 2ITCB 4NNYB 5GGRY 3ZE2E 1UADC 4X6DA 2P8LA 4HKBB 3QEUA 3S34L 1CTOA 3KYKL 5DK0B 1FNSH 5AZ2L 3BWAB 1QSEB 5CILL 4S1RH 1EV2E 1FG2A 4Z7UB 5JMRA 5HI4D 2Q8AL 2WBWB 3DV4A 1IAIM 5IT2H 4QOKA 4Q0XL 2I07B 3SHSA 4KMQA 3ZKXC 4QTHA 1N5YH 5ANMA 5L88L 4O58L 3RL1B 4R0LC 5D7IB 1UH2A 5MENB 3S4SB 2GEEA 3PV6A 1U58A 4EDWH 3IFPA 4YDJA 2D0FA 4NN6B 2O61B 4KJYB 5IQ9B 1KUMA 3K8LA 3L95B 3FRPA 3WNLA 2VLJE 4NP4H 5EOCJ 1KBGH 4Q97A 1AKJB 4JFFB 3KLAA 4P4RB 2QQKL 4O2CB 5C8JA 3CH1B 4NO5B 2NPLX 1FNHA 1KPVA 4NHUB 1FAIH 5J6GB 4NNPL 1R3JB 1UXSB 4KKNA 1IAKA 2AEWA 1HEZB 3BI9X 3CC5A 1A9BB 4DOHB 4LEXH 1P9MA 4U1LB 2HWZL 3TNMB 3MGTA 3VFNA 3M8OH 2ZOLA 4JO2L 4MDIB 1I7UB 2DKSA 3L3IB 1NCDL 3M1BA 2FEEI 4Y4KC 3SGJA 5IKCA 2HLAA 1P7QB 1J8HE 5DEFA 1DFBL 2Y72A 3MRJB 4OJFH 2NY5H 1P4BH 2BSTB 5CHNB 3MR9A 4GXUN 3F7YA 3HPLB 3EYFB 4RMSA 5DD5L 3WFDH 5B3NA 1RD6A 3BW9A 2DQFB 3BQUC 2DL9A 5DMJB 5FYKH 1MJ8H 5C70A 1HZHL 1N64H 4XCFH 1X6LA 4XP5H 3HAEB 2DMBA 2OTPA 1CI5A 4ALAL 1IC4L 1UVQB 2GTZB 1HXMA 3AS3A 3I75B 4ZFOL 3WJLA 3WFEH 1ACYH 4PJ9A 3O45B 3V6OA 4QOKD 4Z78A 3U9PL 3LD8B 2I24N 5IW1B 1DBBL 1KC5L 2D0GA 5IJKA 1BBJB 1JRHH 2M1KA 4KQ4H 4Z7WA 4F80A 3E2HB 5KANG 4PRHB 5HI5C 3DO7B 5CEZE 2RCSH 4XNMB 5JMOC 2CRIA 2D03L 4C59B 3QJHB 2XQBH 1QBLH 2H3NB 1MFCL 1HHGB 3BEWB 4PJCA 5FUCC 3PDOA 4MSWB 3BYYA 3FQUB 1FNEB 1A4JB 2NXZC 2FHFA 4MA7L 3ZL4H 5FECA 5HGHA 1P53A 3TEUA 2HG5B 3WN5B 4N90D 1D9KA 4DCQB 1Z2KA 3OJVC 3JV4B 3CIQA 4S0SD 5EFIA 2LAAA 1QSEE 2HVKA 3GRWA 3EO9H 3G08B 5IB1A 4Z7UE 4DW2H 1BF8A 3G6DL 5DYOB 4L4TA 1GAFH 1JWSB 1NEUA 1P69B 1DANT 1NFIA 1C5CH 3PWUB 3QUMB 5I75C 1L7IH 2HN7B 3LKOA 2VN4A 5I71B 4LLYA 3LQZB 2V9TA 4LCIL 3NGBB 4M7JH 5AYUL 3MMEA 5D7IE 3RBGA 3UJJL 1A7RL 2OZ4L 2XWJA 3ARGA 3O11A 3DV6B 1JUFB 5A2KH 5HVWA 4Z7VE 3RVUD 1DUZB 5C0FB 4LSUH 3V0WL 1PG7X 3NCFB 4BQ6A 1MHHB 5IBLC 3G5XB 3MLWH 3U7WL 1T3FA 3PP3K 1UENA 2ZOKB 1XF2A 2QHLA 5CJ5A 5D7SH 1NEZG 3QCUL 3LEXB 3MUGA 1A6UL 4JO1L 4AM0B 5E8OA 1A5FH 3V8CA 1RZJL 3LQMA 4D2NA 4XH2A 2OJEA 3UYRL 4PJ9D 5CD3B 1FVDB 5EIIA 4OBSA 4DOHE 2XQYG 1W0WA 3QDGA 5FOBA 3L7FA 3UZVB 4PGJA 1LO5A 4WNQB 4WU5B 5HHVL 3OAZH 3ZT7A 4CAGA 1BFOA 5ERWB 5AYQA 5L6YH 4OF7A 4I3RH 3IDXL 3UTSA 5INDB 3T04D 4EI5B 3FQRA 4I0CC 1FORH 1BZQK 1E0OB 1X5KA 5C0GA 5C0EB 1NGZA 4FA8A 4U7MA 3IXTA 2ADIB 4NFCA 5IBUB 1G6RL 4ETYA 1BOGA 3JTSA 3TJHC 4NM8H 3RWEB 1WBYA 3G5ZB 1N59B 2GW5A 1D9KD 3VRLF 4KXZI 1OSPH 1TITA 3QI9D 2K9UA 2AV7A 3EFDL 1KCLA 5C71A 4ONOA 4L4TD 5F71A 4L3EE 4S1QH 4POZD 3ZDXF 5TJWK 4P5TA 1ZGLP 1E6JH 2NYYD 1I8IA 1T66C 4HW6A 1N2RB 4FQIL 2VR4A 4OZIA 5LVEA 2Q8AH 3O2DL 3ARGD 3CFJA 2VDLL 2XWBB 1IQDA 3UTZA 4NQEE 5TDPB 1KTDA 3ARFB 1JHTB 3MREB 1ZWIB 4O2EB 1HH6B 1KPUB 1GGTA 1U8KA 3U0WL 4JJHA 3X14A 4YHOL 4LPCA 2XY1A 4QCIB 1FFNB 4NUGL 1YA5A 2E7BA 1EAJA 4OFKA 2OR9L 2X1XR 3LKRB 1H3GA 3QDGD 4DGVL 5I6XB 5ESQB 4UBDD 3SN6N 3ZHDA 1KULA 4EUPA 3WNNA 3FO2B 4RZCA 3SDAB 4OCSL 1BJ1J 3DBXA 1KENL 1D6EB 4Y5VA 4NNPH 3CX5K 4F9LA 3BEVB 4E9LA 4ISVB 3X13B 4YDLB 3UTSD 1GOGA 2VLJA 4MHHG 3GUTA 3D85B 4OZFG 3B5TA 2YHGA 2HWZH 2Q8BL 4G8IA 5D8JH 4ZS6D 4YK4B 4H5SA 4MCZB 4P2CG 3ZYOA 1KB5B 2UVFA 3VWKA 5E2UL 1FO0B 3VJ6A 2APXA 3P0VL 4JQXA 2DIJA 4OCXL 3B3IB 4ZDHA 4L1HA 4JRWA 5BV7H 1V7NL 4PRDB 5JIIA 1HZHH 2WNGA 2F5BL 4RMUA 1SJHA 5DD0L 3K74B 5J6HA 5T33L 4X6EA 5C0DA 4RQQB 4WW2C 5KVEL 4IIQB 4ALAH 4KMLB 1IC4H 3VFMA 5BJTA 3GSNL 1SJEB 3EHBC 3TGXA 4ACPA 1NFDF 1EHLL 4PJIE 3O3DB 3PGCA 4HDIA 4PJ8B 4R4ND 3GRWH 3GJFK 1NMCC 1UA6H 3GHBH 3HE7C 4D0DA 5I17B 1P1ZA 4DVRH 3GB7B 3RPIA 4PR5A 5SWZB 2E6QA 1KC5H 4I2XE 2FWOA 3U9UB 4OQTL 5JW5A 3BDYL 3BGMA 1GOFA 2HT4D 1UC6A 2E9IA 3MRMB 2D0HA 4JAMA 5ALBH 3BH8A 4PGDB 4G6AD 4HH8A 4Z77A 4LPUA 5E7BA 1CXHA 5KVFH 1W2KT 3Q3GB 4M9PA 4ZYKA 4KQ3H 4MNGE 2VIRB 5TH2B 5C0JA 5IF0A 4ZPVA 1H3PH 1CDYA 1JHLH 5EZIH 4EJ1C 1FL5B 5GRJL 4MA7H 2IPKA 3KGRA 1QO3B 3TPUA 2VLJD 1LO3L 4LFHD 4XBGA 2AS5M 5D6CB 3QNZB 4E42A 1CD0A 1MVFA 4NPYA 4DTGL 1CFBA 2FZ3A 2EDFA 3SKNB 1DE4B 4JFPA 5DI8A 4HT1H 2NLJA 1EEYB 3RVWD 5CS7A 1KYOJ 1JZ2A 4LCIH 3VU2A 1KELL 4P59H 4Z7UA 5IWLC 2DJSA 1RK0A 4YQXH 1IGML 2X42A 5ECJE 4H0HB 1J8HD 2DLFL 4U0RC 1XGQA 1KCKA 2N7BA 4LVHC 4PUBL 3PQYD 2P7TA 2DQTL 5CZXC 3RL1A 5ICZB 1XR9B 1E4JA 4P5KB 4KV5F 4JO1H 5C08E 3PHQA 4Z18A 4P9MH 4Z7VA 5GXBB 1PZUB 1EAPA 1RZJH 3QIWC 5FGBA 2GITA 5MEOB 2NW2B 1HILA 1QR4A 5BOZG 2ZP0T 3CFBB 3L95A 4RDQF 5DS8B 2DD8L 4K7PY 1ITBB 3RTQB 4O2CA 1OTUC 1XCQB 1J7VR 1FPTH 3WD5L 3HE6C 5HVFB 5J6GA 5F97E 4LLWA 3P4LA 1FVEB 1FYTE 1A9BA 3VFVA 4N8VB 5HYEA 3E1F1 2MJWA 5EBGA 3OX8B 4Q6IA 2DTSA 3IFLL 5F9JB 3K80A 4XHJC 1I7UA 4ODVL 4QXGH 3TIEA 5CAYB 1V7MH 1LK3L 2A2QT 4PJBE 3WKNA 3GSXB 1IZJA 5FA3A 2BSTA 5CEZD 1ZE3C 1WTLA 3GSQB 3JV0A 2AKRB 1W0VB 3HPLA 2BMKA 4JN2B 3UPAA 4LCYB 2NZ9D 3FFDA 1XFPA 1CD1B 1T22B 5HYSA 3MV7B 3VMOA 3BDBA 2V7NA 4HXBL 3C6LC 3OHXA 1OVZA 5DJZB 4ERSH 4EUPH 5KZCD 3W5NA 2Q86A 5DHVB 5EOQL 1FP5A 4D0CA 5IQ7H 1P7HL 3RY6C 4HCRA 3FN9A 4IMKC 1QSED 4FQIH 3FQWB 4N8CL 5I8KL 4RGNC 1VGEL 3TT1L 4L3EA 1GC1H 1X5IA 2IPTL 2NW3B 4ZXBB 5F1IB 1R3KB 4LLQB 4IRJC 2OMNA 2DQHH 3NAAL 3ARSA 1AQKL 4QNPE 1YY9C 2DL2A 4K3GA 1CFSB 3KYMB 2Y6SD 1Z9SA 4YHOH 4NQEA 3QIUB 3DO7A 5IB3B 4M61B 3RX7A 4QY8B 3QO1B 4OLUH 3WFCL 5EU4B 1AKJD 1HHGA 3BEWA 4JPKL 1FNEA 2UV3A 4OCSH 3B9EA 1JZ5A 1UJ3B 5HVHB 5E8NB 1SQ2N 3WIHA 4OLXL 1DN0B 1S7VA 1OCWL 4HIXH 4LLAA 1NKOA 3TIDB 1CU4L 1X5JA 4YFLI 3EYQD 1G9EA 3G08A 1I8MA 3MJ9L 4GS7B 4ODTH 3HI1A 4WRLA 5I1KH 1Y6KR 1A3RH 3ZTNL 1ERNA 4N9GB 3DI2B 5HHPA 2UUDK 3DX7A 2NNAA 3L3KA 4Y5YA 3LHPH 1MIEL 1B6UA 1EIBA 3DVGB 3D2UB 1S9WA 5KSUA 4OCXH 4MNQB 4IRSC 3DV6A 3REVB 1BZ7B 2H8PB 5KBNC 4OV6F 1DUZA 2DN7A 3VXNA 5DD0H 4OD1H 3MLUL 1MHHA 3G5XA 3VGDA 3ULUL 5T33H 3VXQA 2OM5A 4WUUB 2ZOKA 4PG9B 2Y36L 4KU1A 1V8HA 2P24A 3IDJB 1NGYA 1YECL 1ZHLB 1NUDA 3C2AH 3DUSB 4AM0A 3V5KB 1YMME 5FDWB 5DSCB 2V7HA 4FZEH 4L3ED 4PB0H 3C87A 3WXVH 3QFJB 1U3HA 1WIPA 3M07A 3VD3A 1A1MA 4NGHL 4WU5A 4PJIA 4V2CB 2Z93B 4OQTH 4GQPH 5DK3A 1B0GB 4U6XB 5INDA 1NDMB 4UUJA 4N0CC 3DMMC 3IS1X 1GZPB 4EI5A 2R8SH 1D5ZB 1EO7A 2VDML 5DQ9A 1BVZA 3L6FB 4I2XA 4Y4HB 2ARJA 3HFMH 3UYPA 5I9QB 5ID1A 4QF1B 2EZ0C 3MV7E 2O5ZH 5D72H 4N68A 2EIDA 4BZ1H 2X70B 4Z5RA 4MNGA 1ZLUK 2DS4A 4M6NL 1LO4L 1ZGLM 5MERB 1LO3H 4WTXA 5L0QC 3KJ4B 3MODH 5GHWH 1M7DB 1F13A 3HZYB 1U95B 1IC1A 4XBPB 4KKCD 4MVBD 4X6BB 3BXNB 3U6RB 5HGBA 1MHPL 2EYTB 1JHKL 4NYLA 5C0ND 3B2UD 2NCMA 4JVUA 1YYLL 2AVGA 2ADGA 4QXTB 1NEZB 3I6KB 2V2WB 1J1XL 2EE2A 3DRQB 1TTFA 3DHMA 5D5MB 3WS3B 5F8RC 3B6SA 2W9EH 1A4KB 3ARFA 3MQIA 5F96H 1ZWIA 4HK0B 4O2EA 1HH6A 1JPSL 3MA7A 3GSWB 2VDQL 1KPUA 4G7YH 4JHAL 4L1DA 3ARDC 1T89A 1CN4A 3O2VL 4R90H 3LKNA 4NQUA 1YN7A 1FFNA 2AXGA 1A6PA 4D9RE 1U3HD 1MQ8A 3FO9B 3H9HB 5C08A 4JQIL 1OWWA 1YNKH 2ZCLL 1H15B 3SDAA 4HCRH 3BO8B 2R2BA 3KPLB 3U82B 3BEVA 4QRQB 4PRPA 4XZUB 3F58L 3FL7A 2D7NA 4EI5D 2FSEB 4YDVB 3MUJA 3IFLH 4D0BB 3AY4A 3JWDH 5FHAL 2ENSA 3LRSB 5HHNA 3I6LE 4WHTA 4MZ2A 5EC2B 5FYKU 2LU4A 1FYTA 5ISZB 1AHWB 2QSCL 3HMXL 1RUKH 2AW2A 2FYYA 1FO0A 1E4KA 35C8H 3VG0L 3VXUB 4FP8L 3FTGB 4LRIC 5H94B 4I48A 1ZTXL 4UILL 3CVHB 1WC7B 3HC0A 4PJBA 4QTIL 4PRDA 4CKVX 1MH5A 1KN4L 2QKIA 4DUWA 2X4NA 1J0HA 4X0KA 3WIHH 4IIQA 4XWGH 3QUXB 3V79C 1FRGL 8FABB 2NY4C 1GL4B 5JIKA 5ICYB 3VRJB 2E6PA 5DJDB 1K6QL 3IKCB 1UZ6F 2X4SA 3RVVC 3LPGA 1CD9B 2IBZX 5AG9A 3ZKMC 1YEFH 1HKLL 3OB0H 4FQXC 4LCUB 3SO3C 2YZ8A 1OQXA 2IJ0C 3MUY1 2ZUSA 3LDBB 1DQDL 4ODSH 4P0DA 5D1QA 3RIAF 4M6OL 3ARFD 4GKNB 3NAAH 3RDTB 4RIRA 3UPRA 1H8SA 3BH9A 3UC0L 4OI8A 1O7SA 4YGVB 1AGEA 3PWLA 3GMOB 1HINH 4PGDA 1VEOA 3VD7A 1M7IB 4PRBB 1A6ZB 3I9GH 4OZFB 1U8HA 3OAUL 2XI9A 5TH2A 3ZE1F 3OAZK 5C08D 4QRPB 4PJFF 2BVYA 4Y5XA 3D39A 1K85A 1F58H 3SDAD 3M45A 4JPKH 2IBGA 3TBTB 5C09A 2UYLB 1G7HA 5EU3B 4RWYH 4FQ2H 4P9HC 2IGFL 1F4YH 4TUKL 5FM5O 1OCWH 1JJUA 4HJJL 3D85D 3PWVA 1LGVA 4N5ED 1CU4H 3EUUA 2XICA 4FFVC 5IHUH 4KJPD 1NCNA 1UCTA 4HQQL 3SKNA 5GS0L 3MJ9H 1HHJA 3OR6B 4Z7OE 1KLGA 1X9QA 3IDGB 3P4OB 1I7TB 1FYTD 5JQHC 3ARTA 1BAFL 3TVMC 3EO0B 3UJIH 3OXSA 4HWBL 1VKXB 2AJYL 1DBJL 2YUXA 4WWKA 1MCQA 3R8BB 4OI9A 4P23B 3AMLA 1FBIL 4L8SB 1ZA6B 1A6VL 1T1XB 3KPSB 4JFDB 3QCTH 1CZ8H 3ULUH 1PW3A 1CDHA 1R5IA 2Y36H 2OL3B 1XR9A 3RI5K 5K9OB 5J8OA 3ARWA 4PRIB 4MA3A 1YECH 1ZLWH 3NCEB 3STBA 4PJ8D 4QT5A 2QQNL 1PQZB 1C12B 1UXWA 4CUCA 5DS8A 4MDJB 4OFPA 1X6NA 4ZD3H 4NGHH 5C2UB 3DUUB 1XCQA 4KUCF 1HSBA 4PJGB 1YMMA 2MNUA 1U42A 1CD8A 3VW3L 3KR3H 3ARQA 4U6TA 5DHYB 2MKWA 4KROC 4NQVA 5MHSE 4NC0B 4GG6A 3H9ZA 4F7EA 3OX8A 2R2CA 4NCC2 4Y4FA 3IFNH 4S2SA 4EDXA 2VXTL 2FJFA 1N7ML 2MQCA 2ITDA 1GGUA 4X8XA 1J1OL 5DJ8A 1JZ8A 4R96B 3ULVL 3JWOL 2K7PA 4JM2B 3QEHA 3GSQA 5DD6B 5DJYA 4HKJB 1W0VA 1F11B 4QYOB 5FO8A 1OARH 1CD1A 3RP1A 3BPNB 4U1KB 1KGCD 3LS5H 2GTWB 4GRMB 3MRGB 3MV7A 4NZJA 5KVMC 3IDNB 2JIXA 4LU5L 1CGTA 4KUZH 15C8L 4PV9B 3MSPA 1RU9L 1LEKB 2VDOL 1R3IL 25C8L 4WWKD 2NY6B 1RIVL 4UDUB 1S7SB 4JGMA 4JGUA 1QFOA 4R7DB 3OKEA 5F7MC 3T09A 4OFDA 3KDMB 5D96C 1TMCB 1KB9K 2WBJB 1CICB 2DLEA 4JM4L 5JOEA 4UAOB 1JPSH 4XVJL 1OTTC 1RJYB 3C60C 4RGMB 3RNKA 3ZMRA 2BOBA 2DICA 3O2VH 3CVIL 2JB6B 2DQGL 2YBRB 3QIUA 1H0DA 5DJ6A 4M61A 3HNSH 3BZEA 3E8UL 2VSDA 4F58H 1UKSA 5I8OL 4J23A 5KG9A 4JFZL 1Y18B 1MAMH 3NCBB 1BFVH 3EGSB 1YMMD 1DN2A 1N0LA 5E8NA 5EU6B 3VXSB 1IT9L 1GSMA 1CGYA 4U3HA 3NN8A 3B9KC 1BVLB 4HBQA 4Q6YA 3AB0B 4ZUSB 3TIDA 5I1GH 4Y4FD 4GAGL 4JO3L 1LD9A 1KTRL 3HPJA 5DC0A 1FYHB 3O6LL 2LE9A 3M17B 4JFDE 4D8PA 2O5YH 2Z4QB 4M7LL 5F8QC 1WQVT 1Y0LA 2XYCA 1B0WA 4FP8H 1T80A 3D2UA 5KS9F 2VE6B 2HT2D 3EDEA 5F70A 4MWFB 4N8PA 2VQTA 2GFBB 1R3LA 4KPHL 3MV7D 1X5HA 4QTIH 1KN4H 3QWOA 4P4KB 5JIHA 3FN3A 2JIXD 5GSRA 3BOVA 4XC1L 2A77L 3IDJA 3GMPA 4F3FA 4EKXA 2W9LA 4FHBD 3ARVA 4GG8A 4PJGE 1IM9B 3W9EA 5DSCA 1H5BA 2VLKE 4XCYA 1MCDA 4MD4B 2NY3C 3RJDA 3RKDD 4GQ9L 5K33A 2JJSC 3KPMB 1NBQA 4JFOB