4G9DA

Crystal structure of hla b2705-kk10
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title A Molecular Basis for the Control of Preimmune Escape Variants by HIV-Specific CD8(+) T Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g9dA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4g9dA01
4DFHA 3MLUH 2QHRH 4WJ5B 3SQOH 3SCMA 1EFXA 1U93B 2IG2H 4PRBB 4XP9H 1NMAL 2Z8WC 2VDPL 3DV4B 5LKNA 3BRGC 1CICB 1G7MA 1CDBA 32C2B 2DICA 1I1YB 3KJ4C 3SKOB 1PDKA 4PV8A 4JN2B 3T8XA 4WWKA 5CCKH 4CNIB 5D7JB 3X3GH 3G5ZB 5JA8B 2F15A 3HR5A 5CIPH 3D25A 4PJDB 5ABDE 1FCCA 1BBDH 1PGRB 2OI9B 2QR0B 5FUCC 1QLEH 3GSVA 4UIMA 3FHAA 4GUPB 2R23B 3OR7B 3KPLA 5A2FA 2FHBA 1RJYA 5B22A 3MLVH 2DMBA 4U2YA 4OTXH 4U6XB 2YC1B 3D2UB 4IOFC 1U92B 1VADA 5E9DB 3ZDXF 4JFOA 4QRRB 5ISZD 4R3SA 2FX9L 1JNNL 2CQVA 5BV7H 2YA0A 1BEYL 4YZFE 1QQDA 3H6JA 4JGMA 2HFGH 5D8JL 5BOZG 3QWOA 2NTFA 4KJPD 3PWPD 3BQUC 4L5FL 1DQMH 4XTRD 1E6OH 3WIIH 5TE4L 4I48A 3OG4B 2BNUA 4DK3A 3KPPA 1BECA 1U8NA 1MRDH 4PJAE 4V3EB 5L9DH 3EW3B 2GFBA 2X10A 4ZPVA 3FAWA 5AUMB 5E8NB 4TSCH 5DJZA 2VDMH 1ZVSA 1MRFL 2VAJA 4DKFH 3MACH 3IFPA 3V0VB 2NXZB 2CKBL 4GW5A 5J12B 2XTJB 4X83A 1NKRA 2EC9T 3ARDB 1XGUB 4NRXB 5IUSA 1RZJL 4Y4KD 2NY7H 3TN0A 4AIXA 5T3XL 3ZKNC 4IRZL 4IOIA 4QHLB 1WK0A 1HH6B 2R0WL 1MJUH 4BFEA 1PSKL 4H88L 5GISH 4DK6A 1HILB 3GSUB 2DTMH 4WY7L 1NEZG 1S7WB 1GPOH 5ALBH 2BSRA 2R39A 4M8QB 1I1AA 5BMFL 2WBJA 1WISA 2QLVB 4X0KB 5E8DH 2VLRB 3MGTA 2V17L 1X3DA 1UVQA 1QVOA 1KCLA 5D1ZC 3WN5B 4ZUWA 4DCQA 3BH8A 4P5TC 4YWGL 1K5NB 4ZS7L 5I76A 4NQDE 4M5YH 1DVFB 2P46B 4YHKH 3WIFB 3P2TA 1NCBL 4N8VG 1GZPA 4FMKA 2V5MA 3OPZL 3QEQE 5CJOH 5HYSG 2XNAB 4B7LA 1IEAB 1K3ZA 3MBEC 3BHBA 1HNGA 3IDGB 3P0YH 4FFZH 3HNVL 1NUGA 4X6EA 4EEEA 1FPTH 1IBGL 4BUHA 4FQ2H 4EUPH 4PYGA 2Y5TB 4XXCC 4RMVA 2EH7H 4F9PC 3VI4E 1C5DA 2H2PC 1XIWB 2D7TH 5JOPE 3FCTA 3M17B 3T2OA 1P84J 3UTTE 3LKOA 4WHYG 4M93C 3P4NA 1PBYA 1NDGB 2OBGA 1IM3A 5CJ8A 3O4LA 4X4XB 1A7NL 3T0EE 5C0RL 2FNBA 3MUGA 3JWDH 1BIIA 1U9KA 4JREB 2E7CA 4KMQA 1T2QH 4POUB 4Y5VC 5EIVA 1JF1B 1NGXA 3ROLA 4PTUB 3BSZH 5EFIB 2AV7A 3EDJA 4IRJD 2NY6D 4UTBH 4ZUVB 4O5LL 3B9KC 5DD0H 4TVPD 2DTSA 5I19L 1UA6H 2R15A 1PX3A 2JK5A 2WANA 4MQTB 4QT5B 2VN4A 5DUBB 2Q8AH 3ULVF 4L29A 5CBEA 3S9DB 4JRXE 4RMRA 1XCQB 2V5SA 4JDVA 2B2XH 5LGJB 1YZZA 3Q2CA 2GSIB 3U0TA 5DR5L 4ETQB 6FABL 5EULV 4JRWA 2DJUA 4GRWH 2W9EL 2J8UF 1FFQA 1X6NA 4L9LC 5F7EH 4HK0B 3ZYIA 4BA8A 3D87B 1TMCB 1RZIA 5C92A 3UPRB 2PCPB 3W9DB 1LD9A 3N1MC 5DJAA 3AB0C 5IEKB 4N9GA 5MI0B 1XFPA 3VG9C 1XCTB 1E4WH 1JJUA 3GHEL 1NCWL 1T22A 1NMAH 4F15B 2VDPH 1TIUA 4Y7MA 3EUUA 1PQZB 2O26U 1G7JB 4JPKH 2BCKA 3ARPA 4NSKA 4GAGL 2J1KA 1IT9L 3RZCB 3CC5B 2QL1A 4HGKC 3RY5A 5DMJB 3NZ8A 4XTRC 4G5ZH 1D5XA 2C3XA 4LLYB 1DE4A 2X7LB 5EZIL 3M07A 5DJ6B 5GGRA 5ID1B 4CW1B 2R4SL 3LV3A 1SHMA 4HT1L 1FRGL 3AY4A 1MFAL 2A2QT 1C12A 1U3HA 2RAMA 4GRWE 1OAQL 4PJ7A 1D9KC 4PJXF 3IXTA 3PWLA 4R4BB 3WIHH 1NFIA 1SY6A 5EUOA 4Y4KC 1A6ZB 2FX9H 3CFDB 3ZKXC 1JNNH 2XA8L 1BEYH 1SVZA 3AMKA 4WTZG 2IWGA 1JNHA 2E6JA 5EU4B 5D8JH 4M7KL 1CGSL 4JHAL 3GSNB 1FL6A 3NPZB 4L5FH 4UV4L 4FXGA 5F70A 3QT2A 4KKBD 5TE4H 1DFBH 4MXQA 1KF9B 4P9HC 3UDWC 3TBVB 3NFNA 3V7MA 3AFLA 5DHYA 1PKQA 1FYTE 2DOCA 1A4JA 5C3LD 1JI2A 3QIWA 3QFJD 1MRFH 5F97E 5EZOL 3FMGL 2CKBH 3EJYD 4JFDA 2J8UB 4ZUSB 3HC0B 4RNRB 2EIBA 2P5EB 1YUHA 3AREB 4IRSB 3CU7A 3SDDD 4TTDD 3MA7A 1RZJH 4FQCL 3V0WH 1BD2A 1PZ5B 2JB5L 2ICEA 3G6JF 4DKAA 1IGJB 2JCCF 2R69L 1S7TA 1CGUA 3EAKA 4IMKA 4MNQD 1WAAA 5CEZH 1PSKH 1E6JL 2NY5H 5GZND 3EO9L 3H9SB 2A6DB 3OAZH 2C3VB 3V2AR 4LPCA 1FBIH 3UYRL 1MWAB 3ZE1F 3PDGA 5BMFH 2H26B 1WC7A 2NZ9D 3V5HB 5HHME 2KBGA 2CDFB 2Y72A 3R06B 2V17H 3QDHA 1I3RA 5JORB 2C9AA 1RI8A 3GMNB 3HS0A 4QGTA 2E9IA 3BDXA 5ADOL 4GBXA 1VERA 3D9AH 4G59A 3L3OB 1NCBH 1CFQB 1JHKL 3KXFA 3KLAB 4PJXB 3OPZH 5F72S 4L8CA 3QHFL 4DOHB 1H3XA 2F53D 4IRJC 5ITBL 3BPLB 4HGWB 4PP2A 2NY6C 2XI9A 4LVHB 3SDCA 5T3XE 2I9LA 3HNVH 2BVQB 4RWYL 4U33A 4HIXH 4LP5A 4D0BA 1IBGH 3MRDB 3DHJA 5TGBB 4YIQA 4RIRB 1MLCA 4C83A 1HHGB 4KWUA 3OAUL 5E6IB 1E4XI 4JLRA 3TNMA 3IS0X 4QRPD 1ZHLB 3GBML 1RJLA 1U8PA 4OGAC 4LHJB 3P73A 5IFHH 2F54D 1A7PL 4FA8A 4WNQB 3IDXL 2UYLB 2X4OB 4OF5A 5FIEA 5A2JH 1T20A 1KIPA 3RIAF 2YN5A 1S7XB 2FHFA 4Y4FB 1ZHNA 4M48H 3O9WB 2EC8A 4I4WB 3GMMA 4I13B 2JJVA 4U1KB 3VXME 4JJ5A 3O6KH 4GG8A 4O5LH 2E7LA 1QSFB 5I19H 1Q9LA 2VZVA 1CDIA 2R4RL 5F8RC 4NKIH 1CXFA 4FMFA 2NY4D 2ITCA 2GEEA 3F5WA 3H9HA 5F6HI 2JJWA 1W0WB 1KFAL 5EC2A 4D9QE 2XQYG 1SBSL 4N0RA 3NZHH 1A5FL 4YXHH 2A1WL 3U7WL 3LN5A 6FABH 1JGEA 4WU5B 4MLIA 3EHBD 2W9EH 5I1LB 2OK0L 3M45A 4FQXC 4FXLA 2OSLB 3SDXE 5IMKB 4QCIB 4ODUA 1XGPB 4LQFL 4MDJA 4KROC 2ZCKL 1BREA 2LE9A 4S11A 1IGTA 2IAMA 2R56H 5I8EB 1T66D 3QUMA 2VXVH 5DF0A 1JTOA 1NCWH 2J88L 3SGEI 5IJKA 1CE1L 5F7YC 1BF8A 1KIRA 4C56A 3ARBD 4ZOCA 1RZFH 3HB3D 4JFPA 4RX4A 1WFNA 3VRLE 2OL3A 5CD3A 2Z93B 3SE4A 4MD5B 1I7TA 3NIGF 1ZVHA 1AO7A 2QQKL 1TZHB 1VESA 1IT9H 3MRMB 4JVUA 5JW4N 3JV4A 1FAIH 4S1QH 3NIDE 3FTGB 4P2RD 4KKBC 2APFA 1JPGA 1P9MC 3BFOA 4X7DC 5KS9A 3KS0J 2YPKB 2Y07L 5HDOA 4M62L 5AD0B 1FRGH 1RU9L 1LEKA 3QEUB 1OB1A 1MFAH 2EDTA 3NFPB 2GAZB 5DC4B 4V3DB 2H32A 4PUBL 4OFYD 4N1HB 2EE9A 2A6JB 4HJGB 3QUZA 4S0TD 1U3ZA 4DGIL 3VXRD 5IMLB 3BWAA 4NQEA 1OAQH 1ZSDA 3DTXB 4GSDL 5J13B 5CINL 1JNJA 1JN6B 3TBSB 3SDDC 4TTDC 3IB4A 3GMPA 4ZFFA 2C4FU 2WW8A 4ELMF 2XA8H 1MNUL 3OF6D 1I8LA 3DPBA 3TIEB 1P4LB 1I7RB 1NBQA 1AKJB 3HE6D 5TDPA 3CDFA 5LBSL 3CSYA 2FIRT 2V9QA 5L8KB 4OGYL 5FK9B 3OTTA 2X1WL 3O3AB 25C8L 5GZNC 5B38G 1NUFA 1Y6KR 3N1FC 3PL6B 4K94C 3FQXA 4PJBE 5FM5O 3TBTB 3GRWL 1CDUA 4EN3C 3CJJA 3HAEA 1CFVL 5EZOH 3FMGH 4BZ2L 3IS1X 3NIFF 5JA9A 4F37K 3KYKL 4F2MB 1XH3B 4P5MA 4GRMB 2YUVA 3ULVL 3HMWL 3PHQA 4PRPB 4B7IA 2C7UB 4FQCH 1YNLH 3JTSB 4DWHA 3KJ6L 5E2JA 1P6AB 2A6KA 4UUJA 4MCYA 4FTVD 1EEUA 1E28B 4QTHB 2GITA 3RX8A 4X6BA 1E6JH 3SO3B 4E5XB 5EO9A 1MCLA 3KPSE 3OAYH 3VXPB 2GUOA 3ARFD 4P57A 3I84A 4YC2B 4U31A 1A2YA 3L7EB 3LKQA 1A7RL 3VFNA 5EZLA 5DO2D 4ZO7A 2X4NA 1UQSA 4YEFA 4HMCA 4Z7WB 1J1XL 2ORBL 1AGFB 2NX5D 1DUZB 1Q9KA 5GS1C 3QIUD 1NC4D 2IPUK 4IEFB 4OLYL 3DVIA 5E24E 4JRYA 1RD6A 3SGKC 1R3KB 4PV9A 1PEWA 4QHKI 5DWUH 4GXUM 2ZSWA 3F6IA 1CICD 5ANMB 2CMRH 5FUZL 2Z0BA 4K2UL 5ITBH 1G7PB 5F9JA 1I8MB 4KK6D 4NRYA 4C4KT 4XHQA 4ZAKB 5F1IA 1WCBA 3FJTA 1H0DA 1A1OB 1MJJA 4PGZA 5JPMB 2FX8L 4NNPH 2BERA 2NY4C 3K4AA 1OT1A 2FATH 5E5UB 3D39B 4DTGL 4PJGE 2P1YA 3JXAA 1G7LB 1MFEH 5GGUB 1Q0XH 3UTPD 3VFSB 1MCWW 2EEBA 1BIHA 2EDJA 1ZT1A 3GBMH 5MEND 1IC1A 1FNSL 1OGTB 3NABL 4FFVD 4GLRH 4RAHA 3PWJA 5J11B 3UTSB 3EHBC 2BVPB 3IDXH 3QUYB 3WV0A 5HPMB 4R90L 4OZGB 2NY3D 3KLDA 3DECA 5ETUB 2A6IB 4XP5H 3TZVB 1FGVH 1AGCB 4Z7UA 1P2CA 1TDQA 2ZSVB 5KVGH 3DGGA 2D31B 5KG9A 3S35X 1EZVX 2R4RH 3SDYH 2CK0L 3O2DH 5DVKA 2FJGB 1TZGH 2NMSA 1S7SB 3ARBC 4L8SB 4S1DC 3U46A 2FEDC 3HB3C 4W6YB 1KFAH 3VD7A 4PGCB 1T1WA 1XF5B 4GAFB 1NLDL 2A1WH 2YUZA 4R26L 4I0KA 3AS2A 4LNRB 1D5MA 5EOCH 2OK0H 2QSQA 1OQOA 1OAXH 1RZGB 5GRVL 2HFFB 4YFDB 2HG5B 4ORZC 1H8NA 4LQFH 2APBA 3TO4A 2HYMA 5EO0A 2ZCKH 2DM2A 3T4YB 4RGMC 3X3FL 2J88H 3GJEA 1NMBH 3GK8H 2AKRB 3DX7A 5LXGL 1XR8B 2AV1A 5DT1L 1M71B 2QADB 5FYKE 3KWWA 1RJCA 2OZ4H 1AJ7H 4QO1A 5E94A 2IQAA 4JKPL 4Z77B 3LRSA 1OTSD 2QQKH 3L6FA 3HE6C 2X89A 1T21B 3DARA 1YEEL 5GQBA 3MV7B 3RAJH 3T0VA 4X8JA 1UH4A 5HGBB 1RZKC 2Y07H 4M62H 2Y9RT 4X6CB 5HTSA 3MREA 4G6FD 4FG6D 2ZUTA 1CLOL 3HLAA 1N2RA 2Z91B 3PABB 4GSDH 3S37X 4ZXBD 1IAII 2CGRL 1MFBH 4K9EL 2MCG1 3NAAH 1IEBA 4Y16B 4KZEL 3VW3L 2YD4A 4UINH 4JG1L 4KKLD 2P24B 2ESVB 1RUAL 5IFJA 3PWVB 4KI1A 3N85H 1K4CA 1U8HB 2ED7A 1QR4A 3VD3A 4JAMA 1REIA 1XIWD 1FZMA 2VDRH 5J56B 1FVDA 3LSOB 5EOTB 1H3WM 1R3LB 4KTEL 1ZMYA 4U1HB 2DYPD 4Q0XL 3GRWH 3REWB 1CFVH 5DD3L 5ICXA 4WV1B 4BZ2H 2ICWI 3GSNH 4YXKL 4X8XA 1NBYB 2FBJL 1I7UB 3I6GA 4ELKB 4XHJC 3FB7B 4XAWL 3ULVH 5ENWB 4XMLL 3HMWH 3S96B 3TBWA 3QIUC 4XPAL 3KJ6H 1OW0A 3SJVA 4U2ZA 3UJTH 4MSWB 4WFGD 1BM3H 3OKYA 4RMUA 2AQ1A 1KYOJ 2NW2B 1CICC 1QA9A 4GO6B 1QACA 2J5LB 1GCFA 2CK2A 5F89B 4ZUTA 2F19L 3QR2A 3CMOL 4MAYA 3OJDA 5D7JC 3DXAB 4GG6B 4PRHA 4QRTA 1KEGH 1S8DA 3L3DA 4GAJL 4HLZG 4DEPB 4W6WB 1IE5A 1YEHL 4WHTB 4GQ9H 5C7XH 4LCYB 3DNKA 1ZVYA 3WKML 2VZ3A 3THML 5LQBL 3OKLA 4G8IB 4IDJL 3TH4T 5I1KH 2XN9D 1ZGLA 2ORBH 3GMQB 3CFIC 4X5XA 3S6CA 1LQVA 3IDUA 3TIDA 1MCQA 3VCLA 1BZ9A 4KZDH 5T1KB 4OLYH 1T04B 3U83A 3K3QA 4LF3B 4URTB 1MWAH 3N0PB 2NY3C 3U30B 3T1FA 3RGVD 3HHRB 5FUCE 3IU4L 5FUZH 3ULVE 1Q38A 3VXUE 3RTQA 4HUVA 1FZJA 1I85A 5JQ6H 1X5YA 3QNYA 2VSCA 4JM2D 1CTOA 4LL9A 2FX8H 4N0YL 1ZS8B 1R24A 5EIIB 1P5UA 3U36B 1HQ4B 1QPPA 4K8RD 2ZP0T 4DTGH 4IM8A 2ZOLB 1A7QL 2B1AH 5DVMA 4P2OD 4L3CA 3QULA 1RK0B 2A83A 2CR6A 1FV1B 1FNSH 4L3EB 2NXZC 1KPRB 2AJZB 4NM8L 3JWOC 5CS7A 4ZOAA 3GUTB 4F33A 5IB3B 3KLHC 4G9FB 4R90H 3LKPA 4LLWB 3ARGD 4HKBA 3V95A 1FORL 4YFLF 4BQ9A 1KOAA 3C08L 2UUDH 3MTRA 2RHEA 5IVZA 1I9RL 1HZHL 5EO1B 4PRDA 3WHXA 4YHLL 3GSOB 3QG7L 3W2DL 4OZIA 4G6AD 2KKQA 3VXSE 1NGYB 4KQ3L 2ERJB 5D96B 1V5JA 4I3GA 3UO1L 2AEIT 3QXDA 5MHSE 4WI4A 4HF5H 1M7IB 2P44B 4TVPL 2W0KA 1NLDH 4HAFA 1UWEH 4R26H 3RIFK 5I18L 2R2CA 5I73C 3MNWA 1ITCA 4G8GE 3WN5C 4E0RB 1N5AA 1KTDA 4FG6C 1SJXA 4GQPH 5IOPA 5BOPA 1DVFC 3FFDA 1EJ6A 4GT7A 4KVCL 4DVRL 2ICWA 4Z7VA 3CUPA 4JFEE 3B3IB 1I3VA 5LXGH 1OL0A 5ICZB 1U95B 2DI8A 4LNVA 1TETL 1MHEA 1BOGA 1U8IB 2BX5A 4F7CA 4KKLC 1FLRH 3MRPB 3GGWB 3T3PE 1RUML 3QZWB 4BJLA 5CIPA 3QG6B 3HPJB 3DUSB 1KCVL 5D6DC 4FFYH 1CL7H 1YEEH 4HK3N 5CEYA 2YD3A 3HE7D 4ONGL 3MRGA 1C5CL 1XIWC 3CPLA 3FFCB 2HKFL 5I16B 5I8KL 1P7QA 2COQA 5EB9A 1CGWA 2VAAA 4BFIB 3FN3A 4NN5B 5D6CA 3ZSSA 5F1KC 1UZ8A 4AY0A 1M6OB 3HPLB 4FQHA 3VFTA 1FG2A 4JREC 3PV6B 4UDTA 3Q5YA 1KSRA 1CXKA 4M43L 2PKDA 2JCCE 1VSCA 5T5NG 4K9EH 1Q94A 3MRRA 3NVQA 3IJYA 3JTCA 3WO4C 5JOFB 1IC5H 2R0KH 3T77A 4KZEH 2VR9A 3IGAA 4JG1H 1II4E 3EJZD 1RUAH 3KYNA 3MNZB 1T1YB 2XICA 4BQ8A 4QNPE 4ODXA 1MHHB 4OZHA 4P4KB 3JZ7A 5H2BB 5D9SA 2C1OA 2PTTB 4PDCE 4RAVB 3U1SH 1HDMA 5HGAA 4CMMA 4KTEH 4PTTB 1HYSD 1U91B 2W38A 4UDUA 2DLIA 3CFEB 3OHXA 5DD3H 4HJ0D 4XNUH 2O5XL 4ZTOH 4HMDA 4QOKB 3QHZL 4Q7DA 2FBJH 2BNQD 3BPOC 3QEQA 4LSPH 1KIUA 4PRNA 1FIGL 1TLKA 2DMKA 4PREB 4XAWH 3QWQB 1F3DH 2APWA 3E3QC 4TNWF 4XMLH 3VJ6A 3IDYC 4MGXA 1QSFD 4B0MM 4Q2ZB 4ZFOL 2XT1B 2Y6SD 2FL5A 5FA3A 4I5BB 3ABZA 5IF0B 3ZYZA 3RGVC 5DTFA 5A1AA 1EVUA 1KXVC 3G04A 3BUYA 5C08D 4KMLB 1DQLL 2F19H 1F2XK 1YEIH 2D7NA 2DQDL 2IJ0C 3CMOH 3IYLW 3RZCC 3VE0B 5BO1H 4U1SB 3FT3B 3RU8L 4GAJH 4YDJB 5IKCB 4FXKA 4Y5XC 1YEHH 1OP5H 3SE9L 4XWOD 4K8RC 4KFZC 2DBLL 1HOCA 1BOYA 5ISZE 2P48B 3WKMH 3THMH 4K3DL 1DQTA 2NY1B 3L95B 5LQBH 2HVJB 2LTQB 2H6PB 4IDJH 4XX1G 3MCLL 3C60B 1AXSA 1I8KB 2YHGA 5I1JL 2MOVA 3EYSL 3PWPE 5JDSA 5I0ZA 4ZFGL 4B50A 5JHDB 1TVBB 3CCHB 3F7RA 5C07A 5L7XL 1XGQB 4ZDHA 2D4FA 3ARGC 3L5WB 5GS0H 2YD9A 4H26B 1ES0A 4AENA 3KHOA 2PXYB 1X4YA 1QTYT 1UXSB 4AIOA 2DLGA 2FX7L 1CZ8L 4PY7B 1D5IH 3AAZB 5FDWA 1AD9A 5IM7B 1P7KB 1SEQL 4EUPA 2EE3A 1KJMA 2CDEA 2F74B 3RDTB 8FABB 1T03L 2B39A 1I9IH 1U36A 3LQZB 1F6AA 2IANB 5F7WC 1A7QH 4MQXD 5DD6B 1ACZA 5C2UB 3EDEA 1F4WL 1MFCL 2VKXA 5EU6B 4M9PA 5D5MA 5HHQB 1XMWA 3WNMA 2V5YA 1Z3GH 4MXWH 4XGZA 4BH8A 5ICYA 3CGTA 1A21A 3AREC 3HZVA 4IRSC 5DUPL 1ZXQA 1RMFH 3ULSB 1FORH 2IALA 3BN9C 5D2LA 3C08H 3TCLA 3A67H 1ZV5A 4R96A 2JB6A 4Z5RB 1HZHH 1SJVA 4YHLH 3MO1B 3NIGE 1UWGL 1AKJD 1J0YA 3W2DH 5KSBA 3WLBA 4JFXA 1OCWH 2H9GA 1LEGA 4OKVA 3C6LD 3KPMA 2BHYA 1UCBL 3DUUA 4KJYB 4IHOB 2WWKO 3KHQA 4CVXB 4QWWC 4TVPH 3V6FB 2DDQL 4OJFL 3N9GL 1WFOA 5IG7A 3HE7C 2LFGA 3FONA 5BQ7B 2WBWB 4PGBB 5DEGB 1OHQA 3UJJH 4XP1H 1FL5A 1QRNB 2HT3C 3HRZA 4WW2F 4ELME 2XZZA 4TUOA 5FOBA 4KVCH 5C8JB 1SYVA 4XNMA 3O45A 4X4YA 3O3BB 4UQ2A 3P0VL 4UU9B 2UWEE 1Q1JH 1NFDA 3EOAA 1TETH 4PJIF 4LVHC 1P53A 3MUHL 4ZUUB 1S9WB 1FYTA 3EJZC 4K71B 2X4QB 4PR5B 3BP6B 4ALAH 5E8PB 1PG7L 5E5MB 4NC1C 2FBOJ 1C5CH 1CFBA 2HKFH 5I8KH 2VNCA 1EVTC 3OX8B 4HIHA 1A9BB 4YDKL 4N0UB 4TVPE 3FQTB 3GIZL 1JZ5A 1ND0B 2DLFH 5C0FA 5I1HL 4HJ0C 5D1QA 4X5LA 1R5IA 3I85A 4KKCD 5K9KB 4P3DA 1N8ZB 1WVZA 4M43H 4WO4B 4NO5A 5MP6L 4KVNL 3KNBA 3O9WC 4NKDA 4OBRA 3F8UB 4AIZA 3GSWA 4JM2F 2FGWL 3F7VA 3FOLB 3U4BH 5DFVD 3QI9D 2EO9A 3U7AA 1CVRA 1IGCL 2L7JA 1V3MA 1DLHB 3F62A 4EOWH 5DRXB 4Z18A 1U0QA 5FA4B 1ZHBA 3BEWA 1MQ8A 4JKLA 5LAXA 3VFMA 1YY8A 2Q8BH 4CL7A 3OXRA 1G9MH 3IKCA 4HIJA 1TQBB 2CKBA 3VFPB 3FRUB 4XWOC 4QRSA 4AEIL 3O4OB 2G75B 3QHZH 1EHNA 2QQQA 5FECA 4X6DE 2O5ZL 5HVHB 5DMYA 2R2HA 1KCKA 1YPZB 1NDMB 1RZKL 1ED3B 5I30H 3FQNA 1FIGH 3UP1A 3TZVD 4PRIB 3RWGB 5D7LA 5F96H 4WW2B 5B39G 3VWJA 5DDHA 4LDEB 4Z95H 2HMID 2EZ0D 1X5IA 5FO7A 4O2FB 4JANB 5AYUL 4QY8B 1WJ3A 4Y2DA 5FB8B 2E7BA 5I1AB 1KLGB 1MI5D 4HWBL 3QIBB 5HHVH 5TH2A 4NNYA 2DQDH 3Q6GL 4RFOL 1EFXB 3RU8H 5SWSD 1A3LH 2C4XA 4GW4A 4U1LA 3R4DA 5IWLA 3EJJX 3VWKD 4ZNEE 5A3IC 5E70A 1I9EA 3BT2L 1G7MB 1HKFA 1QKZH 3C2SA 4JE4B 5C1MB 2ZUYA 5JW3L 3VXMA 3S4SG 4RDQG 2D2OA 3MV9B 2AXHA 2DM3A 3G5YA 4AEHL 4XVUD 3HR5B 3ROOB 4ZOEA 3CXHK 5H37H 4P59L 3VFGL 3D85A 3GSVB 4UIMB 4MQSB 2FX7H 1CZ8H 4J4PC 3KPLB 5ACMA 1EZVY 5J9PA 1AI1L 1Q72L 3QFJE 3OAYK 2GJ6D 3DMMD 1RJYB 1SEQH 1A14H 4HZAA 3LPGA 1K2DB 3QJHA 3MV7D 1NGWB 2ID5A 1MIMH 3Q3GA 3C09B 2E27H 3JVGC 4JFOB 4R0LC 1NUDA 4R3SB 1F4WH 5CHNA 2VUOA 5HPOA 4LMQI 2PTVA 3V5KA 1JHTB 3TT3L 1X5JA 5C0AD 3QWOB 4V1DD 4WUUD 5LCVH 4YAQB 2DQTL 3GMLA 4MNQE 5F6IB 4RGND 1S3KL 2X6MA 3RNQA 3CDCA 3VDCA 3PP3H 2R29L 2BNUB 4D9LL 3KPPB 3S88L 1QLFB 1U8NB 1VA9A 3U82B 3C5ZD 4WUKL 4HWEL 1I7ZB 4NQCA 2WZPD 1UWGH 1ZVSB 4GRLA 2F5AL 4XP4H 5JXED 3TPUE 4GW5B 2C3HA 2VLJD 5HD8D 3HI6H 4DVBA 3V52L 1NC2B 1CTNA 1E27B 3TN0B 2VC2L 3QNXB 4KRPB 4YC2C 5E99L 5SWZA 4DQOH 4KKNA 5KOVC 1O7VA 4IOIB 5GS0C 5JO5B 4PPTA 3MRLA 1MCIA 1XZ0A 1H5BA 2F53E 5I66A 3GZKA 3MRFB 4Z7QF 1KEMH 1HE7A 4HXBH 1Z5LB 3D1MC 5DJ0B 4LVEA 3P40A 1GC1C 1NGPL 3ZT6A 3BIKB 4KJQD 3JWOL 2GKIA 2BSRB 1I1AB 1EXUA 4YHIA 2WBJB 3WFEL 2VXQH 2MTPA 1MF2L 4LDOB 3MGTB 4EBQL 1UVQB 1N0XL 4GJTB 4QRPE 1FZOA 4ZUWB 1JZ6A 2ICES 4ZAKC 2VH5H 5DFVC 2F54E 4GLRI 4WJ5A 5KSAB 4P5KB 4PRBA 5E08H 5KAQG 3DV4A 3EYQC 4M3KB 1GZPB 2P8LB 4HUXA 5GGTH 1I1YA 4MVBC 2J6EH 1EUTA 2J4WL 5C6TL 4LCWD 3BHBB 4JN2A 4GMSL 5J11C 1YEDB 3GIZH 3N1PC 4CNIA 1V3KA 4LRIC 5I1HH 4NZRL 3BP4A 2X05A 5DFWH 5MP6H 1JL8A 3TZVC 1C5DB 2OI9A 3FCTB 2R23A 4GUPA 3KPSA 4QHNA 4K23L 3OR7A 5I1EL 2EZ0C 3LKOB 3P4NB 1RULH 4JZJC 1JP5A 3QDJD 5DHVB 3NCFB 3O4LB 5GXBB 4U6XA 2YC1A 3D2UA 3L7FB 4PJHF 5EBMA 3GSXA 3VG0L 5E9DA 1NGXB 1U8KB 3QBTB 4UIKH 4QRRA 3ROLB 1TZIB 2AV7B 2NXYB 5KZCD 2EYTA 3U2SA 2W91A 1HH9A 3NCCB 4NZJA 2JK5B 3VWKC 1LO4L 4AEIH 1FH5L 4PY8I 4J1UA 4OFPA 3WDHA 3ULUD 3TA3A 4UOW1 1QFOA 4Y5YB 3A6BL 4BSWB 1EHXA 3K0WA 4K3HA 1NCTA 3MJGX 2YRZA 4EIGB 4C4KO 1CXIA 3BVNA 3ETBF 5AUMA 5E8NA 2CRIA 4JDVB 4NDMB 4P2RE 2ZCLL 2LVEA 3DRTA 4XVUC 1DBKH 3U0TB 4N90D 5FO9B 1BFOA 2QADC 4P2QB 3LPFA 4Y1AB 1I1FA 4JFZH 3RVTD 1J8HB 1NQBA 4PJGA 1S5HB 3PJSA 3BZFA 2Z31B 2AK1L 3L3IB 2EDBA 2HRPL 5DJAB 4N9GB 3Q6GH 3VXRE 4MZ3A 5DVNA 3WYRA 1C5BL 1HQRA 3UAJC 1YDPA 4QHLA 3T0DA 1AGDA 1NGQH 3GJFH 2AK4D 1F4XL 2BVUA 1SM3L 3BT2H 4UT7L 1QO3A 5L2KD 3RVXC 4GOSA 4PB9H 2BCKB 3HNSL 2OR9L 2IADB 1CVSC 4AEHH 3VH8G 5HDBE 3NZ8B 4ZO8A 1MCOL 1FHGA 1D5XB 1DE4B 4ZO6A 4X0KA 2VLRA 2A77L 5GGRB 3HZYB 4Y19D 5ESAB 4JHWH 2QSTA 2Z35B 3VFGH 2N4IA 1JFMA 1G9MC 3QSKB 4XNYL 4XH2A 3BWUC 1K5NA 1AI1H 1GHFH 1OAKL 1C12B 1J0IA 3CH1A 3DLQR 5CLTA 4MA7L 3ERYA 4PJ7B 3QDAA 4L8BB 3T04D 4J3OC 4G43A 5TE7L 3HUJF 1ORSA 3O3EB 5EUOB 3LEVL 3RKDC 1IEAA 1XF3A 2MFNA 3GMOA 4XPHL 3GNML 2ED9A 4M5ZL 4JKMA 3DBXB 4C55A 4WV1C 4E41A 3O2WL 4FTVE 1AR2A 2DQTH 3BKCL 3DX9A 1FL6B 3HC3L 4FXGB 3KS0H 3SKMA 4PJ8D 1CGTA 3S88H 2X4PB 3G5XA 1IC7H 4AJ0A 3VXTA 1RZ8B 5DRNB 5DHYB 1PKQB 4CAGA 3O6FA 4KJQC 3IDIA 1CDJA 3QIWB 2F5AH 4X4XA 1IKNA 2E8YA 2Q7NA 3WJLA 4FP8L 4JFDB 1IM9A 1JF1A 1T5XA 3ZTJG 2OTPA 1YUHB 2Y4SA 2NX5E 1JCKA 1LDPH 3V52H 3LIZL 3MA7B 5J89A 1IEHA 2VC2H 3TFKA 1BD2B 4ZUVA 4UT9L 2ICEB 1N64L 1ZWIA 4K3EL 2B0SH 4QT5A 5DUBA 5SWQA 2F8OA 5GRZA 4I0CC 1PEZA 2HT4D 2VB5A 4Q9QL 3LN4B 4PJ9A 1XCQA 2A9ML 2BSTA 2UUDK 3ZL4L 3P30H 5LGJA 3GB7A 1NGPH 1UENA 1P1ZB 4LU5H 5MERA 3U30C 2M2DA 4G7VH 3V6ZB 1WC7B 4RA0C 2OZ4A 1TMCA 4EBQH 3UPRA 1RFDL 2PCPA 4HKXA 3UTPE 1I3RB 3W9DA 1N0XH 2DQIL 4FQJL 5GZOC 5IEKA 2VZ1A 5MENE 2IBZX 1B0WA 1EAJA 2NY2B 1OQXA 3TF7A 2VISB 3ZZ1A 4GBXB 2H3NB 3GIVA 3UYPA 3MLRL 3HTLX 2JJTC 1KNOB 1IAOA 2NY1D 5K33A 1KB5L 1AC0A 4PP2B 3L5HA 1G7JA 5C6TH 1HN1A 1TCRA 2I9LB 4FQQA 1QSEB 2VR4A 1NCCH 1J7VR 4XC3L 5JHDD 3CC5A 4NZRH 4DUVA 2GCYA 4D0BB 4UNVA 4P9ML 3KPNB 3C5JA 4RZCA 3I50H 5DC9B 4YIQB 3QWRA 4PG2A 4CW1A 3TLRA 2P8MA 3BIAX 3FZUD 5I1EH 4J23A 1LQSR 4LMQE 4JLRB 3TNMB 1E4KC 1RJLB 1U8PB 3WUWA 2E7HA 3H3PL 1XGTB 3BW9B 3TJHD 1JRHH 2F8XC 4R4BA 1T20B 2BNRA 5D96C 1KIPB 5KSUA 5C2BH 2X4SB 1ZHNB 3LPWA 1A6ZA 1LO0L 4GKOA 4OQTL 3CFDA 1QD0A 1JGDB 4JO2L 5IB2A 5BRZD 2ZUQB 3GRWA 2AERT 4W6XB 4JJ5B 3U6RA 2VE6B 1JZ3A 2MKLC 1GRWA 3DSNA 4GG8B 2HWZL 5EU4A 1KCRL 3LRGA 1A4KA 2K7PA 4A2LA 2EDFA 4E9LA 3X11B 1LO4H 1FH5H 1B6DA 2VDOL 4NO3B 4EI6A 1JYNA 4FNLH 3A6BH 3F5WB 5D4QA 2P43B 3TYGL 1GXEA 4KRNA 3TBVA 3WD5H 5EC2B 3W39A 2XACC 2BSED 2Q7YB 2DF3A 2ZPKH 3LN5B 1CL7I 1JGEB 4PGEA 4RWHA 2J8UA 4ZUSA 3HC0A 4N68A 2P5EA 2X2YA 3PNWA 2YRPA 5CUSH 3VMOA 4D0CA 4ODUB 2HRPH 3VGHA 5T5NF 3RIAK 2ILLA 1UJ3B 1PZ5A 4YBLB 5EOQL 2APXA 5IMOA 1FNAA 2IAMB 4XAKD 1C5BH 4AH2A 5J6HB 1NSNL 1SM3H 1KIRB 4UT7H 1MFNA 5CILL 4JFQA 4JY6A 4JFPB 1NMCB 4LSDA 3BRDA 2A6DA 5CD3B 3ALWA 3BGMB 3NCYS 1OLLA 5DMIL 3ZE2E 3HNSH 3ARWA 1AO7B 3B5HA 2OR9H 4OQ1A 3JV4B 5HHOB 1RUKL 4HCRL 1MCOH 5CJBA 1FNLA 4PJ8C 3JTTA 5KS9B 2GK0A 2YPLB 3ZTNH 5AZEL 4YFEA 4OUUA 4OLZH 5A2KH 1KT2B 3GMNA 4S1RH 2CR3A 4MD4A 2H32B 3TVMD 1ZK9A 2WQ8A 3K4ZA 3QUZB 4OSUL 1RIVL 4NQEB 1ZSDB 2MQCA 4PJXA 1OP5K 5HGDA 3O8XB 1T83C 4M3JA 4HJJL 3B9DA 5HI4C 3IFNH 4ZFFB 4HGWA 4GH7B 3TWCL 1LHZA 1QBML 4I77L 4WFGE 4E42B 4LAQL 2B5IC 3QPQD 4M5ZH 3FO2A 1MY7A 1B2WH 2Y06H 3HC3H 4PJ5D 3CSYB 4WEMB 3MV8D 2IH1A 5TGBA 3FN0H 4IJ3B 3VD4A 1JYXA 2Q1EA 1OP9A 4FHBD 4RIRA 3X12B 3SE8L 1HHGA 1K4DB 3CLEH 4PJIE 3MUJA 3FOMB 5E7BA 5E6IA 4Z0XB 2YEZA 3FQXB 3SKJL 1ZHLA 4Q6YA 2E5EA 4CVZA 3O6LH 1D6VL 1ERNA 3HAEB 2X4OA 1U2HA 4CBPA 2X42A 2RCSL 1S7XA 4Y4FA 1XF1A 4NGHL 2XN9E 2Y36H 4BK4A 2DQJL 4HH8A 3LIZH 2Q86A 3PHQB 3SBWC 3W11D 1RJZB 3G6JA 3ULUF 4UILL 1N64H 2NNAA 2WP3T 4U6HB 4YUEH 1KTLB 1L6ZA 4UUJB 2JCCA 4MCYB 4PJCF 2BVTA 3RWCA 2NY1C 4Q9QH 1WTLA 2EICA 4NP4L 4DN4H 4JPIA 4JCLA 1QUNA 5EO9B 2OM5A 2GUOB 1N6VA 2A9MH 4P57B 2KDGA 1S5IL 5JUEL 3VXQB 3MR9B 3WFCH 4WU5A 4XNXH 4MXVE 3VFNB 4ZO9A 2PXYC 5EZLB 4OCMC 5C09B 2X4NB 5IMKA 4QCIA 1UQSB 3FZUC 2DQIH 1YYLH 2X1XR 3SCMD 1CS6A 2K7QA 3B83A 5I8EA 4MA1B 3HG1A 2QQNL 4MJ6A 3MJ6A 1DCLA 2R0LL 1JTPA 3B4NA 3RDTC 4PV9B 4XCNB 2ZSWB 5C0EB 1AP2A 1HXYB 1LO2L 2MNUA 5E2UL 2Z93A 5DGRA 3T09A 1FZKB 3RPKA 4WWKD 1TZHA 3MRMA 4LVOB 1WCBB 2DIJA 1H0DB 2DQUL 1MJJB 1GH7A 5B3NA 4P9MH 3RL1A 3QQ3B 3OJVC 4X4ME 1URLA 1FGNL 2YPKA 3C5SA 5ALCL 4TYUA 3QEUA 4LIQL 1GL4B 3I3BA 2D03L 3NFPA 4YK4B 4HKJB 4EXPX 1ZT1B 2VTFA 1GC1L 3PWJB 3H3PH 5IMLA 1KCSH 4CU8A 3RA7L 3QCVL 2I07B 3EGSB 1YEJL 1LO0H 5A2IH 4P2CG 2HKHL 3MRBA 4P99A 1R5VB 1TJGH 2JIXB 1P4LA 3DGGB 5KG9B 1J18A 3CVIL 4QHUB 5DHVH 2VDOH 4OF8A 1ZAGA 3FB5B 4N8PA 5FK9A 3STLA 3O3AA 3TYGH 4LSSL 4F3FA 1LNUA 3QO0B 3PL6A 4IDLA 4M1GL 5IBUB 5MEOA 1T1WB 5DK0B 1BF2A 3TYFB 4WTWA 1LO3H 1VDGA 1Z9SA 1AHWC 1UYWL 5D1XB 3T2NH 1PJ9A 1E0OB 3VD5A 4RGOH 3SKNB 3TO4B 5I2IB 3DETD 1CFNA 4JN1L 4K71C 5EO0B 3TN0D 1DDHB 3ES6A 2HLAA 1AQKL 1MHPL 5EOQH 5HDQL 1RSFA 5CSGA 3GJEB 1LO5A 1X5HA 3DX7B 2AV1B 3B9AA 4RRPA 3KWWB 3WNKA 5CILH 3PXHA 4WI3A 3S8WA 5E94B 3VXPA 2IQAB 3OZ9H 1P84K 4JPVL 3WS6C 5DMIH 4Z7OF 3L6FB 2DL9A 1I1AD 1YYML 1RUKH 1NCAL 2WBJD 3L7EA 3PWUB 5DMKA 5KN5A 4X8JB 2UVEA 3WNNA 3IRPX 4Z7WA 1AGFA 2IFGA 4NHCL 1Z0MA 3C2AL 3LDBB 4OSUH 1N2RB 1RIVH 1TJHH 2IPKB 2BNQE 2D7PA 3QO1A 1MVUA 5FGBC 1MCBA 4XMPL 5GS3A 3P77B 4R7NB 5LG1A 4I0PB 4Z7QE 3TEUA 1T6WA 1FVCA 4ELMA 1T80A 3UBXG 1QSFE 2PNDA 3W11C 1TQBC 4POZC 4XXDA 3RWEA 5IFJB 2ZKHH 2ADFH 4LSQL 5FKPB 1FVEA 5HVHC 4KGLA 1K4CB 5C08E 3D39A 1FZMB 2PYEB 3SE8H 1G7LA 1X5AA 3ZYJA 3V6OE 1YY9D 4BQBA 1OGTA 4KHTL 5IB1A 3QPXL 1P7HL 4TSAL 4BSJA 3QUYA 5HPMA 4RDQF 15C8H 5GRWA 5EBWB 2RCSH 4AYFA 4NGHH 3I6GB 2DQJH 2A6IA 2KQMA 3GDBA 3FL7A 1A3RL 3LN9A 4UT6L 4L4VD 4LLMB 3N50A 3SCMC 3TBWB 2ZSVA 4NHUA 2D31A 1GIGL 3SJVB 5BS0D 2IC2A 3CIQA 4MA3B 3EYFA 2FJGA 1DSFL 2AABL 1S7SA 5JMRA 4JQVA 1MSPA 3BPCA 4WEBL 1QA9B 2HTLD 2OX5A 1DEEA 4XBGA 4BFGA 1CR9L 5EIQA 4WWKC 4PGCA 4MAYB 3OJDB 4I2XE 3LH2H 1S5IH 5JUEH 4OIIL 4QRTB 4NUGH 1S8DB 3L3DB 4LNRA 4JFFD 3MQIA 2HJLB 4KH2A 1AY1L 2HFFA 2HG5A 1BP3B 2VXSL 3D48R 1IFHH 3OKLB 5F7LB 3GMRB 4NRZB 4YZFF 5FYJU 3PHOB 3RJQB 4X5XB 4PJEB 3VCLB 3ESVF 2AJXL 5F9AC 3T4YA 4EXKA 2QQNH 1UFUA 2R0LH 4ZQKA 1XR8A 4KHXL 1M71A 4O58L 4OI7A 5GHWH 3RTQB 5I8CA 1JWUB 4P3CL 2CLVA 4MB3A 4Z77A 4BUGA 2WSKA 2F5BL 3VFUB 4AZ8A 2VDQH 1QSZA 5F6IC 4NWUL 2BFVL 3QNYB 3QEHB 1RVFH 1R24B 4C54A 5HGBA 1FGNH 1S7QB 5C0BD 2OCFD 5ALCH 3GHBL 4L3CB 1X6LA 3QULB 4J7RA 4OCRH 2F9BT 2R2EB 5TPWL 3AXLB 1U3HD 4P46B 5CBAA 4F33B 4N5UA 3NGBB 5EU5A 1CQKA 3QCVH 3WXVH 1YA5A 4HKBB 4HLZH 5KVDL 3TN0C 3L1OH 4HUUA 5IVZB 2P24A 3EKCA 1JK8A 3CVIH 4K7PL 1FSKC 1G6RL 1QHOA 4OZIB 1C8PA 5T33L 3IVKB 4GXVL 4LHUG 1U8HA 1PZUB 2XPGB 5KAQF 4OI9A 1R3LA 1EEYA 4M7LH 4M1GH 5KJRL 3QXDB 4MNGE 1X5FA 2X9YA 1I1AC 2WBJC 5DUMH 2HTKD 3ULUL 1GAFL 1G9NC 1T5WB 1NBYA 1UYWH 3MNWB 3MXVL 4XRCA 1UT9A 1IAKB 2QTEA 1OSPL 4CMHB 4LIQE 4NO0B 1MAJA 3HUJE 4J3UA 1KTDB 5FYJD 3S96A 4NCDA 1MHPH 1PY9A 5E2WH 1F3JB 2G60L 3SDAB 4MSWA 2ZUXA 2UZIL 1QYGL 3CVHL 3K2UL 4DKDC 5CKGA 4N0CA 3MFFA 4HWZA 3V0AC 4HGMA 4PJAB 4X9GA 1MHEB 1BOGB 5F89A 1IGIL 3DXAA 3AS0A 5GGRY 1YYMH 5IW6B 3UJIH 3MLWH 2V2WA 4P0DA 4NCC2 1B4JH 3CPLB 5CP3A 4LCYA 4MMZC 1NGZA 4YPJA 5EU7C 1A6PA 3GMQA 4LSRL 4NHCH 4XNZC 3BYYA 1SEBA 3C2AH 5T1KA 2B4CL 4FQHB 4APQB 4B5EA 4LF3A 3KYOB 1WWBX 4UB0L 4UDTB 3KXFD 3UZEA 7FABL 2VJXA 5JHLL 1Q94B 3MRRB 4M61A 1CD8A 1J11A 1GOGA 3SDCD 3GBNL 4GAYB 4Y8AA 3SOBL 1BLNB 1KELH 3IGAB 4O2CA 5GRUL 5IIEB 2IPUG 2H32H 2QEJA 3PDOA 1MI5E 5EIIA 1BHGA 1L7IL 5IMMB 3I02A 4ODXB 3J8F7 1N4XL 2HTLC 3Q48A 4M6OL 2NTSP 1XGRB 5E8EB 3STBA 2F54A 1FV1A 5SWSE 4BK5A 4KHTH 2QSCL 3QPXH 4NQDB 3EOBA 1KPRA 1UGNA 1T4KA 3GUTA 3OHXB 5IB3A 5GS2D 2DQHH 4LLWA 1G1CA 1U8JB 3QEQB 4PRNB 4L1DA 3NTCL 5HVWA 3GKWL 3VJ6B 1A3RH 2V6HA 5EO1A 4KUCD 4ETYA 3GSOA 3ZKMD 1GIGH 1MRCH 1LP9F 3ILPA 3PGCB 4H8WH 4U1GC 3HAEH 1AFVH 4JB9H 1QR1B 5DTFB 1DSFH 3SGJA 2AABH 2VXUH 1JF5A 2MSPA 1ZT4B 4WEBH 2EE2A 2O5YL 3G04B 1EBPA 5FM4A 1CR9H 3UTTB 2GJ6E 3GI8H 3WSQL 5E6YA 5C0CD 3H3KA 1HINL 4OIIH 5CP7A 3MV7E 1CU4L 1OM3L 3T0EB 4FXKB 1PLGH 4TVSa 5CMAB 2DQGL 2V2XA 4C58B 1HOCB 1AY1H 3F65A 2ADIA 3AY4C 2VXSH 3NH7L 4E0RA 2IH3B 3VXNA 2JKXA 3VFOA 1A8JH 5C0AE 4WUUE 1QBBA 5FHBH 1S9XA 5JDSB 1U3HC 2AJVL 4RGNE 4TNWK 1MREH 1WWCA 4YHNA 1L8JA 5F9OL 1MVFA 5C07B 3MRHA 4KHXH 5GGTA 5ICZA 5L8JB 1U95A 4O58H 4C56D 2J6EA 1ES0B 2ICCA 1HWGB 4JRXB 1U8IA 2DD8L 5ESVB 4P3CH 3X13A 2F5BH 5FDWB 3MJ9L 1AD9B 4NWUH 2BFVH 4IMLA 3DUSA 5IHZA 5KANI 1KTKE 4EUPB 3LS4L 1BQHG 2VLJE 2P47B 4MXQC 3MLYL 1UM4L 2PW1B 4KMTL 1F6AB 4F7PA 3GHBH 3L3HA 5GJSL 4OLUH 4NBZB 1CXLA 2VKWA 3VXRA 3IFLL 3PV6A 4NQED 1A7OL 1OTTD 1NEZA 5B4MD 4BH8B 3HZVB 4OV5B 3MXWL 3OF6A 4M1DH 3VH8B 4O51A 5KVDH 3QDMD 3TCLB 5JOFA 4TNVK 4R96B 2YMXL 5FYLH 4S10A 4M00A 1G6RH 4NJ9H 5KSBB 1MH5A 3RUGE 3WLBB 3GEWB 4IMKC 2YA1A 5AAMA 1MHHA 4A6YB 3VGFA 4CVUA 2H9GB 4P4KA 4XNQA 4OKVB 5H35B 2WMPA 5FCUL 1FP5A 3KPRD 4GG6E 4NBXB 4N8VA 5KJRH 2WIIB 1UG9A 5HYSA 1FFPA 3CFEA 1BX2A 4W4OA 2NZIA 4GRWB 3ULUH 1GAFH 1YEGH 4QOKA 5IG7B 1JUFB 4HWBA 4Q9BA 1H15B 1OSPH 5AEAA 4LCWE 3L3JA 3ILQD 1FL5B 4EZMA 4NIKB 4WEUD 2NY2C 3HRZB 1ZGLP 1DL7L 4AEEA 1JBJA 4JY5L 4K07A 4Q2ZA 4TUOB 4GBXC 5J6GA 2ZG2A 4I5BA 4ZSOE 3GJFA 5IF0A 1QYGH 1TTUA 4UQ2B 3CVHH 3K2UH 1MLBA 3D3VD 3GSRA 3WJJA 3C8HA 4J3SA 2VR5A 3ARFA 3H7LA 3SDCC 4OCXL 4JKKA 4OIBA 3FB6A 1G7QA 1FYTB 1BFSA 3QDJE 3RPIA 4ODWA 5IROA 5IKCA 4ODBD 4XX1E 1JRHI 4OCYL 2PN5A 2X4UA 5L2JA 1WITA 2NX5A 3L95A 4Y4HB 4HIHB 4XVTL 1CK0H 3C60A 5I71C 3QIUA 1NC4A 2XZCL 3P9MA 1I8KA 1INDH 3IETA 4XC1H 2JELL 2V9TA 2B4CH 5C0FB 4R8WL 1TVBA 4JRYD 5D1QB 1ZLSL 3ULUE 1R5IB 5C0JB 4P3DB 4QF1B 1U42A 1R3JB 1F90H 1GGTA 4JFHD 4NO5B 3CSBA 4PJCE 3WS3A 2MPAH 2A74A 4R2GB 4J3XA 2ZUQC 1ZLVH 3DX6B 5CJ5A 4PY7A 1ZHKB 2E7LC 4LP4A 4MA8L 3ZKMC 4N90E 1J5OL 1P7KA 4HS3A 3MBXH 4CGTA 5LWYH 4YGVB 2XG4A 4KK9C 1P69B 1W0YT 1L7IH 1KJ2L 5DEZA 1N4XH 5HHMB 3DVFA 8FABA 3SDXF 1ZHBB 3BEWB 2LQRA 3RVWC 5LAXB 3VFMB 1QP1A 1YY8B 3KPTA 4G6JL 3B2UD 5HHQA 2QSCH 3IKCB 1DLFL 4U6VH 4WI8A 5FF6B 2CKBB 5I9QB 4HFWA 5T1DH 2AK4E 3I6LE 4R4FL 3MCG1 3EYUH 1KC5L 3ALPA 4K7FA 5L2KE 3OQ3B 2R2HB 4MD0A 3FQNB 1D5BA 2DQEH 4U0RC 3GKWH 4YBLC 2JE8A 5D7LB 1DN0A 2IAMC 1INQA 3MLXL 1KB9J 3AS3A 3CH8A 3U0WL 5FO7B 3NIDF 2EDKA 4NZUL 5IJKC 1Y0LB 3OL2A 4Y19E 3MRNA 4WTXA 1BJ1J 3ARTA 4CU7A 1NMCC 5L6YL 3BD5A 4L4TA 3VGBA 3O2VL 1CDHA 5TH2B 2ADGB 2LU7A 4H1LG 3SE4C 5IHUH 4XPBL 3MRJA 2EH8L 3BH9A 5E0QA 3MLZL 1HINH 2PETA 1I3GH 4XCCL 1WV7T 5IT2L 1OM3H 3QCTL 4GW4B 4WI5A 4WTZA 1F13A 5CZVL 5BQ7A 1CT8A 3WXWH 2VLMD 2ENYA 5DQDL 5KW9H 1MCWM 3NH7H 4ZMAT 1V7ML 3VXMB 2W0FA 3QUZC 3G08A 2GTWB 4LHUD 4TULL 1R3HA 5DVOA 5C8JA 3IXAA 5AWNL 4MJ2A 2Q87A 1OTTC 4MB4A 1EEZA 1H3UA 4UU9A 5B4MC 1A1MB 1UB5A 3PV7A 2G9HA 4W4NA 1YEKL 4FRWA 3D85B 4NN6C 1I8LC 4PJBF 4NFDA 1S9WA 2DAVA 3MOBL 3LQAH 1P4BL 1T89A 3MJ9H 2AJYH 5MHSD 2ADJA 3WKNA 3BP6A 5E8PA 4P4RA 1P4IL 3OWEA 4Q6IA 1EO8L 2AJSH 4IJ3C 5E5MA 5I8OL 3Q3GB 3FT2A 3C6SA 5JQHC 2B1HL 3SDXB 4W70A 1U8LA 2FLRT 1A9BA 2OJZH 3RWHA 2E6PA 3FQTA 5GJSH 5EUKB 4IIQA 5J0BA 5JIIA 4Y89A 1BBJA 1ND0A 1V3LA 2NR6C 4NN7B 1VFUA 3MX0A 4ZXBA 1K8IB 5EZJA 2ARWA 3IFLH 4R4NC 1EMTL 1WQVT 2XQBL 1KYOK 3T0BA 4WO4A 2CJUL 1H8OA 1J9CT 3RNQB 3VDAA 2XFXA 3AU1A 3WLWC 1MAMH 3MXWH 1WTGT 3PQYD 5D1ZD 4I3SL 4P5TD 5GSVA 4QYOB 2YMXH 5JW4M 1VFOA 2GK2A 4DGVL 3BZ4B 1A6TA 4M4RA 2UV3A 4HC1L 4QLRA 5GGQL 1AGEA 2FIKB 4NKOA 1IQWH 5FA4A 3QAZC 3QUXA 5FCUH 3VFVA 3WCYA 4J3TA 1ROWA 2R9HC 5CSZB 3NN8B 5SWZB 1C08A 4LPTA 2HN7B 3HA0A 3FRUA 5DJCA 1F4YL 5K59E 1A3QA 3MRLB 4HDIA 4M6ML 1XZ0B 1F5WA 1H5BB 1NDMA 4H0IA 4LARL 4A6YL 5I66B 4XCYB 4KUCF 2H2PD 3BESR 3RWGA 5I6XB 4WW2A 3LZFL 4O4YH 1BZ7B 1DL7H 2KUTA 5JHDE 4MA1C 1HIML 4JY5H 2R0ZL 2X9XA 2JF1A 4MCZB 5FB8A 2P5WD 1EXUB 1QNZL 1KLGA 4YHIB 5I1AA 1YECH 4LKXA 3QIBA 3N1QC 4PJIA 4OCXH 1BVLA 2WINA 1HKLL 1Q9OB 3SGDH 4HIEB 4PRHD 2HH0H 1F97A 3B9KD 3MPCA 2YZ1A 4OCYH 4WI2A 3WFDL 5K9OA 2DLTA 3TCXA 1OWWA 3GBLA 4HUXB 1C1EL 1QLRA 5EU6E 2C4FT 5TQ2L 5BRZE 5D72L 4XVTH 4YK4C 3B2UC 4I9WD 2XZCH 1TPXB 1WEJH 5C70A 3MV9A 2NLJA 4LSUL 3LMJL 4R8WH 1ZLSH 3BP4B 4P3WA 1G9NL 1GGBL 3ROOA 2BHZA 4NPYB 3V9FA 1U8OA 1AQDA 1KGCD 3DX8A 2H8PB 1N6QL 2R8SL 4QHNB 3KPSB 3G5VB 2OQJA 4JGJA 5FAAA 4JM2A 1PYWA 2L0DA 4MA8H 5EN2A 2APVA 3KR3L 5JTWA 1T0NB 2GSGB 2V2TB 4J2XA 1K2DA 3DVGA 1EBAA 1KJ2H 1NGWA 1TFHA 4XT1C 5EBMB 2OP4H 3GSXB 4TRPH 4P2OA 2BOCA 4LSTL 1HSBA 4PB0H 4OLVL 5JOEA 4F9LA 5F1NB 5LGHL 4K3GA 4G6JH 4XAKE 1FE8L 1RZ7H 2EYTB 4BM7A 3U2SB 1JHTA 1HH9B 4YAQA 4YHOL 4J1UB 1CLYL 1KC5H 3TA3B 1OPGL 3TO4C 1QLFA 2N56A 4IS6B 3BVNB 2HJFA 2V5RA 4D94A 3GKZA 1OT2A 1I7ZA 3MLXH 4UTAL 5I15H 3MA9L 3U0WH 3EFFA 3DRTB 4LAJH 3CX2A 1WIUA 3MYJB 5IV2B 1BFOB 4F58L 1D9KD 4QKXB 2VITB 1A6VL 4X4MA 1I1FB 4BQ6A 2VLKD 5L6YH 4L8DA 4PJGB 3PJSB 3BZFB 2SEBA 4OT1L 1NC2A 1E27A 3O6ML 4XPGL 1O0VA 3QNXA 2EH8H 3MLZH 3NA9L 1UXWA 2R2BA 4LCIH 5TQ0L 4G3YL 1HQRB 5HGHA 1YDPB 4PBXA 4XCCH 1BAFL 5IT2H 5DD1L 4MJIA 2XG5A 5JO5A 1MCSA 3QCTH 5ADPH 1AGDB 5CZVH 3DVNA 5HVGB 3GM0A 3MRFA 5DQDH 4P23A 2IGFL 4N0UE 1QO3B 1Z5LA 5DJ0A 1V7MH 1KN2H 4PS4H 2HLFD 3LDBC 4WGVB 5IGXL 1BVKA 1G1YA 4PJ5E 4TULH 3BIKA 3MV8E 5AWNH 5CZKA 3KG5A 1W2KT 5KSVB 1R5WB 5BJTA 1JHLL 1KB5A 1YEKH 4TUJA 4Y2OA 3LKRB 4XH2B 1H9VA 4NJAL 4OM0L 3MOBH 4H20L 5KSAA 1OAYL 4P5KA 3SE3A 3Q1SH 4O9HH 3CH1B 3ZYOA 5TDOB 4HEPG 4YPGA 2P8LA 2X1PA 4G43B 1VFMA 1P7QD 1ORSB 1YMMA 3RRQA 2R1YA 1J1PL 3ZT5A 1XF3B 1YEDA 3GMOB 1WZ1L 5J1SC 2YKLH 4E41B 1KXQE 35C8H 1YPZE 3DX9B 2XQBH 3QNZB 4DN3L 4CRPA 3C87A 3SKMB 4OQTA 5JR1L 1PAMA 3G5XB 5TFSL 1QFHA 1K6QL 3VXTB 3LY6A 4KGJA 4RA3A 1OW0C 3O6FB 3IDIB 5DHVA 5F7DA 5I74C 2IQ9L 3QEGL 4DGVH 4EI5B 3L7FA 3RBGA 4DAGH 1IM9B 4HC1H 5GGQH 1T5XB 1YQVL 4ZTPH 1U8KA 1DP0A 2GT9A 5CZXD 3CDGA 4MAYC 2VDKL 1TZIA 4OZFG 2AJ3B 2J12B 3V4PH 2C3WA 5F7HA 1ZLUK 1U58B 3BUTA 4OUOA 4JO3L 2BNQA 2FB4L 1ZWIB 4KQ4L 3UBXB 5SWQB 4QHMB 4HS8L 4Y5YA 4A6YH 4BSWA 1NAKL 12E8H 2A9NL 2OTUB 1QFWI 4PJ9B 3CFCH 3U9PL 1DUYA 3T2PA 4NDMA 3QDGA 2BSTB 2R0ZH 2AVGA 3GB7B 1UACH 4OGAD 4ONHA 5MERB 3CFKA 5FO9A 1I1CA 4P2QA 4Y1AA 1T3FA 3MMEA 5C08A 3MLTA 1J8HA 5D7SL 3RTQC 1LE5A 4ENEC 4U3XA 1S5HA 1VKXA 2Z31A 4HKXB 3L3IA 5FYJL 1OTUD 1HKLH 3WFBL 1I85C 1MFDL 1JGVH 3V6OA 4TTGA 2AQ3A 4UNTA 4YDIL 3BZDA 4WCYL 3WFDH 4U49A 2AJUL 4HH9B 3GIVB 5DHXB 4BZYA 3S36L 1C1EH 3CNKA 1IAOB 4RISL 5L8LB 5D72H 4N8CL 4NO2B 4LPYA 1DJSA 1TCRB 4FQQB 3U7YL 4G80A 4DZ8A 4LSUH 3ZTJH 4I18A 2IADA 1CLCA 2G5BA 4LHQB 2GCYB 3NGBC 1LP9E 2CLRB 2R1WB 1MPAL 2PO6A 3C5JB 4RZCB 2APTA 3HZYA 4LCCC 5ESAA 1QFWL 1KG0A 4FQXD 2Z35A 2P8MB 5HVFB 5EBLA 4I2XA 4KROD 3RBSA 3WBDA 3WUWB 4GKNA 3OKOB 4OD1L 3MRCA 5HI3D 4L8BA 2BNRB 4R97B 5KSUB 4PJHA 3P11L 3KJ4B 4OLVH 3O3EA 5LGHH 8CGTA 2WQRA 2KZWA 4F37F 3E2HA 5F44A 4BQCA 5IB2B 1FE8H 3DIFB 3NFSL 3U6RB 2XRAL 3DBXA 3HRPA 4KRLB 1A4KB 2FO4A 4YHOH 4EI6B 1CLYH 4Z76A 5IVXF 3KLSA 4B41A 4MX7A 3VXUB 2X4PA 3TBYA 5HYJD 2XWBB 2F8VA 2HLFC 1JNLL 1RZ8A 5DRNA 4OF0A 3T3PF 3W39B 3LD8C 2VDLL 3DO7A 4PGEB 1TCMA 1IL1B 3C6LA 3BDYL 4LPVA 2WLYA 4U4BA 1T1XA 1A6VH 5I1DA 4R0LA 3PNWB 4D0CB 5FGCE 4RMWA 4OT1H 5HJ3A 1EJOL 3W5NA 3T65A 5T3XH 5IP4A 4G8EB 5IESL 2MKWA 5TQ0H 5IMOB 4IRZH 4HBQA 3BQUB 4CN4A 5DD1H 4AH2B 2R0WH 3H7BB 1XF2A 3LN4A 5IVOA 3V8OA 4H88H 4JFQB 4JY6B 4NFCA 3UX9B 2AP2A 2GIYA 1UKTA 4WY7H 5IGXH 1P1ZA 5T3ZE 2E9BA 4EN3D 4QNPF 3V6ZA 3VXSB 2AI0L 5BV7C 3JTTB 5EBGA 5EU7E 2GK0B 1ZGLM 4LGRB 4OUUB 4LGPB 3EBAA 4YWGH 1JF6A 1F00I 4OFIA 1PW3A 1JV5A 3QUML 1OAYH 4MD4B 4ZS7H 3WE6B 2VISA 4PBVC 1B0RA 4MDIB 1K9TA 2H3NA 4OF3A 5HGDB 4G8GB 1KNOA 5CZXC 3WHE0 5E6ZA 1JMXA 2OL3L 2RR3A 3HUJA 4L4VE 3F7QA 1WZMA 1J1PH 2C5DC 1QSEA 4PLJD 5BS0E 1WICA 2EXYC 1WZ1H 3FO2B 5D1QD 5T1LB 4JFEB 5DZOA 3KPNA 3BPNB 2IH1B 1BFVL 5BXFA 1NCDL 4LASL 4DN3H 3MRIB 4JY4B 5TFSH 1K6QH 1U8MB 3QI9A 3TP4A 4PP1C 2YEZB 4OD3L 5SX4I 2ZG3A 1EGJL 4CVZB 5K9JL 1XGTA 3CSPA 4JFFE 1A7NH 3BW9A 4XCFL 1KTRL 5C0RH 3FO0L 1R3IL 2IF7A 4JJHA 2X4SA 5FEBA 5FYKL 2MCPL 5CEXB 1OTUC 5EDXA 2BP3A 4MNHA 3MBEB 3FQWA 2VDKH 1JGDA 2Q86B 2VE6A 3G6JB 2NNAB 2VQUA 4KQ4H 1UB6A 4J12A 3X11A 1IAIM 4NO3A 2JCCB 4BELD 5I17A 3NCJL 4HS8H 3RWCB 4K55A 1NAKH 4JPIB 4BSVB 5DD5L 2GY5A 3VWJD 1K85A 2Q7YA 4M6NL 1RHHA 4ZPTA 4OCSL 4JQXA 1DEDA 5DR5H 4Y2DD 2XZAL 1MI5A 3W0WD 3HKFA 1F58L 5HBBA 4Y5VB 5C0BE 2FO1A 5CEZD 2EDWA 3ZKQD 2G2RB 5IFAL 1E4XL 3IAQA 3STZA 1UJ3A 5SWSA 1SVCP 4PJ7E 4YDIH 4ODVL 4UBDD 3ZE0F 3IJSA 3HG1B 3GHEH 4MJ6B 5JZ7C 5HI3C 5J6HA 5KVMC 4OCWL 4X7EC 5EUOE 3S36H 2XKNA 1J05A 4S1DD 2ZCHL 2FEDD 1AP2B 3BGMA 3U7YH 5DEFB 4Z7VF 3TT1L 4GAGH 3JWDC 1CE6B 3CFBA 4R6UA 1KULA 3VDBA 5HHOA 5DS8B 5CWSB 4L9LB 4O00A 5EZIH 3RL1B 3VMPA 2HP4A 2YPLA 2R4SH 4U7MA 4U1NB 3C5SB 3D85D 4HT1H 4XWGL 1KT2A 2GJ6A 3DMMA 3E1F1 3LCYA 3VG9B 1YJDL 3HCVB 2ARJQ 4MS8A 4NOBA 2A73B 4LKCA 4ZS6D 5ISZB 2EDRA 3O8XA 1NCUA 4NQTA 4OB5L 5D2NE 3WDJA 3T4AA 5FYJE 5GGVL 3MRBB 1HHKB 5C0AA 1DQJB 3L9RA 3NFSH 2XZQL 4V1DA 3PWPB 4E42A 1LEIA 1CWVA 4M7KH 1CGSH 4JHAH 1GZQA 2JJSC 1NCNA 2CSPA 2VIRA 2UWEF 1WAAE 4UV4H 3MJ8B 1CQYA 3TNNA 5GGSY 3STLB 3C5ZA 1PVHA 3X12A 5JLZB 3RWFA 1QFUL 3FHQA 1K4DA 4F3FB 1BQHB 3FOMA 1LNUB 3G6DL 4Z0XA 1JNLH 5HXMA 1UM6L 1A64A 5DSCA 5MEOB 4NQCD 4WVRA 5IQ7L 1MIEL 5JXEA 2VDLH 2XA3A 2Q3ZA 4GRLD 3QCUL 3HC4L 1UM5L 4Y4KB 2D0FA 3ZKXB 2MWCA 1EJOH 1CFNB 1M7XA 3ES6B 5SWZD 2HLAB 2JB5H 1FFNB 5IESH 1RJZA 3J7HA 4NZTL 2IPTL 4U6HA 2EDNA 2I24N 1D3CA 1KTLA 3KXFE 2FJFA 3B5GA 2R69H 1LO5B 5B8CA 3ARYA 4RFNB 1F8TL 4LVNC 1EO7A 2ZZUT 2CO6B 3EO9H 4MWFA 4PLJC 1OGAA 1WIOA 1TXKA 3S5LG 4KY1L 3UYRH 5D1QC 3VXQA 3SHSA 3D18A 3MR9A 1VACB 1W8NA 1BQSA 1QPXA 5DMKB 1KENL 4QXGL 5KN5B 4N0FA 2EIZA 2AI0H 5C09A 3I9GL 3M1BA 2W9LA 4XHJD 3OXSA 3DROA 3ECBB 5ADOH 1WF5A 1FN4A 5HHNA 4YDLB 1Y6MR 4X6DF 1JHKH 2EXWC 3QO1B 1MVUB 4XCNA 5C0EA 2NYYD 4LCWA 3QHFH 1HXYA 3S3JA 1CDCA 1FVCB 4ELMB 3D69B 1FZKA 5F3BB 3CZFA 5D7JD 5I9QC 4RWYH 4XXDB 2LAGB 4ZSOA 1KIQA 3RWEB 1FVEB 4MAUL 4G7YL 1BFVH 3QQ3A 5MEQA 1RZJC 4LLAA 1CBVL 4YDVB 5C0CE 4O2EA 3FAXA 3VWJC 3OAUH 2AGJL 4HKJA 4GKZA 4OD3H 3V8CA 1EGJH 3BKML 5K9JH 2FECI 1G6RA 4Y2DC 5IB1B 3S98A 1A7PH 5TF1L 3D2UD 1R3IH 4HIIA 2P4AB 4PJFF 1OWRM 2NY5C 2I07A 5M7QA 5E9DD 5BVJA 4IRJB 4NQXB 2MCPH 5FYKH 2CUHA 3EGSA 4QRRD 4QRUA 2NY6B 4LEOA 1R5VA 1BVZA 1T7VA 2JIXA 4UBDC 3TJEL 3VGAB 4NHUB 1FNEA 4QHUA 1JVKA 2XWTA 3FB5A 4C56E 2ZWLT 4J6RL 3EYFB 2Y1VA 5E1HB 4PJCA 4DJMA 3BPCB 3BAEL 1DEEB 1FJ1B 2J8HA 3QO0A 4WFFD 4XBGB 4AEFA 3F58L 4MQ7B 4U1JB 3OBAA 1SBSH 4M7JL 5DK0A 3TYFA 1A5FH 4OCSH 3U7WH 3CVHA 4WHDA 2NXZD 1W72L 3MZTA 2VMFA 3KLHD 5D1XA 2XTJD 3H42L 3ARDD 2EKJA 3ARUA 3DURB 5IFAH 3SKNA 5I2IA 5A16A 1DDHA 4JFYA 4CDHA 5E4EC 3H8NA 5CLWA 4NQEE 3A6OA 2L7UA 1T2JA 4ODVH 2AK4A 4ZS6C 3U4EB 3UEZA 4ZQKB 4X6DB 4DW2L 5L2KA 2WWMD 1O5DT 1CE1H 4JO1L 3QDME 5CD5C 3DV6A 1B4RA 4Z0BL 5I8CB 2CLVB 5JIPA 4NN7C 3TT1H 2X4TA 1IGML 2FLBT 2M26A 3RY6A 4M4PA 1NFDF 3K74B 1XGYL 4CVWA 3PWUA 1YNKL 2VLRD 3EOYG 3VGEA 3KPRE 3OR6B 5IK3B 1RU9H 2CRZA 1CLZL 3MODL 4EVNA 4PUBH 4GRLC 1DVFD 5E2TL 5DMGC 4DGIH 2BHUA 2IPKA 2Y23A 5CBAB 3ELAT 2IFFL 5EU5B 5JDJA 4LPUA 1KCGC 3P77A 3VI3F 4R7NA 2BDNL 5CINH 1U3YA 4I0PA 5ELIA 5GGVH 2B8OT 3FKUS 1MNUH 4PGDB 4JKWA 4HUUB 4E41D 1JK8B 3IRZA 4P48A 3QXWA 3SGEH 5IB5A 3D3VE 5FKPA 2FZ3A 5LBSH 4OAWB 2I9TA 4PJ8A 1H5BC 3HI5L 4OGYH 3QRFM 5I6XC 25C8H 5GJTL 2PYEA 3G6DH 3SGDI 1EEYB 2XIDA 3QQ9D 3BE1L 2BJML 3QFJB 4ODSL 4ZFOB 2DB8A 1MCPL 4OLXL 3BP7B 1ODAA 5DA0B 3AM8A 2YRLA 2BOBA 3HC4H 3KYKH 5EBWA 3SDDB 4XRCB 3RWDB 3DSFL 4XBPB 3W9EA 5JXAL 2DN7A 1VGKB 3F12A 4ZOBA 4LLMA 3TFKD 4OLWL 4JRYE 1LWRA 3PIQB 2ATPA 4NZTH 2IPTH 5AYQA 1W0VA 1N7ML 4MNQB 4LSVL 4JFHE 1IAIL 4MA3A 2NYYC 4UV7L 3MFFB 4HWZB 2CD0A 3PF2A 2AEWA 3U48A 3WO3B 1F8TH 5CJXA 1G0YR 1TPXC 2BMKB 4LEXL 2C1PA 2BY3A 5EPMA 5FDYA 1GGUA 3RP1A 1XF4B 3TPUB 2V2WB 1A7RH 2HJLA 2OI9C 4PLKC 5E2VL 1NGZB 4P9HL 4UQ3A 3I9GH 1EO5A 2V9RA 5FKAB 3GMRA 4NRZA 3SQOL 1J1XH 4TPRL 2IG2L 3PHOA 3MJ9A 4PJEA 4LDLB 4XP9L 3QISA 1SEBB 3KPOA 3LS5L 3NMEA 1ADQL 5B39A 4X7CC 2D0HA 4PD4J 3UZQA 2VZSA 1KPUB 4Z7UE 3OKDB 4M61B 4K2UH 5CCKL 1DBAL 3X3GL 1JWUA 5BZDB 5F7NC 3K8LA 4O2CB 3VFUA 3RZCD 5IW1B 4X7SL 1MQKL 3MZGB 2Z92B 2ZUUA 3PDOB 3QEHA 1F3RB 1DANU 3TA3C 1BBDL 3ZLQC 3BEVA 3I02B 3QWRD 1S7QA 3TO2A 4QRPB 2F54B 5GS1B 3ZHDA 2FWOA 2R2EA 3MLVL 3NABH 3TJHA 3JBG7 3AXLA 3IDNB 3EOBB 4P46A 1T4KB 3D0LA 4FFWD 3S4SA 1D5ZB 1WBYA 2VLME 5J12C 2XTJC 2BNRD 2BVEA 3ARDC 5BV7L 3IKKA 2VN7A 2GJZA 4X6FA 2UY7A 3I6KA 1DQML 5D7IF 1E6OL 5HDBF 1SMAA 1FNGB 2NY4B 3EYVB 3ILPB 3IVKA 2WWMC 2CK0H 1BMGA 2D7MA 5DZNA 2XPGA 4AM0A 4X5WB 1QHPA 3F58H 2VDML 3PWNA 2NQCA 4M7JH 4DKFL 3MACL 4Z8FL 5CP7B 3UPAA 4XI5C 4GFTB 1W72H 2PUQT 1T5WA 5F93C 2V2XB 1AGBB 1IAKA 2P5ED 2ADIB 3ARED 4IRSD 4NO0A 1VFAA 5C0DA 3LB6C 3BN9D 4MHHI 4TQEL 3VXNB 3VFOB 4LOUD 4ONOA 1CI5A 1F3JA 3SDAA 1S9XB 4HZLB 1QBAA 4YHNB 3X3FH 3CD4A 3FRPA 1IVLA 1WBXA 3ARBB 1BJ1H 3MRHB 2XKUA 4D3CL 5GISL 5DT1H 4JO1H 5IVXE 3PQYE 3GFUA 4PJAA 1J87A 3H9SD 4Z0BH 1GPOL 3ME0A 4JKPH 4RAUA 1CFSA 3X13B 1YEFL 4P2RB 4QWWD 2MQ3A 5GGVY 3FO9A 5E8DL 4IMLB 5IW6A 5IHZB 1AHWA 3ESUF 5EORL 1K8DA 1YNKH 2V7NB 1MELA 4H5SA 3QQ9C 1TITA 4F7PB 3TVMA 2HT3D 2X40A 3O6FC 3L3HB 4YHKL 1AXIB 1PG7X 1WT5A 3MODH 4XMKL 3VXRB 1CLOH 4APQA 1IKNC 3KYOA 3WJLC 2PYFA 3JUYA 1KJ2A 4LLDB 5CJOL 5C86A 2IFFH 1NEZB 2E8ZA 2CGRH 2BDNH 4JGUA 3P0YL 4FFZL 3ZHKA 4NCC1 4O51B 3TFKC 1NFKA 4GAYA 1BLNA 3VW3H 4PJDF 3HE6B 5IIEA 2H41A 4FQ2L 3CSGA 2P5WE 1EUUA 1MH5B 2EDOA 2VL4A 5IMMA 5F88B 4U1MA 1EAPA 5MEPB 3HI5H 4RFEA 2VLLB 4KAQL 4XNQB 4PJ9C 5BW7A 3UXFA 5GJTH 1XGRA 4KK5D 5E8EA 5E6ID 4PRHE 1A9EA 5D93B 4N8VB 3BE1H 3I3EA 2BJMH 4Q0XH 3JWDL 4NQDA 5HYSB 1FFPB 5GSRA 4OLXH 1BX2B 1T2QL 4KDTA 3A0OA 1FFRA 4YXKH 1U8JA 3BSZL 4Y4FD 4CN6A 2I25N 2FDBP 4I9WE 3L3JB 3O9WD 5MI0C 3RHWF 3K46A 5JXAH 2Q3AA 1G7IA 5DD0L 1UA6L 4KDWA 3TF7C 4OLWH 4XPAH 4OD2A 5J6GB 4FTVB 3PGCA 1N7MH 1JWMB 3GJFB 4LSVH 4F15C 1R0AL 1ONQA 1IAIH 1QR1A 1MLBB 1KGCE 3GSRB 4UV7H 1N5YL 1GGYA 1ZT4A 4OI8A 2B2XL 2OXHA 3ARFB 3DO3A 3UTTA 3ET9F 1T7WA 3WL9A 3FB6B 1G7QB 3R8QA 4X4ZA 5C0IA 3QXTA 4WENB 3RPIB 4ODWB 4PFEA 4RQQB 3T0EA 4OZFB 5CMAA 2X4UB 5L2JB 4PG2C 1T7ZA 4X98B 5C6PB 4NQUA 2NX5B 1JZ8A 1F6FB 1HHJA 2IH3A 3H0TB 2RFXA 4TPRH 4K94L 1A1NB 1E4WL 1NC4B 3P9MB 3QIUB 4HD9A 2DLEA 2CIKB 5HYQA 3IETB 3LS5H 4FFWC 1ADQH 3HG1D 4PP8C 1GSMA 1A47A 4NKMB 4U1IB 4R97C 3RNKB 2GI7A 1H8SA 3WS3B 4JPKL 2WIMA 3IU4H 3VU2A 1CXEA 2A74B 4CKVX 4JRXA 4ZG1A 5ESVA 1DBAH 1JPST 1MY5A 1KLUB 3KGRA 2M8XA 4G5ZL 3OAZK 4OZIE 4X7SH 4HS3B 1MQKH 4XCEA 1Z9MA 4N0YH 5DRWA 2RB8A 1JI1A 4HKZA 4GMTL 3RJDA 2VLKE 2ZOKB 3ULVC 1SJHB 2PW1A 5A3ID 1OF2A 2FYYB 4ZFZB 5MENB 3KPQA 2YK1L 5IJVB 2W9DL 3MUZ1 3WIHL 4NM8H 3ZE0E 1FAKT 2NY3B 4HFWB 3UTZB 4HC1A 4HLJA 4K7FB 4OCLC 4OV5A 4G9DA 1M05A 4MD0B 4M9OA 3VH8A 1D5BB 3TPKA 4JZOA 4LOUC 1DN0B 3C9NA 1I9RH 3ZE2F 4YJZL 1INQB 4J4PD 3IT8D 4Z7VE 3QG7H 1MHCA 1CCZA 3P9WB 5ECJE 5C3TA 1LP9A 4LLVA 1DFBL 4YR6A 3MRNB 4A6YA 4CADA 4F7EA 4KQ3H 5H35A 1Q0YL 1VPOL 4L4TB 3UO1H 1JZ2A 5DJ2B 3PL6D 3UTQA 3MRJB 2BVOB 3BH9B 2WIIA 4Z8FH 2DS4A 3RVVD 3KDMB 4OIAA 5DYOB 5TDNA 1JUFA 3QZWG 4LPXA 5I18H 3FO1A 5T5FL 1IARB 1H15A 1CT8B 1PKOA 3V0WL 5J8OA 4KJWC 4G42A 4PRPD 2EIDA 3DHMA 4TQEH 2K9UA 2DKUA 2W0FB 2X41A 2ZNXA 3K8MA 5SX5H 3G08B 1R3HB 3IXAB 1OY3B 3IJHB 4DVRH 1EEZB 5CEZL 3O3DB 4D3CH 2NY5L 1UB5B 3RZWA 3ARQA 1T1ZA 2BY1A 5ACLA 3BPLC 5IEHB 5INCA 2G9HB 1FBIL 3LEXA 4M8VA 1WZKA 3FQRA 1RUMH 1YEFH 2CIIB 2ADJB 3K4DA 4P4RB 3BPNC 4I8DA 4OZHE 4Q6IB 4UNUA 1KCVH 5I73B 5GS0D 1J12A 5EORH 3ZSTA 1NANH 1A6WL 4ONGH 5L0QB 4N5EA 3FT2B 3C6SB 4G6FB 4KK5C 5E6IC 4Y4HA 1U8LB 4X7TB 4CJ0A 3RWHB 4XMKH 3QH3A 4IIQB 3D9AL 1KLFA 1BBJB 1X44A 3BX7C 4ZXBB 5EZJB 5C0JA 4H1LH 4QF1A 4Y4FC 1R3JA 1MCCA 5TF0A 2XFXB 3AU1B 3DX6A 4HIXL 1ZHKA 4ZAKD 2YD5A 2I5YL 5GSVB 1S7UA 4IOSD 4YGVA 4FZEL 1A6TB 4MXVF 1EERB 2QJDA 3P9LA 2FR4A 4AQOA 5HHMA 1W8OA 4HSQA 1AGEB 3EYQD 4KAQH 4NKOB 3D39D 3QUXB 3V4VL 3VFVB 5LJYH 2A0LD 2DYPB 4MVBD 5IFHL 4OLEA 1C08B 3E6HB 2KH2B 1U8QA 5FF6A 3UTSD 2X09A 1G7HB 3QUYD 5DJCB 2O5XH 1ZA3A 4HDIB 3BO8A 4M48L 3VRJB 4L4VA 2XWJB 3HI1B 3WO4B 3O6KL 5GGSA 4HUWA 5BS0A 5C07E 4NKIL 2WUBL 4O02L 3REVA 2HA1A 4Y8DC 1R0AH 1Y0LA 4H0GA 2DWDB 1N5YH 4LKXB 3RI5F 3NZHL 2ADGA 4PJIB 1BVLB 2CXKA 2WINB 1DQLH 4YXHL 4L4JA 4I3RL 1ZLWH 4JFFA 1LILA 2Y7QA 2XV6B 4K9EC 5DRZB 3E6FA 4NUJA 3DI2B 3SE9H 5K9OB 3BPOB 5HDLA 2DBLH 4PJFE 2KQNA 3TH3T 2XN9B 2WY3A 3S34L 5EU3A 1QLRB 4K3DH 3IDYB 3P4LA 3MCLH 3DYPA 2R56L 5D5ME 4K94H 2VXVL 1DBJL 5I1JH 1SBBA 2GTZB 3EYSH 4JM4L 2GTWA 2YZ8A 2NLJB 1YNTA 4WI7A 4ZFGH 5IR1B 3OKKA 5J13C 5L7XH 3RGVB 1A1MA 1RZFL 4WFED 2QADD 5D2LE 3QFDA 5KANG 5HYJE 1U8OB 3IAGC 1AQDB 4JVPA 5CP3H 5IBLD 3SQBA 3DX8B 1PY4A 4KJPC 1V3JA 1JGLL 1FAIL 1QRKA 2OQJB 4PG9A 4S1QL 4JM2B 1PYWB 1VEMA 2MMXA 5EN2B 5KSBE 1VEOA 4Y5XB 2QKIB 1E4JA 1L9MA 3UAJD 3BXNA 2VWEC 5HYEA 5FOJA 4GMTH 5C0BA 3DVGB 4F57L 3QXAB 43CAA 4HG4J 4P2OB 2BOCB 3SDXA 1HSBB 1T03H 3PL6C 1JYVA 5JW5B 2WWKT 2YK1H 3RVXD 2CKNA 1MFCH 3L3GA 5EUKA 3RVVC 4NQVA 4GW1A 2VL5B 2W9DH 1K8IA 3AS1A 1MJ8L 3ARGB 4R7DB 3PG2A 1T0MB 5DUPH 4Q9CA 3U9UB 4EDWL 3NPSB 4KDVA 5E03A 4Y16D 4MYWB 2HJFB 2VO5A 3FT4A 5E8OB 5C6WH 4QYOA 2ESVD 3EFFB 3WDIA 3BZ4A 5F9DC 1NFDE 2UZXB 2VQ1A 1HK6A 3H9YA 4RFNC 2FIKA 5EG6C 3SO3C 1HXMB 1Q0YH 2DI9A 1VPOH 3F7PC 4L8DB 1UCBH 2SEBB 5CSZA 3RKDD 3NN8A 4HUMB 5CSBA 1YN6A 1UXWB 2R2BB 2CLZB 2DDQH 2HN7A 3OKMA 4IBLT 4OJFH 4Q9RL 5HGHB 3N9GH 4YHML 1V7NL 2OMBA 4MJIB 3DVNB 5T5FH 5D2NA 1ZEAL 4ONFL 4XCYA 3VI3E 4P23B 1YNLL 4WGWB 1S7RA 3B6SA 2EE6A 1BZ7A 3U0PA 5F7UA 4X9FA 4YDLC 3B8SA 1BVKB 5B38B 3T08A 4MCZA 4RBPH 3P0VH 4FQ1L 3EO1B 4UAOB 4N0CD 4HUKB 3DRQB 3X14A 5BJTB 5C71A 1KB5B 5E56A 4PRAA 4TUJB 4PJBA 1Q9OA 3DXAD 1HCVA 4HIEA 3HE7B 1PG7H 4YPGB 2OR8A 1A6WH 3O11A 2YXMA 3QRGL 1CG9B 2A0LC 1YMMB 2YD1A 2Y25A 4KRMB 2R1YB 4YDKH 4OGXL 5T1KD 3JV5A 3QUYC 5DWUL 1G6VK 2CMRL 5JPNA 4NPYA 3S5LB 4KVNH 5D7LE 5DGQA 2CRMA 2H8PA 1CFTA 4TSBL 3VGAC 3HZKA 5GZOD 3G5VA 1FO0B 2I26N 1EFQA 2FGWH 4NNPL 2I5YH 2KPNA 3W0WE 3MV11 3EZ8A 1T0NA 3UBXI 5F7DB 2GSGA 4FZEH 3V79C 1IGCH 2FATL 5CEZE 2V2TA 2J8OA 4L8SC 5B3JF 4JQVC 1MFEL 2C3GA 1Q0XL 3V4VH 5M94B 5F1NA 2GT9B 3CDGB 1GOFA 1RQ5A 4L3ED 4OFVA 2QV2A 1OP3H 2BNQB 3VXOB 4G9FD 5FFLA 4EKXA 4XP5L 2O5ZH 1FGVL 4G6ML 1RZKH 1AIFB 5KVGL 4J8RB 4IS6A 1DUYB 3QDGB 1NPUA 3SDYL 5TJWK 2WUBH