4G9FA

Crystal structure of c12c tcr-hlab2705-kk10-l6m
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Molecular Basis for the Control of Preimmune Escape Variants by HIV-Specific CD8(+) T Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2012-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g9fA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4g9fA01
1MRFH 1BOYA 4JQIL 5C09E 4FRWA 1D5ZA 3K74B 4WU7A 3MV7E 3KHQA 4UTBL 3C6LD 2AP2A 1NCAH 4NIKB 1E6JL 1FCGA 2F58H 5HGAA 5C2BH 3DX6B 4WI9A 4JRXA 1IGML 4QHMB 5KBNC 4LIQL 3DRTB 4TULH 2A74A 4FABL 3V0WL 5EO1B 1YEFL 3U36A 1KB9J 2NY7H 4OCWH 2V7NA 1SY6L 4K3DH 1YN7B 1X5KA 1IGJB 2IQAB 3CVIL 5I2IA 2ZUWA 1MFCH 4HIHA 3SCMB 3BHBA 1S3KL 3LPFA 3BN9C 1RZ7H 3RX5A 4FFWD 1DCLA 2ZSWB 3MGOA 4TTGA 5J9PB 2VC2H 3IDMA 2PYEB 1WZMA 1FJ1A 4GW1B 4AYFA 4XRCA 4NQDA 1A4KB 1J0KA 4LSUL 4FG6D 4JFEE 2FH8A 1RZFL 4HBCL 5CZKA 1J18A 5TDNB 3N0PB 3GBLA 4I77L 2C4FU 3BOVA 3V7AE 1BBJB 5FYJH 5I9QC 5D7IE 1JGDA 4JFHD 4NNYB 3OJVC 4PP1D 3TT1H 4JRXD 4OQTL 1A6UH 1ZHBA 4QXGH 5I1GH 1DFBL 1CXFA 4JFYA 3ZDYF 4JM2F 1NAMA 3CFDB 1HSAB 1I3GL 5D1XA 5DJAA 5JUEH 2NY2B 1SMOA 2FJHB 4AIZA 4K23L 3IDYC 2EEAA 1DUYA 4H88L 4R3SA 3L3OB 3VFPB 4AQ1B 2X2YA 4LU5L 2ZOLA 4KQ3H 1EGJH 3ARTA 3VFWA 1FN4A 3NH7H 5FYKD 1XZ0B 4MNGA 4ZPVA 5HHME 1R5IA 2BJMH 3BGMB 2QQKH 1X6NA 3AREA 4PYGA 3KPRA 4UQ2A 1VFBB 4XWGH 5BXFB 1BJMA 1MSPA 1YPZE 2UZIH 4OFDA 1TDQA 3NIFF 1WGOA 5MP6H 3L5JA 4N0CA 3H9YA 3PWPD 3W81A 1VADA 2AJVH 1AY1H 4QRPE 2F5BH 4DVRH 1A1OB 2DQDH 5BW7C 3SDXF 3VJ6A 1G0XA 1KB5B 3DMMC 1T5WA 5EZLA 3BGAA 2DWEA 2NX5D 2NW2A 1AH1A 1PAMA 4JDVB 4LAJH 4BK5A 4R9HA 4B53A 2BDNL 3HNVH 4CKVX 3T0EB 3NFPA 5ESVA 3JTCA 3GRWL 2GSGB 3HE6D 3VFNB 4RGNB 4OIIL 1ETZB 5HHNA 5J11C 3N85H 4GBXC 1UACL 2A6KB 3F5WA 3PV6B 1MJJA 3QQNA 4LDLB 4LKXA 1FE8H 3G08B 4XP6H 1X5XA 2BJML 4YX2L 1CFQB 5IK3A 3NH7L 3V95A 3PHOB 1YEDA 3UEZA 1RZJC 1WSST 3HE7D 3ARED 3OBAA 3IDMB 4EDXA 4LSSL 2XWJA 4JPWL 3KPQB 3KYOB 3DBXB 5HD8C 1LEIB 4UB0H 4HGKC 3S4SB 1IAOB 5CD3A 4LOUC 4P9HH 1IGJA 3VFGL 1I1AA 4IJ3C 4PRHA 5ID1B 5J6GA 2VLMD 4JDTL 3THML 1GGTA 4PB9H 1T66D 5JA9A 3CFCH 3I6GB 3RIAK 2FWOB 4Y5XB 1VB9A 4P57A 5DVMA 3GJFH 5FOBA 3IXAA 4IHOB 2AQ1A 5DURD 1NEZG 1TXKA 3KPRD 4J3XA 2Z91A 1RZFH 1D5ZB 1MLCA 4XI5C 3ECBA 1K8IB 1FPTL 1I4FA 4IRSB 3OR7B 2AV7B 3FRUB 3X13B 3PABA 2HT2C 3SGJC 4KJPD 5B38G 4HIEB 3B2VL 4DZBA 4YXHH 4NQEA 5DK2B 5FECA 2CSPA 1DZBA 2FX8H 2XZZA 3HMWH 4Y8DC 1XF3B 2FLRT 4PP1C 1KTLB 2ZG3A 32C2A 4L8DA 5DVNA 5K9KA 4LLUB 2VLJD 1KCUL 2BNQA 1X7QA 3UJTL 1FORH 5FGCB 5C3LD 3S37H 3DYMA 5IB2A 1D9KA 3T4YB 3B9DA 2YUXA 3O8XD 2Z92B 5D1XC 3LQMA 4OD3H 4NKIH 4M6MH 1AFVH 3BIKA 3W9DB 4AEHL 1X3DA 2YXFA 3OWEA 4U7KA 3FRPA 4IBLT 2P1YA 4MLIA 1IRAY 4PJDF 3ILPB 5ESQA 2R2CA 3HZVA 5FYLL 5EU6E 4KROD 2G5BA 1YA5A 4M7KH 4Y2DA 1QVOA 5EBLB 4RWYL 2FR4A 4XCCL 3X3GH 3STZB 3SKJL 4N9OB 4YFLI 4ZG1A 4MXWL 4XPHL 3L7FA 4M7ZC 4WFGE 4RISH 4JKLA 1UCBL 1CVSC 3HMXH 4NN6C 4EDWH 2W1NA 1NUGA 1WZLA 4FQHA 2NTFB 1E4KA 1CD9B 1J0IA 2X7LB 4F57H 5DWUL 2XKUA 4MHHG 4LCWA 2V7HB 1CU4H 1JFMA 5IM7B 3C60B 2JB6A 3BAEL 2UWEB 3CVHH 2VL5B 3BIBX 2I07B 3QQ3B 4PY7B 1MJ8L 3QT2A 4F15C 4HK0A 1Y0LB 5HTSA 5D7KE 1UA6L 2ESVB 4WTZA 4NQEE 3CK0H 1H5BB 1D6EB 4DOHE 1TENA 2GIYA 5GGTH 5F8RC 1I7ZB 4LRNH 4RZCA 3RZWA 1S9XA 1OTUD 3NN8B 3RTQB 5DR5L 4OZ4B 3Q5TA 5JLZB 2M1KA 2OR9L 1IILE 5HI3C 3VFRB 4R7DA 1AQDB 3TA3A 5IVZB 4EXKA 1E4WH 3UX9B 1F3RB 2VLME 1U8LB 3MRJA 3G5YB 4RCAA 4X5LA 5FYJU 4Q9RL 3F7RA 4OUUA 2BY2A 1Z5LA 1IL1A 4J4PA 5CAYB 2CIIB 4ZPTB 1CE1H 4ZFOL 2BNRE 3VRIA 3HNTL 4RFNB 5IEHB 2VDKL 4WTZG 3BFOA 4G80B 2YMXH 5HHOE 1KLGB 5GGUA 1MJ7L 1MPAH 2BCKB 3BP5A 4HWBA 1CLYL 1N8ZB 3M8OL 3MNZA 3NPZB 4Q58C 1PW3A 5DTFA 1U93A 4BKLA 4W4NA 5AAMA 1IKFL 4UILL 1FDLL 1GGYA 2GHWB 3HLAB 4Y89A 5EOTB 5GGUB 3QIUD 4R4ND 2OL3H 4GRLB 5DA0B 4APQC 4AMKH 3UAJD 4S11A 5I1AA 1DSFH 4FXLA 2V5YA 2OJZL 4PUBH 1A6ZA 4I18C 4S1DC 4AL8H 4RFNC 4K3JL 2YD4A 3TO4C 1QZ1A 4NC1C 1S7QA 3DXAA 1WBXA 4IRSD 3PXJA 1XEDA 4OZGB 5I8KL 4PJEB 3WUWA 1UM5H 5D96B 5FUZH 1YNKH 3KLHD 4H26A 2PO6A 3FQRB 2WUCL 1GPOH 3FO2B 5INCA 2GY7B 3VXOB 1HIMH 4UDUB 5EU4B 3MXWL 5IM7A 4UT6H 4W70A 2EEDA 3GBNL 5HI5D 1A8JH 2V7HA 3MUGA 5I1AB 3MZTA 2VABA 4QRRA 1YC8A 1E4XL 2SEBA 1Y0LA 1NAKL 2V5RA 3VWJC 5MI0C 3BRFA 1CE6A 4FQHB 3QNZB 2P49B 5C0BE 1NAMH 4S1SH 5HHVH 2FX9H 1D5IH 4OZHB 2ZNWA 4CDHA 3CC5B 4EQ3A 1BIIA 4P4KB 3RGVA 3D85B 3ILQD 5C6PB 3VXNB 1BVKB 5C0ND 3STZA 3LKSA 1WC7B 3FT3B 3ZE0F 5L2KB 1AI1H 2ICWA 4H25A 1OP5K 4GFTB 1KBGH 1JI1A 1ZEAH 1FL6A 1J1OL 1CFSB 2EECA 3RWGB 5A43C 3UBXI 3ULVE 3O45A 2CR6A 3A6CL 3K1DA 5I75C 4ZXBD 3ARXA 3BESR 5ESQB 1FVDA 3WUWG 1F42A 1O0VA 4IRZL 3H9ZA 3RUGE 2EYRA 4HHAA 4Q7DA 4YDKH 1KG0A 3QXTA 4J1UB 2HMIC 2Q1EA 2IAMA 1N0XL 3W9DA 5DD1H 1S7UA 1N0XH 1AO7D 3C5ZA 2DQFA 2APTA 2DN7A 1JK8B 4YX2H 1JGEA 5GRVK 2H32H 1T3FA 5K9KB 1UWEL 4MQ7B 2GAZA 3UPAA 4HSQA 5GSVB 5I1KH 4Y19B 3T3ME 3ZYOA 2IPUG 4EQ2A 1TJIL 4CGTA 4RISL 5HHOA 1JBJA 4L5FH 2VLLB 4NDMA 5I1DA 2CLVB 4HAGA 4L8DB 3C60A 3V4PL 4UIKL 5C0GB 1LP9A 5DEGA 3RFZC 4GG8B 3LS5L 4X7TA 3GI8L 4KI5C 4MQSB 5TQ0H 3KPLA 3P0YL 2DBJA 2HWZH 4Z0XA 3QXUA 3MRLB 1GSMA 5F44A 5C0IA 5FUOH 4L5FL 4HUXB 4U05A 4P57B 4W6WB 2FWOA 2XTJE 5DMGD 4X6DF 1FO0L 1J8HA 5K9OB 4M5ZL 3RTQC 3QIBC 5ID1A 3TYGH 1P53A 4Y16D 4MMZC 4KKBD 1RK1A 2BZDA 5TDPA 3BUTA 4K7PY 3IVKA 4QRTA 3B5TA 2E27H 4P4RB 4XCYA 3TESA 1OSPL 1UH3A 1I8KB 3DETD 4GUPA 5F7WC 3ZE2E 2NZ9C 3ROOB 5CHNB 4PS4H 4BSWA 2X89A 2ITCB 5IK3B 2PN5A 1WZ1H 1TTGA 5F7UA 2APWA 3JUZA 5A3IC 3GM0A 1KUMA 5T3ZE 3K1KC 1A6UL 1I1CA 4NBZB 4RDQF 4JKPH 4GG6B 2F54E 1CFQA 5DK2A 4NQEB 2DJSA 5GIRB 5LWYH 1HHKB 1DQML 4S1RL 1F4XL 2DM3A 4UNTA 1TQCB 2QLVB 2YA0A 2P4AB 1WWCA 3M8OH 3VGDA 2ZZUT 4NQCB 4CNIB 4OLXH 1P2CA 1BQHA 1GH7A 4X6BA 1G1CA 4JDVA 4L4TD 3TO4B 1LP9B 3CFKB 2BRRL 3RGVC 2AGJH 1FFNA 1EERB 5GRWA 5GS0C 3QNYA 2KKQA 4RSVA 5F3HB 2F53A 3VJ6B 1AC0A 1Q9OB 4R4BA 4LQFL 2E3VA 1NGQH 3AXLB 4P2QD 4XNUL 1F2XK 3EYOB 5IB5B 4PRPB 4JHAH 4F33A 5CZXC 3K2MC 2JJTC 3CSBA 3EDDA 1IEAB 3O8XC 3TT3H 2X41A 1Q9KB 5EN2A 2E7MA 3MBED 4KZDL 2X4OA 3TZVB 4BM7A 4PRPA 2XFXB 3H3PL 1J10A 2R29H 4NZRL 2XY1A 2MKWA 3HN3A 1L6XA 1HSAA 3LCYA 2QL1A 4ZTPL 3DV4B 1PZUB 4IIQA 4UTBH 2VIRA 1AXIB 3L3OA 3VFPA 1WIOA 2IPTL 4AK1A 4HS8L 4TVPE 5DWUH 1X5IA 1U8KA 3O6KL 3CX2A 3MV7D 1PQZA 4OTXH 4XC1H 3SCMC 3U83A 3TGXA 1T4KA 3P40A 5C0EA 4DVRL 2X4TB 2R8SL 5HGDB 5A1AA 1MH5B 1JE6A 1BX2A 1FGNH 4YBQC 3L3IB 3MREA 3BDBA 3QHTC 3TEUA 4OKDA 1H15A 4ZD3H 1OCWL 1WV7T 3GB7A 3UTSD 3X3GL 4DGVL 4GS7B 4ODWB 1IT9L 4M4PA 1FL5A 2RGSA 3L5WB 2QHRH 1NFIA 2F8XC 3FOMB 3VU2A 1MY5A 2AJYL 4JR9H 4XBPB 3UJJH 4RMWA 5DUBA 4J4PC 3Q0HA 3I84A 4F9LC 3ARFA 1FNEA 4MCZB 5I75B 4KMTL 4LPYA 5GS2H 4TOYH 2RR3A 4Y16C 4NN7B 5DYOB 1YECH 4PRID 2WWKT 2X9YA 2V9RA 1F6AA 1Z0NA 5JPNA 3CVHL 2B5IC 2X6MA 4XP9L 1EHLH 3ROLA 4JN1H 2W59A 5CIPH 3MRIB 5KZCB 1ZE3C 1SVCP 4M1GL 4S2SB 5C0CB 1LO2L 2FJHA 2V7NB 1MFDL 3MJ6A 5DA4A 1FP5A 1NMAL 3MGTA 4G8IB 4AH2B 1YJDL 1T1XB 4WEMB 4FQCL 5BRZA 3HE6C 4WEBH 3NCJL 3G5ZA 4MXWH 4K3GA 1YEGH 4Y5VA 3EDEA 5EO9A 4FTVE 1H0DB 3FOLB 5ADOH 4ETQA 3DXAE 1CZ8H 3T2NH 1ZT1A 3WLWD 3IJSA 3RDTD 3QG7H 1BBJA 5IEHA 5E2VH 2CH8A 3D85D 4JZJB 4QRSA 3VA2C 5HYSB 5DQ9A 4CW1A 2HFTA 5F3BA 4G6FB 1FG9C 4HD9A 3DGGA 1FFRA 4XP1L 2V2WB 4DTGH 1MCKA 5GS3A 1C8PA 5KS9F 2R1WA 2R0LL 1T1ZB 5LJYH 4BH8B 5JLZA 2DQTL 1IEBB 1JRHI 3ZYZA 5KG9B 4NQCE 1ZANH 4KKLD 3X12A 2FJFA 5DRWB 1HNGA 1SJEB 3OB0K 4V1DE 3JWDL 4M6NH 5B3JF 3GIZL 1HHIA 3L3JA 5F7FA 1ZAGA 5FUCE 5KG9A 2WY3A 4RAUB 1MCRA 1FVCB 3TBTA 3BKJH 5IJVA 5FYJD 1E6JH 3FQXA 2YC1B 5I17A 4HK0B 2NX5E 3CU7A 1VERA 1RPQA 1WUNT 4OFYA 3CFEA 2FO4A 1SBSL 3NPSC 5I8CB 1CDBA 5HPMA 1FL6B 5EC2B 1YPZB 3W2DL 1I1FB 3H6JA 3TCLB 3OJMB 4JFEA 1WEJH 2P24B 4ONHB 3E3QE 4JKMA 4Y4FB 5FM5M 5GRZA 2XZQL 4XXCA 4GAFB 1PSKL 43CAB 4ORGB 2X44D 4TVSa 1U92B 5M7QA 4MQXD 2AXHA 2O5XL 3TN0D 2DQDL 3QXAA 3MJ7B 2IAMC 1Z9LA 3REWA 1YNLL 1TFHA 1F13A 4I8DA 3WXVH 1KEGH 4LHQB 2M2DA 5JTWA 3UXFA 4M48L 2R4SH 3P11L 3A67H 1N2RA 5CGTA 4XWOC 2BSSB 3FAXA 2YRPA 4DKEH 1JZ7A 1TMCB 4O5LL 4TUOB 5EO0A 2KQMA 5F89A 1U91B 3FFCA 4HX1B 4CW1B 2QQQA 1I9JH 4HH8A 1ZT4A 5I19H 4PRBA 4LCIL 2Y36H 4P5TC 4ZOEA 1PYWB 2R1WB 4HWEH 1HH6B 4GRLA 3VRLF 2W07A 1P1ZA 5TE4L 3LN5B 4G3YL 5I1JH 3K2UL 3RP1A 5D1ZB 4CU8A 2P5ED 4PJIF 2X09A 4K3HA 3ZZ1A 1CN4A 5I15L 4N0RA 2O26U 1JWSA 5T1LB 1S7SA 2CIKA 1TZIB 1OM3H 3MRQA 4L4JA 4L9DA 2BVQA 4HFUH 4LFHD 5JW3H 5DFTA 3HZYA 3MLZL 2DQGH 4TVPD 3T09A 3U0WH 4AEEA 3MLRH 3ESVF 3X17A 2C3HA 1KB5L 1IL1B 4KTDL 2H6PA 1EX0A 3H9HA 4P5TB 1JF1B 4DUWA 1CS6A 4HS3A 4F37F 3DHJA 4ZS6C 3VFRA 1L9MA 3P73B 4D9RE 4YHML 3QWOA 3GMLA 2DKUA 4YO0B 1RJYB 2HLAA 5CBAB 4X7CC 1G7JB 1I8LC 4U1MB 4U3HA 1N5YH 1I7ZA 5FGRA 4B41A 4U1LA 4BZ2L 1O5DT 2ZCLL 2ESVA 1SMAA 1CXLA 2N7BA 1ZOXA 2YD7A 1JGVH 4LKXB 4NO3A 1IGYB 4QHLA 3SE4A 1AKJB 2JB6B 4MQTB 1BQHG 1NFIB 4EIZC 2B1HH 4PRIA 4DJMA 1SJHB 1WAAA 3UTTA 3QIWB 5CJOH 2VLKD 1YEHL 3OX8A 3NIDE 3QUYC 1QP1A 2C5DC 2RCSL 2Y1VA 1EBPA 1D6VH 1F4WH 4NRXB 3VXSD 1JGUL 3DVGA 4TSBL 4OF7A 3QUZB 1FO0B 5ALBH 4KI5E 1KJVB 5DK3A 3BPNB 3BPOB 2R0WH 4IIQB 3S88L 4YDJA 5BRZD 2X9WA 3ULSA 4JRYD 1K4CB 2CJUL 2NY1C 5EBLA 1N0LA 1BQLL 4QHNA 4R26H 4D94A 1A22B 1H8SA 3GGWB 4X4XB 4KJWD 4Z7UA 3OV6A 2YD5A 3RWDA 2EDHA 1NGWA 3GMPA 3RWFB 2BMKA 3BSZL 2PXYC 2XFXA 5CCKL 3GSUB 1SY6H 4XHJC 2AEQL 4OCYL 2PTUA 4ZOAA 5EDXA 2NY7L 4XVTH 3TH3T 1RJCA 4PJGA 5ISZA 1RK1B 4HWEL 4TSCH 2X1OA 3F7VB 3L5IA 3EYOA 1A5FL 4LK4A 4NO2A 4EJ1C 4ZSOB 2QSTA 4Z7VF 2NXYC 5D1XB 2IPKB 5E4IA 1Q9OA 4R4BB 3PABB 5IESH 2X5PA 2FIRT 5GHWL 3MC0A 3PP4H 3QUZD 3HUJB 3TBVB 1QO3B 4NRYA 4GXUN 5DVKA 5CSZB 2DICA 3VG9C 4JN2B 1JNHA 2Q3ZA 2R0ZL 3I50H 4I0CC 4UIKH 4GG8A 4K3EH 1U3HD 3C2SA 5B3NA 3QUMB 2CDGA 3ZE1E 4NWTH 2DQCL 1ED3B 3QEQA 3OMZA 5HHOB 5FGCE 3TFKC 4U1GC 3S36X 4PJGB 1ZLSL 1JYXA 3CFBB 1A0QH 2BFVH 2DLHA 3LD8C 1HZHL 4MXVF 3P3YA 1CXEA 4Y19A 3MLUL 1R24B 3D25A 3S5LB 1NBYB 3BKCH 4E41A 1KTRL 4MAYB 1D5MB 2WIIA 1F3DJ 1U3ZA 4NKQB 4P2RB 5CBEA 3P2TA 4C83A 1LO5A 1QSEA 4D0BB 1G0YR 5B8CB 1RUQL 3IJYA 2ZUTA 2FYYA 1U6AL 2XN9A 1MFNA 5H37H 3RDTC 3VFTB 1OP5H 4YZFE 2RJMA 4LDOB 3VWKB 1I3RB 1KIRB 2ZUYA 1EO5A 2XKSA 3T3PF 3OXRB 1WLHA 4F7PA 5HSFA 3IVKB 5IFAL 1A7OL 4Z7WA 4D0DA 1HI6B 4ODXA 5DC0A 1T0MA 3LKNA 3PL6B 1M1SA 3QZWB 3T2QA 5GS0H 4WO4C 4RX4A 3BZEB 4OZIB 1HNFA 1A1MA 4YH6A 2YA2A 1DEEA 2VAAA 1ZHLB 4HDIB 1HILA 4N5ED 1ZS8B 2AABL 3QRGH 2Y07L 2CLVA 1G84A 1IZKA 3QUYA 3MRFA 1QNZH 5IB1B 1DL7L 2QHLA 4MD5A 3GSRA 3NCBB 3U46A 1CD0A 3DIFA 4YGVA 1TETL 2HTKD 1EJOH 3BO8A 1D5XA 2VXSH 3LY6A 4MDIB 3RIFK 1Z9MA 1I8MA 3EJJX 5C0JB 4PJHF 4OBSA 4QWWD 1QACA 5FUZL 1UM5L 4U1NA 2GTWB 2Y07H 3T2NL 4I18A 2R9HD 4ELMB 3DOSA 4CVZA 2ZUQB 3U9UA 5ACZA 1BOGA 1B2WL 1OAZH 4EVNA 5F96H 3UDWC 5F71A 1V7MH 3BP6A 5LVEA 3VWKD 4IS6B 2CO6B 2F19H 1ZHNA 2QQNH 1IFHL 4J1UA 1KG0B 2NLJA 3EJZC 2W0LA 1U8MB 1C1EH 2XTLA 3ZDXE 4YR6A 3ULUD 1K4CA 3QFJD 4G43A 3PQYB 3QDHA 4YDJB 2Z9TA 1Q94B 1JGLL 1SYVA 3ARDC 2H45A 3QG6A 5KSVB 3X11A 1F00I 4U3XA 1KENL 5EUOA 5IBLD 5L2KD 3QH3B 2DI7A 2OLDA 2YMXL 4NT6A 4PRNA 3IJHB 1JUFA 4L4VE 5E8OB 3UBXA 1NLBL 3IFOA 5JNYA 3GSWA 4M7JL 3DSNA 4QRRB 2AJYH 4JR9L 1CGWA 1ZT4B 3WCYA 2WLYA 1KCLA 2PTVA 4HUUB 4R97C 3VXOA 4HKJA 4QHKI 4EI5C 4HG4K 3ALXA 3C2AH 3QCVH 2OR9H 3A67L 5CZXD 3B5HA 4R7DB 4Y2DC 2VABB 3BP7B 5CGYD 4YAQB 5TQ2L 3OJ2C 1J8HD 3U4EA 3IDXL 2IALB 3SDDC 4NZUL 1D3CA 3FQRA 4JG1H 3MO1A 3OAUH 2AEIT 4RRPG 2DLGA 4X0KB 1A7RH 3OKOA 5GHWH 3MFGB 3T8XB 4IM8A 4ONFH 4UDTA 1LO0H 4GAYA 5DVLA 4EUPB 4FQ1H 3RA7H 3ULUC 4JO1H 4PJ5A 2A77H 1H9VA 3V52L 1A6ZB 1BP3B 2W60A 1M05A 3MYJA 5J12C 3RUGB 4ORGA 4P9HC 4K94C 5C0DB 1GAFL 3HI1B 4KKAC 3DX9B 3DX6A 2G5RA 4P48A 2BNQE 2C1OB 1MFBL 1QBMH 3MV9A 1Y6MR 3ZMRA 5KAQG 3DTXA 1W0WA 3L95B 5SWZB 5E1AB 3ARUA 2X40A 5GGRB 4RWYH 5IHBA 3HZMA 4YIQB 5F7MC 1C7SA 3PQYA 1RUMH 3O3BA 2VLJB 1ZA6B 4M6NL 2G2RA 2QQLH 1RJLB 4JGJA 1DQLH 2J5LC 3B5GA 3NIGE 4WJ5A 4BSJA 4YHYC 1KJMB 1Q72L 3BPNC 3BPOC 4LGPB 2LQRA 3FFDB 4N5EC 4ZNCD 4LNRA 4X8JB 4OD3L 1MCIA 4JFFD 2PW1B 1VKXB 4MA3B 3SQBA 2DQUH 1PG7L 1WFUA 4HEPG 4JKKA 1DQLL 4KGLA 1MVFA 1D9KB 2HT3C 2NYYC 1KPRA 4TQEL 5IFJA 1R3KA 2MNUA 3P4OA 3V5DA 4Z7OF 1KIPA 1XGTA 3WS3A 5E70A 2XI9A 2I25N 4E41D 5F3BB 4PLKD 4NQXB 3SDDB 4YGVB 1BPVA 2PYED 3F7PC 1RIHL 3EDJA 1R0AL 1TLKA 3BX7C 3GHBL 3MJ7A 2HVJA 4JANB 2OXGA 5ESAA 3T0EC 2IPUK 4UUJA 1FZJB 3NA9H 4IIQC 4G7VL 5DK0A 3M1BA 1QHOA 1J5OL 1OSPH 1W72B 1FLRL 1QYGL 4UU9B 1MIMH 3LEXA 3D0LB 5FYKH 4PD4K 4KY1H 2BVOB 2A73A 3I9GL 1L0XA 1FL3A 2Z93A 1GC1C 4GRWH 3ZT5A 1OLZA 3OHXA 4PB9L 1JPTL 3THMH 5F7KC 5DD6B 1QVOB 1BF2A 4WUUA 3MV9D 5GISH 3QIUB 4NKDA 4PJDE 4R96B 1HHHB 2EZ0D 4OZIE 5I16A 3ULVD 3O0RL 2WWKO 3MBEB 2VKXA 4FNLL 3DBXA 4XPBL 3WHXB 3D39D 4GH7B 3LS5H 4JFFE 2EYTA 1JTTA 1T21A 1T04B 1HDMB 4UT9H 3PE9A 2ZUQC 1FGVL 4ODWA 3CFBA 3ARFD 4Z7VE 3ARGB 1GC1L 4MJ6A 4D2NA 2HJKA 2HFFB 1JIBA 3GMOB 1WIUA 3B8SA 4U6TA 5DHYB 2BVUA 3PWPB 1JGLH 1I3UA 5DI8A 5HDBE 1MHCB 1UQSB 1JNHB 2PYEE 3NFPB 5ESVB 3FHAA 3B6SB 3KGRA 3LN4B 5H35B 3C5ZD 4X99A 5IVXB 12E8H 4X9BA 2OM5A 3S34H 2VB5A 4JM4L 1X5ZA 2CKNA 3NOIA 2VZ1A 3EJYC 5EOQL 4G6ML 3IDXH 2A9ML 4RWHA 2MWCA 1FHGA 3PXHA 4ZSOA 4P46C 2J88L 3IXAB 1RIUH 2OK0H 5FOBB 1H8OA 4M4RA 5EOCJ 2NW3A 1PX4A 4MCYB 2HMID 4YHKH 5KTEL 5FK9B 1IKNC 4JFDB 2ZJSL 2VXSL 4U6HB 4HGWA 4LPCA 3MFFA 3EO9L 4PRHB 1T7WA 4LGRB 4N1EA 3QXDB 3AXLA 5KVEH 4OLYH 1P4BL 3AS3A 4LF3B 4LU5H 4XGZA 3QIUC 3GJEA 4FXGB 4JZOA 5B22A 2Y7QA 3FOMA 5JXAL 3VD7A 4AIZB 2VDQL 2A6KA 4GO6B 4G8FB 4F15B 1AGDB 2W9EL 3T1WA 3UZEA 3MLPA 3CFDA 2YWZA 1IGCL 4OQTH 2XZCL 4LP4A 5BOPA 1C1EL 2GFBB 1CXKA 1BVLA 1VENA 4YC2C 3QUML 2DQJH 2BVYA 3IRPX 4LEXL 4NKMA 4JJHA 3Q3GA 4OFYD 1RZKC 4MA7L 1EFXA 3G9VA 2C3GA 3KNBB 3UTTB 4L8BB 4XVJL 5HDQL 1ONQA 5HPOA 3GO1H 3V7MA 2DQTH 3CD4A 3MR9B 2EZ0C 4L9LB 4NCDA 5HI4C 5J8OA 1OTUC 4R2GB 4PJ9C 4GQ9H 4XRCB 3IETB 4HQQL 5CD5C 3MCLL 4V3EB 1EMTL 3R06A 1G9ML 1TJHL 4C56E 4HIIB 5HYQB 4KRPD 5MEQB 4ELKB 2CKBL 3CDCA 5C92A 3C09B 3VFWB 1LD9A 1CGXA 3CVIH 3UYPA 2YN3A 1QR4A 5F9WC 1QRND 5CGMA 2Y5EA 1BD2D 3BQUA 4OCWL 3SQOH 2ADIA 1DUYB 5FUOL 1QR1B 3L3GA 3QFJB 3LHPL 4IOFD 5HYFA 5K9JL 1EAPB 5EO1A 1CL7I 1NGPL 4HLJA 3P0YH 5K93A 2OQJB 3G6JB 4GKSA 4IOFC 3EAKA 4FZ8L 4LSQH 4HUXA 5C8JA 1ES0A 4KPHH 1U0QA 1DE4A 3QQ9D 4YXLL 1Y6KR 2Q8AL 5JA8B 2JJSA 4ZS7H 4MMXC 4WENB 4URTB 4LHJB 3ZDYE 5IBUB 4KROC 5SX4I 1EFXD 5KSBF 3RHWF 3TPUE 3MLYH 4ZFOA 1NGZB 1K4DB 4WI7A 3QIBB 4GRLC 4HIJA 4XAKE 4W68A 5D72L 5C0GA 5I1CL 1XR9A 2GSIB 4MJ6B 3PGDB 3T1FB 5GGQH 5LQBH 2YEZA 2BNUA 3KYNB 4M62H 5F1IB 5TDNA 1ZLWK 3KYAA 1HDMA 1MJUH 4X9IA 4TSAH 1H3UA 2DBLH 1N64H 2BHYA 3NBNA 4I4WA 5I30H 4KXZI 4NHCL 1LK3H 3O3DB 4O4YH 1ZHKB 1CR9L 1H3WM 5L8KB 4HH9A 4IOIA 1F90L 1HQRA 4I5BA 1YN7A 4O2FB 3DURA 1I8KA 1N2RB 2BVEA 3FO0H 3X3FH 5CMAA 1AR1C 2R8SH 4BQ9A 4WUUB 3MGOB 2EDWA 3U36B 4WI5A 4XCCH 3I02B 4ZOCA 3VXUB 5E6ID 1JRHL 3FCTA 3AUVA 3PWNB 4MB4A 5I2IB 2IQAA 5E8NB 4JRXB 1NEUA 4G9FA 2W9DH 2FEDC 1IKNA 3TCXA 4UQ3B 1U3YA 1J87A 1F4WL 5ID0B 4MD4A 4ERSH 4GMSL 2FX9L 1UXWA 4G9DA 3WS6A 2WINA 4KUZL 4JFDD 3HNSL 4V1DB 2ADFH 3ZE0E 3ZKND 5CINH 3H3PH 1AFVL 2CDFB 4M6ML 1ZGLB 1E4XH 1KN2H 5FF6B 4PV8B 2JELL 2HFGL 1JGVL 4OKVB 1SQ2N 5DEFB 4MJ2A 3E8UH 2YS4A 2ZUSA 1FFPB 4UINL 3S35H 1LQVA 1AJ7H 5EWIH 5F7EH 2VNCA 2WAHA 2WM0A 3ESUF 5HVGB 4XNXL 5DK0B 1OGAE 2DWDB 2P48B 5CCKH 3ARQA 2ATPB 3QHFH 1MCCA 3CH1A 1KTDA 3ZTJH 3VXMB 3C6LB 1XGTB 4X98B 1LDPL 5H8DA 3VFMA 1IGIL 3UYOD 4PJ8B 5B38B 1KCSH 1X5YA 1IE5A 3VRJB 3H42H 1S7XB 2GT9A 1YQ2A 4HWZB 3TLRA 2VN7A 1BJ1H 1R3IL 2R0WL 4OD2B 4NNPH 4HXBH 1KC5H 4YBLB 5DRWA 4JY6A 4Q6YA 1XR8B 1U8PB 3CDGA 4Z7UF 4N9GB 4ERSL 3SKOA 5BZDB 4NM4H 4L3AA 3B2UD 4JFOB 4JY5H 2PW1A 4LMQI 1ZA6A 2ZUUA 3HI5H 2E7LA 2LFGA 3WD5H 4HXBL 4DW2L 5EOTA 1MPAL 3L5XL 1RUKL 3KPNA 1SM3L 2GKIA 5BRZE 4WJ5B 3JWOH 4MNHA 4P3CL 5TDOB 4IMLA 1Z6JT 5E8PB 1K5NB 2ADGB 5I1IL 3VXRE 4BQBA 4GAGH 3JWNC 3SE4C 4BA8A 1I85C 4D9QE 3WNMA 2X70B 4Q0XH 4YPGA 1C08B 1EHAA 4JPKH 1BF8A 4GMTL 3OJDB 3CDFA 3QHFL 1MCDA 3A6BH 5BV7B 2YZ8A 3P4MB 5D1QB 4QXTB 2R1YA 2E9JA 5T1DH 3QNZA 4FZEL 3G5YA 4NO5A 3GSNA 1C5DB 1ZT7B 4UOW1 4KK8C 3O9WC 3FQNB 4RFEA 1TVBA 2BC4B 4FQQA 1BECA 3TNNB 1B4JH 35C8L 1J0ZA 5DDHA 1RUPH 2ADFL 1LDSA 3GRWH 3JVGA 4QRUB 3O3AA 1HOCB 3DUUB 4JLRB 1S7WA 1D6EA 1N6UA 5EZOL 5DO2C 2O5ZH 1RVFL 4YK4C 4Z7OE 4KPHL 4PGDA 5EFIA 5JO5A 1TTFA 1AQKH 3QQ3A 4U49A 1MY7A 2AV1A 1J05A 1B0GB 1NUFA 5D7IF 3O6LL 4YHNA 3L5WA 1UZ8B 3MRNA 4JHZA 5CJ8A 5GGVL 5I1JL 3E6FB 5MP6L 2BSTA 2FLBT 1AGFA 4XNZB 3GNML 2IH1B 2A0LD 4HZAA 2VKWA 4QXWA 4OIBA 4ZO9A 2H8PA 4OLZL 2UWEE 2BCKA 3F7YB 2J8HA 3WYRA 5E24E 3PWLB 1EGJL 1JZ3A 4OFIA 3TN0A 4BUGA 5LXGL 3LIZL 1LEGB 5DURB 2NQCA 2DTML 3CJJA 3O3UN 3VRIB 5IHLB 3KXFD 1T03L 1SYVB 1Q94A 4L8SC 3MACH 2F54D 5LAXA 1AD9B 1WWWX 4MA7H 4WV1A 1LO4H 4YR6B 3FONA 4QXGL 2AXFA 1PX3A 3UO1H 3KYMA 2YD3A 3V0VB 3IDIB 5J3HD 3OKNA 2DLFH 5BMFH 1EA9C 2VDNL 1NCDL 2W9EH 2C3VB 2DOCA 32C2B 3PGCB 1VPOL 3QEUB 4E42A 1NAML 4S1SL 5HHVL 3V5HA 4QTIL 1BWMA 1A7NH 2E7HA 1NAKH 2B8OT 1NCUA 2F53B 3JV4B 5JIPA 2PR4L 1AD0A 4JFPB 3BH9A 1VA9A 1N5AB 4MD5B 3FQTA 3ECBB 4RGND 1Q1JL 5HXMA 2VQ1B 1TCRB 1EJ6A 3V6OE 1IQDA 3QZWA 3SGEI 5ACMA 4QNPF 1AXTL 3U2SB 4KZEL 5D1ZD 1KXQE 3VFUB 1DDHB 5IMOB 4ZUWB 2VDML 1LE9A 3RY4A 3CIQA 2PCPB 1XF1A 1V7NL 1LO4L 3UTOA 3SJVD 1L9NA 1YECL 2G60L 3RTQD 3RZCD 5DMGC 2ORBL 2QJDA 4JPWH 3GMQA 4U33A 4ZYKA 4J23A 3BN9D 4WFFE 1NCAL 1NPUA 1A4JA 5BZWA 3W39A 3VXUA 3EDFA 4XPAL 5DJ6A 1D5MA 3B9KC 5ITFA 4HZLB 5D7LB 4DGIL 3ARDD 4PJBB 1MHHA 1G9NL 3G9AB 3OPZH 2MCG1 1OCWH 2JJSC 2PNDA 4MAYA 3C9NB 3RY6C 2N1KA 4Z5RB 4LLUA 4NO0A 5DD3H 1MCEA 2DMKA 4WUUD 3UPRB 1BGXL 2QBWA 4FXKB 5L0QB 4GLRI 4JHBA 3T1FA 2ITDB 3E2HC 4HS6B 4QOKD 1M7DB 3OG6B 1UEYA 1EUTA 2NNAB 1BWWA 1PDKA 3HG1B 2O5ZL 3PDDA 4N0YH 1A9EA 5ITBL 5F21B 2Z31D 5ALCL 2XG5A 4OCRL 5JQ6L 5ISZD 5CUSH 5JQ6H 4KMTH 4O51B 4XNQA 1U8QA 3BXNA 5C8JB 2ITDA 4HS6A 3TT3L 3HUJF 3G6JA 1MCOH 3U9PH 2QADD 1FFOA 5GGSY 3KPMA 5HYIA 3ZTNH 1PG7X 3QFJA 3VH8A 1EO8H 3MRCB 2DQHL 4OFKA 1XGQB 1CDHA 2Y6SD 5TF1L 4Z7UB 4M5YH 1JYWA 5AWNH 2DRUA 3VFOA 1I7TB 2HH0L 2LVEA 4YBHA 2WK2A 5ICZB 1UWXH 3R06B 2Q8BH 3TF7A 1LQSR 4BSVB 4RGNE 1F6LL 2HA1A 5IR1A 2I5YL 3QDJE 5BJTA 4MVBC 5I6XC 3QI9B 2CK2A 4NM4L 2V5TA 3C09C 3RL2A 3PWUA 1FC2D 1OVZA 1P84J 3GSNL 4NKIL 3VXQB 1GGBH 3WNNA 3LEYH 2JK5B 5L0QC 4KMLB 1KIUA 3C8KB 5CP3H 5FGBC 5C0CE 1KCSL 4PJ9B 4Y88A 4H20H 1A4KA 2X4NB 3SE3C 5CEZE 4X6DB 1YEEL 4LASH 3RJQB 4DK3A 1N5AA 4OT1H 4Y5XC 5GZOC 2W38A 4E41E 4Y19D 3T4AB 1IGYA 4PDCE 3ZKXC 4YEFA 1G1YA 1FG2B 4X5XA 4JEGB 5IQ7L 1PG7W 2NCMA 1MFEL 2QR0B 3UP1A 5KS9B 1AJ7L 2HP4A 3AMKA 3T65B 1NC2A 3PGCA 3BPCA 3QFDA 4A6YB 1KIQA 1U3HA 2XNAB 4U6HA 2EXWD 3SKUD 4OLXL 5D5MA 1QKZL 2EDQA 4F3FB 3RU8H 1CTOA 1HSBB 4NRZA 4FQQB 2AXFB 1LK2A 2I9TB 4PY8J 4QO1A 3PGFH 3L9RA 3LSOB 3ILQC 1PY4A 3ZL4H 5HI3D 3N9GH 4ZTOH 2XTJD 4WDIB 2JCCE 3E1F1 4XHJD 4RX4D 1U36A 4U6YB 2YPLD 4PJHE 3MRKA 2NXZD 4NNYA 3BP5B 3HFML 4Q9QH 2ILLA 3KPPA 3LN5A 4I9WD 2V2XB 3BW9B 4LLYA 4M61B 4QGYA 1CLZL 4ACPA 4PJCE 5CLTA 3SPVB 3WFHB 4DN3L 3WFDL 5EU5A 5L2JB 1DQJA 1S9YA 3RVUD 3UC0H 3IXTB 3TJEH 1IGFL 5GRVL 4XAWL 1TMCA 4PGBB 1T7XA 5E0QA 3HG1D 5IKCB 3IFLH 1FFQA 3O6FC 4KHTH 1E28B 3HS0B 1MCLA 1YJDC 2ZWLT 3X14A 1NUDA 1PZ5A 4GSDH 1JN6A 1B88A 2EE9A 3E2HB 4N0YL 2Q8AH 1EV2E 1X4XA 2R4RH 3ARGD 1XCTA 4POZD 1NCBH 2XZAL 5D7KD 4QRUA 1A6PA 4EN3B 3QIUA 4NBXB 5IBUG 5T3ZL 3SBWA 1VEPA 3KDMA 2F19L 3D87B 2AJVL 4CADB 3TNNA 4HG4J 2BC4A 1V7ML 2OSLB 2PETA 5IWLC 3SDCB 3ARFC 1TJIH 5F7DB 4L4VD 4PJDA 1MI5A 1BQSA 3RZCC 5KJRH 1JV5B 3EYQD 4M93B 2P47B 3ZSSA 3IF1B 3F62A 4UUJB 4HPYH 4PGJA 3ZE2F 4L3CB 4ODSH 2VLRB 3RUGF 3ARBA 4PJDB 2QKIB 4KQ3L 1QLRA 4ZUVA 5ID0A 2ADGA 2IWGA 4KDWA 1BZ7A 1Q8MA 2W9LA 2OSLA 2R2BA 1UT9A 5I8CA 2NY3C 4D0CA 1SVZA 1UB5B 2G60H 3I02A 3HE6A 4XVJH 3QDGE 1T6VN 3BQUD 1V7NH 4IMKC 1NGXB 4HJJL 5EU7E 2FBJH 4WW2C 1C16B 3LRHA 2AXJA 1BFVL 5F72S 1ZA3A 3R4DA 4OGZA 4OGAC 5IEKB 5E2UH 5EORL 4X6CE 5D9SB 3MYZA 3O9WB 3JXAA 2W91A 4QNPE 4JZJA 2BNUB 5KS9E 1RUAH 1T1WB 1RJLA 3VFMB 3CH8A 3KPPB 3MRHB 4KDTA 1QLRB 2HYMA 2QSQA 3GI9H 4LOUD 4Y5YB 3WXWH 4Z7QF 1NFDF 5EIIA 2JB5L 2XQBL 4XH2B 4WTXA 5L2JA 1MUJA 4XWOD 3JWOC 4EI5B 1VCAA 2PW2B 1I9RL 3ALWA 3RWIB 4C4KT 1JL8A 2EDDA 1ADQA 3DVNB 1IM9A 3KVQA 2JCCF 5SX5H 5F7NC 5IROA 2VDLH 3MRIA 2CQVA 3O6MH 4K9EL 4K8RC 5BS0B 4GKSB 4U3CA 5IW1B 3MGTB 4G8IA 4ZFZB 5EOQH 3L3HA 2R0KL 5E5MA 1F3DH 4MD4B 4XB8A 3VD3A 3L3GB 3MV9E 5KSAC 1INEH 1ZVSB 2EDJA 5GS0D 5FM5O 5IVXE 4K8RH 4ISVA 4I0PA 3G5VB 1JTOA 3PP4L 1KFAL 4I2XA 5F7LB 4I3SL 1QRNB 5DQJA 2A83A 2HT4D 4RA0C 3VI3F 3UTSE 2WIMA 3MXVL 3HAEH 3NACH 1FNLA 2VWEE 3GBML 4I4WB 3MBXL 2W0KA 2VTFA 3U6RB 2W65B 3LKRB 3R0MA 1RUQH 5B21A 3W5MA 1GC1H 1HKLL 1PBYA 3FO0L 3IFLL 2ZCHH 4LVOB 5KOMC 5EC1A 4C56B 4KWUA 2R9HC 3T4AA 2AEWA 5FHAL 2HLFD 4KJYA 2GUOB 4PRHE 1BFOA 1HN1A 5FKAB 5C0RL 5L8JB 3WFDH 1INDH 1UFUA 5IFHH 2RFXB 4PJFF 4O58L 5SX4H 1CFTB 1B90A 1J7VR 4OV6F 5CS7A 1K2DA 2GFBA 3EHBC 3RX8A 2VXVH 3HZKB 4MAUH 4BSVA 5JHDE 3SGKA 1IC1A 1QSFB 2OJEA 4U1KA 1OAQL 5BVJB 4NPYB 3KYKL 1A6AB 4OCSL 4KKBC 5C0AD 5KANG 1QRKA 4LKCB 1Z3GH 3O4LD 4HW6A 5K9QG 3SY0B 3BMVA 4OLUH 2ZUVA 4NUGL 1T5XB 1HSBA 4NRZB 4U1IB 5HJ3A 1KV3A 4NGHL 3NFSL 1N3NB 5EBMB 4PJ7A 4F57L 4G7VH 3KPSE 3VFSA 4NWUH 4WI3A 2DQIL 4P2RD 3SDAA 3GRWA 5AG8A 4XMPH 4KK6D 5DD5L 2H2SC 5BQ7B 5I1IH 3PIQA 1MFEH 4PLJD 1U8QB 4XNQB 1A6AA 1S9WA 3BO8B 3WJLA 3DIFB 4MD0A 1FFOB 3BSZH 3MLSL 5AYUH 1UENA 4Z8FH 3KWWB 5F6IB 1NEZA 3LKPA 1N59B 4NP4L 2ED9A 4FFWC 4X6EB 2WBJB 3GSXA 3IU3B 4X6CB 4H20L 1YEIH 2Y4SA 1E4XI 6CGTA 4WHCA 1MAML 4X6BB 5GRXG 4AQOA 3HB3D 4QT5A 5KOVC 3ZHKA 1A1MB 1MHCA 1UQSA 3Q3GB 4O00A 2XWBA 2VR4A 1N4XL 3CXHK 5BCAA 1U3HC 2NY6B 3QI9A 3WFEH 4ODXB 5DHYA 5TH2A 4YDLC 1IGIH 1ZVYA 2NNAA 2DQGL 1HHKA 3C9NA 4CVXA 1M7DA 3KLDA 4CUCA 5GIRA 2P44B 4C59B 4PJXB 4HFUL 1T20B 2AAVA 3FJTA 1F11B 3KXFB 5C71A 3BEVA 5I8EA 3QNXB 4KUCD 1G7QB 2K3TA 1J1PL 2X4QA 4M6OL 4O02L 2FEDD 2CKBA 2ZPKL 4P4RA 4XCYB 3BDYL 4JJ5A 1Q0YH 4Z7WE 3RVTD 3PL6C 3HPLA 2R2EA 4PJHB 4DCQB 2I60H 3K2UH 1MFBH 3IDUA 3QULA 1A6WH 4NJAL 3MRCA 3G5VA 1OP3K 4HGWB 3DGCR 1RZKH 5FYLE 3L3HB 4KUZH 1V3MA 2F74A 2IEPA 4B7IA 4OLYL 4L4TB 5GJTL 3SOBL 1RZJL 4P2RE 4PG2A 1FZOB 1LO0L 4L8SB 1UCTA 1G7HB 5C0FA 3U30C 2MJWA 2C4FT 3TWCL 4FQXB 1UXSA 1NBVL 3T04D 2CO7B 1IAIH 4Z77A 2VDRL 5FA3B 4JDTH 4O2CB 3PJSA 5CEZL 5F88B 1YY9D 3O2WH 4OFVA 3KPLB 5DUML 1N64L 1IAIL 4KU1A 1OTSC 3DUSA 4JGMA 3UPRA 4M7LT 1A3RH 5GGSB 4XCNB 5J6HB 3LV3B 3RPKA 1S9WB 1IC5L 3JSSA 4FQ2L 3HI6L 3ZKNC 2NY2C 4TNWK 4Q6IA 4PGEA 4WHTA 4R7NA 1CG9A 2NPLX 5KSAB 3TBWB 5JHDB 5JUEL 5DRNB 1NGXA 3Q5YA 3PQYE 4Y2OA 3GMPB 1U3JA 2BOBA 3MUHL 3V4VH 3RWGA 4LKCA 5DZLA 1MREH 2X4RB 4Y4FC 3D48R 4LDEB 4L4VB 5E9DA 3EFFB 3U7YL 1OAKH 2Z8RA 4RMUA 4ZUVB 1X4ZA 3C6SB 1FAIL 2NY3D 2E7CA 3UPCA 3DETC 3NIFE 3QDGB 1K2DB 1IJ9A 1I9IH 4GAJL 2PYFB 4TUJB 5DJXA 1NBZA 1KT2B 3BEWB 1LGVA 4X6FB 4Y4KB 2CGRH 4KKCD 2AK1L 5H94A 3H9SA 2YD9A 1MAMH 3FQTB 2BSRA 5IMMB 1FNSH 1VHPA 3W11C 1Q1JH 4R2GC 1UJ3B 1G9MH 2VC2L 3MYJB 1I8LA 1YYLL 4NP4H 1YYML 5FYKL 3CFIC 2VXUL 5GJTH 2HVJB 3DV6A 1KCVL 1NCTA 1F02I 5D6DC 1G7IB 2AJSH 3V5HB 1TZGH 2W0FB 5JZ7D 1I1AC 5EPMA 1YJDH 4P5TD 5CBAA 1R0AH 3TO2B 4FABH 4TVPH 1I7UB 1T2QH 2ZPKH 3WFBH 3ARGC 5LGHL 4D3CL 1OGAB 4S1QL 4UBDC 2QSCL 2APVA 4ODVL 4XVUC 3DV6B 4EI6A 3H9HB 1HHJA 2EDXA 2Q76A 4DKAA 3P4MA 5D1QA 1DQJB 1UJ3A 1FZMA 3JZ7A 5CP7A 3ULVF 2R0LH 3EYVA 4Z95L 25C8H 1U8OB 5LXGH 1AKJD 4DTGL 4FTVD 2H8PB 2DF3A 3SJVB 1FC1A 1W0VB 3QG6B 2ZJSH 4HFWA 1IBGL 2FSEA 4MQXC 3T77A 4O58H 4Y5YA 1HHJB 5EOCH 3MRNB 3BD3A 3DI3B 1J12A 1II4E 3RUGA 4Y0GA 1ZV5A 2E7BA 1Z2KA 5T33H 2YPLA 2BHUA 2WLZA 3C60D 1FAIH 2VDRH 5SX5K 4EI6B 2R0ZH 1A1NB 3MODH 1IVLA 1U8NA 1RZ8B 4CAGA 3WIIH 1ERNA 3MOBL 5EIVA 3TV3H 1ZXQA 5JOFB 3BZ4B 5AZEL 4JO1L 5H2BB 5AZEH 4NZTH 1KJ2L 2IANE 3LQZA 3D2UD 3VDCA 2UWEA 1UB5A 1D5XB 4MDIA 1EAJA 1I8MB 3WIIL 4D0CB 1K6QL 3MJ9A 1OAQH 2VUOA 1X5GA 4KZDH 1XF2A 2VISB 4HC1L 3CH1B 5DHVB 2FDBP 5IB4B 5BV7L 5IIEA 4H1LG 1CICB 3RWCA 2FHCA 5FYKU 1IC5H 5L7XH 3U4BL 1ZGLA 4N8CL 4XNUH 1DR9A 3RVWC 1S78C 4HIXH 1I9RH 1UXWB 4G9DB 1L4IA 2P5EE 5DUMH 2IGFL 4MHHI 2PYFA 5E56A 2YD6A 1OAYH 4Z0BL 4GAGL 4M7JH 5IR1B 4MNHB 4HF5L 3WSQL 5DJDA 3GI9L 3WXWL 1N4XH 5E1HB 3IDNA 2BXYA 1K9TA 1TNMA 1Y18A 1I7TA 5I8OL 3L6FB 5ICZA 1KNOB 3TBWA 3DYOA 2BNRB 3FB7B 3HI5L 4F37K 1WWAX 3I9GH 4MA1C 4PRAB 4QF1A 4HJ0D 5C1MB 1X7QB 5TFSH 4E41B 2NR6D 3X12B 1UADC 5T3XE 3B4NA 1T2QL 2Z4QA 3T4YA 3WFBL 4WFHD 3T0BA 3IB4A 3RKDC 1F11A 3KXFA 3VWJA 3NVQA 4U1NB 1ULVA 2BNQB 1EVTC 4ZUUB 4ETYA 1Q0YL 1EO7A 3KPRE 5GSRA 1T83A 1F3JB 2MCPL 1VFOA 2G9HA 5JIHA 2QADC 1U8IB 5ENWA 4LPXA 2VN4A 1YYLH 2IADA 2Z91B 2Q86B 2DDQH 1ZS8A 3GSQB 4IHOA 2J8UB 2NY4B 4M1CC 1NJ9B 1MAJA 4N0CC 4OZIA 4K7PH 2DS4A 1TNNA 4X4MA 5C6TL 4NO2B 1IGTA 1G7HA 2OTPA 1HI6A 3EBAA 3MJ9H 5C0FB 1M6OB 1BEYH 3S6CA 1ES0B 5J1AA 5E8NA 3LDBC 5DQDH 2W9DL 4TNVK 5J3HC 1LD9B 4PG2C 5ABDE 5DMYA 4EOWL 3HR5B 5EU6B 4JKPL 3QEHB 1JHLH 3ALPA 5IFAH 3AVEA 4R4FH 1XIWD 1U8JA 4EDXB 4R97B 5ITFB 1VGKA 3O3EB 2GK2A 1KCRH 3AU1B 3LN9A 5B8CA 3O11A 2FB4H 3MRMB 3G5XA 3IETA 2V17L 4O4YL 2APXA 5KN5B 2ZCKH 4F7CA 1HKLH 4FMKA 3GGWA 4XBPA 1RD6A 5TH2B 4HIIA 5FM8A 5HYQA 4GW5A 3WO3B 5A2FA 4U1KB 2ZOKB 3NFSH 1T20A 4JRYB 5LBSH 2UYLA 4P9ML 3GKWL 2WV3A 4P5MA 3NZ8A 1KEML 1Z3GL 1G9NC 2L7JA 3TM6A 4YHZH 1MRCH 4I0KA 3LKPB 4KK5D 3L3KA 2P5WB 3QJFA 1XH3B 1HCFX 4PJEE 1TTUA 1AGDA 1DTUA 1PQZB 1SJHA 4NRYB 3RX7A 3HUJA 2FHBA 1DE4B 3UBXG 4OGXL 3PIQB 1NBVH 4HUNB 4F7CB 1FNHA 3TWCH 1X9QA 1EAPA 1BJ1J 3ME0A 1R5WB 4MJ5B 1FIEA 2VZOA 5IG7A 4XNMB 4RAVA 1XF4A 3QP3A 1CGTA 5ISZB 3DSFL 3CCHB 4MX7A 3IDIA 3HAEB 4N0CD 5A3ID 3MFFB 3MLXH 4N90D 2BMKB 1SBSH 5EH1A 3UTPD 1QSFA 1TJHH 1U95B 2E8ZA 5EBWA 3W0WD 1UB6A 3GJFK 1ZLWH 1V5JA 2J1KA 5DFWH 5F3HA 5D2NC 3FB5B 3BGFB 5HDLA 4KRMB 5IVOA 4WU5B 4LAQL 3O8XB 1IFHH 4K94L 4JZJC 2OI9A 4HMCA 3FT4B 1MHPH 4NN5B 4TN9A 1X44A 1R3HA 2DMBA 2AI0H 3CLFL 4XPTH 4MAYD 2ZSVB 3QWQB 1CICC 1H8NA 5EC1B 3EYUH 5MERB 3QUXC 3LZFL 3ARGA 4HJ0C 1MF2H 4PRBB 1NBQA 1B6UA 1JTPA 3EOBA 4BZ1L 1J05B 5FYLD 4C56A 3V6BR 1G7LB 1TPXB 1IAMA 4LLWB 1KF9B 3FN0H 4NQDB 1HEZA 1RURL 3TZVC 2BRQA 2BY1A 3HPJB 3U0TB 4WO4B 4JFXA 5FIEA 1HOCA 3QQ4B 3P4NA 1ZVSA 1CE1L 3OF6A 5JW4Q 4FQCH 3EO9H 2ZSWA 1S78D 4NQED 4QRTB 1ZMYA 1L0YA 3FQNA 4G8GE 1A7OH 1MCWM 1NCBL 4BQ6A 5I8KH 2EIDA 1CL7H 3CXDH 3BT2L 3LS4H 5KSBA 4R0LB 1HXYA 1T7ZA 3GSVA 3WIHH 1OF2B 1ZWIB 3O81A 1H3TA 4LLQA 5DHVA 4CMHB 5ESAB 1SJXA 2IADB 3LN4A 2D4DA 4XAWH 3BVNA 5K59F 1I1FA 3U0WL 4YUEL 1T1WA 5LG1A 5HYJD 3KDMB 3QUZC 4OV5A 4JANA 4QLRA 5C0RH 3LQZB 1RHFA 4M8VA 2AJ3A 2X89D 4J8RA 5CEYB 4UNVA 3EW3B 1WVZA 43C9B 1DUZA 3I75A 3MCKB 4M5YL 4G6JH 3VGEA 1VKXA 5DJ2A 2UY7A 5LKNA 5JXEA 2UVEA 1EHNA 4JO3H 3RBGA 3VXRA 3WN5C 4F8TA 1KPRB 2GTZA 3HC4H 2YK1H 5BS0E 4BH8A 3DMMA 2FRGP 4L29B 4P2CG 1A47A 2GJJA 1Y18B 2NY5L 2VLJA 2IAND 3HE6B 2A6JA 1KPVB 4O9HH 4PREA 1QKZH 1Q9WA 1S7RA 4L3CA 1JF6A 1XGRA 4YC2B 4HFWB 1CDIA 3DPBA 2ORBH 3CUPB 4XCFH 3N1QC 3DVIA 4JPIA 1QA9A 1A6TA 3UYRL 4Z6AT 4NUJA 3F7YA 4P5KB 4Z7VA 4IRJA 4BUHA 5GGRA 1YNLH 5FF6A 4Y1AB 3FQWA 3CC5A 5E4EC 5BRZB 2MKLC 1J5OH 4WDIA 3OKLB 4FQLL 2CRMA 2W60B 3KPSD 3MV9B 4GRMA 4OD1H 3QAZB 4S2SA 4ALAL 5C0CA 5TF0A 1A2YB 4F9LA 3U48A 4LHUB 1Q0XH 3VMPA 4YHNB 4ZO8A 3LEYL 3WHE1 2DQEL 3MOAL 4N90E 4WNQB 2XA8H 2ICEA 1A7NL 2DAVA 1F8TL 2VR5A 3FN0L 3LMJH 4ODHH 1HQRB 3H7BA 4DGYL 4RFOL 2BERA 5EULV 3DVFA 3RI5K 4BZ1H 1A3QA 5GZNC 2EDEA 1CLOH 3P0VH 4NOBA 4FP8L 2XTJC 2VDPH 4I3RH 4WI6A 1KJMA 4PJFA 1OHQA 3GMMB 2FX7H 3GMRA 5J0BA 4YDIL 2YRZA 3MUJA 4P9HL 4U6VL 3H9SB 1MWAA 1HINL 4JZNB 2P8MB 5IGXL 4OZFG 5ISZE 4YIQA 4KJWC 1N5YL 2EXWC 5B39G 5IMLB 3BJLA 4M02A 3HMWL 3V6ZB 4ENED 3MRBB 3G6DH 1EXUB 2BVTA 4PRPE 3EFFA 4AG4L 1REIA 1H5BC 1SHMA 1GZPB 4IMLB 2NY0B 5E8PA 2I9TA 3RI5F 4TYUA 1TVDA 4C57C 4KTDH 5BV7C 5MHSE 3BKYL 5E4EB 1TVHB 1ZSDA 3NCJH 4FFVD 4M43L 3P30H 1QPXA 3H0TB 3P9LB 5T3ZH 4ONFL 2Q87A 3U7YH 4M8QA 3ARBD 4HKXB 5JW4N 4F33B 3VGAB 3D18A 1FSKC 3BP6B 4OCXH 5MEQA 1DVFD 3HC0B 4EN3C 4M43H 4KAQH 4MDJB 2MQ3A 4U4BA 2GW5A 2GTWA 3EJYD 3GSRB 4PJ8A 4YJZL 1FG2A 4PY7A 2KZWA 4K7FA 1RULH 4OB5H 4NSKB 4PIRF 3OXSB 4JPVL 1JNJA 4G9FE 4HUUA 4H0HB 2M26A 5E00A 2EC9U 2MQCA 1IAKB 2QQKL 3IDGA 3UROR 3W0WB 3BRGC 1Q38A 3GB7B 3VA6A 3MLTA 4YNYA 1F4AA 4NNXB 3LH2H 3OKMA 5FDYA 3BGFC 4WFGD 3L7FB 4J3VA 2UZYB 5I1EL 3DWTA 4HUMB 4JPKL 4OB5L 1GHFL 1NCCL 1CK0H 1SEQH 2DMCA 4ZOBA 4GG6A 3PWUB 2BDNH 3HNVL 1T0MB 3LKNB 1FYTA 3R0NA 4GW5B 4KQ4H 1LO3L 3ULUE 2A6IB 2HRPH 5F9WB 1GIGL 1QFWI 1OB1B 1AXTH 2Q7YA 2O5XH 2ITCA 3TIEA 4DW2H 4Y1AE 5MEND 3PGFL 4IS6A 3QXDA 4HKZA 5HDOA 1AO7A 4I77H 3VFOB 2EO9A 1YEJL 3QNXA 4L4TE 5HDBF 1A9BA 4U0RC 1GOHA 4ZTPH 4UZGA 3W39B 1OARL 4M9PA 1WZKA 1IEAA 3F12B 2NW3B 1MCHA 3O4LB 1CI5A 1M6OA 4UMGA 3G6AA 3MZGB 5J11B 4OCNC 4KKLC 1UZ6F 3ZO0A 3MXWH 4LCUA 1HYRC 2VQUA 4NHUB 4BELD 3KLAB 2OTWA 3V0AC 1RAMA 1H3VA 3WL9A 3AREC 4LLAA 5IB3B 5KVFH 4G59A 3OQ3B 5F9AC 1CDGA 4RNRB 4C56D 3EYUL 3LPWA 3TZVD 5H35A 2NY6C 2VAAB 2J4WL 2YBRB 1CD1A 2VZTA 4NQCA 3E0GA 4PG9B 2BOCB 1HYSD 4MD0B 1BD2A 4JY4B 3PL6A 2FX7L 4DAGH 1AD0B 4PLNC 1UGNA 4NO0B 1CGUA 5GSRB 1WITA 4WVRA 5FGBA 3F7VA 5BW7A 1QBAA 5DJ8A 2OTWB 4E5XA 2MHAB 4MXQC 1N6QH 1YZZA 2IPKA 4OLZH 2AQ2A 4K07A 4UILH 2Z4QB 3ZHDA 2AXGA 4HK3N 2X4UB 3WHXA 2BY3A 3D2UA 3FN9A 3L3DA 3N1FC 3MV01 4XC3H 5C08A 4CN6A 3VCLA 2IH3A 1A4JB 3RVTC 3D0VB 4P2RA 4H8WL 2Q20A 1EEZB 4UAOB 4G6JL 1FVDB 1EH9A 3GMQB 4ELKA 5BVJA 3O6LH 3QUKB 1AD9A 1QD0A 1XGYL 5BZWB 3BYTA 2VLKB 1QFWM 4JREB 4U1HB 5DJDB 2HJFA 4QRPA 4EXPX 4CVUA 3KXFE 4CVXB 2APBA 5MENA 1JNNL 3NZHL 1PKQA 3MR9A 2JJTA 5DD0H 2NX5A 4G9FD 2XQYG 1PKQE 2IANB 5ERWB 2DD8H 4NQCD 5AZ2L 4OIAA 1S5IL 3C08H 2NW2B 4F58L 4P23C 3BH9B 4NO3B 4QHLB 5LCVH 1MIEL 1TCRA 3HNSH 3Q1SL 3E6FA 5JXED 4X4YA 5AZ2H 1KEMH 2B4CC 2R15A 3QIWA 3U6RA 1L6ZA 1MRFL 2HWZL 4WI4A 4CMMB 3GMNA 4MDJA 1CU4L 4WGVB 4JFFB 3F6LA 3MOBH 4PJBE 4H1LH 5FHBL 4FZ8H 3ZYJA 3ARRA 3BPLB 1DBML 1RIVL 5JDJA 1DLFH 4Q2ZA 1X5AA 4MNQB 4LF3A 1S7WB 2OP4L 2COQA 5GSVA 1NQBA 4UQ2B 4OZGA 4U1LB 1NSNL 3GSUA 4HS3B 3WDHA 3IFNH 3VI4E 1S7UB 3UMTA 1JHLL 3L5XH 1D5BA 3O6KH 5LAXB 3QWOB 1G9NH 5IW1A 5FHBH 3RWDB 3LB6D 4RFEB 3S7GA 2XXCB 4HS8H 4AIOA 3VXSA 3DVNA 3WV0A 3I6KB 1UVQA 3ULVH 3LQAC 1EXUA 3LZFH 1T0NA 5HYEA 4LEOA 1R3IH 1RUPL 2GCYB 1O7VA 5FXCH 4C4KO 1U93B 4QYOA 3ARSA 4OF3A 3DVGB 3GO1L 1U58B 4K55A 1ZGLM 3AM8C 3TJHA 5JHLH 4WCYH 1VSCA 4TSBH 3GHEH 1LE5A 1P1ZB 1DQQB 1MLBA 1BMGA 3VDAA 1J1OH 3IDYB 3O6ML 1PYWA 2J4WH 3DX9A 3MLVL 4LHUD 4HCRA 2P5WD 2Z8VC 3TC9A 4JFDE 4XTRC 4OJFL 1K3ZA 2LAGB 3SO5A 2Q76B 3VRLE 2WWMC 4WUUE 3N1MC 2HFFA 1JPST 2P8MA 1AGFB 1BQUA 5C07E 4KK8D 4S0TD 2W65A 3LKRA 3SCMD 2BRRH 3GMMA 3KAAA 4WFHE 4HKBA 5DJCA 2FIKA 2EIEA 3QDME 5JDSB 3BWUC 1GGCH 5D2LF 3T08A 4M00A 3T0VA 5CINL 2WW8A 1JHKL 4RGOL 3LAFA 3U4EB 4UT6L 3BHBB 5GPRA 5E2WH 2HTKC 4LHUA 3WUWB 1TVBB 5GRJL 2R2BB 2BSSA 1G7IA 1IAIM 3IYLW 1HHHA 3GZKA 4ZAKB 4KK5C 5B8CC 1FZKA 2WUCH 4X98A 1KJ2A 3FO1B 2Y06H 4PJ5E 2ADJB 4G6AC 2B0SL 3ARDA 3QISA 2OTUB 1VFMA 1INQB 2CLRA 2EICA 1KELL 4YDVB 3PNWB 2B2XL 2C3XA 4WCYL 1C08A 2A9MH 1BIHA 3QO1B 1ORSB 4NCC1 4NM8L 2GJZB 4K7PX 3KR3H 4LL9A 2A2QT 4JFHE 4ZQKA 1IZJA 1G7PA 5CWSA 4OLVL 4OM1H 3EDKA 2NY5C 1Q9WB 1S7RB 3KPOB 2A6JB 4ELMF 1KLGA 3NABL 3F7QA 4GG6F 4P9MH 3BD5A 4HJGB 4L29A 4G9FB 5D70L 2LU4A 5TDOA 1H3GA 2XKNB 2JCCB 2ZUXA 4QRRD 1G6VK 4F7MB 4P23D 2MFNA 1XR8A 3O6FD 4L9LC 5I18H 1XIWB 2FD6H 4D8PA 4NC0B 5ANMB 4IEFB 4XCEA 1YUHA 4ZXBA 1WFOA 4X7SL 3VXPA 3WBDA 5KVEL 1KCRL 3TVMC 1RIVH 1DQDL 1I7RA 4YXLH 4QCIA 1FIGH 3MV7B 3NN8A 3QPQD 4TUKH 2V2WA 4LNRB 3P11H 4OV5B 3VRJA 3P0GB 2F5BL 1KTLA 4M48H 4GQPH 3AFLA 4FFYH 5EU5B 1G6RH 1BZ7B 4KQ4L 2XICA 2G2RB 2HRLA 1NANI 5E2JA 3S3SA 3K8MA 1I75A 1YMHB 1QTYT 2GJ6B 3HKFA 5EUKA 4Y4KD 5GGTL 4OFPA 1MRCL 5I1EH 5CZVH 3MRKB 5K9QI 2E9IA 3RJDA 4NJ9L 1K4DA 3UTTD 3T3MF 2GEEA 1ZKAA 4M62L 1FNGB 1LHZA 1N6VA 4KY1L 3BAEH 4LSTH 4HQQH 2VXQL 3U1SL 4YDKL 2C1OA 1FRGL 2J5LB 4OKVA 5DEFA 3UZQA 2KH2B 5HY9B 4L8SA 4PJAE 3SDCA 2IQ9H 3NA9L 1FZOA 4JPVH 5IW3A 5HPMB 3AS0A 1AGCB 2JIXB 2OQJA 1M05B 3VMOA 2FEEL 3D6GA 5D7SL 5C07A 4NJAH 3FO1A 4N8PA 5J13C 1AC6A 3BDYH 4UT9L 4JFZL 1QQDB 4Y16A 2H32A 3UTZB 5M95B 1FNAA 3WD5L 4S1QH 3S4SA 2VITB 1B9ZA 3VD4A 1F6AB 5EA0L 4K71C 3ULUL 2IALA 5F9DC 2XWJB 3DURB 1BEYL 4UNUA 2XV6B 1IM9D 5I8EB 3HS0A 4DGYH 5C6TH 2YUVA 4BFIB 3BP7A 3DECA 5CJQH 5E6YA 4LPWA 3MTRA 1G7LA 4HKJB 1J0HA 2P8PB 1NFDA 2H3NA 2MPAL 3CPLA 2XRAH 1DN0A 1GZQB 2VQTA 5FO8A 5HGDA 2VR9A 4XVUD 3T2OA 1MLBB 3G6DL 1T4KB 2YZ1A 5C0EB 4OJFH 5CSZA 4RMRA 5E8OA 3UTPE 5IHUH 3SDXE 3L1OL 2RAMA 3BI9X 2AV7A 3FRUA 5BJTB 1JPSL 3X11B 1KB5A 1L7TH 4ZFOB 4AZ8A 4K3JH 4HC1H 1R3LB 3S96A 3DV4A 2OL3B 4PUBL 5DMJB 2OZ4A 2OJZH 4G43B 5HVWA 4KC3B 2HFGH 5I0DA 3HHRB 3KPSB 4KUCF 5BOZG 1GGBL 5GJSH 3L9RB 1AR1D 3RL1A 3DO7B 5IV2A 2GITB 1UB6B 4NQVA 1Q9KA 5EN2B 3I2CH 5TGBB 3V4VL 1OW0C 2XOTA 5B39A 2CPCA 5GRUL 3PQYD 1JNLH 1ADQL 1PFCA 4FMFA 3LRSA 2NY1B 2VDQH 5ACZB 5FK9A 4ELMA 5CD3B 2K1MA 3KYKH 4HWUA 1T5XA 5HJ3B 2EEBA 4WFED 4UT7H 5AD0A 1UKSA 5BVPL 1A3LL 2K9UA 4L9LA 1MNUL 3QI9D 3RPIA 3WKNA 4Z0BH 2K7PA 4Z9KB 4JFFA 4AT6B 4LARL 4BQ8A 3EIFA 2OL3A 3FQUB 3RZCB 4IRSC 1EO8L 4WY7L 1JPGB 4HV8B 4JFYB 2H26A 3G08A 3GSOB 4V2BA 4DGVH 5GRYA 3VDBA 5DUPH 2XN9E 4LARH 4BYHA 1JGDB 1JVKA 4YUEH 1T22B 4EN3D 3H3KA 4AEFA 1MNUH 5FCUH 5IBTH 2X4TA 4FQXC 4LRNL 3BZEA 4LCCC 4JRYA 1JPTH 3N1GC 4KJYB 1UG9A 1JF5A 2F9BT 3CK0L 1AKJA 4CL7A 12E8L 4Z7WB 2HJKB 3GMOA 4FFVC 2CXGA 2WBKA 2Y7QB 1MCBA 3QUYD 4PBXA 1JNLL 4U1HA 4XXDA 1C5CL 3BT2H 2ZOKA 3LS4L 1MIML 1SYSA 4G8FA 5DJZA 5FCSH 3VW3H 2BVPB 3AY4A 5J9PA 1KLUA 3ZHLA 1RZKL 4KRLB 1JJUA 2KUTA 4N0UA 2X4PA 4PTUB 4LSPH 4D0BA 1LO5B 1NC2D 4MCYA 1QLEH 1T0PB 1VFBA 5BXFA 3TJHD 3L3DB 4I0PB 5I74C 4ZYKB 3HCVB 5GGTA 5IB5A 2BX5A 3PWJA 3SGKC 1IGTB 3OKEA 5D1XD 1XZ0A 5C09A 5C07B 2E5EA 4ZFZA 5DJ0A 5A16A 1G7MA 5SWZE 3CVHA 2YD8A 4DGIH 3RL1B 4FQJL 3DO7A 5HY9A 2UY6A 3HAEG 3CU1A 1FNSL 3QUXB 4K2UH 2J2ZA 3BISA 5AUMB 1QPPA 4UU9A 2Z31C 1NAMB 3ERYA 4LIQE 3QDMB 1RFDL 5DLMH 1MUJB 2WBJC 3B9EA 2ICWJ 3SHSA 4XPTL 1P9MC 5GS2D 3GSQA 5IGXH 5IVXA 3S37L 1DBAL 3MRHA 3VXTB 1HH6A 5GS0L 5I1GL 4WUKH 5C9KA 4LCUB 3M17B 3GUTA 3Q5OA 2G9HB 4GXVL 1Q9LB 1JK8A 3FT2B 1R5VA 3F58L 3B2VH 2QQNL 4HUVA 1QBML 3MCG1 3NCCB 1ROWA 3V0VA 1ZA3B 4PJ7F 4MA3A 2C1PB 1YDPA 4R96A 4QXUL 4XCEB 2B4CL 3CDYA 4JO4L 1G9EA 5DXWA 4X8JA 3HI6H 3IDNB 3S37X 5DD6A 3ZKQD 2N4IA 1YEJH 1NGWB 3B43A 4NGHH 4ODTL 2Q7YB 2YPKA 2H32B 2XKNA 4TQEH 5TDPB 3TA3D 1SEBB 3MRGA 1RJZA 1XF5A 1AP2A 4YHKL 1HZHH 3VH8G 4J6RH 5I76B 2F5AL 3MLWH 3ULSB 4BH7B 5KJRL 3LEXB 3IKCB 3S36H 3VXNA 2F54A 3ABZA 2UWEF 5D1QC 4PLJC 5HHXL 2ZNXA 5KSUB 4PJ8D 4FFYL 3EYSH 3Q6FB 1F5WA 4UB0L 3AMLA 4KVNL 5E8DL 2DTMH 3W0WA 1KB9K 3IDGB 3PNWA 4P4KA 4XBEH 1F6FB 2WQ8A 4QOKA 4O9HL 3RWCB 3K3QA 2ADJA 2CK0H 4YEEA 5JR1L 4XBGA 4RMTA 5H2BA 2PO6B 4OZHE 1GOGA 3MLXL 4MJID 3PP3K 3VWKC 1PZ5B 4TSCL 4G5ZL 4GJTB 1DVFB 1NFKA 4ZO7A 2E6JA 2VERN 5DDHB 5JDSA 2HLFC 3LQAH 4OSUL 3KYMB 5JR1H 3EUUA 1TIUA 4YAQA 3TBYA 3VFVB 3HG1E 4PGBA 2AJZA 1U9KA 4WV1B 4D8PB 5HBBA 4OGYL 1AY1L 1WK0A 2R69L 4BFGA 3ARPA 5E2TL 2D31A 5EZJB 4DKFL 2RHEA 4LBEA 2V2XA 2VDLL 4GRWE 4EBQH 3UBXB 3IAQA 1ITCA 2YD1A 4G80A 3MRBA 4Y5VB 2GYSA 1S7VB 5CP7B 3OAZH 4IDJH 5D93B 3ZL4L 3DTXB 1N8ZA 3MNZB 4LEOB 1MVUB 4GRWF 4OUUB 2IH1A 1LWRA 4OQTA 1NH6A 3SOBH 3QYCA 4Z8FL 3GEWB 1MWAB 1RY7B 1JHKH 1XGPA 4RBPH 3S3JA 4GMTH 1A7QL 4YDVA 4G8GD 1TPXC 2AABH 4H1LB 4WWKD 5CKGA 3P77B 4KTEL 5DT1H 5F8QC 4RZCB 1U3HB 5DYOA 4S0UC 1ND0B 3F58H 3U9UB 3VG0L 1OGAD 3BZDA 1WBYB 4GXVH 4WGWB 3SE3A 2CRIA 3T0XA 4Q2ZB 3RBSA 5FEBA 1YNKL 4MNQD 3JBG7 2QR0A 1WBXB 4YHYB 2V9QA 5C0JA 1EGJA 4OZHF 4ZNEE 3IRZA 4OLUL 4KK9C 1KTDB 3WS6C 2W0FA 4AL8L 2AKRB 2E6QA 3Q2CA 4XB7A 2NTSP 4M03A 3OB0H 2OZ4H 4XBGB 4DUXA 1IC7L 4MYWB 5IQ9A 5CLWA 1KB5H 4LNVA 3ULVL 2WNGA 4TUJA 1OAYL 1IC4H 4WW2B 1NC4D 4K94H 3VXQA 2R2HB 3C87A 3P9MA 5JNYB 5IFHL 3C6SA 2IANA 1QA9B 1QNZL 1XAUA 3UJIL 4BJLA 2B1HL 4ONGH 5MEOB 2X4RA 4YE4L 5KSVA 3MV8A 2GCYA 3RY5A 2OP4H 2DJ4A 3IT8D 3V0WH 3JVGC 2DQIH 1KN2L 5F1KC 3BIAX 3F65A 1I1YA 1OAXL 1U8MA 1WWBX 1ACZA 4A2LA 4DZ8A 3MNWA 2FJGB 1E4WL 5E99H 1UH4A 3RWJB 4OZ4A 4PBVC 3VI4F 1QSEB 4YFEA 3RDTB 3Q6GH 5CBEB 3ZKXB 2XT1B 3HRPA 3Q6GL 4NZTL 2CK0L 1S9XB 4HWNA 5C9JA 5E7BA 3WUZA 3K81A 4EVNB 1R24A 4EI5D 5J6HA 2GY5A 1DUZB 3D1MC 3D3VD 4PGEB 3ZE1F 5FDWB 4Z7QE 4R8WH 5I74B 2VUYA 3GJFB 2DD8L 1MHEB 5D5MF 1V8HA 4PRDB 2O93L 3IFPB 1PVHA 4LVNC 5FA3A 1MJUL 4LLDA 4OZIF 4HIEA 1X4YA 2NY6D 3HC3L 1HILB 1JZ5A 2JB5H 2XQBH 2GK0A 1QRNE 4R8WL 5DD3L 1DJSA 3EOTL 4Z77B 3IKCA 4AH2A 5A16B 3GKZA 4L4TA 3BUYB 4KJQD 2WINB 5DZOA 5ERWA 4L3EB 1RUAL 1AP2B 1G6RA 3PWJB 4QHKJ 4U7MA 4D0DB 4RQQA 1I1AB 4I1NB 1BBDH 3ILPA 4P49A 2HJFB 1AGBA 3EO0B 5DJ0B 3CXDL 3T0WA 4PJGF 5SV4A 2D0FA 1N6QL 3BIKB 1NDGB 1TQCC 3BKML 5SWSA 4XPGH 5FGSA 2A9NL 3NA4A 4HH9B 4IOIB 4C54A 3AGVA 4E9LA 1X5JA 3PHQA 4D3CH 5DJ6B 1NGPH 5IB2B 5DQDL 2R0KH 2ZKHH 4MCZA 3ARFB 1CT8A 4P46A 3BWAB 5I1HH 3MNVA 3KPQA 5DFVC 1FORL 3IAPA 4YE4H 3S5LA 1G6RB 1CCZA 1TZGL 1CFNA 4AENB 5DLML 4K7PL 5BO1H 4IMKA 2Q6WB 4PJXA 5D2NA 3BRDA 5GZND 1RI8A 5C0AB 4LPUA 1IBGH 1H15B 2FGZA 5J06A 4YXHL 2DDQL 2CRYA 3VXME 3F5WB 3PV6A 4J3WA 1I4FB 3DARA 1K8IA 1BX2B 4JM2B 4KHXH 2NR6C 1IC7H 3VWJD 1A7BA 5D7JB 1UEMA 4FHBD 3K4ZA 1UYWH 4RMSA 1QO3A 3O2DA 5HDQH 3QUXA 3OXSA 1YMMB 5EZLB 1JGUH 4HEME 3ES6A 3GSOA 4W6XB 1NEZB 1J8HE 4HV8A 3CVHB 1DBBH 3OB8A 4HUKB 3EO1B 2XZAH 4AT6A 1RHHA 3FKUS 5F9OH 2ADIB 1JGEB 2X4OB 3TZVA 3WE6A 2FBJL 3GMLB 4YO0A 2ZOLB 3KYOA 4HHAB 1LEIA 2VXTH 3TYFB 5JXAH 3MACL 1C12A 1AO7B 2IF7A 5B39B 3ZTNL 4DEPC 5SWQB 2XXMB 1HHGA 2VXQH 4NC2B 3CFJA 2GITA 2IAMD 1HCVA 4X9FA 4H25B 4DKEL 1A0QL 2BFVL 2CXKA 2AK1H 1TITA 1BVKA 4R0LC 1OT1A 2R4SL 4PJFE 3C60C 1U42A 1FO0A 3NCEB 4ESKA 3PWPA 5E2TH 1G6RL 4R6UA 5IQ9B 3W11D 3ZYIA 4JM4H 3NFNA 2Q7NA 1UZ8A 3QXVA 3VG9B 2X42A 4PRIB 1T2JA 1NL0L 1RMFH 2EDFA 1CFNB 4AENA 4NSKA 1SJVA 5GGRY 2ZG1A 3MV11 1CDUA 3IDJA 3DYPA 5LBSL 3BP4B 5FYJE 2YKLL 5TE4H 4H26B 4HPOL 4XMKH 4G8GB 1QRNA 4I48B 1U2CA 5DQJB 5HI5C 1AGEA 5C7XL 1VGKB 3O3EA 3O3AB 3NTCH 3DXAB 1G7JA 4U1MA 3NAAH 1ZTXH 4P5TA 1NDGA 5FYKE 3QJHB 4FZEH 2D7QA 4QRRE 3P73A 4M6OH 5J1AB 2DB8A 3DX8A 2J8UF 4LSRH 3QIWC 1FYHB 4XPBH 1KACB 5IHUL 1CLZH 5E5MB 1N26A 3HLAA 3BUYA 3ARYA 3MRPA 1OQXA 4G6FD 1UWGL 3UAJC 4V3DB 5DTFB 1KGCE 1FZJA 4ZMAT 5MI0B 5J1TC 4P3WA 1MEXL 1A6TB 5JW5B 2D9QB 3VXRD 1CLOL 2W0PA 1OTSD 3LD8B 5T1LA 5I73B 1YPZA 5FYJL 15C8H 1PY9A 4U1JB 5KANI 5GRUH 2IMMA 2P8PA 4XP4L 5EUKB 4ODTH 3GDBA 5D1ZA 5LWYL 1WBZB 3B3IB 5EA0H 3MSPA 4ZUUA 5DS8B 1NUNB 1YN6B 2WMPA 4QGTA 1CF8H 5EZIL 5ADOL 1OAUH 2HFEB 4LQ1A 2PYEA 4Z7NE 3QB7C 2NY4D 4MQ7A 3OF6D 3EZ8A 4OD2A 4MB5A 1S7XA 1SBBA 2GT9B 3GFUA 2C4XA 5J13B 4YHLL 1NDMB 4Y4KC 5EZIH 1OOAA 4RA3A 3I75B 4YXKH 4MZ3A 3QPXH 3PWVA 4FFEX 3K46A 3UZVB 1HXMB 4Y4FD 4RGNC 3AB0B 2HN7A 3E6HA 5D5ME 4YHMH 3JWDH 3WLBB 2OBGA 4OCMC 1U92A 2XRAL 3WJJA 4U1JA 1YEFH 2PTTB 1QLFA 1A2YA 3REWB 3IJSB 1FV1A 3WSQH 2XPGA 4KJQC 3LIZH 4MAUL 1Q72H 4ETQB 2VLRA 1QBBA 2HAZA 3TCLA 1JZ6A 1YEIL 3M1BB 5C0DA 4PY8I 2CDFA 4N0FB 2QHRL 3ARDB 5LGKA 3ZT6A 4R0LA 4WY7H 2PO6C 5KSBB 5I15H 4YPJA 1MREL 1T1YA 1FIGL 5KVDL 1XF5B 3RWEA 1HXMA 2D7MA 4LCWE 1BJ8A 3QO0A 4LSVL 4CADA 2JJVA 4AIXA 3L3JB 3MO1B 3WLBA 5I18L 4Q74A 2LU7A 3NTCL 4JB9L 2HN7B 3E6HB 4KXZH 1ZLVK 1BD2E 4GKZA 4GKNA 3FO2A 3BDXA 2DLIA 2VLRD 2FJFB 2YC1A 2DBLL 2IQ9L 5IFJB 4D9LH 1ZHKA 1NLDL 1FNEB 4JN1L 4XNZC 4LFHG 1HHIB 1UZ6E 1RZ8A 2D2OA 4X9HA 5HGHA 3MMEB 4LLWA 1GJIA 2VO5A 4NJ9H 1NL0H 3IXTA 3ETBF 4NOFA 2M8XA 1KYOJ 1LILA 3EOBB 4GBXD 4TOYL 2OX5A 4OCSH 43C9A 5I1CH 2LAAA 1VFUA 5IKCA 1YNTA 2ESVE 4HMEA 4L3EE 3CSPA 3NFNB 5J7CC 5DS8A 3QXWA 1A6VH 3B3IA 1XCQA 2EC9T 2RB8A 2FL5B 1H0DA 3FOLA 3QH3A 4I3GA 5D2LB 4IRSA 4Y1AD 3GK8L 5C09D 4BKLB 5JXEC 2VWEC 2IBZX 3A6BL 3QCVL 1T1XA 4WHDA 4GW4A 3BVNB 1GRWA 4LMQE 1BGXH 1U8KB 3I6KA 4ZD3L 4Q0XL 1DQDH 5B4MC 3SDAC 4LBEB 2AS5M 3TNMB 4QTHB 1OTTD 5L8LB 4RGMC 1HHGB 4RGOH 4HK3J 1U95A 2DM2A 2J6EA 3OKKB 3QJHA 4ZFFB 1GGCL 1FYTE 3NCFB 4ZDHB 1CFBA 5CJQL 3OKEB 1PEWA 1A6WL 1YMMD 4GAYB 4EUPA 3RRQA 3VFVA 3JTSA 4LLMB 2DYPB 3DX8B 1XMWA 3ROLB 4YDLB 1JPFB 4TNVF 3K8LA 3QDJB 3IU4L 2DLFL 4V1DD 3QR2A 5A40E 1P7HL 1E6OH 4XNMA 3P4NB 1D9KC 1J88A 1DBBL 3DI2B 4K8RL 1IM3A 4JFZH 4JFXB 5CIPB 5F6HJ 2YUWA 3OKYA 3T65A 4EUPH 3D3VE 4G7YL 1WAAE 3UTTE 2J6EH 2B2XH 2L4OA 2J3SA 2J6EL 3C8DA 2H2SD 1KXTB 1L7TL 3CSGA 1MJJB 2OMBA 3EGSB 1JPSH 1T83C 1FL5B 4CMMA 4U1SA 1E6OL 2LV4A 2VXUH 1T22A 2XZCH 1EJOL 3RL2B 4X7EC 2ZSVA 5F7EL 2CUHA 1BVLB 2JK5A 3QG7L 1D5IL 1QSED 4QYOB 4K8RD 1E0OB 1QUNA 2F54B 2OI9B 5EU7C 3S98A 1MWAH 2R39A 3H9SE 3RNKA 4L4VA 1C12B 5TE7H 5FO7A 5C0BB 4MWFB 1JZ8A 5EUOE 5AD0B 3SKMB 2XN9B 1NCDH 1QFOA 3GJEB 3BWAA 1P7QD 4BSWB 3VCLB 1P4IL 4OBRA 5DJYB 2APFA 3O9WD 4QHUA 4XPGL 3E3QA 4AEIL 3AREB 4JQXC 3D5OF 1RK0B 1ORQB 1LO3H 2B20A 4X80L 1V3KA 1F97A 3H3BC 3ES6B 4RQQB 4XPFH 2IC2A 2EC8A 3GMNB 4L3EA 3P9WB 1R3JB 2VH5H 3U1SH 4OAWA 5D7JA 5T1DL 2VE6B 1IAII