4G9MA

Crystal structure of the rhizoctonia solani agglutinin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
APISLPAGTYTLKNVSTGTVLDLWRGEAAEGTAIQGYKSHGGDNQKWRLKWTGKGNQVTLQNVKSGTYVGTASNIQNSVNVVGSTTAVPLDIVAADKGFAIEAADHRLFVLDLKESNPANETPVIYYNNNATDNQKWKFIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords agglutinin
publication title Structural analysis of the Rhizoctonia solani agglutinin reveals a domain-swapping dimeric assembly.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 41
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4g9mA00
1FGAA 4ENDA 1PUUB 3WMUA 3MALA 1DQOA 4I7IA 1F31A 4I4YA 3ILAA 5BXRA 1KNMA 2FGFA 2D7RA 4XFTA 4KBBA 4ZLBB 2RG9B 3BB2A 3BAVA 1BFBA 1ISZA 4P6AA 3RTJB 2NM1A 2RSTA 3LTQA 4JKQA 5G00A 1IOBA 1JT3A 2DRYA 1G9AA 2X2SA 4I4OA 3SNVA 4D0ZA 2MLLB 4QKSA 5BXPA 5DZUA 3FUOA 3V0BB 21BIA 3AKGA 3T8SA 4XFSA 5JMCA 5B2HA 4I4QA 2NZ9A 1YXWA 4YOLA 4LO1A 1S0BA 1RMLA 1IT0A 1S0LA 4OUJA 1XYFA 4ZFYB 2NVHA 1TTUA 3C9ZA 4IY8A 2Y9FA 1N4KA 3PG0A 4LO1C 1TWEA 4J2KA 1YBIA 1W3FA 1RG8A 4Q9GA 3S8JA 2MC2A 1W3GA 4I4VA 2DRZA 3N7JA 1W3AA 1V6UA 3QYDA 1MD6A 1M16A 4QBCA 3P6JA 4OEEA 4ZKTB 5E24E 1HCEA 3FJEA 2Q3NB 1FV2A 1BLAA 2D20A 1NZKA 4OWLA 1HWOB 1NUNA 1S0EA 2QYIB 2ET2A 1WBAA 3CA1A 2ZQOA 3VEQA 3UJ0A 6I1BA 4L4HA 2D24A 2FFVA 5D62A 4IY9A 3FGMA 4OWJA 3CRGA 3N0KA 5FNWA 3ZX7A 3I29B 3BAHA 2RQ9A 1IJTA 5BVPI 4IZEA 3HMYA 1SZ6B 3ZC9A 1FN0A 3HBWA 4QC4A 1ITBA 3NBNA 2K8RA 3HN1A 1EPWA 3H6SE 4I0YA 5BXTA 1AFCA 2DREA 1XG6A 1QQKA 7I1BA 2FDBM 1TP0A 4OEFA 4I4RA 1R8OA 2AAIB 2AQZA 4KEJA 4EEEB 4J23B 4P0KA 3I2AA 4IZXA 4J2YA 4A7KA 1TOOA 3CU1B 2KKIA 4Q91A 2NTDA 3WA1A 2FFUA 4G6MA 1PC8B 1BA7A 3WO4A 3FJHA 5BOWA 41BIA 2XOAA 4ZGRB 3N7LA 3OGFA 3UDAA 3RMYA 1G82A 1QXMA 3RTIB 4I1EA 3Q7XA 1L2HA 4LO0A 1J0SA 3BADA 3FJIA 4USPA 1PUMB 4ZA3B 4H04A 3VSZA 1S0GA 1D0HA 2NP0A 1E0OA 2D1ZA 4LO0C 3FJ8A 4I2SA 1M2TB 2BFHA 4QD2B 3TC2A 2LIQA 1A8DA 2IHOA 1DLLA 3FJCA 1AVAC 4P0LA 1HWPB 1Q04A 3FJKA 5F8YA 4Q9PA 5F8WA 3FJ9A 4PC4A 4LO8B 1WD4A 1IILA 5HPZA 4I96A 1BFCA 4QALA 1XHBA 3A21A 3K1XA 4IQPA 1DFCA 4R6UB 3Q7WA 2D44A 4EKXB 2UUSA 3WMVA 3HSMA 4EFQA 2ZR1B 4EFPA 2KI6B 4I6IA 4AN7B 5BQUA 1FWVA 2MIBA 4JAWA 1T9FA 1PZZA 2AXMA 3UJ4A 3BA5A 2FO1A 1FWUA 2D22A 4USOA 4OWKA 1ISYA 2DS0A 4ZFWB 5JLVA 1V6VA 2Y9GA 3NBDA 4I3NA 5BQUC 4X39A 3BA4A 4KC3A 3R4SA 4JPZA 1Z0HA 1FQ9A 3ZXGA 1TWMA 2M49A 2D23A 2LIEA 4LO2A 1PWAA 1EYLA 4G6JA 2Y9WC 3H6RA 4ZFUB 4KEIA 5EHAA 3BAUA 1JTCA 4X38A 3NBCA 4LO2C 3OBRA 1YF8B 3FUQA 4GAIA 4IONA 1WBCA 4DENA 4QO3A 3MPPG 3CRHA 3LLPA 2D43A 4I4SA 3BRGC 3E8LC 3CA4A 5BXSA 4X3AA 4G9MA 2VU9A 3S8KA 4OW4A 1MC9A 3O4OA 2KI4A 3JUTA 1DQGA 4J2XA 3IIRA 4HR6C 2E4MA 1OQLB 1V6WA 1Q1UA 1YYNA 3AKFA 3AZVA 3F1RA 2IWTB 1HIBA 3H6RB 1HKNA 4EFRA 1UPSA 4JRAA 2I1BA 2E4MC 1SR4A 3O5WB 1I1BA 3NJ5A 3D7WB 3BA7A 2F2FA 1Q03A 4J2SA 3P53A 2VXTI 3NBEA 2VXRA 2GO2A 1XZZA 3V0AA 3AZWA 1Z2VA 3O4AA 5FNXA 4G9NA 2KH2A 1TFMB 3OJVA 1SR4C 4EB2B 5BP5A 3FJBA 5FZUA 1K5VA 3AKHA 4ISRA 3HOMA 2F2FC 1K5UA 4LO7C 4Z8SB 4I4UA 3A22A 1EV2A 5BP5C 2WBCA 3FJAA 3CA6A 3CA3A 3IM7A 4FVVA 2WRYA 3FJFA 3CA0A 4I37A 4QKRA 2D7IA 3IM6A 4I4PA 1HWMB 2K43A 5I1BA 3OGGA 1T4QA 4TLPA 1ILR1 2P23A 3KMVA 2J3PA 3CA5A 1CVSA 2Q9XA 1AF9A 1BARA 3AKIA 1AVUA 2R9KB 31BIA 3BAGA 1ABRB 2YUGA 4ZOTA 1WD3A 1JY0A 1FMMS 1JLXA 4DCKC 1IRPA 4KEKA 5D61A 3UD9A 3AJ6A 1ISXA 4GP0A 4WBCA 4F34A 3VT0A 1JT4A 3AH4A 4XKIA 3A07A 3ZC8A 1BASA 3R4UA 4JQ0A 4HJJA 3WO2A 4GOVA 1DIWA 1DFQA 4H9WA 4ISQA 3CRIA 3BRDA 1FV3A 2K4AB 3W9TA 4F83A 1TIEA 3AH2A 3QR5A 1I1EA 5F90A 1FMZA 1S0FA 4FGFA 4II0A 3BAQA 1DZCA 4IHZA 5GAQA 3BRFA 3RMXA 5DUYA 3PHZA 1G9DA 4HA2A 1GGPB 1V6XA 3UD8A 1IHKA 3F62B 4GP3A 5EG6C 3A23A 1BLDA 1ISWA 4OEGA 4A7YA 1JLYA 1JT5A 2ZQNA 3FJDA 8I1BA 4QBVA 1VCLA 3HALA 4P0JA 2GZBA 2VLCA 4Z9WB 3RSJA 5EC5A 1G9CA 9ILBA 3O4DA 4I8MA 1BFFA 1DJSB 1QQLA 5F8SA 2HW9A 3JRRA 1JT7A 3AJ5A 3BTAA 3O44A 3IM5A 1RY7A 1R8NA 2Z49A 1S0DA 5DSSB 4JKXB 4LO3A 2VSEA 3P6IA 2ESUA 3O4CA 2NYYA 3FFZA 4L4IA 1S0CA 4I1BA 1RZOB 3BX1C 1DZDA 4G1RA 5DVHA 3O3QA 3Q7YA 2BEBA 3O4BA 3OJMA 4LO3C 3O49A 2BEAA 3FJJA 3VT1A 3WINA 3PMEA 1YTOA 4I4XA 4D8HA 3VSFA 2P39A 3PUBA 3OJ2A 3UD7A 5D63A 2KLLA 2Z48A 3N7MA 4DEPA 4IYBA 5FZYA 3OBTA 1Z4SA 2AFGA 2L5XA 3WINC 1II4A 4XFUA 1HWNB 2QN4A 4GOYA 1BFGA 3AH1A 4JP0A 2Y9XE 4ZBVB 2X2TA 3EF2A 1ONKB 1P63A 1CE7B 4X37A 4D0TA 1AXMA 1AVWB 1ISVA 4GAFA 1IRAX 1AVXB 3I2XA 2HWMA 1G9BA 3CQAA 2HZ9A 1HCDA 4A7ZA 1JQZA 2ERMA 5FZZA 3BAOA 4AN6A 3ZXDA 4CJMA 3VUOA 3V79C 3VT2A 3H6QA 3WO3A 2VSAA 2F8XC 3CAHA 2VUAA 1EVTA 3POKA 3B9UA 4LO7B 3VWCA 3V0AB 2HWAA 4QD2C 3IAGC 3N7KA 3V0BA
chains in the Genus database with same CATH superfamily
1FGAA 4ENDA 1PUUB 3WMUA 3MALA 1DQOA 4I7IA 1F31A 4I4YA 3ILAA 5BXRA 1KNMA 2FGFA 2D7RA 4XFTA 4KBBA 4MZFB 4ZLBB 2RG9B 3BB2A 3BAVA 1BFBA 1ISZA 4P6AA 3RTJB 2NM1A 2RSTA 3LTQA 4JKQA 5G00A 1IOBA 1JT3A 2DRYA 1G9AA 2X2SA 4I4OA 3SNVA 4D0ZA 2MLLB 4QKSA 5BXPA 5DZUA 3FUOA 3V0BB 21BIA 3AKGA 3T8SA 4XFSA 5JMCA 5B2HA 4I4QA 2NZ9A 1YXWA 4YOLA 4LO1A 1S0BA 1RMLA 1IT0A 1S0LA 4OUJA 1XYFA 4ZFYB 2NVHA 1TTUA 3C9ZA 4IY8A 2Y9FA 1N4KA 3PG0A 4LO1C 1TWEA 4J2KA 1YBIA 1W3FA 1RG8A 4Q9GA 3S8JA 2MC2A 1W3GA 4I4VA 2DRZA 3N7JA 1W3AA 1V6UA 3QYDA 1MD6A 1M16A 4QBCA 3P6JA 4OEEA 4ZKTB 5E24E 1HCEA 3FJEA 2Q3NB 1FV2A 1BLAA 2D20A 1NZKA 4OWLA 1HWOB 4MZHA 1NUNA 1S0EA 2QYIB 2ET2A 1WBAA 3CA1A 2ZQOA 3VEQA 3UJ0A 6I1BA 4L4HA 2D24A 2FFVA 5D62A 4IY9A 3FGMA 4OWJA 3CRGA 3N0KA 5FNWA 3ZX7A 3I29B 3BAHA 2RQ9A 1IJTA 5BVPI 4IZEA 3HMYA 1SZ6B 3ZC9A 1FN0A 3HBWA 4QC4A 1ITBA 3NBNA 2K8RA 3HN1A 1EPWA 3H6SE 4I0YA 5BXTA 1AFCA 2DREA 1XG6A 1QQKA 7I1BA 2FDBM 1TP0A 4OEFA 4I4RA 1R8OA 2AAIB 2AQZA 4KEJA 4EEEB 4J23B 4P0KA 3I2AA 4IZXA 4J2YA 4A7KA 1TOOA 3CU1B 2KKIA 4Q91A 2NTDA 3WA1A 2FFUA 4G6MA 1PC8B 1BA7A 3WO4A 3FJHA 5BOWA 41BIA 2XOAA 4ZGRB 3N7LA 3OGFA 3UDAA 3RMYA 1G82A 1QXMA 3RTIB 4I1EA 3Q7XA 1L2HA 4LO0A 1J0SA 3BADA 3FJIA 4USPA 1PUMB 4ZA3B 4H04A 3VSZA 1S0GA 1D0HA 2NP0A 1E0OA 2D1ZA 4LO0C 3FJ8A 4I2SA 1M2TB 2BFHA 4QD2B 3TC2A 2LIQA 1A8DA 2IHOA 1DLLA 3FJCA 1AVAC 4P0LA 1HWPB 1Q04A 3FJKA 5F8YA 4Q9PA 5F8WA 3FJ9A 4PC4A 4LO8B 1WD4A 1IILA 5HPZA 4H75A 4MZGB 4I96A 1BFCA 4QALA 1XHBA 3A21A 3K1XA 4IQPA 1DFCA 4R6UB 3Q7WA 2D44A 4EKXB 2UUSA 3WMVA 3HSMA 4EFQA 2ZR1B 4EFPA 2KI6B 4I6IA 4AN7B 5BQUA 1FWVA 2MIBA 4JAWA 1T9FA 1PZZA 2AXMA 3UJ4A 3BA5A 2FO1A 1FWUA 2D22A 4USOA 4OWKA 1ISYA 2DS0A 4ZFWB 5JLVA 1V6VA 2Y9GA 3NBDA 4I3NA 5BQUC 4X39A 3BA4A 4KC3A 3R4SA 4JPZA 4UY4A 1Z0HA 1FQ9A 3ZXGA 1TWMA 2M49A 2D23A 2LIEA 4LO2A 1PWAA 1EYLA 4G6JA 2Y9WC 3H6RA 4ZFUB 4KEIA 5EHAA 3BAUA 1JTCA 4X38A 3NBCA 4LO2C 3OBRA 1YF8B 3FUQA 4GAIA 4IONA 1WBCA 4DENA 4QO3A 3MPPG 3CRHA 3LLPA 2D43A 4I4SA 3BRGC 3E8LC 3CA4A 5BXSA 4X3AA 4G9MA 2VU9A 3S8KA 4OW4A 1MC9A 3O4OA 2KI4A 3JUTA 1DQGA 4J2XA 3IIRA 4HR6C 2E4MA 1OQLB 1V6WA 1Q1UA 1YYNA 3AKFA 3AZVA 3F1RA 2IWTB 1HIBA 3H6RB 1HKNA 4EFRA 1UPSA 4JRAA 2I1BA 2E4MC 1SR4A 3O5WB 1I1BA 3NJ5A 3D7WB 3BA7A 2F2FA 1Q03A 4J2SA 3P53A 2VXTI 3NBEA 2VXRA 2GO2A 1XZZA 3V0AA 3AZWA 1Z2VA 3O4AA 5FNXA 4G9NA 2KH2A 1TFMB 3OJVA 1SR4C 4EB2B 5BP5A 3FJBA 5FZUA 1K5VA 3AKHA 4ISRA 3HOMA 2F2FC 1K5UA 4LO7C 4Z8SB 4I4UA 3A22A 1EV2A 5BP5C 2WBCA 3FJAA 3CA6A 3CA3A 3IM7A 4FVVA 2WRYA 3FJFA 3CA0A 4I37A 4QKRA 2D7IA 3IM6A 4I4PA 1HWMB 2K43A 5I1BA 3OGGA 1T4QA 4TLPA 1ILR1 2P23A 3KMVA 2J3PA 3CA5A 1CVSA 2Q9XA 1AF9A 1BARA 3AKIA 1AVUA 2R9KB 31BIA 3BAGA 1ABRB 2YUGA 4ZOTA 1WD3A 1JY0A 1FMMS 1JLXA 4DCKC 1IRPA 4KEKA 5D61A 3UD9A 3AJ6A 1ISXA 4GP0A 4WBCA 4F34A 3VT0A 1JT4A 3AH4A 4XKIA 3A07A 3ZC8A 1BASA 3R4UA 4JQ0A 4HJJA 3WO2A 4GOVA 1DIWA 1DFQA 4H9WA 4ISQA 3CRIA 3BRDA 1FV3A 2K4AB 3W9TA 4F83A 1TIEA 3AH2A 3QR5A 1I1EA 5F90A 1FMZA 1S0FA 4FGFA 4II0A 3BAQA 1DZCA 4IHZA 5GAQA 3BRFA 3RMXA 5DUYA 3PHZA 1G9DA 4HA2A 1GGPB 1V6XA 3UD8A 1IHKA 3F62B 4GP3A 5EG6C 3A23A 1BLDA 1ISWA 4OEGA 4A7YA 1JLYA 1JT5A 2ZQNA 3FJDA 8I1BA 4QBVA 1VCLA 3HALA 4P0JA 2GZBA 2VLCA 4Z9WB 3RSJA 5EC5A 1G9CA 9ILBA 3O4DA 4I8MA 1BFFA 1DJSB 1QQLA 5F8SA 2HW9A 3JRRA 1JT7A 3AJ5A 3BTAA 3O44A 3IM5A 1RY7A 1R8NA 2Z49A 1S0DA 5DSSB 4JKXB 4LO3A 2VSEA 3P6IA 2ESUA 3O4CA 2NYYA 3FFZA 4L4IA 1S0CA 4I1BA 1RZOB 3BX1C 1DZDA 4G1RA 5DVHA 3O3QA 3Q7YA 2BEBA 3O4BA 3OJMA 4LO3C 3O49A 2BEAA 3FJJA 3VT1A 3WINA 3PMEA 1YTOA 4I4XA 4D8HA 3VSFA 2P39A 3PUBA 3OJ2A 3UD7A 5D63A 2KLLA 2Z48A 3N7MA 4DEPA 4IYBA 5FZYA 3OBTA 1Z4SA 2AFGA 2L5XA 3WINC 1II4A 4XFUA 1HWNB 2QN4A 4GOYA 1BFGA 3AH1A 4JP0A 2Y9XE 4ZBVB 2X2TA 3EF2A 1ONKB 1P63A 1CE7B 4X37A 4D0TA 1AXMA 1AVWB 1ISVA 4GAFA 1IRAX 1AVXB 3I2XA 2HWMA 1G9BA 3CQAA 2HZ9A 1HCDA 4A7ZA 1JQZA 2ERMA 5FZZA 3BAOA 4AN6A 3ZXDA 4CJMA 3VUOA 3V79C 3VT2A 3H6QA 3WO3A 2VSAA 2F8XC 3CAHA 2VUAA 1EVTA 3POKA 3B9UA 4LO7B 3VWCA 3V0AB 2HWAA 4QD2C 3IAGC 3N7KA 3V0BA 2NS2A
chains in the Genus database with same CATH topology
1FGAA 4ENDA 1PUUB 3WMUA 3MALA 1DQOA 4I7IA 1F31A 4I4YA 3ILAA 5BXRA 1KNMA 2FGFA 2D7RA 4XFTA 4KBBA 4MZFB 4ZLBB 2RG9B 3BB2A 3BAVA 1BFBA 1ISZA 4P6AA 3RTJB 2NM1A 2RSTA 3LTQA 4JKQA 5G00A 1IOBA 1JT3A 2DRYA 1G9AA 2X2SA 4I4OA 3SNVA 4D0ZA 2MLLB 4QKSA 5BXPA 5DZUA 3FUOA 3V0BB 21BIA 3AKGA 3T8SA 4XFSA 5JMCA 5B2HA 4I4QA 2NZ9A 1YXWA 4YOLA 4LO1A 1S0BA 1RMLA 1IT0A 1S0LA 4OUJA 1XYFA 4ZFYB 2NVHA 1TTUA 3C9ZA 4IY8A 2Y9FA 1N4KA 3PG0A 4LO1C 1TWEA 4J2KA 1YBIA 1W3FA 1RG8A 4Q9GA 3S8JA 2MC2A 1W3GA 4I4VA 2DRZA 3N7JA 1W3AA 1V6UA 3QYDA 1MD6A 1M16A 4QBCA 3P6JA 4OEEA 4ZKTB 5E24E 1HCEA 3FJEA 2Q3NB 1FV2A 1BLAA 2D20A 1NZKA 4OWLA 1HWOB 4MZHA 1NUNA 1S0EA 2QYIB 2ET2A 1WBAA 3CA1A 2ZQOA 3VEQA 3UJ0A 6I1BA 4L4HA 2D24A 2FFVA 5D62A 4IY9A 3FGMA 4OWJA 3CRGA 3N0KA 5FNWA 3ZX7A 3I29B 3BAHA 2RQ9A 1IJTA 5BVPI 4IZEA 3HMYA 1SZ6B 3ZC9A 1FN0A 3HBWA 4QC4A 1ITBA 3NBNA 2K8RA 3HN1A 1EPWA 3H6SE 4I0YA 5BXTA 1AFCA 2DREA 1XG6A 1QQKA 7I1BA 2FDBM 1TP0A 4OEFA 4I4RA 1R8OA 2AAIB 2AQZA 4KEJA 4EEEB 4J23B 4P0KA 3I2AA 4IZXA 4J2YA 4A7KA 1TOOA 3CU1B 2KKIA 4Q91A 2NTDA 3WA1A 2FFUA 4G6MA 1PC8B 1BA7A 3WO4A 3FJHA 5BOWA 41BIA 2XOAA 4ZGRB 3N7LA 3OGFA 3UDAA 3RMYA 1G82A 1QXMA 3RTIB 4I1EA 3Q7XA 1L2HA 4LO0A 1J0SA 3BADA 3FJIA 4USPA 1PUMB 4ZA3B 4H04A 3VSZA 1S0GA 1D0HA 2NP0A 1E0OA 2D1ZA 4LO0C 3FJ8A 4I2SA 1M2TB 2BFHA 4QD2B 3TC2A 2LIQA 1A8DA 2IHOA 1DLLA 3FJCA 1AVAC 4P0LA 1HWPB 1Q04A 3FJKA 5F8YA 4Q9PA 5F8WA 3FJ9A 4PC4A 4LO8B 1WD4A 1IILA 5HPZA 4H75A 4MZGB 4I96A 1BFCA 4QALA 1XHBA 3A21A 3K1XA 4IQPA 1DFCA 4R6UB 3Q7WA 2D44A 4EKXB 2UUSA 3WMVA 3HSMA 4EFQA 2ZR1B 4EFPA 2KI6B 4I6IA 4AN7B 5BQUA 1FWVA 2MIBA 4JAWA 1T9FA 1PZZA 2AXMA 3UJ4A 3BA5A 2FO1A 1FWUA 2D22A 4USOA 4OWKA 1ISYA 2DS0A 4ZFWB 5JLVA 1V6VA 2Y9GA 3NBDA 4I3NA 5BQUC 4X39A 3BA4A 4KC3A 3R4SA 4JPZA 4UY4A 1Z0HA 1FQ9A 3ZXGA 1TWMA 2M49A 2D23A 2LIEA 4LO2A 1PWAA 1EYLA 4G6JA 2Y9WC 3H6RA 4ZFUB 4KEIA 5EHAA 3BAUA 1JTCA 4X38A 3NBCA 4LO2C 3OBRA 1YF8B 3FUQA 4GAIA 4IONA 1WBCA 4DENA 4QO3A 3MPPG 3CRHA 3LLPA 2D43A 4I4SA 3BRGC 3E8LC 3CA4A 5BXSA 4X3AA 4G9MA 2VU9A 3S8KA 4OW4A 1MC9A 3O4OA 2KI4A 3JUTA 1DQGA 4J2XA 3IIRA 4HR6C 2E4MA 1OQLB 1V6WA 1Q1UA 1YYNA 3AKFA 3AZVA 3F1RA 2IWTB 1HIBA 3H6RB 1HKNA 4EFRA 1UPSA 4JRAA 2I1BA 2E4MC 1SR4A 3O5WB 1I1BA 3NJ5A 3D7WB 3BA7A 2F2FA 1Q03A 4J2SA 3P53A 2VXTI 3NBEA 2VXRA 2GO2A 1XZZA 3V0AA 3AZWA 1Z2VA 3O4AA 5FNXA 4G9NA 2KH2A 1TFMB 3OJVA 1SR4C 4EB2B 5BP5A 3FJBA 5FZUA 1K5VA 3AKHA 4ISRA 3HOMA 2F2FC 1K5UA 4LO7C 4Z8SB 4I4UA 3A22A 1EV2A 5BP5C 2WBCA 3FJAA 3CA6A 3CA3A 3IM7A 4FVVA 2WRYA 3FJFA 3CA0A 4I37A 4QKRA 2D7IA 3IM6A 4I4PA 1HWMB 2K43A 5I1BA 3OGGA 1T4QA 4TLPA 1ILR1 2P23A 3KMVA 2J3PA 3CA5A 1CVSA 2Q9XA 1AF9A 1BARA 3AKIA 1AVUA 2R9KB 31BIA 3BAGA 1ABRB 2YUGA 4ZOTA 1WD3A 1JY0A 1FMMS 1JLXA 4DCKC 1IRPA 4KEKA 5D61A 3UD9A 3AJ6A 1ISXA 4GP0A 4WBCA 4F34A 3VT0A 1JT4A 3AH4A 4XKIA 3A07A 3ZC8A 1BASA 3R4UA 4JQ0A 4HJJA 3WO2A 4GOVA 1DIWA 1DFQA 4H9WA 4ISQA 3CRIA 3BRDA 1FV3A 2K4AB 3W9TA 4F83A 1TIEA 3AH2A 3QR5A 1I1EA 5F90A 1FMZA 1S0FA 4FGFA 4II0A 3BAQA 1DZCA 4IHZA 5GAQA 3BRFA 3RMXA 5DUYA 3PHZA 1G9DA 4HA2A 1GGPB 1V6XA 3UD8A 1IHKA 3F62B 4GP3A 5EG6C 3A23A 1BLDA 1ISWA 4OEGA 4A7YA 1JLYA 1JT5A 2ZQNA 3FJDA 8I1BA 4QBVA 1VCLA 3HALA 4P0JA 2GZBA 2VLCA 4Z9WB 3RSJA 5EC5A 1G9CA 9ILBA 3O4DA 4I8MA 1BFFA 1DJSB 1QQLA 5F8SA 2HW9A 3JRRA 1JT7A 3AJ5A 3BTAA 3O44A 3IM5A 1RY7A 1R8NA 2Z49A 1S0DA 5DSSB 4JKXB 4LO3A 2VSEA 3P6IA 2ESUA 3O4CA 2NYYA 3FFZA 4L4IA 1S0CA 4I1BA 1RZOB 3BX1C 1DZDA 4G1RA 5DVHA 3O3QA 3Q7YA 2BEBA 3O4BA 3OJMA 4LO3C 3O49A 2BEAA 3FJJA 3VT1A 3WINA 3PMEA 1YTOA 4I4XA 4D8HA 3VSFA 2P39A 3PUBA 3OJ2A 3UD7A 5D63A 2KLLA 2Z48A 3N7MA 4DEPA 4IYBA 5FZYA 3OBTA 1Z4SA 2AFGA 2L5XA 3WINC 1II4A 4XFUA 1HWNB 2QN4A 4GOYA 1BFGA 3AH1A 4JP0A 2Y9XE 4ZBVB 2X2TA 3EF2A 1ONKB 1P63A 1CE7B 4X37A 4D0TA 1AXMA 1AVWB 1ISVA 4GAFA 1IRAX 1AVXB 3I2XA 2HWMA 1G9BA 3CQAA 2HZ9A 1HCDA 4A7ZA 1JQZA 2ERMA 5FZZA 3BAOA 4AN6A 3ZXDA 4CJMA 3VUOA 3V79C 3VT2A 3H6QA 3WO3A 2VSAA 2F8XC 3CAHA 2VUAA 1EVTA 3POKA 3B9UA 4LO7B 3VWCA 3V0AB 2HWAA 4QD2C 3IAGC 3N7KA 3V0BA 2NS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGA A;  4END A;  1PUU B;  3WMU A;  3MAL A;  1DQO A;  4I7I A;  1F31 A;  4I4Y A;  3ILA A;  5BXR A;  1KNM A;  2FGF A;  2D7R A;  4XFT A;  4KBB A;  4ZLB B;  2RG9 B;  3BB2 A;  3BAV A;  1BFB A;  1ISZ A;  4P6A A;  3RTJ B;  2NM1 A;  2RST A;  3LTQ A;  4JKQ A;  5G00 A;  1IOB A;  1JT3 A;  2DRY A;  1G9A A;  2X2S A;  4I4O A;  3SNV A;  4D0Z A;  2MLL B;  4QKS A;  5BXP A;  5DZU A;  3FUO A;  3V0B B;  21BI A;  3AKG A;  3T8S A;  4XFS A;  5JMC A;  5B2H A;  4I4Q A;  2NZ9 A;  1YXW A;  4YOL A;  4LO1 A;  1S0B A;  1RML A;  1IT0 A;  1S0L A;  4OUJ A;  1XYF A;  4ZFY B;  2NVH A;  1TTU A;  3C9Z A;  4IY8 A;  2Y9F A;  1N4K A;  3PG0 A;  4LO1 C;  1TWE A;  4J2K A;  1YBI A;  1W3F A;  1RG8 A;  4Q9G A;  3S8J A;  2MC2 A;  1W3G A;  4I4V A;  2DRZ A;  3N7J A;  1W3A A;  1V6U A;  3QYD A;  1MD6 A;  1M16 A;  4QBC A;  3P6J A;  4OEE A;  4ZKT B;  5E24 E;  1HCE A;  3FJE A;  2Q3N B;  1FV2 A;  1BLA A;  2D20 A;  1NZK A;  4OWL A;  1HWO B;  1NUN A;  1S0E A;  2QYI B;  2ET2 A;  1WBA A;  3CA1 A;  2ZQO A;  3VEQ A;  3UJ0 A;  6I1B A;  4L4H A;  2D24 A;  2FFV A;  5D62 A;  4IY9 A;  3FGM A;  4OWJ A;  3CRG A;  3N0K A;  5FNW A;  3ZX7 A;  3I29 B;  3BAH A;  2RQ9 A;  1IJT A;  5BVP I;  4IZE A;  3HMY A;  1SZ6 B;  3ZC9 A;  1FN0 A;  3HBW A;  4QC4 A;  1ITB A;  3NBN A;  2K8R A;  3HN1 A;  1EPW A;  3H6S E;  4I0Y A;  5BXT A;  1AFC A;  2DRE A;  1XG6 A;  1QQK A;  7I1B A;  2FDB M;  1TP0 A;  4OEF A;  4I4R A;  1R8O A;  2AAI B;  2AQZ A;  4KEJ A;  4EEE B;  4J23 B;  4P0K A;  3I2A A;  4IZX A;  4J2Y A;  4A7K A;  1TOO A;  3CU1 B;  2KKI A;  4Q91 A;  2NTD A;  3WA1 A;  2FFU A;  4G6M A;  1PC8 B;  1BA7 A;  3WO4 A;  3FJH A;  5BOW A;  41BI A;  2XOA A;  4ZGR B;  3N7L A;  3OGF A;  3UDA A;  3RMY A;  1G82 A;  1QXM A;  3RTI B;  4I1E A;  3Q7X A;  1L2H A;  4LO0 A;  1J0S A;  3BAD A;  3FJI A;  4USP A;  1PUM B;  4ZA3 B;  4H04 A;  3VSZ A;  1S0G A;  1D0H A;  2NP0 A;  1E0O A;  2D1Z A;  4LO0 C;  3FJ8 A;  4I2S A;  1M2T B;  2BFH A;  4QD2 B;  3TC2 A;  2LIQ A;  1A8D A;  2IHO A;  1DLL A;  3FJC A;  1AVA C;  4P0L A;  1HWP B;  1Q04 A;  3FJK A;  5F8Y A;  4Q9P A;  5F8W A;  3FJ9 A;  4PC4 A;  4LO8 B;  1WD4 A;  1IIL A;  5HPZ A;  4I96 A;  1BFC A;  4QAL A;  1XHB A;  3A21 A;  3K1X A;  4IQP A;  1DFC A;  4R6U B;  3Q7W A;  2D44 A;  4EKX B;  2UUS A;  3WMV A;  3HSM A;  4EFQ A;  2ZR1 B;  4EFP A;  2KI6 B;  4I6I A;  4AN7 B;  5BQU A;  1FWV A;  2MIB A;  4JAW A;  1T9F A;  1PZZ A;  2AXM A;  3UJ4 A;  3BA5 A;  2FO1 A;  1FWU A;  2D22 A;  4USO A;  4OWK A;  1ISY A;  2DS0 A;  4ZFW B;  5JLV A;  1V6V A;  2Y9G A;  3NBD A;  4I3N A;  5BQU C;  4X39 A;  3BA4 A;  4KC3 A;  3R4S A;  4JPZ A;  1Z0H A;  1FQ9 A;  3ZXG A;  1TWM A;  2M49 A;  2D23 A;  2LIE A;  4LO2 A;  1PWA A;  1EYL A;  4G6J A;  2Y9W C;  3H6R A;  4ZFU B;  4KEI A;  5EHA A;  3BAU A;  1JTC A;  4X38 A;  3NBC A;  4LO2 C;  3OBR A;  1YF8 B;  3FUQ A;  4GAI A;  4ION A;  1WBC A;  4DEN A;  4QO3 A;  3MPP G;  3CRH A;  3LLP A;  2D43 A;  4I4S A;  3BRG C;  3E8L C;  3CA4 A;  5BXS A;  4X3A A;  4G9M A;  2VU9 A;  3S8K A;  4OW4 A;  1MC9 A;  3O4O A;  2KI4 A;  3JUT A;  1DQG A;  4J2X A;  3IIR A;  4HR6 C;  2E4M A;  1OQL B;  1V6W A;  1Q1U A;  1YYN A;  3AKF A;  3AZV A;  3F1R A;  2IWT B;  1HIB A;  3H6R B;  1HKN A;  4EFR A;  1UPS A;  4JRA A;  2I1B A;  2E4M C;  1SR4 A;  3O5W B;  1I1B A;  3NJ5 A;  3D7W B;  3BA7 A;  2F2F A;  1Q03 A;  4J2S A;  3P53 A;  2VXT I;  3NBE A;  2VXR A;  2GO2 A;  1XZZ A;  3V0A A;  3AZW A;  1Z2V A;  3O4A A;  5FNX A;  4G9N A;  2KH2 A;  1TFM B;  3OJV A;  1SR4 C;  4EB2 B;  5BP5 A;  3FJB A;  5FZU A;  1K5V A;  3AKH A;  4ISR A;  3HOM A;  2F2F C;  1K5U A;  4LO7 C;  4Z8S B;  4I4U A;  3A22 A;  1EV2 A;  5BP5 C;  2WBC A;  3FJA A;  3CA6 A;  3CA3 A;  3IM7 A;  4FVV A;  2WRY A;  3FJF A;  3CA0 A;  4I37 A;  4QKR A;  2D7I A;  3IM6 A;  4I4P A;  1HWM B;  2K43 A;  5I1B A;  3OGG A;  1T4Q A;  4TLP A;  1ILR 1;  2P23 A;  3KMV A;  2J3P A;  3CA5 A;  1CVS A;  2Q9X A;  1AF9 A;  1BAR A;  3AKI A;  1AVU A;  2R9K B;  31BI A;  3BAG A;  1ABR B;  2YUG A;  4ZOT A;  1WD3 A;  1JY0 A;  1FMM S;  1JLX A;  4DCK C;  1IRP A;  4KEK A;  5D61 A;  3UD9 A;  3AJ6 A;  1ISX A;  4GP0 A;  4WBC A;  4F34 A;  3VT0 A;  1JT4 A;  3AH4 A;  4XKI A;  3A07 A;  3ZC8 A;  1BAS A;  3R4U A;  4JQ0 A;  4HJJ A;  3WO2 A;  4GOV A;  1DIW A;  1DFQ A;  4H9W A;  4ISQ A;  3CRI A;  3BRD A;  1FV3 A;  2K4A B;  3W9T A;  4F83 A;  1TIE A;  3AH2 A;  3QR5 A;  1I1E A;  5F90 A;  1FMZ A;  1S0F A;  4FGF A;  4II0 A;  3BAQ A;  1DZC A;  4IHZ A;  5GAQ A;  3BRF A;  3RMX A;  5DUY A;  3PHZ A;  1G9D A;  4HA2 A;  1GGP B;  1V6X A;  3UD8 A;  1IHK A;  3F62 B;  4GP3 A;  5EG6 C;  3A23 A;  1BLD A;  1ISW A;  4OEG A;  4A7Y A;  1JLY A;  1JT5 A;  2ZQN A;  3FJD A;  8I1B A;  4QBV A;  1VCL A;  3HAL A;  4P0J A;  2GZB A;  2VLC A;  4Z9W B;  3RSJ A;  5EC5 A;  1G9C A;  9ILB A;  3O4D A;  4I8M A;  1BFF A;  1DJS B;  1QQL A;  5F8S A;  2HW9 A;  3JRR A;  1JT7 A;  3AJ5 A;  3BTA A;  3O44 A;  3IM5 A;  1RY7 A;  1R8N A;  2Z49 A;  1S0D A;  5DSS B;  4JKX B;  4LO3 A;  2VSE A;  3P6I A;  2ESU A;  3O4C A;  2NYY A;  3FFZ A;  4L4I A;  1S0C A;  4I1B A;  1RZO B;  3BX1 C;  1DZD A;  4G1R A;  5DVH A;  3O3Q A;  3Q7Y A;  2BEB A;  3O4B A;  3OJM A;  4LO3 C;  3O49 A;  2BEA A;  3FJJ A;  3VT1 A;  3WIN A;  3PME A;  1YTO A;  4I4X A;  4D8H A;  3VSF A;  2P39 A;  3PUB A;  3OJ2 A;  3UD7 A;  5D63 A;  2KLL A;  2Z48 A;  3N7M A;  4DEP A;  4IYB A;  5FZY A;  3OBT A;  1Z4S A;  2AFG A;  2L5X A;  3WIN C;  1II4 A;  4XFU A;  1HWN B;  2QN4 A;  4GOY A;  1BFG A;  3AH1 A;  4JP0 A;  2Y9X E;  4ZBV B;  2X2T A;  3EF2 A;  1ONK B;  1P63 A;  1CE7 B;  4X37 A;  4D0T A;  1AXM A;  1AVW B;  1ISV A;  4GAF A;  1IRA X;  1AVX B;  3I2X A;  2HWM A;  1G9B A;  3CQA A;  2HZ9 A;  1HCD A;  4A7Z A;  1JQZ A;  2ERM A;  5FZZ A;  3BAO A;  4AN6 A;  3ZXD A;  4CJM A;  3VUO A;  3V79 C;  3VT2 A;  3H6Q A;  3WO3 A;  2VSA A;  2F8X C;  3CAH A;  2VUA A;  1EVT A;  3POK A;  3B9U A;  4LO7 B;  3VWC A;  3V0A B;  2HWA A;  4QD2 C;  3IAG C;  3N7K A;  3V0B A; 
#chains in the Genus database with same CATH topology
 1FGA A;  4END A;  1PUU B;  3WMU A;  3MAL A;  1DQO A;  4I7I A;  1F31 A;  4I4Y A;  3ILA A;  5BXR A;  1KNM A;  2FGF A;  2D7R A;  4XFT A;  4KBB A;  4MZF B;  4ZLB B;  2RG9 B;  3BB2 A;  3BAV A;  1BFB A;  1ISZ A;  4P6A A;  3RTJ B;  2NM1 A;  2RST A;  3LTQ A;  4JKQ A;  5G00 A;  1IOB A;  1JT3 A;  2DRY A;  1G9A A;  2X2S A;  4I4O A;  3SNV A;  4D0Z A;  2MLL B;  4QKS A;  5BXP A;  5DZU A;  3FUO A;  3V0B B;  21BI A;  3AKG A;  3T8S A;  4XFS A;  5JMC A;  5B2H A;  4I4Q A;  2NZ9 A;  1YXW A;  4YOL A;  4LO1 A;  1S0B A;  1RML A;  1IT0 A;  1S0L A;  4OUJ A;  1XYF A;  4ZFY B;  2NVH A;  1TTU A;  3C9Z A;  4IY8 A;  2Y9F A;  1N4K A;  3PG0 A;  4LO1 C;  1TWE A;  4J2K A;  1YBI A;  1W3F A;  1RG8 A;  4Q9G A;  3S8J A;  2MC2 A;  1W3G A;  4I4V A;  2DRZ A;  3N7J A;  1W3A A;  1V6U A;  3QYD A;  1MD6 A;  1M16 A;  4QBC A;  3P6J A;  4OEE A;  4ZKT B;  5E24 E;  1HCE A;  3FJE A;  2Q3N B;  1FV2 A;  1BLA A;  2D20 A;  1NZK A;  4OWL A;  1HWO B;  4MZH A;  1NUN A;  1S0E A;  2QYI B;  2ET2 A;  1WBA A;  3CA1 A;  2ZQO A;  3VEQ A;  3UJ0 A;  6I1B A;  4L4H A;  2D24 A;  2FFV A;  5D62 A;  4IY9 A;  3FGM A;  4OWJ A;  3CRG A;  3N0K A;  5FNW A;  3ZX7 A;  3I29 B;  3BAH A;  2RQ9 A;  1IJT A;  5BVP I;  4IZE A;  3HMY A;  1SZ6 B;  3ZC9 A;  1FN0 A;  3HBW A;  4QC4 A;  1ITB A;  3NBN A;  2K8R A;  3HN1 A;  1EPW A;  3H6S E;  4I0Y A;  5BXT A;  1AFC A;  2DRE A;  1XG6 A;  1QQK A;  7I1B A;  2FDB M;  1TP0 A;  4OEF A;  4I4R A;  1R8O A;  2AAI B;  2AQZ A;  4KEJ A;  4EEE B;  4J23 B;  4P0K A;  3I2A A;  4IZX A;  4J2Y A;  4A7K A;  1TOO A;  3CU1 B;  2KKI A;  4Q91 A;  2NTD A;  3WA1 A;  2FFU A;  4G6M A;  1PC8 B;  1BA7 A;  3WO4 A;  3FJH A;  5BOW A;  41BI A;  2XOA A;  4ZGR B;  3N7L A;  3OGF A;  3UDA A;  3RMY A;  1G82 A;  1QXM A;  3RTI B;  4I1E A;  3Q7X A;  1L2H A;  4LO0 A;  1J0S A;  3BAD A;  3FJI A;  4USP A;  1PUM B;  4ZA3 B;  4H04 A;  3VSZ A;  1S0G A;  1D0H A;  2NP0 A;  1E0O A;  2D1Z A;  4LO0 C;  3FJ8 A;  4I2S A;  1M2T B;  2BFH A;  4QD2 B;  3TC2 A;  2LIQ A;  1A8D A;  2IHO A;  1DLL A;  3FJC A;  1AVA C;  4P0L A;  1HWP B;  1Q04 A;  3FJK A;  5F8Y A;  4Q9P A;  5F8W A;  3FJ9 A;  4PC4 A;  4LO8 B;  1WD4 A;  1IIL A;  5HPZ A;  4H75 A;  4MZG B;  4I96 A;  1BFC A;  4QAL A;  1XHB A;  3A21 A;  3K1X A;  4IQP A;  1DFC A;  4R6U B;  3Q7W A;  2D44 A;  4EKX B;  2UUS A;  3WMV A;  3HSM A;  4EFQ A;  2ZR1 B;  4EFP A;  2KI6 B;  4I6I A;  4AN7 B;  5BQU A;  1FWV A;  2MIB A;  4JAW A;  1T9F A;  1PZZ A;  2AXM A;  3UJ4 A;  3BA5 A;  2FO1 A;  1FWU A;  2D22 A;  4USO A;  4OWK A;  1ISY A;  2DS0 A;  4ZFW B;  5JLV A;  1V6V A;  2Y9G A;  3NBD A;  4I3N A;  5BQU C;  4X39 A;  3BA4 A;  4KC3 A;  3R4S A;  4JPZ A;  4UY4 A;  1Z0H A;  1FQ9 A;  3ZXG A;  1TWM A;  2M49 A;  2D23 A;  2LIE A;  4LO2 A;  1PWA A;  1EYL A;  4G6J A;  2Y9W C;  3H6R A;  4ZFU B;  4KEI A;  5EHA A;  3BAU A;  1JTC A;  4X38 A;  3NBC A;  4LO2 C;  3OBR A;  1YF8 B;  3FUQ A;  4GAI A;  4ION A;  1WBC A;  4DEN A;  4QO3 A;  3MPP G;  3CRH A;  3LLP A;  2D43 A;  4I4S A;  3BRG C;  3E8L C;  3CA4 A;  5BXS A;  4X3A A;  4G9M A;  2VU9 A;  3S8K A;  4OW4 A;  1MC9 A;  3O4O A;  2KI4 A;  3JUT A;  1DQG A;  4J2X A;  3IIR A;  4HR6 C;  2E4M A;  1OQL B;  1V6W A;  1Q1U A;  1YYN A;  3AKF A;  3AZV A;  3F1R A;  2IWT B;  1HIB A;  3H6R B;  1HKN A;  4EFR A;  1UPS A;  4JRA A;  2I1B A;  2E4M C;  1SR4 A;  3O5W B;  1I1B A;  3NJ5 A;  3D7W B;  3BA7 A;  2F2F A;  1Q03 A;  4J2S A;  3P53 A;  2VXT I;  3NBE A;  2VXR A;  2GO2 A;  1XZZ A;  3V0A A;  3AZW A;  1Z2V A;  3O4A A;  5FNX A;  4G9N A;  2KH2 A;  1TFM B;  3OJV A;  1SR4 C;  4EB2 B;  5BP5 A;  3FJB A;  5FZU A;  1K5V A;  3AKH A;  4ISR A;  3HOM A;  2F2F C;  1K5U A;  4LO7 C;  4Z8S B;  4I4U A;  3A22 A;  1EV2 A;  5BP5 C;  2WBC A;  3FJA A;  3CA6 A;  3CA3 A;  3IM7 A;  4FVV A;  2WRY A;  3FJF A;  3CA0 A;  4I37 A;  4QKR A;  2D7I A;  3IM6 A;  4I4P A;  1HWM B;  2K43 A;  5I1B A;  3OGG A;  1T4Q A;  4TLP A;  1ILR 1;  2P23 A;  3KMV A;  2J3P A;  3CA5 A;  1CVS A;  2Q9X A;  1AF9 A;  1BAR A;  3AKI A;  1AVU A;  2R9K B;  31BI A;  3BAG A;  1ABR B;  2YUG A;  4ZOT A;  1WD3 A;  1JY0 A;  1FMM S;  1JLX A;  4DCK C;  1IRP A;  4KEK A;  5D61 A;  3UD9 A;  3AJ6 A;  1ISX A;  4GP0 A;  4WBC A;  4F34 A;  3VT0 A;  1JT4 A;  3AH4 A;  4XKI A;  3A07 A;  3ZC8 A;  1BAS A;  3R4U A;  4JQ0 A;  4HJJ A;  3WO2 A;  4GOV A;  1DIW A;  1DFQ A;  4H9W A;  4ISQ A;  3CRI A;  3BRD A;  1FV3 A;  2K4A B;  3W9T A;  4F83 A;  1TIE A;  3AH2 A;  3QR5 A;  1I1E A;  5F90 A;  1FMZ A;  1S0F A;  4FGF A;  4II0 A;  3BAQ A;  1DZC A;  4IHZ A;  5GAQ A;  3BRF A;  3RMX A;  5DUY A;  3PHZ A;  1G9D A;  4HA2 A;  1GGP B;  1V6X A;  3UD8 A;  1IHK A;  3F62 B;  4GP3 A;  5EG6 C;  3A23 A;  1BLD A;  1ISW A;  4OEG A;  4A7Y A;  1JLY A;  1JT5 A;  2ZQN A;  3FJD A;  8I1B A;  4QBV A;  1VCL A;  3HAL A;  4P0J A;  2GZB A;  2VLC A;  4Z9W B;  3RSJ A;  5EC5 A;  1G9C A;  9ILB A;  3O4D A;  4I8M A;  1BFF A;  1DJS B;  1QQL A;  5F8S A;  2HW9 A;  3JRR A;  1JT7 A;  3AJ5 A;  3BTA A;  3O44 A;  3IM5 A;  1RY7 A;  1R8N A;  2Z49 A;  1S0D A;  5DSS B;  4JKX B;  4LO3 A;  2VSE A;  3P6I A;  2ESU A;  3O4C A;  2NYY A;  3FFZ A;  4L4I A;  1S0C A;  4I1B A;  1RZO B;  3BX1 C;  1DZD A;  4G1R A;  5DVH A;  3O3Q A;  3Q7Y A;  2BEB A;  3O4B A;  3OJM A;  4LO3 C;  3O49 A;  2BEA A;  3FJJ A;  3VT1 A;  3WIN A;  3PME A;  1YTO A;  4I4X A;  4D8H A;  3VSF A;  2P39 A;  3PUB A;  3OJ2 A;  3UD7 A;  5D63 A;  2KLL A;  2Z48 A;  3N7M A;  4DEP A;  4IYB A;  5FZY A;  3OBT A;  1Z4S A;  2AFG A;  2L5X A;  3WIN C;  1II4 A;  4XFU A;  1HWN B;  2QN4 A;  4GOY A;  1BFG A;  3AH1 A;  4JP0 A;  2Y9X E;  4ZBV B;  2X2T A;  3EF2 A;  1ONK B;  1P63 A;  1CE7 B;  4X37 A;  4D0T A;  1AXM A;  1AVW B;  1ISV A;  4GAF A;  1IRA X;  1AVX B;  3I2X A;  2HWM A;  1G9B A;  3CQA A;  2HZ9 A;  1HCD A;  4A7Z A;  1JQZ A;  2ERM A;  5FZZ A;  3BAO A;  4AN6 A;  3ZXD A;  4CJM A;  3VUO A;  3V79 C;  3VT2 A;  3H6Q A;  3WO3 A;  2VSA A;  2F8X C;  3CAH A;  2VUA A;  1EVT A;  3POK A;  3B9U A;  4LO7 B;  3VWC A;  3V0A B;  2HWA A;  4QD2 C;  3IAG C;  3N7K A;  3V0B A;  2NS2 A; 
#chains in the Genus database with same CATH homology
 1FGA A;  4END A;  1PUU B;  3WMU A;  3MAL A;  1DQO A;  4I7I A;  1F31 A;  4I4Y A;  3ILA A;  5BXR A;  1KNM A;  2FGF A;  2D7R A;  4XFT A;  4KBB A;  4MZF B;  4ZLB B;  2RG9 B;  3BB2 A;  3BAV A;  1BFB A;  1ISZ A;  4P6A A;  3RTJ B;  2NM1 A;  2RST A;  3LTQ A;  4JKQ A;  5G00 A;  1IOB A;  1JT3 A;  2DRY A;  1G9A A;  2X2S A;  4I4O A;  3SNV A;  4D0Z A;  2MLL B;  4QKS A;  5BXP A;  5DZU A;  3FUO A;  3V0B B;  21BI A;  3AKG A;  3T8S A;  4XFS A;  5JMC A;  5B2H A;  4I4Q A;  2NZ9 A;  1YXW A;  4YOL A;  4LO1 A;  1S0B A;  1RML A;  1IT0 A;  1S0L A;  4OUJ A;  1XYF A;  4ZFY B;  2NVH A;  1TTU A;  3C9Z A;  4IY8 A;  2Y9F A;  1N4K A;  3PG0 A;  4LO1 C;  1TWE A;  4J2K A;  1YBI A;  1W3F A;  1RG8 A;  4Q9G A;  3S8J A;  2MC2 A;  1W3G A;  4I4V A;  2DRZ A;  3N7J A;  1W3A A;  1V6U A;  3QYD A;  1MD6 A;  1M16 A;  4QBC A;  3P6J A;  4OEE A;  4ZKT B;  5E24 E;  1HCE A;  3FJE A;  2Q3N B;  1FV2 A;  1BLA A;  2D20 A;  1NZK A;  4OWL A;  1HWO B;  4MZH A;  1NUN A;  1S0E A;  2QYI B;  2ET2 A;  1WBA A;  3CA1 A;  2ZQO A;  3VEQ A;  3UJ0 A;  6I1B A;  4L4H A;  2D24 A;  2FFV A;  5D62 A;  4IY9 A;  3FGM A;  4OWJ A;  3CRG A;  3N0K A;  5FNW A;  3ZX7 A;  3I29 B;  3BAH A;  2RQ9 A;  1IJT A;  5BVP I;  4IZE A;  3HMY A;  1SZ6 B;  3ZC9 A;  1FN0 A;  3HBW A;  4QC4 A;  1ITB A;  3NBN A;  2K8R A;  3HN1 A;  1EPW A;  3H6S E;  4I0Y A;  5BXT A;  1AFC A;  2DRE A;  1XG6 A;  1QQK A;  7I1B A;  2FDB M;  1TP0 A;  4OEF A;  4I4R A;  1R8O A;  2AAI B;  2AQZ A;  4KEJ A;  4EEE B;  4J23 B;  4P0K A;  3I2A A;  4IZX A;  4J2Y A;  4A7K A;  1TOO A;  3CU1 B;  2KKI A;  4Q91 A;  2NTD A;  3WA1 A;  2FFU A;  4G6M A;  1PC8 B;  1BA7 A;  3WO4 A;  3FJH A;  5BOW A;  41BI A;  2XOA A;  4ZGR B;  3N7L A;  3OGF A;  3UDA A;  3RMY A;  1G82 A;  1QXM A;  3RTI B;  4I1E A;  3Q7X A;  1L2H A;  4LO0 A;  1J0S A;  3BAD A;  3FJI A;  4USP A;  1PUM B;  4ZA3 B;  4H04 A;  3VSZ A;  1S0G A;  1D0H A;  2NP0 A;  1E0O A;  2D1Z A;  4LO0 C;  3FJ8 A;  4I2S A;  1M2T B;  2BFH A;  4QD2 B;  3TC2 A;  2LIQ A;  1A8D A;  2IHO A;  1DLL A;  3FJC A;  1AVA C;  4P0L A;  1HWP B;  1Q04 A;  3FJK A;  5F8Y A;  4Q9P A;  5F8W A;  3FJ9 A;  4PC4 A;  4LO8 B;  1WD4 A;  1IIL A;  5HPZ A;  4H75 A;  4MZG B;  4I96 A;  1BFC A;  4QAL A;  1XHB A;  3A21 A;  3K1X A;  4IQP A;  1DFC A;  4R6U B;  3Q7W A;  2D44 A;  4EKX B;  2UUS A;  3WMV A;  3HSM A;  4EFQ A;  2ZR1 B;  4EFP A;  2KI6 B;  4I6I A;  4AN7 B;  5BQU A;  1FWV A;  2MIB A;  4JAW A;  1T9F A;  1PZZ A;  2AXM A;  3UJ4 A;  3BA5 A;  2FO1 A;  1FWU A;  2D22 A;  4USO A;  4OWK A;  1ISY A;  2DS0 A;  4ZFW B;  5JLV A;  1V6V A;  2Y9G A;  3NBD A;  4I3N A;  5BQU C;  4X39 A;  3BA4 A;  4KC3 A;  3R4S A;  4JPZ A;  4UY4 A;  1Z0H A;  1FQ9 A;  3ZXG A;  1TWM A;  2M49 A;  2D23 A;  2LIE A;  4LO2 A;  1PWA A;  1EYL A;  4G6J A;  2Y9W C;  3H6R A;  4ZFU B;  4KEI A;  5EHA A;  3BAU A;  1JTC A;  4X38 A;  3NBC A;  4LO2 C;  3OBR A;  1YF8 B;  3FUQ A;  4GAI A;  4ION A;  1WBC A;  4DEN A;  4QO3 A;  3MPP G;  3CRH A;  3LLP A;  2D43 A;  4I4S A;  3BRG C;  3E8L C;  3CA4 A;  5BXS A;  4X3A A;  4G9M A;  2VU9 A;  3S8K A;  4OW4 A;  1MC9 A;  3O4O A;  2KI4 A;  3JUT A;  1DQG A;  4J2X A;  3IIR A;  4HR6 C;  2E4M A;  1OQL B;  1V6W A;  1Q1U A;  1YYN A;  3AKF A;  3AZV A;  3F1R A;  2IWT B;  1HIB A;  3H6R B;  1HKN A;  4EFR A;  1UPS A;  4JRA A;  2I1B A;  2E4M C;  1SR4 A;  3O5W B;  1I1B A;  3NJ5 A;  3D7W B;  3BA7 A;  2F2F A;  1Q03 A;  4J2S A;  3P53 A;  2VXT I;  3NBE A;  2VXR A;  2GO2 A;  1XZZ A;  3V0A A;  3AZW A;  1Z2V A;  3O4A A;  5FNX A;  4G9N A;  2KH2 A;  1TFM B;  3OJV A;  1SR4 C;  4EB2 B;  5BP5 A;  3FJB A;  5FZU A;  1K5V A;  3AKH A;  4ISR A;  3HOM A;  2F2F C;  1K5U A;  4LO7 C;  4Z8S B;  4I4U A;  3A22 A;  1EV2 A;  5BP5 C;  2WBC A;  3FJA A;  3CA6 A;  3CA3 A;  3IM7 A;  4FVV A;  2WRY A;  3FJF A;  3CA0 A;  4I37 A;  4QKR A;  2D7I A;  3IM6 A;  4I4P A;  1HWM B;  2K43 A;  5I1B A;  3OGG A;  1T4Q A;  4TLP A;  1ILR 1;  2P23 A;  3KMV A;  2J3P A;  3CA5 A;  1CVS A;  2Q9X A;  1AF9 A;  1BAR A;  3AKI A;  1AVU A;  2R9K B;  31BI A;  3BAG A;  1ABR B;  2YUG A;  4ZOT A;  1WD3 A;  1JY0 A;  1FMM S;  1JLX A;  4DCK C;  1IRP A;  4KEK A;  5D61 A;  3UD9 A;  3AJ6 A;  1ISX A;  4GP0 A;  4WBC A;  4F34 A;  3VT0 A;  1JT4 A;  3AH4 A;  4XKI A;  3A07 A;  3ZC8 A;  1BAS A;  3R4U A;  4JQ0 A;  4HJJ A;  3WO2 A;  4GOV A;  1DIW A;  1DFQ A;  4H9W A;  4ISQ A;  3CRI A;  3BRD A;  1FV3 A;  2K4A B;  3W9T A;  4F83 A;  1TIE A;  3AH2 A;  3QR5 A;  1I1E A;  5F90 A;  1FMZ A;  1S0F A;  4FGF A;  4II0 A;  3BAQ A;  1DZC A;  4IHZ A;  5GAQ A;  3BRF A;  3RMX A;  5DUY A;  3PHZ A;  1G9D A;  4HA2 A;  1GGP B;  1V6X A;  3UD8 A;  1IHK A;  3F62 B;  4GP3 A;  5EG6 C;  3A23 A;  1BLD A;  1ISW A;  4OEG A;  4A7Y A;  1JLY A;  1JT5 A;  2ZQN A;  3FJD A;  8I1B A;  4QBV A;  1VCL A;  3HAL A;  4P0J A;  2GZB A;  2VLC A;  4Z9W B;  3RSJ A;  5EC5 A;  1G9C A;  9ILB A;  3O4D A;  4I8M A;  1BFF A;  1DJS B;  1QQL A;  5F8S A;  2HW9 A;  3JRR A;  1JT7 A;  3AJ5 A;  3BTA A;  3O44 A;  3IM5 A;  1RY7 A;  1R8N A;  2Z49 A;  1S0D A;  5DSS B;  4JKX B;  4LO3 A;  2VSE A;  3P6I A;  2ESU A;  3O4C A;  2NYY A;  3FFZ A;  4L4I A;  1S0C A;  4I1B A;  1RZO B;  3BX1 C;  1DZD A;  4G1R A;  5DVH A;  3O3Q A;  3Q7Y A;  2BEB A;  3O4B A;  3OJM A;  4LO3 C;  3O49 A;  2BEA A;  3FJJ A;  3VT1 A;  3WIN A;  3PME A;  1YTO A;  4I4X A;  4D8H A;  3VSF A;  2P39 A;  3PUB A;  3OJ2 A;  3UD7 A;  5D63 A;  2KLL A;  2Z48 A;  3N7M A;  4DEP A;  4IYB A;  5FZY A;  3OBT A;  1Z4S A;  2AFG A;  2L5X A;  3WIN C;  1II4 A;  4XFU A;  1HWN B;  2QN4 A;  4GOY A;  1BFG A;  3AH1 A;  4JP0 A;  2Y9X E;  4ZBV B;  2X2T A;  3EF2 A;  1ONK B;  1P63 A;  1CE7 B;  4X37 A;  4D0T A;  1AXM A;  1AVW B;  1ISV A;  4GAF A;  1IRA X;  1AVX B;  3I2X A;  2HWM A;  1G9B A;  3CQA A;  2HZ9 A;  1HCD A;  4A7Z A;  1JQZ A;  2ERM A;  5FZZ A;  3BAO A;  4AN6 A;  3ZXD A;  4CJM A;  3VUO A;  3V79 C;  3VT2 A;  3H6Q A;  3WO3 A;  2VSA A;  2F8X C;  3CAH A;  2VUA A;  1EVT A;  3POK A;  3B9U A;  4LO7 B;  3VWC A;  3V0A B;  2HWA A;  4QD2 C;  3IAG C;  3N7K A;  3V0B A;  2NS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...